BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001P13

Length=526
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KHG25436.1|  Tubulin beta-8 chain -like protein                      293   1e-96   Gossypium arboreum [tree cotton]
ref|XP_002271992.1|  PREDICTED: tubulin beta-2 chain                    298   3e-96   Vitis vinifera
gb|KHG21955.1|  Tubulin beta-8 chain -like protein                      290   6e-96   Gossypium arboreum [tree cotton]
ref|XP_007205123.1|  hypothetical protein PRUPE_ppa004884mg             298   7e-96   
ref|XP_006421924.1|  hypothetical protein CICLE_v10004755mg             299   8e-96   
ref|XP_002509780.1|  tubulin beta chain, putative                       296   1e-95   Ricinus communis
gb|KHG16112.1|  Tubulin beta-1 chain                                    289   1e-95   Gossypium arboreum [tree cotton]
ref|XP_006827680.1|  hypothetical protein AMTR_s00009p00255970          296   1e-95   Amborella trichopoda
ref|XP_010940464.1|  PREDICTED: tubulin beta-2 chain                    296   2e-95   Elaeis guineensis
ref|NP_001289638.1|  tubulin beta-9 chain                               295   2e-95   Eucalyptus grandis [rose gum]
ref|XP_002304488.1|  hypothetical protein POPTR_0003s12540g             295   3e-95   Populus trichocarpa [western balsam poplar]
ref|XP_008355135.1|  PREDICTED: tubulin beta chain-like                 289   3e-95   
gb|ABK94073.1|  unknown                                                 295   3e-95   Populus trichocarpa [western balsam poplar]
ref|XP_011022718.1|  PREDICTED: tubulin beta-5 chain-like               295   4e-95   Populus euphratica
ref|XP_006404194.1|  hypothetical protein EUTSA_v10010366mg             295   5e-95   Eutrema salsugineum [saltwater cress]
ref|XP_010255421.1|  PREDICTED: tubulin beta-2 chain                    295   5e-95   Nelumbo nucifera [Indian lotus]
ref|XP_009626214.1|  PREDICTED: tubulin beta-2 chain-like               295   6e-95   Nicotiana tomentosiformis
gb|EYU38358.1|  hypothetical protein MIMGU_mgv1a007077mg                293   7e-95   Erythranthe guttata [common monkey flower]
ref|XP_008355572.1|  PREDICTED: tubulin beta chain                      287   8e-95   
emb|CDX88051.1|  BnaA06g26420D                                          293   8e-95   
ref|XP_006490393.1|  PREDICTED: tubulin beta-1 chain-like               294   9e-95   Citrus sinensis [apfelsine]
gb|EYU38453.1|  hypothetical protein MIMGU_mgv1a006387mg                294   9e-95   Erythranthe guttata [common monkey flower]
ref|XP_010557230.1|  PREDICTED: tubulin beta-2 chain-like               294   1e-94   Tarenaya hassleriana [spider flower]
emb|CDX80390.1|  BnaC07g30540D                                          294   1e-94   
ref|XP_011076163.1|  PREDICTED: tubulin beta-1 chain                    293   1e-94   Sesamum indicum [beniseed]
ref|XP_002510784.1|  tubulin beta chain, putative                       294   1e-94   Ricinus communis
gb|KJB34131.1|  hypothetical protein B456_006G049000                    293   1e-94   Gossypium raimondii
ref|XP_010521908.1|  PREDICTED: tubulin beta-2 chain-like               293   1e-94   Tarenaya hassleriana [spider flower]
ref|XP_008778745.1|  PREDICTED: tubulin beta-2 chain-like               293   1e-94   Phoenix dactylifera
ref|XP_009150907.1|  PREDICTED: tubulin beta-8 chain                    293   1e-94   Brassica rapa
ref|XP_008804937.1|  PREDICTED: tubulin beta-2 chain                    293   1e-94   Phoenix dactylifera
ref|XP_009793967.1|  PREDICTED: tubulin beta-2 chain-like               293   1e-94   Nicotiana sylvestris
emb|CDP05193.1|  unnamed protein product                                293   2e-94   Coffea canephora [robusta coffee]
ref|XP_008806874.1|  PREDICTED: tubulin beta-2 chain                    293   2e-94   Phoenix dactylifera
gb|AAK32919.1|AF367332_1  AT5g62700/MRG21_12                            290   2e-94   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010273068.1|  PREDICTED: tubulin beta-1 chain-like               293   2e-94   Nelumbo nucifera [Indian lotus]
ref|XP_006848044.1|  hypothetical protein AMTR_s00029p00190040          293   2e-94   Amborella trichopoda
emb|CDP09135.1|  unnamed protein product                                292   2e-94   Coffea canephora [robusta coffee]
gb|KJB25808.1|  hypothetical protein B456_004G210600                    292   3e-94   Gossypium raimondii
ref|XP_010510475.1|  PREDICTED: tubulin beta-7 chain isoform X1         293   3e-94   Camelina sativa [gold-of-pleasure]
ref|XP_009794774.1|  PREDICTED: tubulin beta-2 chain                    293   3e-94   Nicotiana sylvestris
ref|XP_004249588.1|  PREDICTED: tubulin beta-2 chain-like               293   3e-94   Solanum lycopersicum
ref|XP_009629036.1|  PREDICTED: tubulin beta-2 chain                    293   3e-94   Nicotiana tomentosiformis
ref|XP_010469941.1|  PREDICTED: tubulin beta-7 chain-like               293   3e-94   Camelina sativa [gold-of-pleasure]
ref|XP_011072483.1|  PREDICTED: tubulin beta-8 chain-like               292   3e-94   Sesamum indicum [beniseed]
gb|AGH08232.1|  beta-tubulin 3                                          292   4e-94   Salix arbutifolia
ref|XP_008376592.1|  PREDICTED: tubulin beta-1 chain-like               292   4e-94   Malus domestica [apple tree]
ref|XP_009144365.1|  PREDICTED: tubulin beta-7 chain                    292   4e-94   Brassica rapa
emb|CDY45452.1|  BnaA05g12490D                                          292   4e-94   Brassica napus [oilseed rape]
ref|XP_004249594.1|  PREDICTED: tubulin beta-2 chain                    292   4e-94   Solanum lycopersicum
ref|XP_011072460.1|  PREDICTED: tubulin beta-8 chain-like               292   4e-94   Sesamum indicum [beniseed]
ref|XP_009763987.1|  PREDICTED: tubulin beta-8 chain-like               292   4e-94   Nicotiana sylvestris
ref|XP_009590874.1|  PREDICTED: tubulin beta-8 chain-like               292   4e-94   Nicotiana tomentosiformis
ref|XP_009371335.1|  PREDICTED: tubulin beta-1 chain                    292   4e-94   Pyrus x bretschneideri [bai li]
ref|XP_010108341.1|  Tubulin beta-1 chain                               292   4e-94   Morus notabilis
ref|XP_007218003.1|  hypothetical protein PRUPE_ppa005698mg             292   4e-94   Prunus persica
ref|XP_010542657.1|  PREDICTED: tubulin beta-2 chain-like               292   4e-94   Tarenaya hassleriana [spider flower]
ref|XP_006424984.1|  hypothetical protein CICLE_v10028436mg             292   4e-94   Citrus clementina [clementine]
gb|AGH08227.1|  beta-tubulin 4                                          292   4e-94   Salix arbutifolia
ref|XP_010908105.1|  PREDICTED: tubulin beta-2 chain-like               292   4e-94   Elaeis guineensis
ref|XP_010934750.1|  PREDICTED: tubulin beta-2 chain-like               292   5e-94   Elaeis guineensis
ref|XP_004506645.1|  PREDICTED: tubulin beta-2 chain-like               292   5e-94   Cicer arietinum [garbanzo]
gb|KDP46576.1|  hypothetical protein JCGZ_08548                         292   5e-94   Jatropha curcas
gb|ABY86655.1|  beta-tubulin 4                                          292   5e-94   Gossypium hirsutum [American cotton]
ref|XP_003536467.1|  PREDICTED: tubulin beta-1 chain-like               292   5e-94   Glycine max [soybeans]
ref|XP_008377500.1|  PREDICTED: tubulin beta-1 chain                    292   6e-94   Malus domestica [apple tree]
gb|AAL92026.1|AF484959_1  tubulin beta-1                                292   6e-94   Gossypium hirsutum [American cotton]
emb|CDY21784.1|  BnaA06g20530D                                          291   6e-94   Brassica napus [oilseed rape]
ref|XP_007133955.1|  hypothetical protein PHAVU_010G006400g             292   7e-94   Phaseolus vulgaris [French bean]
sp|Q6VAF4.1|TBB9_GOSHI  RecName: Full=Tubulin beta-9 chain; AltNa...    291   7e-94   Gossypium hirsutum [American cotton]
ref|XP_002313404.1|  hypothetical protein POPTR_0009s04500g             292   7e-94   
ref|XP_003556108.1|  PREDICTED: tubulin beta-1 chain-like               291   7e-94   Glycine max [soybeans]
ref|XP_009337361.1|  PREDICTED: tubulin beta chain-like                 291   7e-94   Pyrus x bretschneideri [bai li]
ref|XP_009374320.1|  PREDICTED: tubulin beta chain                      291   7e-94   Pyrus x bretschneideri [bai li]
ref|XP_002298330.1|  Tubulin beta-2/beta-3 chain family protein         291   9e-94   Populus trichocarpa [western balsam poplar]
ref|XP_011035226.1|  PREDICTED: tubulin beta-2 chain                    291   9e-94   Populus euphratica
ref|XP_008220065.1|  PREDICTED: tubulin beta chain                      291   9e-94   Prunus mume [ume]
ref|XP_006291122.1|  hypothetical protein CARUB_v10017235mg             291   9e-94   Capsella rubella
ref|XP_002864813.1|  tubulin beta-2                                     291   9e-94   
ref|XP_002299541.1|  hypothetical protein POPTR_0001s09180g             291   9e-94   Populus trichocarpa [western balsam poplar]
ref|XP_009149954.1|  PREDICTED: tubulin beta-2 chain-like               291   9e-94   Brassica rapa
ref|XP_002877519.1|  tubulin beta-2                                     291   9e-94   
ref|NP_001289924.1|  tubulin beta-2 chain                               291   1e-93   Camelina sativa [gold-of-pleasure]
ref|XP_010459234.1|  PREDICTED: tubulin beta-2 chain-like               291   1e-93   Camelina sativa [gold-of-pleasure]
ref|NP_568959.1|  tubulin beta-2/beta-3 chain                           291   1e-93   Arabidopsis thaliana [mouse-ear cress]
tpg|DAA42820.1|  TPA: beta tubulin1                                     290   1e-93   
ref|XP_009150568.1|  PREDICTED: tubulin beta-2 chain-like               291   1e-93   Brassica rapa
ref|XP_003520939.1|  PREDICTED: tubulin beta-2 chain-like               291   1e-93   
ref|XP_002468688.1|  hypothetical protein SORBIDRAFT_01g050310          291   1e-93   Sorghum bicolor [broomcorn]
ref|XP_008811481.1|  PREDICTED: tubulin beta-8 chain-like               291   1e-93   Phoenix dactylifera
ref|XP_004986075.1|  PREDICTED: tubulin beta-2 chain-like               291   1e-93   Setaria italica
ref|XP_003516925.1|  PREDICTED: tubulin beta-2 chain-like               291   1e-93   Glycine max [soybeans]
ref|XP_004302651.1|  PREDICTED: tubulin beta-1 chain-like               291   1e-93   Fragaria vesca subsp. vesca
ref|XP_010483981.1|  PREDICTED: tubulin beta-2 chain-like               291   1e-93   Camelina sativa [gold-of-pleasure]
gb|KFK28005.1|  hypothetical protein AALP_AA8G459200                    291   2e-93   Arabis alpina [alpine rockcress]
ref|XP_006404432.1|  hypothetical protein EUTSA_v10010368mg             291   2e-93   Eutrema salsugineum [saltwater cress]
gb|KFK34015.1|  hypothetical protein AALP_AA5G090900                    291   2e-93   Arabis alpina [alpine rockcress]
sp|Q8H7U1.1|TBB2_ORYSJ  RecName: Full=Tubulin beta-2 chain; AltNa...    290   2e-93   Oryza sativa Japonica Group [Japonica rice]
gb|AGN95064.1|  putative tubulin beta-2-like protein                    291   2e-93   Physaria fendleri
sp|P37392.1|TBB1_LUPAL  RecName: Full=Tubulin beta-1 chain; AltNa...    290   2e-93   Lupinus albus
ref|XP_009396166.1|  PREDICTED: tubulin beta-1 chain                    290   2e-93   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004308083.1|  PREDICTED: tubulin beta-1 chain                    290   2e-93   Fragaria vesca subsp. vesca
gb|AAY43798.1|  tubulin                                                 290   3e-93   Gossypium hirsutum [American cotton]
emb|CAM58986.1|  beta tubulin 8                                         290   3e-93   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AGV54374.1|  tubulin beta-2 chain-like protein                       289   4e-93   Phaseolus vulgaris [French bean]
gb|EMT08428.1|  Tubulin beta-1 chain                                    290   4e-93   
gb|AFR42136.1|  beta-tubulin                                            279   4e-93   Populus trichocarpa [western balsam poplar]
gb|KHG21113.1|  Tubulin beta-9 chain                                    282   5e-93   Gossypium arboreum [tree cotton]
ref|XP_010520236.1|  PREDICTED: tubulin beta-2 chain-like               290   5e-93   Tarenaya hassleriana [spider flower]
gb|ABY86654.1|  beta-tubulin 2                                          289   6e-93   Gossypium hirsutum [American cotton]
gb|AGQ43300.1|  TUBB3                                                   278   1e-92   Oryza sativa f. spontanea
gb|KJB36870.1|  hypothetical protein B456_006G179900                    288   1e-92   Gossypium raimondii
ref|XP_007040195.1|  Tubulin beta 8                                     288   2e-92   Theobroma cacao [chocolate]
gb|AFR42167.1|  beta-tubulin                                            277   2e-92   Populus nigra [black poplar]
ref|XP_010530505.1|  PREDICTED: tubulin beta-8 chain                    287   3e-92   
emb|CAL46265.1|  beta-tubulin 6                                         276   3e-92   Oryza sativa Indica Group [Indian rice]
gb|ABY86662.1|  beta-tubulin 16                                         287   3e-92   Gossypium hirsutum [American cotton]
ref|XP_002267380.1|  PREDICTED: tubulin beta-1 chain                    287   3e-92   Vitis vinifera
ref|XP_007038700.1|  Tubulin beta 8                                     287   3e-92   Theobroma cacao [chocolate]
ref|XP_003592284.1|  Tubulin beta chain                                 287   4e-92   Medicago truncatula
ref|XP_009803077.1|  PREDICTED: tubulin beta-1 chain-like               287   4e-92   Nicotiana sylvestris
ref|XP_010035138.1|  PREDICTED: tubulin beta-1 chain                    287   4e-92   Eucalyptus grandis [rose gum]
ref|XP_004496560.1|  PREDICTED: tubulin beta-1 chain-like               287   4e-92   Cicer arietinum [garbanzo]
gb|AAK96884.1|  beta tubulin                                            287   5e-92   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006287738.1|  hypothetical protein CARUB_v10000948mg             287   5e-92   Capsella rubella
ref|NP_568437.1|  tubulin beta-8 chain                                  287   5e-92   Arabidopsis thaliana [mouse-ear cress]
gb|KHG02753.1|  Tubulin beta-2/beta-3 chain -like protein               280   6e-92   Gossypium arboreum [tree cotton]
gb|EYU19549.1|  hypothetical protein MIMGU_mgv1a006353mg                286   7e-92   Erythranthe guttata [common monkey flower]
ref|XP_002872076.1|  tubulin beta-8                                     286   8e-92   
ref|XP_009767718.1|  PREDICTED: tubulin beta-1 chain                    286   8e-92   Nicotiana sylvestris
ref|XP_009596463.1|  PREDICTED: tubulin beta-1 chain                    286   8e-92   Nicotiana tomentosiformis
gb|KHN27008.1|  Tubulin beta-1 chain                                    286   9e-92   Glycine soja [wild soybean]
sp|P18025.1|TBB1_MAIZE  RecName: Full=Tubulin beta-1 chain; AltNa...    286   1e-91   Zea mays [maize]
ref|XP_004970293.1|  PREDICTED: LOW QUALITY PROTEIN: tubulin beta...    288   1e-91   
ref|NP_001167651.1|  uncharacterized protein LOC100381281               288   1e-91   Zea mays [maize]
ref|XP_009141007.1|  PREDICTED: tubulin beta-7 chain-like               286   1e-91   Brassica rapa
gb|AGH08238.1|  beta-tubulin 2                                          286   1e-91   Salix arbutifolia
emb|CDY67078.1|  BnaAnng23580D                                          284   1e-91   Brassica napus [oilseed rape]
ref|XP_011032195.1|  PREDICTED: tubulin beta-2 chain-like               286   1e-91   Populus euphratica
gb|KFK27675.1|  hypothetical protein AALP_AA8G414100                    286   1e-91   Arabis alpina [alpine rockcress]
ref|XP_007026823.1|  Tubulin beta 8                                     286   1e-91   
emb|CDY51360.1|  BnaA04g28540D                                          286   1e-91   Brassica napus [oilseed rape]
ref|XP_006294210.1|  hypothetical protein CARUB_v10023206mg             286   2e-91   Capsella rubella
emb|CBI32808.3|  unnamed protein product                                280   2e-91   Vitis vinifera
ref|XP_006387289.1|  hypothetical protein POPTR_1327s00200g             280   2e-91   
ref|XP_003559023.1|  PREDICTED: tubulin beta-2 chain                    286   2e-91   Brachypodium distachyon [annual false brome]
ref|XP_008370041.1|  PREDICTED: tubulin beta chain                      285   2e-91   Malus domestica [apple tree]
ref|XP_010535429.1|  PREDICTED: tubulin beta-2 chain                    285   2e-91   Tarenaya hassleriana [spider flower]
gb|KJB20686.1|  hypothetical protein B456_003G159400                    285   2e-91   Gossypium raimondii
ref|XP_007143420.1|  hypothetical protein PHAVU_007G070800g             285   2e-91   Phaseolus vulgaris [French bean]
ref|XP_007205196.1|  hypothetical protein PRUPE_ppa005693mg             285   2e-91   Prunus persica
gb|KHG11026.1|  Tubulin beta-8 chain -like protein                      278   3e-91   Gossypium arboreum [tree cotton]
gb|AFR42164.1|  beta-tubulin                                            274   3e-91   Populus nigra [black poplar]
gb|AGE44289.1|  beta-tubulin                                            285   3e-91   Dimocarpus longan [longan]
ref|XP_006339000.1|  PREDICTED: tubulin beta-8 chain-like               285   3e-91   Solanum tuberosum [potatoes]
ref|XP_004234396.1|  PREDICTED: tubulin beta-1 chain                    285   3e-91   Solanum lycopersicum
emb|CDY53366.1|  BnaC04g54460D                                          285   4e-91   Brassica napus [oilseed rape]
gb|KJB21246.1|  hypothetical protein B456_003G126300                    283   4e-91   Gossypium raimondii
ref|NP_001274811.1|  uncharacterized protein LOC102577679               285   4e-91   Solanum tuberosum [potatoes]
ref|XP_004240734.1|  PREDICTED: tubulin beta-1 chain                    285   4e-91   Solanum lycopersicum
gb|AAA32886.1|  beta-8 tubulin                                          285   4e-91   Arabidopsis thaliana [mouse-ear cress]
gb|AGV54311.1|  tubulin beta chain                                      285   4e-91   Phaseolus vulgaris [French bean]
gb|EEC71666.1|  hypothetical protein OsI_04129                          286   4e-91   Oryza sativa Indica Group [Indian rice]
ref|XP_006353299.1|  PREDICTED: tubulin beta-1 chain-like isoform X1    285   4e-91   Solanum tuberosum [potatoes]
ref|XP_006394642.1|  hypothetical protein EUTSA_v10004208mg             285   4e-91   Eutrema salsugineum [saltwater cress]
gb|AGH08233.1|  beta-tubulin 1                                          285   4e-91   Salix arbutifolia
ref|XP_010685649.1|  PREDICTED: tubulin beta-1 chain                    284   5e-91   Beta vulgaris subsp. vulgaris [field beet]
gb|EMT00232.1|  Tubulin beta-2 chain                                    285   5e-91   
gb|AIS84174.1|  beta-tubulin 7a                                         284   5e-91   Linum usitatissimum
ref|XP_008388103.1|  PREDICTED: tubulin beta chain-like                 284   5e-91   Malus domestica [apple tree]
gb|ACU22866.1|  unknown                                                 282   5e-91   Glycine max [soybeans]
gb|AGH08235.1|  beta-tubulin 11                                         284   5e-91   Salix arbutifolia
gb|AIA09927.1|  beta-tubulin                                            284   6e-91   Quercus suber [cork oak]
ref|XP_003604816.1|  Tubulin beta chain                                 284   6e-91   Medicago truncatula
tpg|DAA57202.1|  TPA: beta tubulin6                                     285   6e-91   
ref|NP_001105317.1|  tubulin beta-6 chain                               284   7e-91   
ref|XP_010087906.1|  Tubulin beta-1 chain                               284   7e-91   Morus notabilis
gb|AGH08240.1|  beta-tubulin 15                                         284   7e-91   Salix arbutifolia
ref|XP_006429261.1|  hypothetical protein CICLE_v10011723mg             284   7e-91   Citrus clementina [clementine]
ref|NP_001044565.1|  Os01g0805900                                       284   7e-91   
emb|CAA55022.1|  beta tubulin                                           284   7e-91   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002298455.1|  hypothetical protein POPTR_0001s27960g             284   7e-91   
gb|KDP25455.1|  hypothetical protein JCGZ_20611                         284   7e-91   Jatropha curcas
ref|XP_010673793.1|  PREDICTED: tubulin beta-4 chain                    284   8e-91   Beta vulgaris subsp. vulgaris [field beet]
gb|AAA66495.1|  beta-tubulin                                            284   8e-91   Oryza sativa [red rice]
ref|XP_002881057.1|  tubulin beta-7 chain                               284   8e-91   
gb|AIS84176.1|  beta-tubulin 7c                                         284   8e-91   Linum usitatissimum
ref|XP_010232467.1|  PREDICTED: tubulin beta chain                      284   8e-91   
gb|KHG13886.1|  Tubulin beta-3 chain                                    276   8e-91   Gossypium arboreum [tree cotton]
pir||JC2510  beta-tubulin R1623 - rice                                  284   8e-91
gb|ADE76978.1|  unknown                                                 284   8e-91   Picea sitchensis
ref|XP_004240391.1|  PREDICTED: tubulin beta-8 chain-like               283   9e-91   Solanum lycopersicum
emb|CAE52516.1|  beta tubulin                                           284   9e-91   Setaria viridis
ref|XP_006481398.1|  PREDICTED: tubulin beta-2 chain                    283   9e-91   Citrus sinensis [apfelsine]
ref|XP_010101838.1|  Tubulin beta-1 chain                               283   9e-91   Morus notabilis
gb|AIS84175.1|  beta-tubulin 7b                                         284   1e-90   Linum usitatissimum
ref|XP_010676480.1|  PREDICTED: tubulin beta-1 chain                    283   1e-90   Beta vulgaris subsp. vulgaris [field beet]
gb|AIC33036.1|  beta-tubulin                                            279   1e-90   Panax ginseng [Asiatic ginseng]
ref|NP_001168511.1|  hypothetical protein                               283   1e-90   Zea mays [maize]
gb|AFN53689.1|  putative tubulin beta-1 chain protein                   283   1e-90   Linum usitatissimum
sp|Q9ZRB1.1|TBB2_WHEAT  RecName: Full=Tubulin beta-2 chain; AltNa...    283   1e-90   Triticum aestivum [Canadian hard winter wheat]
emb|CDM85842.1|  unnamed protein product                                283   1e-90   Triticum aestivum [Canadian hard winter wheat]
gb|AGH08239.1|  beta-tubulin 13                                         283   1e-90   Salix arbutifolia
sp|P93176.1|TBB_HORVU  RecName: Full=Tubulin beta chain; AltName:...    283   1e-90   Hordeum vulgare [barley]
ref|XP_010905373.1|  PREDICTED: tubulin beta-8 chain-like               283   1e-90   
gb|ABY86665.1|  beta-tubulin 19                                         283   1e-90   Gossypium hirsutum [American cotton]
gb|ABY86664.1|  beta-tubulin 18                                         283   1e-90   Gossypium hirsutum [American cotton]
gb|AGH08237.1|  beta-tubulin 16                                         283   1e-90   Salix arbutifolia
gb|AIZ74332.1|  beta-tubulin                                            283   1e-90   Pinus massoniana [Chinese red pine]
emb|CDX69693.1|  BnaA10g20420D                                          284   1e-90   
ref|XP_002456503.1|  hypothetical protein SORBIDRAFT_03g037490          283   1e-90   
ref|XP_008448943.1|  PREDICTED: tubulin beta chain-like                 283   1e-90   Cucumis melo [Oriental melon]
ref|XP_004172348.1|  PREDICTED: tubulin beta-1 chain-like               283   1e-90   
ref|XP_006644872.1|  PREDICTED: tubulin beta-4 chain-like               283   1e-90   Oryza brachyantha
ref|XP_004147894.1|  PREDICTED: tubulin beta-1 chain-like               283   2e-90   Cucumis sativus [cucumbers]
sp|Q9ZPN9.1|TBB2_ELEIN  RecName: Full=Tubulin beta-2 chain; AltNa...    283   2e-90   Eleusine indica [crabgrass]
gb|AAU14217.1|  TUB8                                                    283   2e-90   Quercus petraea [durmast oak]
gb|EYU18601.1|  hypothetical protein MIMGU_mgv1a005215mg                284   2e-90   Erythranthe guttata [common monkey flower]
ref|XP_007016239.1|  Tubulin beta 8                                     283   2e-90   Theobroma cacao [chocolate]
ref|XP_010662749.1|  PREDICTED: tubulin beta-1 chain-like               274   2e-90   Vitis vinifera
ref|XP_008777278.1|  PREDICTED: tubulin beta-8 chain-like               283   2e-90   Phoenix dactylifera
ref|XP_010654216.1|  PREDICTED: tubulin beta-2 chain                    283   2e-90   Vitis vinifera
ref|XP_011075464.1|  PREDICTED: tubulin beta-5 chain isoform X1         283   2e-90   
gb|AFW84815.1|  hypothetical protein ZEAMMB73_647337                    283   2e-90   
gb|ABY86663.1|  beta-tubulin 17                                         283   2e-90   Gossypium hirsutum [American cotton]
gb|ABA46752.1|  unknown                                                 283   2e-90   Solanum tuberosum [potatoes]
dbj|BAA82637.1|  Beta-tubulin                                           283   2e-90   Zinnia elegans [garden zinnia]
ref|XP_010909929.1|  PREDICTED: tubulin beta-1 chain-like               282   3e-90   Elaeis guineensis
gb|AGZ90159.1|  tubulin beta                                            282   3e-90   Litsea cubeba [may chang]
ref|XP_011025004.1|  PREDICTED: tubulin beta-4 chain-like               282   4e-90   Populus euphratica
ref|XP_010088982.1|  Tubulin beta-1 chain                               282   4e-90   Morus notabilis
ref|XP_002270069.1|  PREDICTED: tubulin beta-4 chain                    282   4e-90   Vitis vinifera
gb|KEH28915.1|  tubulin beta-1 chain                                    282   4e-90   Medicago truncatula
gb|AAC84132.1|  beta-tubulin                                            273   4e-90   Cichorium intybus [radicchio]
ref|XP_008798348.1|  PREDICTED: tubulin beta-1 chain                    282   4e-90   Phoenix dactylifera
gb|AGH08224.1|  beta-tubulin 6                                          282   4e-90   Salix arbutifolia
ref|XP_010909062.1|  PREDICTED: tubulin beta-1 chain                    282   4e-90   Elaeis guineensis
ref|XP_003624927.1|  Tubulin beta chain                                 284   4e-90   
ref|XP_010271905.1|  PREDICTED: tubulin beta-1 chain                    282   4e-90   Nelumbo nucifera [Indian lotus]
sp|Q9ZRA8.1|TBB5_WHEAT  RecName: Full=Tubulin beta-5 chain; AltNa...    282   5e-90   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009401585.1|  PREDICTED: tubulin beta-1 chain-like               282   5e-90   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003568202.1|  PREDICTED: tubulin beta-5 chain-like               282   5e-90   Brachypodium distachyon [annual false brome]
ref|NP_001055546.1|  Os05g0413200                                       281   5e-90   
ref|XP_008442483.1|  PREDICTED: tubulin beta chain-like                 282   5e-90   Cucumis melo [Oriental melon]
gb|AFC88825.1|  putative tubulin beta-7 chain                           277   5e-90   Miscanthus sinensis
sp|P29500.1|TBB1_PEA  RecName: Full=Tubulin beta-1 chain; AltName...    282   5e-90   Pisum sativum [garden pea]
tpg|DAA54230.1|  TPA: hypothetical protein ZEAMMB73_283964              281   5e-90   
ref|XP_006644071.1|  PREDICTED: tubulin beta-1 chain-like               282   5e-90   Oryza brachyantha
ref|XP_004137743.1|  PREDICTED: tubulin beta-1 chain-like               281   5e-90   Cucumis sativus [cucumbers]
gb|ABK94893.1|  unknown                                                 275   5e-90   Populus trichocarpa [western balsam poplar]
ref|XP_010673063.1|  PREDICTED: tubulin beta-6 chain isoform X1         282   5e-90   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009398811.1|  PREDICTED: tubulin beta-2 chain-like               281   5e-90   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008788536.1|  PREDICTED: tubulin beta-5 chain-like               281   5e-90   Phoenix dactylifera
ref|XP_010922039.1|  PREDICTED: tubulin beta-5 chain                    281   6e-90   Elaeis guineensis
ref|XP_009420971.1|  PREDICTED: tubulin beta-4 chain                    281   6e-90   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004249322.1|  PREDICTED: tubulin beta-5 chain                    281   6e-90   Solanum lycopersicum
sp|Q40106.1|TBB2_LUPAL  RecName: Full=Tubulin beta-2 chain; AltNa...    281   6e-90   Lupinus albus
ref|XP_002307960.1|  hypothetical protein POPTR_0006s03390g             281   6e-90   Populus trichocarpa [western balsam poplar]
ref|XP_010243823.1|  PREDICTED: tubulin beta-4 chain-like               281   6e-90   Nelumbo nucifera [Indian lotus]
ref|NP_001042761.1|  Os01g0282800                                       281   6e-90   
ref|XP_003568451.1|  PREDICTED: tubulin beta-2 chain                    281   6e-90   Brachypodium distachyon [annual false brome]
gb|ACG32188.1|  tubulin beta-4 chain                                    281   7e-90   Zea mays [maize]
gb|AGH08225.1|  beta-tubulin 18                                         281   7e-90   Salix arbutifolia
ref|XP_004967662.1|  PREDICTED: tubulin beta-5 chain-like               281   7e-90   Setaria italica
ref|XP_003567397.1|  PREDICTED: tubulin beta-4 chain                    281   7e-90   Brachypodium distachyon [annual false brome]
ref|XP_006358716.1|  PREDICTED: tubulin beta-2 chain-like               281   7e-90   Solanum tuberosum [potatoes]
ref|XP_003624926.1|  Tubulin beta chain                                 281   7e-90   Medicago truncatula
sp|Q9ZPN7.1|TBB4_ELEIN  RecName: Full=Tubulin beta-4 chain; AltNa...    281   7e-90   Eleusine indica [crabgrass]
ref|XP_008654521.1|  PREDICTED: uncharacterized protein LOC100272...    281   7e-90   Zea mays [maize]
emb|CAM58984.1|  beta tubulin 6                                         281   7e-90   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002322609.1|  hypothetical protein POPTR_0016s03300g             281   8e-90   Populus trichocarpa [western balsam poplar]
ref|XP_011009154.1|  PREDICTED: tubulin beta chain-like                 281   8e-90   Populus euphratica
gb|AFW79504.1|  hypothetical protein ZEAMMB73_908177                    281   8e-90   
ref|XP_009588441.1|  PREDICTED: tubulin beta-1 chain                    281   8e-90   Nicotiana tomentosiformis
sp|Q9ZRB2.1|TBB1_WHEAT  RecName: Full=Tubulin beta-1 chain; AltNa...    281   8e-90   Triticum aestivum [Canadian hard winter wheat]
ref|NP_001105458.1|  tubulin beta-5 chain                               281   8e-90   Zea mays [maize]
ref|XP_004962088.1|  PREDICTED: tubulin beta-2 chain-like               281   9e-90   Setaria italica
gb|KHG07472.1|  Tubulin beta-9 chain                                    273   9e-90   Gossypium arboreum [tree cotton]
emb|CDP06213.1|  unnamed protein product                                284   9e-90   Coffea canephora [robusta coffee]
ref|XP_011041397.1|  PREDICTED: tubulin beta-5 chain-like               281   9e-90   
ref|XP_002323545.2|  hypothetical protein POPTR_0016s11660g             281   9e-90   
ref|XP_006826860.1|  hypothetical protein AMTR_s00010p00119100          281   9e-90   
ref|XP_004493370.1|  PREDICTED: tubulin beta-6 chain-like               281   1e-89   
gb|AGH08229.1|  beta-tubulin 17                                         281   1e-89   
ref|XP_002283056.1|  PREDICTED: tubulin beta-5 chain                    281   1e-89   
ref|XP_007015367.1|  Beta-6 tubulin isoform 1                           281   1e-89   
ref|XP_004241186.1|  PREDICTED: tubulin beta chain-like                 281   1e-89   
ref|XP_007015368.1|  Beta-6 tubulin isoform 2                           281   1e-89   
ref|XP_011040743.1|  PREDICTED: tubulin beta-5 chain-like               281   1e-89   
gb|KDP24509.1|  hypothetical protein JCGZ_25073                         281   1e-89   
gb|ACJ84610.1|  unknown                                                 281   1e-89   
ref|XP_011079080.1|  PREDICTED: tubulin beta-5 chain-like               280   2e-89   
sp|Q9ZRB0.1|TBB3_WHEAT  RecName: Full=Tubulin beta-3 chain; AltNa...    280   2e-89   
ref|XP_011075465.1|  PREDICTED: tubulin beta-5 chain isoform X2         280   2e-89   
gb|KJB09278.1|  hypothetical protein B456_001G132500                    280   2e-89   
ref|XP_006350813.1|  PREDICTED: tubulin beta-2 chain-like               280   2e-89   
ref|XP_003604818.1|  Tubulin beta chain                                 280   2e-89   
ref|XP_011029244.1|  PREDICTED: tubulin beta-1 chain-like               280   2e-89   
gb|KDP36971.1|  hypothetical protein JCGZ_08563                         280   2e-89   
ref|XP_011036386.1|  PREDICTED: tubulin beta-5 chain                    280   2e-89   
ref|XP_002523247.1|  tubulin beta chain, putative                       280   2e-89   
emb|CDX97180.1|  BnaC09g44450D                                          281   2e-89   
ref|XP_010536143.1|  PREDICTED: tubulin beta-4 chain                    280   2e-89   
emb|CAM58980.1|  beta tubulin 2                                         280   2e-89   
ref|XP_003569962.1|  PREDICTED: tubulin beta-3 chain                    280   2e-89   
ref|XP_006649228.1|  PREDICTED: tubulin beta-2 chain-like               280   2e-89   
gb|EEC79224.1|  hypothetical protein OsI_19960                          285   2e-89   
gb|EEE63725.1|  hypothetical protein OsJ_18543                          285   2e-89   
ref|NP_001239638.1|  beta-tubulin                                       280   2e-89   
gb|KHN08902.1|  Tubulin beta-1 chain                                    280   2e-89   
ref|XP_007015369.1|  Beta-6 tubulin isoform 1                           280   2e-89   
ref|XP_010673064.1|  PREDICTED: tubulin beta-6 chain isoform X2         280   2e-89   
ref|XP_003554108.1|  PREDICTED: tubulin beta-4 chain-like               280   2e-89   
sp|Q6VAF8.1|TBB3_GOSHI  RecName: Full=Tubulin beta-3 chain; AltNa...    280   2e-89   
ref|XP_008644456.1|  PREDICTED: tubulin beta-7 chain                    280   2e-89   
ref|XP_004951797.1|  PREDICTED: tubulin beta-3 chain-like               280   3e-89   
gb|KFK44234.1|  hypothetical protein AALP_AA1G232100                    280   3e-89   
ref|NP_001105426.1|  tubulin beta-2 chain                               280   3e-89   
ref|XP_009395425.1|  PREDICTED: tubulin beta-2 chain-like               280   3e-89   
gb|ABY86657.1|  beta-tubulin 10                                         280   3e-89   
sp|P12460.1|TBB2_SOYBN  RecName: Full=Tubulin beta-2 chain; AltNa...    280   3e-89   
ref|XP_009393896.1|  PREDICTED: tubulin beta chain                      280   3e-89   
ref|NP_001289666.1|  tubulin beta-5 chain                               280   3e-89   
ref|XP_006387232.1|  hypothetical protein POPTR_1455s00200g             280   3e-89   
ref|XP_009121863.1|  PREDICTED: tubulin beta-6 chain                    280   3e-89   
ref|XP_006339255.1|  PREDICTED: tubulin beta-1 chain-like               280   3e-89   
tpg|DAA51374.1|  TPA: hypothetical protein ZEAMMB73_041268              280   3e-89   
ref|XP_002314014.2|  hypothetical protein POPTR_0009s07150g             280   3e-89   
ref|XP_007028241.1|  Beta-6 tubulin                                     280   3e-89   
gb|ACM89775.1|  beta-tubulin 3                                          280   3e-89   
ref|XP_006399740.1|  hypothetical protein EUTSA_v10013524mg             280   3e-89   
sp|P29501.1|TBB2_PEA  RecName: Full=Tubulin beta-2 chain; AltName...    280   3e-89   
dbj|BAP59013.1|  beta tubulin                                           280   3e-89   
ref|XP_007211629.1|  hypothetical protein PRUPE_ppa005785mg             280   3e-89   
ref|XP_011036385.1|  PREDICTED: tubulin beta-1 chain-like               280   3e-89   
ref|XP_006650676.1|  PREDICTED: tubulin beta-7 chain-like               280   4e-89   
ref|XP_010541432.1|  PREDICTED: tubulin beta-2 chain-like               280   4e-89   
gb|EYU20815.1|  hypothetical protein MIMGU_mgv1a006356mg                280   4e-89   
ref|XP_006836258.1|  hypothetical protein AMTR_s00101p00135960          278   4e-89   
ref|XP_006430521.1|  hypothetical protein CICLE_v10011719mg             280   4e-89   
gb|ABK95893.1|  unknown                                                 279   4e-89   
ref|XP_004981550.1|  PREDICTED: tubulin beta-7 chain-like               279   4e-89   
ref|XP_002520451.1|  tubulin beta chain, putative                       282   4e-89   
ref|XP_002466356.1|  hypothetical protein SORBIDRAFT_01g006310          279   4e-89   
ref|XP_006482055.1|  PREDICTED: tubulin beta-1 chain-like               279   5e-89   
ref|XP_010274718.1|  PREDICTED: tubulin beta-6 chain-like               279   5e-89   
gb|AEN19686.1|  beta-tubulin                                            276   5e-89   
ref|XP_010228968.1|  PREDICTED: tubulin beta-4 chain                    279   5e-89   
ref|XP_010042213.1|  PREDICTED: tubulin beta chain-like                 269   6e-89   
gb|AIX10967.1|  tubulin                                                 279   6e-89   
ref|XP_010419814.1|  PREDICTED: tubulin beta-6 chain-like               279   6e-89   
ref|NP_196786.1|  beta-6 tubulin                                        279   6e-89   
ref|XP_006289933.1|  hypothetical protein CARUB_v10003555mg             279   6e-89   
gb|KHG02799.1|  Tubulin beta-5 chain                                    271   6e-89   
ref|XP_010491982.1|  PREDICTED: tubulin beta-6 chain-like               279   6e-89   
ref|XP_003563397.1|  PREDICTED: LOW QUALITY PROTEIN: tubulin beta...    279   6e-89   
gb|AEN19688.1|  beta-tubulin                                            276   6e-89   
sp|Q40665.2|TBB3_ORYSJ  RecName: Full=Tubulin beta-3 chain; AltNa...    279   6e-89   
ref|XP_006654403.1|  PREDICTED: tubulin beta-1 chain-like               279   7e-89   
ref|NP_001058334.1|  Os06g0671900                                       278   7e-89   
ref|NP_001275206.1|  tubulin beta-2 chain-like                          279   7e-89   
ref|NP_001046006.1|  Os02g0167300                                       279   7e-89   
gb|ABK92780.1|  unknown                                                 279   7e-89   
emb|CAM58981.1|  beta tubulin 3                                         279   7e-89   
pir||JC2511  beta-tubulin R2242 - rice                                  279   7e-89
ref|XP_009792728.1|  PREDICTED: tubulin beta chain                      279   7e-89   
emb|CAA55912.1|  beta tubulin                                           279   8e-89   
ref|XP_009622091.1|  PREDICTED: tubulin beta chain                      278   8e-89   
ref|XP_002451606.1|  hypothetical protein SORBIDRAFT_04g004520          279   8e-89   
gb|EMS61990.1|  Tubulin beta-4 chain                                    279   8e-89   
emb|CAM58983.1|  beta tubulin 5                                         278   8e-89   
ref|XP_010540645.1|  PREDICTED: tubulin beta chain                      278   8e-89   
sp|Q9ZRA9.1|TBB4_WHEAT  RecName: Full=Tubulin beta-4 chain; AltNa...    278   8e-89   
ref|NP_001105688.1|  tubulin beta-7 chain                               278   8e-89   
ref|XP_009403832.1|  PREDICTED: tubulin beta-1 chain-like               279   8e-89   
ref|XP_002299042.1|  hypothetical protein POPTR_0001s46870g             278   9e-89   
sp|Q9ZPP0.1|TBB1_ELEIN  RecName: Full=Tubulin beta-1 chain; AltNa...    278   9e-89   
ref|NP_180515.1|  tubulin beta-7 chain                                  278   9e-89   
ref|XP_011037726.1|  PREDICTED: tubulin beta chain                      278   9e-89   
ref|XP_008648960.1|  PREDICTED: tubulin beta-7 chain-like               278   9e-89   
ref|XP_010926884.1|  PREDICTED: tubulin beta chain-like                 278   9e-89   
ref|XP_011039269.1|  PREDICTED: tubulin beta chain-like                 278   1e-88   
ref|XP_008790003.1|  PREDICTED: tubulin beta-1 chain-like               278   1e-88   
gb|AHB86962.1|  beta-tubulin                                            278   1e-88   
gb|AGT02044.1|  beta-tubulin                                            278   1e-88   
ref|XP_008807190.1|  PREDICTED: tubulin beta chain-like                 278   1e-88   
ref|XP_007201980.1|  hypothetical protein PRUPE_ppa004851mg             280   1e-88   
ref|XP_004139067.1|  PREDICTED: tubulin beta-2 chain-like               278   1e-88   
ref|XP_011096695.1|  PREDICTED: tubulin beta chain                      278   2e-88   
ref|XP_008450322.1|  PREDICTED: tubulin beta-6 chain                    278   2e-88   
ref|XP_004294235.1|  PREDICTED: tubulin beta chain                      278   2e-88   
sp|Q6VAF7.1|TBB5_GOSHI  RecName: Full=Tubulin beta-5 chain; AltNa...    278   2e-88   
ref|NP_001168917.1|  uncharacterized protein LOC100382727               280   2e-88   
emb|CDP12577.1|  unnamed protein product                                278   2e-88   
ref|XP_010516638.1|  PREDICTED: tubulin beta chain                      278   2e-88   
sp|Q41785.1|TBB8_MAIZE  RecName: Full=Tubulin beta-8 chain; AltNa...    278   2e-88   
ref|NP_001169695.1|  uncharacterized protein LOC100383576               278   2e-88   
ref|NP_001048679.2|  Os03g0105600                                       267   2e-88   
ref|XP_006410627.1|  hypothetical protein EUTSA_v10016629mg             278   2e-88   
ref|XP_006448872.1|  hypothetical protein CICLE_v10015255mg             278   2e-88   
ref|XP_010941598.1|  PREDICTED: tubulin beta chain                      277   2e-88   
ref|NP_001051451.1|  Os03g0780600                                       277   2e-88   
gb|AIS84173.1|  beta-tubulin 6b                                         278   2e-88   
gb|AIS84172.1|  beta-tubulin 6a                                         277   2e-88   
ref|XP_009404699.1|  PREDICTED: tubulin beta-1 chain                    277   2e-88   
gb|AET80382.1|  beta-tubulin 1                                          274   2e-88   
ref|XP_003535107.1|  PREDICTED: tubulin beta-3 chain-like               277   3e-88   
ref|XP_002962357.1|  hypothetical protein SELMODRAFT_78418              277   3e-88   
ref|XP_004966294.1|  PREDICTED: tubulin beta-1 chain-like               277   3e-88   
ref|XP_006377941.1|  tubulin beta chain family protein                  277   3e-88   
ref|XP_002523174.1|  tubulin beta chain, putative                       277   3e-88   
gb|AGH08242.1|  beta-tubulin 8                                          277   3e-88   
sp|P28551.2|TBB3_SOYBN  RecName: Full=Tubulin beta chain; AltName...    276   3e-88   
ref|XP_006410629.1|  hypothetical protein EUTSA_v10016629mg             278   3e-88   
ref|XP_004135544.1|  PREDICTED: tubulin beta-1 chain-like               277   3e-88   
sp|Q9ZPN8.1|TBB3_ELEIN  RecName: Full=Tubulin beta-3 chain; AltNa...    277   3e-88   
gb|EPS63676.1|  beta-tubulin                                            277   3e-88   
ref|XP_010906251.1|  PREDICTED: tubulin beta chain-like                 277   3e-88   
gb|KFK36378.1|  hypothetical protein AALP_AA4G115600                    277   3e-88   
ref|XP_007147456.1|  hypothetical protein PHAVU_006G126100g             277   3e-88   
ref|XP_008445559.1|  PREDICTED: tubulin beta chain                      277   4e-88   
gb|KDP23866.1|  hypothetical protein JCGZ_27135                         277   4e-88   
ref|XP_002438838.1|  hypothetical protein SORBIDRAFT_10g027010          277   4e-88   
ref|XP_003546276.1|  PREDICTED: tubulin beta-3 chain                    277   4e-88   
gb|AGH08230.1|  beta-tubulin 7                                          277   4e-88   
gb|ACM78033.1|  beta-tubulin                                            277   4e-88   
ref|XP_001767052.1|  predicted protein                                  276   4e-88   
ref|XP_002969671.1|  hypothetical protein SELMODRAFT_410535             276   4e-88   
ref|XP_002961071.1|  hypothetical protein SELMODRAFT_402668             276   4e-88   
ref|XP_008227321.1|  PREDICTED: tubulin beta-4 chain                    277   5e-88   
emb|CDX84283.1|  BnaC04g10450D                                          276   5e-88   
gb|AIY99977.1|  tubulin beta 4                                          276   5e-88   
ref|XP_004293671.1|  PREDICTED: tubulin beta chain                      276   5e-88   
emb|CDY31638.1|  BnaA05g09090D                                          276   5e-88   
ref|XP_010509706.1|  PREDICTED: tubulin beta chain-like                 276   5e-88   
gb|KDP21557.1|  hypothetical protein JCGZ_03665                         276   5e-88   
gb|EYU43219.1|  hypothetical protein MIMGU_mgv1a006450mg                276   5e-88   
ref|XP_009144143.1|  PREDICTED: LOW QUALITY PROTEIN: tubulin beta...    277   6e-88   
gb|AID52920.1|  tubulin beta-2 chain                                    276   6e-88   
ref|XP_002881356.1|  beta-tubulin R2242-rice                            276   6e-88   
ref|XP_008787350.1|  PREDICTED: tubulin beta chain-like                 276   6e-88   
ref|XP_004486478.1|  PREDICTED: tubulin beta-3 chain-like               276   6e-88   
dbj|BAA02505.1|  beta-tubulin                                           276   6e-88   
ref|XP_002527881.1|  tubulin beta chain, putative                       276   7e-88   
gb|KJB29774.1|  hypothetical protein B456_005G118100                    276   7e-88   
ref|XP_008793578.1|  PREDICTED: tubulin beta chain                      276   7e-88   
ref|XP_003594596.1|  Tubulin beta chain                                 276   7e-88   
ref|XP_002309109.1|  hypothetical protein POPTR_0006s09610g             276   8e-88   
gb|ABY86661.1|  beta-tubulin 15                                         276   9e-88   
ref|XP_004504719.1|  PREDICTED: tubulin beta-3 chain-like               276   1e-87   
ref|XP_010519051.1|  PREDICTED: tubulin beta chain-like                 276   1e-87   
ref|XP_010923772.1|  PREDICTED: tubulin beta chain-like                 276   1e-87   
gb|KHN25859.1|  Tubulin beta-1 chain                                    276   1e-87   
ref|XP_009385041.1|  PREDICTED: tubulin beta chain-like                 276   1e-87   
gb|AIS84169.1|  beta-tubulin 4a                                         276   1e-87   
ref|XP_006410012.1|  hypothetical protein EUTSA_v10016651mg             276   1e-87   
ref|XP_009380867.1|  PREDICTED: tubulin beta chain-like                 276   1e-87   
dbj|BAC42563.1|  putative tubulin beta-6 chain                          276   1e-87   
ref|XP_002281289.1|  PREDICTED: tubulin beta-2 chain                    276   1e-87   
ref|XP_009405384.1|  PREDICTED: tubulin beta chain                      276   1e-87   
ref|XP_006656368.1|  PREDICTED: tubulin beta-3 chain-like               275   1e-87   
ref|XP_002965374.1|  hypothetical protein SELMODRAFT_23429              274   1e-87   
gb|AGK36091.1|  beta-tubulin                                            275   1e-87   
gb|KJB56321.1|  hypothetical protein B456_009G115600                    275   1e-87   
ref|XP_010098541.1|  Tubulin beta-1 chain                               275   1e-87   
ref|XP_010533801.1|  PREDICTED: tubulin beta-5 chain                    275   1e-87   
ref|XP_010926477.1|  PREDICTED: tubulin beta-5 chain-like               275   2e-87   
ref|XP_009393282.1|  PREDICTED: tubulin beta chain-like                 275   2e-87   
ref|XP_010504960.1|  PREDICTED: tubulin beta chain-like                 275   2e-87   
ref|XP_009399255.1|  PREDICTED: tubulin beta chain-like                 275   2e-87   
gb|KCW77253.1|  hypothetical protein EUGRSUZ_D01612                     275   2e-87   
gb|KJB36869.1|  hypothetical protein B456_006G179900                    276   2e-87   
ref|NP_001289662.1|  tubulin beta chain                                 275   2e-87   
gb|ABY86660.1|  beta-tubulin 14                                         275   2e-87   
gb|ACM89774.1|  beta-tubulin 14                                         275   2e-87   
gb|KJB56320.1|  hypothetical protein B456_009G115600                    275   2e-87   
ref|XP_010521570.1|  PREDICTED: tubulin beta-5 chain-like               275   2e-87   
ref|XP_009412045.1|  PREDICTED: tubulin beta chain-like                 275   2e-87   
ref|XP_004506720.1|  PREDICTED: tubulin beta-1 chain-like               275   2e-87   
ref|XP_006853321.1|  hypothetical protein AMTR_s00032p00056500          275   2e-87   
ref|XP_006302256.1|  hypothetical protein CARUB_v10020293mg             275   2e-87   
gb|KJB20685.1|  hypothetical protein B456_003G159300                    275   2e-87   
ref|XP_010036380.1|  PREDICTED: tubulin beta-1 chain-like               275   2e-87   
ref|XP_003531075.2|  PREDICTED: LOW QUALITY PROTEIN: tubulin beta...    275   3e-87   
ref|XP_002267304.1|  PREDICTED: tubulin beta chain                      275   3e-87   
ref|XP_001759099.1|  predicted protein                                  275   3e-87   
ref|XP_002960790.1|  hypothetical protein SELMODRAFT_73284              274   3e-87   
gb|AFR42145.1|  beta-tubulin                                            263   3e-87   
ref|XP_007022910.1|  Tubulin beta-7 chain                               274   4e-87   
emb|CDX98679.1|  BnaA03g44640D                                          274   4e-87   
ref|XP_011085182.1|  PREDICTED: tubulin beta chain-like                 276   4e-87   
ref|XP_007158988.1|  hypothetical protein PHAVU_002G198600g             274   4e-87   
ref|XP_006413842.1|  hypothetical protein EUTSA_v10025207mg             274   4e-87   
gb|AGV54389.1|  tubulin beta-1 chain-like protein                       274   5e-87   
ref|XP_010434259.1|  PREDICTED: tubulin beta-9 chain                    274   5e-87   
ref|XP_006283733.1|  hypothetical protein CARUB_v10004805mg             274   5e-87   
gb|AIY99978.1|  tubulin beta 2                                          274   5e-87   
ref|XP_009362200.1|  PREDICTED: tubulin beta chain-like                 274   5e-87   
gb|KDO84876.1|  hypothetical protein CISIN_1g036688mg                   266   5e-87   
gb|AGH08243.1|  beta-tubulin 5                                          274   5e-87   



>gb|KHG25436.1| Tubulin beta-8 chain -like protein [Gossypium arboreum]
Length=280

 Score =   293 bits (750),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 135/140 (96%), Positives = 139/140 (99%), Gaps = 0/140 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVCAEHGID TG+YHGDSDLQLER+NVYYNEASCGR+V
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDSTGKYHGDSDLQLERINVYYNEASCGRYV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCHSLG  526
            RKEAENCDCLQGFQVCHSLG
Sbjct  121  RKEAENCDCLQGFQVCHSLG  140



>ref|XP_002271992.1| PREDICTED: tubulin beta-2 chain [Vitis vinifera]
Length=447

 Score =   298 bits (762),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 138/140 (99%), Positives = 139/140 (99%), Gaps = 0/140 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVCAEHGID TGRYHGDSDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDSTGRYHGDSDLQLERVNVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCHSLG  526
            RKEAENCDCLQGFQVCHSLG
Sbjct  121  RKEAENCDCLQGFQVCHSLG  140



>gb|KHG21955.1| Tubulin beta-8 chain -like protein [Gossypium arboreum]
Length=241

 Score =   290 bits (742),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 136/140 (97%), Positives = 138/140 (99%), Gaps = 0/140 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVCAEHGID TGRY GD+DLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDSTGRYQGDNDLQLERVNVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCHSLG  526
            RKEAENCDCLQGFQVCHSLG
Sbjct  121  RKEAENCDCLQGFQVCHSLG  140



>ref|XP_007205123.1| hypothetical protein PRUPE_ppa004884mg [Prunus persica]
 gb|EMJ06322.1| hypothetical protein PRUPE_ppa004884mg [Prunus persica]
Length=487

 Score =   298 bits (763),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 138/143 (97%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = +2

Query  98   QPKMREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCG  277
            +PKMREILHIQGGQCGNQIGAKFWEVVCAEHGID TGRYHGDS+LQLERVNVYYNEAS G
Sbjct  39   EPKMREILHIQGGQCGNQIGAKFWEVVCAEHGIDSTGRYHGDSELQLERVNVYYNEASGG  98

Query  278  RFVPRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVL  457
            R+VPRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVL
Sbjct  99   RYVPRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVL  158

Query  458  DVVRKEAENCDCLQGFQVCHSLG  526
            DVVRKEAENCDCLQGFQVCHSLG
Sbjct  159  DVVRKEAENCDCLQGFQVCHSLG  181



>ref|XP_006421924.1| hypothetical protein CICLE_v10004755mg [Citrus clementina]
 gb|ESR35164.1| hypothetical protein CICLE_v10004755mg [Citrus clementina]
Length=514

 Score =   299 bits (765),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 137/141 (97%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  104  KMREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRF  283
            KMREILHIQGGQCGNQIGAKFWEVVCAEHGID TGRY+GD+DLQLERVNVYYNEASCGRF
Sbjct  68   KMREILHIQGGQCGNQIGAKFWEVVCAEHGIDSTGRYNGDNDLQLERVNVYYNEASCGRF  127

Query  284  VPRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDV  463
            VPRAVLMDLEPGTMDS+RSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDV
Sbjct  128  VPRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDV  187

Query  464  VRKEAENCDCLQGFQVCHSLG  526
            VRKEAENCDCLQGFQVCHSLG
Sbjct  188  VRKEAENCDCLQGFQVCHSLG  208



>ref|XP_002509780.1| tubulin beta chain, putative [Ricinus communis]
 gb|EEF51167.1| tubulin beta chain, putative [Ricinus communis]
Length=446

 Score =   296 bits (759),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 136/140 (97%), Positives = 139/140 (99%), Gaps = 0/140 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILH+QGGQCGNQIGAKFWEVVCAEHGID TGRYHGD+DLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHVQGGQCGNQIGAKFWEVVCAEHGIDSTGRYHGDTDLQLERVNVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCHSLG  526
            RKEAENCDCLQGFQVCHSLG
Sbjct  121  RKEAENCDCLQGFQVCHSLG  140



>gb|KHG16112.1| Tubulin beta-1 chain [Gossypium arboreum]
Length=227

 Score =   289 bits (739),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 135/140 (96%), Positives = 138/140 (99%), Gaps = 0/140 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVCAEHGID TGRY GDS+LQLER+NVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDSTGRYGGDSELQLERINVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCHSLG  526
            RKEAENCDCLQGFQVCHSLG
Sbjct  121  RKEAENCDCLQGFQVCHSLG  140



>ref|XP_006827680.1| hypothetical protein AMTR_s00009p00255970 [Amborella trichopoda]
 gb|ERM95096.1| hypothetical protein AMTR_s00009p00255970 [Amborella trichopoda]
Length=446

 Score =   296 bits (758),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 137/140 (98%), Positives = 138/140 (99%), Gaps = 0/140 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVC EHGID TGRYHGDSDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCTEHGIDSTGRYHGDSDLQLERVNVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCHSLG  526
            RKEAENCDCLQGFQVCHSLG
Sbjct  121  RKEAENCDCLQGFQVCHSLG  140



>ref|XP_010940464.1| PREDICTED: tubulin beta-2 chain [Elaeis guineensis]
Length=447

 Score =   296 bits (757),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 137/140 (98%), Positives = 139/140 (99%), Gaps = 0/140 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVCAEHGID TGRYHGDSDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDATGRYHGDSDLQLERVNVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELID+VLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDAVLDVV  120

Query  467  RKEAENCDCLQGFQVCHSLG  526
            RKEAENCDCLQGFQVCHSLG
Sbjct  121  RKEAENCDCLQGFQVCHSLG  140



>ref|NP_001289638.1| tubulin beta-9 chain [Eucalyptus grandis]
 gb|ABS50666.1| beta-tubulin [Eucalyptus grandis]
 gb|KCW85484.1| hypothetical protein EUGRSUZ_B02285 [Eucalyptus grandis]
Length=447

 Score =   295 bits (756),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 137/140 (98%), Positives = 139/140 (99%), Gaps = 0/140 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVCAEHGID TGRYHGDS+LQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDATGRYHGDSELQLERVNVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCHSLG  526
            RKEAENCDCLQGFQVCHSLG
Sbjct  121  RKEAENCDCLQGFQVCHSLG  140



>ref|XP_002304488.1| hypothetical protein POPTR_0003s12540g [Populus trichocarpa]
 gb|EEE79467.1| hypothetical protein POPTR_0003s12540g [Populus trichocarpa]
Length=446

 Score =   295 bits (755),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 137/140 (98%), Positives = 138/140 (99%), Gaps = 0/140 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVCAEHGID TGRYHGDS LQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDSTGRYHGDSALQLERVNVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCHSLG  526
            RKEAENCDCLQGFQVCHSLG
Sbjct  121  RKEAENCDCLQGFQVCHSLG  140



>ref|XP_008355135.1| PREDICTED: tubulin beta chain-like [Malus domestica]
Length=261

 Score =   289 bits (739),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 136/140 (97%), Positives = 138/140 (99%), Gaps = 0/140 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVCAEHGID TGRYHGDS+LQLERVNVYYNEAS GR+V
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDSTGRYHGDSELQLERVNVYYNEASGGRYV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCHSLG  526
            RKEAENCDCLQGFQVCHSLG
Sbjct  121  RKEAENCDCLQGFQVCHSLG  140



>gb|ABK94073.1| unknown [Populus trichocarpa]
Length=446

 Score =   295 bits (755),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 137/140 (98%), Positives = 138/140 (99%), Gaps = 0/140 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVCAEHGID TGRYHGDS LQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDSTGRYHGDSALQLERVNVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCHSLG  526
            RKEAENCDCLQGFQVCHSLG
Sbjct  121  RKEAENCDCLQGFQVCHSLG  140



>ref|XP_011022718.1| PREDICTED: tubulin beta-5 chain-like [Populus euphratica]
Length=446

 Score =   295 bits (755),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 137/140 (98%), Positives = 138/140 (99%), Gaps = 0/140 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVCAEHGID TGRYHGDS LQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDSTGRYHGDSALQLERVNVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCHSLG  526
            RKEAENCDCLQGFQVCHSLG
Sbjct  121  RKEAENCDCLQGFQVCHSLG  140



>ref|XP_006404194.1| hypothetical protein EUTSA_v10010366mg [Eutrema salsugineum]
 gb|ESQ45647.1| hypothetical protein EUTSA_v10010366mg [Eutrema salsugineum]
Length=451

 Score =   295 bits (754),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 136/140 (97%), Positives = 138/140 (99%), Gaps = 0/140 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVCAEHGID TGRY GDSDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDSTGRYQGDSDLQLERVNVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRA+LMDLEPGTMDS+RSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAILMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCHSLG  526
            RKEAENCDCLQGFQVCHSLG
Sbjct  121  RKEAENCDCLQGFQVCHSLG  140



>ref|XP_010255421.1| PREDICTED: tubulin beta-2 chain [Nelumbo nucifera]
 ref|XP_010255422.1| PREDICTED: tubulin beta-2 chain [Nelumbo nucifera]
Length=446

 Score =   295 bits (754),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 137/140 (98%), Positives = 138/140 (99%), Gaps = 0/140 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVCAEHGID TGRY GDSDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDATGRYQGDSDLQLERVNVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCHSLG  526
            RKEAENCDCLQGFQVCHSLG
Sbjct  121  RKEAENCDCLQGFQVCHSLG  140



>ref|XP_009626214.1| PREDICTED: tubulin beta-2 chain-like [Nicotiana tomentosiformis]
Length=447

 Score =   295 bits (754),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 136/140 (97%), Positives = 139/140 (99%), Gaps = 0/140 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVCAEHGID TGRY+GDSDLQLER+NVYYNEA+CGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDSTGRYNGDSDLQLERINVYYNEATCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCHSLG  526
            RKEAENCDCLQGFQVCHSLG
Sbjct  121  RKEAENCDCLQGFQVCHSLG  140



>gb|EYU38358.1| hypothetical protein MIMGU_mgv1a007077mg [Erythranthe guttata]
Length=420

 Score =   293 bits (751),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 136/140 (97%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVC EHGID TGRY GDSDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCTEHGIDSTGRYQGDSDLQLERVNVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCHSLG  526
            RKEAENCDCLQGFQVCHSLG
Sbjct  121  RKEAENCDCLQGFQVCHSLG  140



>ref|XP_008355572.1| PREDICTED: tubulin beta chain [Malus domestica]
Length=244

 Score =   287 bits (735),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 136/140 (97%), Positives = 138/140 (99%), Gaps = 0/140 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVCAEHGID TGRYHGDS+LQLERVNVYYNEAS GR+V
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDSTGRYHGDSELQLERVNVYYNEASGGRYV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCHSLG  526
            RKEAENCDCLQGFQVCHSLG
Sbjct  121  RKEAENCDCLQGFQVCHSLG  140



>emb|CDX88051.1| BnaA06g26420D [Brassica napus]
Length=426

 Score =   293 bits (751),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 136/140 (97%), Positives = 138/140 (99%), Gaps = 0/140 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVCAEHGID TGRY G+SDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDSTGRYQGESDLQLERVNVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCHSLG  526
            RKEAENCDCLQGFQVCHSLG
Sbjct  121  RKEAENCDCLQGFQVCHSLG  140



>ref|XP_006490393.1| PREDICTED: tubulin beta-1 chain-like [Citrus sinensis]
 gb|KDO59996.1| hypothetical protein CISIN_1g013291mg [Citrus sinensis]
Length=446

 Score =   294 bits (752),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 136/140 (97%), Positives = 139/140 (99%), Gaps = 0/140 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVCAEHGID TGRY+GD+DLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDSTGRYNGDNDLQLERVNVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCHSLG  526
            RKEAENCDCLQGFQVCHSLG
Sbjct  121  RKEAENCDCLQGFQVCHSLG  140



>gb|EYU38453.1| hypothetical protein MIMGU_mgv1a006387mg [Erythranthe guttata]
Length=445

 Score =   294 bits (752),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 137/140 (98%), Positives = 138/140 (99%), Gaps = 0/140 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVCAEHGID TGRY GDSDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDQTGRYDGDSDLQLERVNVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSLRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCHSLG  526
            RKEAENCDCLQGFQVCHSLG
Sbjct  121  RKEAENCDCLQGFQVCHSLG  140



>ref|XP_010557230.1| PREDICTED: tubulin beta-2 chain-like [Tarenaya hassleriana]
Length=448

 Score =   294 bits (752),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 136/140 (97%), Positives = 138/140 (99%), Gaps = 0/140 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVCAEHGID TGRYHGDSDLQLER+NVYYNEASCGR V
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDPTGRYHGDSDLQLERINVYYNEASCGRIV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCHSLG  526
            RKEAENCDCLQGFQVCHSLG
Sbjct  121  RKEAENCDCLQGFQVCHSLG  140



>emb|CDX80390.1| BnaC07g30540D [Brassica napus]
Length=449

 Score =   294 bits (752),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 136/140 (97%), Positives = 138/140 (99%), Gaps = 0/140 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVCAEHGID TGRY G+SDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDSTGRYQGESDLQLERVNVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCHSLG  526
            RKEAENCDCLQGFQVCHSLG
Sbjct  121  RKEAENCDCLQGFQVCHSLG  140



>ref|XP_011076163.1| PREDICTED: tubulin beta-1 chain [Sesamum indicum]
Length=446

 Score =   293 bits (751),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 136/140 (97%), Positives = 139/140 (99%), Gaps = 0/140 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVCAEHGID TGRY+GD+DLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDSTGRYNGDNDLQLERVNVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCHSLG  526
            RKEAENCDCLQGFQVCHSLG
Sbjct  121  RKEAENCDCLQGFQVCHSLG  140



>ref|XP_002510784.1| tubulin beta chain, putative [Ricinus communis]
 gb|EEF51386.1| tubulin beta chain, putative [Ricinus communis]
Length=448

 Score =   294 bits (752),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 136/140 (97%), Positives = 138/140 (99%), Gaps = 0/140 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVCAEHGID TGRY GD+DLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDSTGRYQGDNDLQLERVNVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCHSLG  526
            RKEAENCDCLQGFQVCHSLG
Sbjct  121  RKEAENCDCLQGFQVCHSLG  140



>gb|KJB34131.1| hypothetical protein B456_006G049000 [Gossypium raimondii]
Length=448

 Score =   293 bits (751),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 136/140 (97%), Positives = 138/140 (99%), Gaps = 0/140 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVCAEHGID TGRY GD+DLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDSTGRYQGDNDLQLERVNVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCHSLG  526
            RKEAENCDCLQGFQVCHSLG
Sbjct  121  RKEAENCDCLQGFQVCHSLG  140



>ref|XP_010521908.1| PREDICTED: tubulin beta-2 chain-like [Tarenaya hassleriana]
 gb|ABW81102.1| BTub-1 [Cleome spinosa]
Length=448

 Score =   293 bits (751),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 135/140 (96%), Positives = 138/140 (99%), Gaps = 0/140 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIG+KFWEVVCAEHGID TGRYHGDSDLQLERVNVYYNEASCGR V
Sbjct  1    MREILHIQGGQCGNQIGSKFWEVVCAEHGIDPTGRYHGDSDLQLERVNVYYNEASCGRLV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRA+LMDLEPGTMDS+RSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAILMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCHSLG  526
            RKEAENCDCLQGFQVCHSLG
Sbjct  121  RKEAENCDCLQGFQVCHSLG  140



>ref|XP_008778745.1| PREDICTED: tubulin beta-2 chain-like [Phoenix dactylifera]
Length=448

 Score =   293 bits (751),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 136/140 (97%), Positives = 138/140 (99%), Gaps = 0/140 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVCAEHGID TG YHGDSDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDATGSYHGDSDLQLERVNVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELID+VLDVV
Sbjct  61   PRAVLMDLEPGTMDSLRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDAVLDVV  120

Query  467  RKEAENCDCLQGFQVCHSLG  526
            RKEAENCDCLQGFQVCHSLG
Sbjct  121  RKEAENCDCLQGFQVCHSLG  140



>ref|XP_009150907.1| PREDICTED: tubulin beta-8 chain [Brassica rapa]
Length=449

 Score =   293 bits (751),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 136/140 (97%), Positives = 138/140 (99%), Gaps = 0/140 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVCAEHGID TGRY G+SDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDSTGRYQGESDLQLERVNVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCHSLG  526
            RKEAENCDCLQGFQVCHSLG
Sbjct  121  RKEAENCDCLQGFQVCHSLG  140



>ref|XP_008804937.1| PREDICTED: tubulin beta-2 chain [Phoenix dactylifera]
Length=446

 Score =   293 bits (751),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 137/140 (98%), Positives = 138/140 (99%), Gaps = 0/140 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVCAEHGID TGRY GDSDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDATGRYLGDSDLQLERVNVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCHSLG  526
            RKEAENCDCLQGFQVCHSLG
Sbjct  121  RKEAENCDCLQGFQVCHSLG  140



>ref|XP_009793967.1| PREDICTED: tubulin beta-2 chain-like [Nicotiana sylvestris]
Length=447

 Score =   293 bits (751),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 135/140 (96%), Positives = 139/140 (99%), Gaps = 0/140 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVCAEHGID TGRY+GDSDLQLER+NVYYNEA+CGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDSTGRYNGDSDLQLERINVYYNEATCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELID+VLDVV
Sbjct  61   PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDAVLDVV  120

Query  467  RKEAENCDCLQGFQVCHSLG  526
            RKEAENCDCLQGFQVCHSLG
Sbjct  121  RKEAENCDCLQGFQVCHSLG  140



>emb|CDP05193.1| unnamed protein product [Coffea canephora]
Length=447

 Score =   293 bits (751),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 136/140 (97%), Positives = 138/140 (99%), Gaps = 0/140 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVCAEHGID TGRY GD+DLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDSTGRYKGDNDLQLERVNVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCHSLG  526
            RKEAENCDCLQGFQVCHSLG
Sbjct  121  RKEAENCDCLQGFQVCHSLG  140



>ref|XP_008806874.1| PREDICTED: tubulin beta-2 chain [Phoenix dactylifera]
Length=447

 Score =   293 bits (750),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 136/140 (97%), Positives = 138/140 (99%), Gaps = 0/140 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVCAEHGID TGRY GDSDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDATGRYQGDSDLQLERVNVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELID+VLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDAVLDVV  120

Query  467  RKEAENCDCLQGFQVCHSLG  526
            RKEAENCDCLQGFQVCHSLG
Sbjct  121  RKEAENCDCLQGFQVCHSLG  140



>gb|AAK32919.1|AF367332_1 AT5g62700/MRG21_12 [Arabidopsis thaliana]
 gb|AAM16247.1| AT5g62700/MRG21_12 [Arabidopsis thaliana]
Length=353

 Score =   290 bits (742),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 135/140 (96%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVCAEHGID TGRY GDSDLQLER+NVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDPTGRYTGDSDLQLERINVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGPYGQ FRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSLRSGPYGQTFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCHSLG  526
            RKEAENCDCLQGFQVCHSLG
Sbjct  121  RKEAENCDCLQGFQVCHSLG  140



>ref|XP_010273068.1| PREDICTED: tubulin beta-1 chain-like [Nelumbo nucifera]
Length=446

 Score =   293 bits (750),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 137/140 (98%), Positives = 138/140 (99%), Gaps = 0/140 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVCAEHGID TGRYHGDSDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDATGRYHGDSDLQLERVNVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSG YGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGHYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCHSLG  526
            RKEAENCDCLQGFQVCHSLG
Sbjct  121  RKEAENCDCLQGFQVCHSLG  140



>ref|XP_006848044.1| hypothetical protein AMTR_s00029p00190040 [Amborella trichopoda]
 gb|ERN09625.1| hypothetical protein AMTR_s00029p00190040 [Amborella trichopoda]
Length=446

 Score =   293 bits (750),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 136/140 (97%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVCAEHGID TG YHGDSDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDSTGSYHGDSDLQLERVNVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELID VLDVV
Sbjct  61   PRAVLMDLEPGTMDSLRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDLVLDVV  120

Query  467  RKEAENCDCLQGFQVCHSLG  526
            RKEAENCDCLQGFQVCHSLG
Sbjct  121  RKEAENCDCLQGFQVCHSLG  140



>emb|CDP09135.1| unnamed protein product [Coffea canephora]
Length=425

 Score =   292 bits (748),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 136/140 (97%), Positives = 138/140 (99%), Gaps = 0/140 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVCAEHGID TGRY GDSDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDATGRYQGDSDLQLERVNVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGP+GQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPHGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCHSLG  526
            RKEAENCDCLQGFQVCHSLG
Sbjct  121  RKEAENCDCLQGFQVCHSLG  140



>gb|KJB25808.1| hypothetical protein B456_004G210600 [Gossypium raimondii]
Length=419

 Score =   292 bits (747),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 135/140 (96%), Positives = 138/140 (99%), Gaps = 0/140 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVCAEHGID TGRY GDS+LQLER+NVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDSTGRYGGDSELQLERINVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCHSLG  526
            RKEAENCDCLQGFQVCHSLG
Sbjct  121  RKEAENCDCLQGFQVCHSLG  140



>ref|XP_010510475.1| PREDICTED: tubulin beta-7 chain isoform X1 [Camelina sativa]
 ref|XP_010510476.1| PREDICTED: tubulin beta-7 chain isoform X2 [Camelina sativa]
 ref|XP_010414372.1| PREDICTED: tubulin beta-7 chain [Camelina sativa]
Length=449

 Score =   293 bits (749),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 135/140 (96%), Positives = 138/140 (99%), Gaps = 0/140 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIG+KFWEVVCAEHGID TGRY GDSDLQLERVNVYYNEASCGR+V
Sbjct  1    MREILHIQGGQCGNQIGSKFWEVVCAEHGIDQTGRYQGDSDLQLERVNVYYNEASCGRYV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCHSLG  526
            RKEAENCDCLQGFQVCHSLG
Sbjct  121  RKEAENCDCLQGFQVCHSLG  140



>ref|XP_009794774.1| PREDICTED: tubulin beta-2 chain [Nicotiana sylvestris]
Length=446

 Score =   293 bits (749),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 135/140 (96%), Positives = 138/140 (99%), Gaps = 0/140 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVCAEHGID TGRY GD+DLQLER+NVYYNEA+CGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDSTGRYDGDADLQLERINVYYNEATCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCHSLG  526
            RKEAENCDCLQGFQVCHSLG
Sbjct  121  RKEAENCDCLQGFQVCHSLG  140



>ref|XP_004249588.1| PREDICTED: tubulin beta-2 chain-like [Solanum lycopersicum]
Length=448

 Score =   293 bits (749),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 135/140 (96%), Positives = 138/140 (99%), Gaps = 0/140 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVCAEHGID TGRY GDSDLQLER+NVYYNEA+CGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDSTGRYSGDSDLQLERINVYYNEATCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELID+VLDVV
Sbjct  61   PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDAVLDVV  120

Query  467  RKEAENCDCLQGFQVCHSLG  526
            RKEAENCDCLQGFQVCHSLG
Sbjct  121  RKEAENCDCLQGFQVCHSLG  140



>ref|XP_009629036.1| PREDICTED: tubulin beta-2 chain [Nicotiana tomentosiformis]
Length=447

 Score =   293 bits (749),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 135/140 (96%), Positives = 138/140 (99%), Gaps = 0/140 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVCAEHGID TGRY GD+DLQLER+NVYYNEA+CGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDSTGRYDGDADLQLERINVYYNEATCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCHSLG  526
            RKEAENCDCLQGFQVCHSLG
Sbjct  121  RKEAENCDCLQGFQVCHSLG  140



>ref|XP_010469941.1| PREDICTED: tubulin beta-7 chain-like [Camelina sativa]
Length=448

 Score =   293 bits (749),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 135/140 (96%), Positives = 138/140 (99%), Gaps = 0/140 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIG+KFWEVVCAEHGID TGRY GDSDLQLERVNVYYNEASCGR+V
Sbjct  1    MREILHIQGGQCGNQIGSKFWEVVCAEHGIDQTGRYQGDSDLQLERVNVYYNEASCGRYV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCHSLG  526
            RKEAENCDCLQGFQVCHSLG
Sbjct  121  RKEAENCDCLQGFQVCHSLG  140



>ref|XP_011072483.1| PREDICTED: tubulin beta-8 chain-like [Sesamum indicum]
Length=445

 Score =   292 bits (748),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 135/140 (96%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVC EHGID TGRY GDSDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCTEHGIDSTGRYQGDSDLQLERVNVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGP+GQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCHSLG  526
            RKEAENCDCLQGFQVCHSLG
Sbjct  121  RKEAENCDCLQGFQVCHSLG  140



>gb|AGH08232.1| beta-tubulin 3 [Salix arbutifolia]
Length=447

 Score =   292 bits (748),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 136/140 (97%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVCAEHGID TGRY GDS LQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDSTGRYQGDSALQLERVNVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCHSLG  526
            RKEAENCDCLQGFQVCHSLG
Sbjct  121  RKEAENCDCLQGFQVCHSLG  140



>ref|XP_008376592.1| PREDICTED: tubulin beta-1 chain-like [Malus domestica]
Length=447

 Score =   292 bits (748),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 135/140 (96%), Positives = 138/140 (99%), Gaps = 0/140 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVCAEHGID TGRY GD++LQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDSTGRYQGDNELQLERVNVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCHSLG  526
            RKEAENCDCLQGFQVCHSLG
Sbjct  121  RKEAENCDCLQGFQVCHSLG  140



>ref|XP_009144365.1| PREDICTED: tubulin beta-7 chain [Brassica rapa]
Length=449

 Score =   292 bits (748),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 135/140 (96%), Positives = 138/140 (99%), Gaps = 0/140 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIG+KFWEVVCAEHGID TGRY GDSDLQLERVNVYYNEASCGR+V
Sbjct  1    MREILHIQGGQCGNQIGSKFWEVVCAEHGIDQTGRYQGDSDLQLERVNVYYNEASCGRYV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCHSLG  526
            RKEAENCDCLQGFQVCHSLG
Sbjct  121  RKEAENCDCLQGFQVCHSLG  140



>emb|CDY45452.1| BnaA05g12490D [Brassica napus]
Length=449

 Score =   292 bits (748),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 135/140 (96%), Positives = 138/140 (99%), Gaps = 0/140 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIG+KFWEVVCAEHGID TGRY GDSDLQLERVNVYYNEASCGR+V
Sbjct  1    MREILHIQGGQCGNQIGSKFWEVVCAEHGIDQTGRYQGDSDLQLERVNVYYNEASCGRYV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCHSLG  526
            RKEAENCDCLQGFQVCHSLG
Sbjct  121  RKEAENCDCLQGFQVCHSLG  140



>ref|XP_004249594.1| PREDICTED: tubulin beta-2 chain [Solanum lycopersicum]
Length=446

 Score =   292 bits (748),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 135/140 (96%), Positives = 138/140 (99%), Gaps = 0/140 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVCAEHGID TGRY GD+DLQLER+NVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDSTGRYDGDADLQLERINVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELID+VLDVV
Sbjct  61   PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDAVLDVV  120

Query  467  RKEAENCDCLQGFQVCHSLG  526
            RKEAENCDCLQGFQVCHSLG
Sbjct  121  RKEAENCDCLQGFQVCHSLG  140



>ref|XP_011072460.1| PREDICTED: tubulin beta-8 chain-like [Sesamum indicum]
Length=445

 Score =   292 bits (748),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 135/140 (96%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVC EHGID TGRY GDSDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCTEHGIDSTGRYQGDSDLQLERVNVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGP+GQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCHSLG  526
            RKEAENCDCLQGFQVCHSLG
Sbjct  121  RKEAENCDCLQGFQVCHSLG  140



>ref|XP_009763987.1| PREDICTED: tubulin beta-8 chain-like [Nicotiana sylvestris]
Length=445

 Score =   292 bits (748),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 135/140 (96%), Positives = 138/140 (99%), Gaps = 0/140 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVCAEHGID TG YHG+SD+QLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDSTGAYHGESDIQLERVNVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCHSLG  526
            RKEAENCDCLQGFQVCHSLG
Sbjct  121  RKEAENCDCLQGFQVCHSLG  140



>ref|XP_009590874.1| PREDICTED: tubulin beta-8 chain-like [Nicotiana tomentosiformis]
Length=445

 Score =   292 bits (748),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 135/140 (96%), Positives = 138/140 (99%), Gaps = 0/140 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVCAEHGID TG YHG+SD+QLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDSTGAYHGESDIQLERVNVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCHSLG  526
            RKEAENCDCLQGFQVCHSLG
Sbjct  121  RKEAENCDCLQGFQVCHSLG  140



>ref|XP_009371335.1| PREDICTED: tubulin beta-1 chain [Pyrus x bretschneideri]
 ref|XP_009340030.1| PREDICTED: tubulin beta-1 chain [Pyrus x bretschneideri]
 ref|XP_009342969.1| PREDICTED: tubulin beta-1 chain [Pyrus x bretschneideri]
Length=447

 Score =   292 bits (748),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 135/140 (96%), Positives = 138/140 (99%), Gaps = 0/140 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVCAEHGID TGRY GD++LQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDSTGRYQGDNELQLERVNVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCHSLG  526
            RKEAENCDCLQGFQVCHSLG
Sbjct  121  RKEAENCDCLQGFQVCHSLG  140



>ref|XP_010108341.1| Tubulin beta-1 chain [Morus notabilis]
 gb|EXC19132.1| Tubulin beta-1 chain [Morus notabilis]
Length=447

 Score =   292 bits (748),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 135/140 (96%), Positives = 138/140 (99%), Gaps = 0/140 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVCAEHGID TGRY GD++LQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDSTGRYQGDNELQLERVNVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCHSLG  526
            RKEAENCDCLQGFQVCHSLG
Sbjct  121  RKEAENCDCLQGFQVCHSLG  140



>ref|XP_007218003.1| hypothetical protein PRUPE_ppa005698mg [Prunus persica]
 ref|XP_008234243.1| PREDICTED: tubulin beta-1 chain [Prunus mume]
 ref|XP_008234244.1| PREDICTED: tubulin beta-1 chain [Prunus mume]
 gb|EMJ19202.1| hypothetical protein PRUPE_ppa005698mg [Prunus persica]
Length=447

 Score =   292 bits (748),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 135/140 (96%), Positives = 138/140 (99%), Gaps = 0/140 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVCAEHGID TGRY GD++LQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDSTGRYQGDNELQLERVNVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCHSLG  526
            RKEAENCDCLQGFQVCHSLG
Sbjct  121  RKEAENCDCLQGFQVCHSLG  140



>ref|XP_010542657.1| PREDICTED: tubulin beta-2 chain-like [Tarenaya hassleriana]
Length=448

 Score =   292 bits (748),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 136/140 (97%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVCAEHGID TGRY GDSDLQLERVNVYYNEASCGR V
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDPTGRYQGDSDLQLERVNVYYNEASCGRLV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCHSLG  526
            RKEAENCDCLQGFQVCHSLG
Sbjct  121  RKEAENCDCLQGFQVCHSLG  140



>ref|XP_006424984.1| hypothetical protein CICLE_v10028436mg [Citrus clementina]
 ref|XP_006488439.1| PREDICTED: tubulin beta-2 chain-like [Citrus sinensis]
 gb|ESR38224.1| hypothetical protein CICLE_v10028436mg [Citrus clementina]
 gb|KDO66717.1| hypothetical protein CISIN_1g013165mg [Citrus sinensis]
Length=448

 Score =   292 bits (748),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 135/140 (96%), Positives = 138/140 (99%), Gaps = 0/140 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVCAEHGID TGRY GDS+LQLER+NVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDSTGRYDGDSELQLERINVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCHSLG  526
            RKEAENCDCLQGFQVCHSLG
Sbjct  121  RKEAENCDCLQGFQVCHSLG  140



>gb|AGH08227.1| beta-tubulin 4 [Salix arbutifolia]
Length=446

 Score =   292 bits (748),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 136/140 (97%), Positives = 138/140 (99%), Gaps = 0/140 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVCAEHGID TGRY+GDS LQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDSTGRYNGDSALQLERVNVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSLRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCHSLG  526
            RKEAENCDCLQGFQVCHSLG
Sbjct  121  RKEAENCDCLQGFQVCHSLG  140



>ref|XP_010908105.1| PREDICTED: tubulin beta-2 chain-like [Elaeis guineensis]
Length=447

 Score =   292 bits (748),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 136/140 (97%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVC EHGID TGRY GDSDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCTEHGIDATGRYLGDSDLQLERVNVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCHSLG  526
            RKEAENCDCLQGFQVCHSLG
Sbjct  121  RKEAENCDCLQGFQVCHSLG  140



>ref|XP_010934750.1| PREDICTED: tubulin beta-2 chain-like [Elaeis guineensis]
Length=447

 Score =   292 bits (748),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 135/140 (96%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVC EHGID TG YHGDSDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCTEHGIDATGSYHGDSDLQLERVNVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELID+VLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDAVLDVV  120

Query  467  RKEAENCDCLQGFQVCHSLG  526
            RKEAENCDCLQGFQVCHSLG
Sbjct  121  RKEAENCDCLQGFQVCHSLG  140



>ref|XP_004506645.1| PREDICTED: tubulin beta-2 chain-like [Cicer arietinum]
Length=448

 Score =   292 bits (748),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 135/140 (96%), Positives = 138/140 (99%), Gaps = 0/140 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVCAEHGID TGRY GDS+LQLER+NVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDSTGRYVGDSELQLERINVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCHSLG  526
            RKEAENCDCLQGFQVCHSLG
Sbjct  121  RKEAENCDCLQGFQVCHSLG  140



>gb|KDP46576.1| hypothetical protein JCGZ_08548 [Jatropha curcas]
Length=448

 Score =   292 bits (747),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 136/140 (97%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVCAEHGID TGRY GDSDLQLER+NVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDSTGRYQGDSDLQLERINVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDSIRSG YGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSIRSGTYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCHSLG  526
            RKEAENCDCLQGFQVCHSLG
Sbjct  121  RKEAENCDCLQGFQVCHSLG  140



>gb|ABY86655.1| beta-tubulin 4 [Gossypium hirsutum]
Length=448

 Score =   292 bits (747),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 135/140 (96%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQ GQCGNQIGAKFWEVVCAEHGID TGRY GD+DLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQAGQCGNQIGAKFWEVVCAEHGIDSTGRYQGDNDLQLERVNVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCHSLG  526
            RKEAENCDCLQGFQVCHSLG
Sbjct  121  RKEAENCDCLQGFQVCHSLG  140



>ref|XP_003536467.1| PREDICTED: tubulin beta-1 chain-like [Glycine max]
 gb|KHN21746.1| Tubulin beta-1 chain [Glycine soja]
Length=448

 Score =   292 bits (747),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 135/140 (96%), Positives = 138/140 (99%), Gaps = 0/140 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVCAEHGID TGRY GD++LQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDSTGRYQGDNELQLERVNVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCHSLG  526
            RKEAENCDCLQGFQVCHSLG
Sbjct  121  RKEAENCDCLQGFQVCHSLG  140



>ref|XP_008377500.1| PREDICTED: tubulin beta-1 chain [Malus domestica]
Length=447

 Score =   292 bits (747),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 135/140 (96%), Positives = 138/140 (99%), Gaps = 0/140 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVCAEHGID TGRY GD++LQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDATGRYQGDNELQLERVNVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCHSLG  526
            RKEAENCDCLQGFQVCHSLG
Sbjct  121  RKEAENCDCLQGFQVCHSLG  140



>gb|AAL92026.1|AF484959_1 tubulin beta-1 [Gossypium hirsutum]
 gb|AAL92118.1|AF487511_1 beta-tubulin [Gossypium hirsutum]
 gb|KJB25807.1| hypothetical protein B456_004G210600 [Gossypium raimondii]
Length=445

 Score =   292 bits (747),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 135/140 (96%), Positives = 138/140 (99%), Gaps = 0/140 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVCAEHGID TGRY GDS+LQLER+NVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDSTGRYGGDSELQLERINVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCHSLG  526
            RKEAENCDCLQGFQVCHSLG
Sbjct  121  RKEAENCDCLQGFQVCHSLG  140



>emb|CDY21784.1| BnaA06g20530D [Brassica napus]
 emb|CDX99087.1| BnaA06g17780D [Brassica napus]
Length=427

 Score =   291 bits (745),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 135/140 (96%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVCAEHGID TGRY GDSDLQLER+NVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDPTGRYTGDSDLQLERINVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGPYGQ FRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSLRSGPYGQTFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCHSLG  526
            RKEAENCDCLQGFQVCHSLG
Sbjct  121  RKEAENCDCLQGFQVCHSLG  140



>ref|XP_007133955.1| hypothetical protein PHAVU_010G006400g [Phaseolus vulgaris]
 gb|ESW05949.1| hypothetical protein PHAVU_010G006400g [Phaseolus vulgaris]
Length=449

 Score =   292 bits (747),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 135/140 (96%), Positives = 138/140 (99%), Gaps = 0/140 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVCAEHGID TGRY GDS+LQLER+NVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDPTGRYDGDSELQLERINVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCHSLG  526
            RKEAENCDCLQGFQVCHSLG
Sbjct  121  RKEAENCDCLQGFQVCHSLG  140



>sp|Q6VAF4.1|TBB9_GOSHI RecName: Full=Tubulin beta-9 chain; AltName: Full=Beta-9-tubulin 
[Gossypium hirsutum]
 gb|AAQ92668.1| beta-tubulin 9 [Gossypium hirsutum]
Length=445

 Score =   291 bits (746),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 135/140 (96%), Positives = 138/140 (99%), Gaps = 0/140 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVCAEHGID TGRY GDS+LQLER+NVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDSTGRYGGDSELQLERINVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCHSLG  526
            RKEAENCDCLQGFQVCHSLG
Sbjct  121  RKEAENCDCLQGFQVCHSLG  140



>ref|XP_002313404.1| hypothetical protein POPTR_0009s04500g [Populus trichocarpa]
 gb|EEE87359.1| hypothetical protein POPTR_0009s04500g [Populus trichocarpa]
Length=451

 Score =   292 bits (747),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 135/140 (96%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVCAEHGID TGRY GDS LQLER+NVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDSTGRYQGDSPLQLERINVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCHSLG  526
            RKEAENCDCLQGFQVCHSLG
Sbjct  121  RKEAENCDCLQGFQVCHSLG  140



>ref|XP_003556108.1| PREDICTED: tubulin beta-1 chain-like [Glycine max]
 gb|KHN26647.1| Tubulin beta-1 chain [Glycine soja]
Length=448

 Score =   291 bits (746),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 135/140 (96%), Positives = 138/140 (99%), Gaps = 0/140 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVCAEHGID TGRY GD++LQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDSTGRYQGDNELQLERVNVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCHSLG  526
            RKEAENCDCLQGFQVCHSLG
Sbjct  121  RKEAENCDCLQGFQVCHSLG  140



>ref|XP_009337361.1| PREDICTED: tubulin beta chain-like [Pyrus x bretschneideri]
Length=446

 Score =   291 bits (746),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 136/140 (97%), Positives = 138/140 (99%), Gaps = 0/140 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVCAEHGID TGRYHGDS+LQLERVNVYYNEAS GR+V
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDSTGRYHGDSELQLERVNVYYNEASGGRYV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCHSLG  526
            RKEAENCDCLQGFQVCHSLG
Sbjct  121  RKEAENCDCLQGFQVCHSLG  140



>ref|XP_009374320.1| PREDICTED: tubulin beta chain [Pyrus x bretschneideri]
Length=446

 Score =   291 bits (746),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 136/140 (97%), Positives = 138/140 (99%), Gaps = 0/140 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVCAEHGID TGRYHGDS+LQLERVNVYYNEAS GR+V
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDSTGRYHGDSELQLERVNVYYNEASGGRYV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCHSLG  526
            RKEAENCDCLQGFQVCHSLG
Sbjct  121  RKEAENCDCLQGFQVCHSLG  140



>ref|XP_002298330.1| Tubulin beta-2/beta-3 chain family protein [Populus trichocarpa]
 gb|ABK94690.1| unknown [Populus trichocarpa]
 gb|EEE83135.1| Tubulin beta-2/beta-3 chain family protein [Populus trichocarpa]
Length=449

 Score =   291 bits (746),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 135/140 (96%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVCAEHGID TG YHGDS LQLER+NVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDSTGSYHGDSPLQLERINVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSLRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCHSLG  526
            RKEAENCDCLQGFQVCHSLG
Sbjct  121  RKEAENCDCLQGFQVCHSLG  140



>ref|XP_011035226.1| PREDICTED: tubulin beta-2 chain [Populus euphratica]
Length=449

 Score =   291 bits (746),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 135/140 (96%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVCAEHGID TG YHGDS LQLER+NVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDSTGSYHGDSPLQLERINVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSLRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCHSLG  526
            RKEAENCDCLQGFQVCHSLG
Sbjct  121  RKEAENCDCLQGFQVCHSLG  140



>ref|XP_008220065.1| PREDICTED: tubulin beta chain [Prunus mume]
 gb|ACI03399.1| beta-tubulin [Prunus salicina var. cordata]
Length=446

 Score =   291 bits (746),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 136/140 (97%), Positives = 138/140 (99%), Gaps = 0/140 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVCAEHGID TGRYHGDS+LQLERVNVYYNEAS GR+V
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDSTGRYHGDSELQLERVNVYYNEASGGRYV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCHSLG  526
            RKEAENCDCLQGFQVCHSLG
Sbjct  121  RKEAENCDCLQGFQVCHSLG  140



>ref|XP_006291122.1| hypothetical protein CARUB_v10017235mg [Capsella rubella]
 ref|XP_006292748.1| hypothetical protein CARUB_v10018995mg [Capsella rubella]
 gb|EOA24020.1| hypothetical protein CARUB_v10017235mg [Capsella rubella]
 gb|EOA25646.1| hypothetical protein CARUB_v10018995mg [Capsella rubella]
Length=451

 Score =   291 bits (746),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 135/140 (96%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVCAEHGID TGRY GDSDLQLER+NVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDPTGRYTGDSDLQLERINVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGPYGQ FRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSLRSGPYGQTFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCHSLG  526
            RKEAENCDCLQGFQVCHSLG
Sbjct  121  RKEAENCDCLQGFQVCHSLG  140



>ref|XP_002864813.1| tubulin beta-2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH41072.1| tubulin beta-2 [Arabidopsis lyrata subsp. lyrata]
Length=450

 Score =   291 bits (746),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 135/140 (96%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVCAEHGID TGRY GDSDLQLER+NVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDPTGRYTGDSDLQLERINVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGPYGQ FRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSLRSGPYGQTFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCHSLG  526
            RKEAENCDCLQGFQVCHSLG
Sbjct  121  RKEAENCDCLQGFQVCHSLG  140



>ref|XP_002299541.1| hypothetical protein POPTR_0001s09180g [Populus trichocarpa]
 gb|EEE84346.1| hypothetical protein POPTR_0001s09180g [Populus trichocarpa]
Length=447

 Score =   291 bits (746),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 135/140 (96%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVCAEHGID TGRY GDS LQ+ERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDSTGRYQGDSALQIERVNVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCHSLG  526
            RKEAENCDCLQGFQVCHSLG
Sbjct  121  RKEAENCDCLQGFQVCHSLG  140



>ref|XP_009149954.1| PREDICTED: tubulin beta-2 chain-like [Brassica rapa]
Length=449

 Score =   291 bits (746),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 135/140 (96%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVCAEHGID TGRY GDSDLQLER+NVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDPTGRYTGDSDLQLERINVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGPYGQ FRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSLRSGPYGQTFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCHSLG  526
            RKEAENCDCLQGFQVCHSLG
Sbjct  121  RKEAENCDCLQGFQVCHSLG  140



>ref|XP_002877519.1| tubulin beta-2 [Arabidopsis lyrata subsp. lyrata]
 ref|XP_010503303.1| PREDICTED: tubulin beta-2 chain-like [Camelina sativa]
 gb|EFH53778.1| tubulin beta-2 [Arabidopsis lyrata subsp. lyrata]
Length=449

 Score =   291 bits (746),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 135/140 (96%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVCAEHGID TGRY GDSDLQLER+NVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDPTGRYTGDSDLQLERINVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGPYGQ FRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSLRSGPYGQTFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCHSLG  526
            RKEAENCDCLQGFQVCHSLG
Sbjct  121  RKEAENCDCLQGFQVCHSLG  140



>ref|NP_001289924.1| tubulin beta-2 chain [Camelina sativa]
 ref|XP_009150241.1| PREDICTED: tubulin beta-2 chain [Brassica rapa]
 ref|XP_009151388.1| PREDICTED: tubulin beta-2 chain [Brassica rapa]
 ref|XP_010515012.1| PREDICTED: tubulin beta-2 chain [Camelina sativa]
 ref|XP_010444122.1| PREDICTED: tubulin beta-2 chain [Camelina sativa]
 gb|AID81896.1| tubulin [Camelina sativa]
 emb|CDY38073.1| BnaC03g75120D [Brassica napus]
 emb|CDY00319.1| BnaA06g22200D [Brassica napus]
 emb|CDX86102.1| BnaC03g56170D [Brassica napus]
 emb|CDX84345.1| BnaC03g51550D [Brassica napus]
Length=450

 Score =   291 bits (746),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 135/140 (96%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVCAEHGID TGRY GDSDLQLER+NVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDPTGRYTGDSDLQLERINVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGPYGQ FRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSLRSGPYGQTFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCHSLG  526
            RKEAENCDCLQGFQVCHSLG
Sbjct  121  RKEAENCDCLQGFQVCHSLG  140



>ref|XP_010459234.1| PREDICTED: tubulin beta-2 chain-like [Camelina sativa]
Length=451

 Score =   291 bits (746),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 135/140 (96%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVCAEHGID TGRY GDSDLQLER+NVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDPTGRYTGDSDLQLERINVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGPYGQ FRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSLRSGPYGQTFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCHSLG  526
            RKEAENCDCLQGFQVCHSLG
Sbjct  121  RKEAENCDCLQGFQVCHSLG  140



>ref|NP_568959.1| tubulin beta-2/beta-3 chain [Arabidopsis thaliana]
 ref|NP_568960.1| tubulin beta-2/beta-3 chain [Arabidopsis thaliana]
 sp|Q56YW9.2|TBB2_ARATH RecName: Full=Tubulin beta-2 chain [Arabidopsis thaliana]
 sp|Q9ASR0.2|TBB3_ARATH RecName: Full=Tubulin beta-3 chain [Arabidopsis thaliana]
 gb|AAA32881.1| beta-2 tubulin [Arabidopsis thaliana]
 gb|AAA32882.1| beta-3 tubulin [Arabidopsis thaliana]
 dbj|BAA97216.1| tubulin beta-2/beta-3 chain [Arabidopsis thaliana]
 dbj|BAB10838.1| tubulin beta-2/beta-3 chain [Arabidopsis thaliana]
 gb|AAL08267.1| AT5g62690/MRG21_11 [Arabidopsis thaliana]
 gb|AAL31181.1| AT5g62700/MRG21_12 [Arabidopsis thaliana]
 gb|AAL32692.1| tubulin beta-2/beta-3 chain [Arabidopsis thaliana]
 gb|AAL32820.1| tubulin beta-2/beta-3 chain [Arabidopsis thaliana]
 gb|AAM65411.1| tubulin beta-2/beta-3 chain [Arabidopsis thaliana]
 gb|AAM91185.1| tubulin beta-2/beta-3 chain [Arabidopsis thaliana]
 dbj|BAC42096.1| putative tubulin beta-2/beta-3 chain [Arabidopsis thaliana]
 gb|AAO00947.1| tubulin beta-2/beta-3 chain [Arabidopsis thaliana]
 gb|AED97643.1| tubulin beta-2/beta-3 chain [Arabidopsis thaliana]
 gb|AED97644.1| tubulin beta-2/beta-3 chain [Arabidopsis thaliana]
Length=450

 Score =   291 bits (746),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 135/140 (96%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVCAEHGID TGRY GDSDLQLER+NVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDPTGRYTGDSDLQLERINVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGPYGQ FRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSLRSGPYGQTFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCHSLG  526
            RKEAENCDCLQGFQVCHSLG
Sbjct  121  RKEAENCDCLQGFQVCHSLG  140



>tpg|DAA42820.1| TPA: beta tubulin1 [Zea mays]
Length=421

 Score =   290 bits (743),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 136/140 (97%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVCAEHGID TGRY GDSDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDATGRYGGDSDLQLERVNVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGPYG IFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGHIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCHSLG  526
            RKEAENCDCLQGFQVCHSLG
Sbjct  121  RKEAENCDCLQGFQVCHSLG  140



>ref|XP_009150568.1| PREDICTED: tubulin beta-2 chain-like [Brassica rapa]
Length=449

 Score =   291 bits (745),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 135/140 (96%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVCAEHGID TGRY GDSDLQLER+NVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDPTGRYTGDSDLQLERINVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGPYGQ FRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSLRSGPYGQTFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCHSLG  526
            RKEAENCDCLQGFQVCHSLG
Sbjct  121  RKEAENCDCLQGFQVCHSLG  140



>ref|XP_003520939.1| PREDICTED: tubulin beta-2 chain-like [Glycine max]
Length=449

 Score =   291 bits (745),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 135/140 (96%), Positives = 138/140 (99%), Gaps = 0/140 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVCAEHGID TGRY GDS+LQLER+NVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDPTGRYGGDSELQLERINVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCHSLG  526
            RKEAENCDCLQGFQVCHSLG
Sbjct  121  RKEAENCDCLQGFQVCHSLG  140



>ref|XP_002468688.1| hypothetical protein SORBIDRAFT_01g050310 [Sorghum bicolor]
 ref|XP_008667860.1| PREDICTED: uncharacterized protein LOC100273658 isoform X1 [Zea 
mays]
 gb|EER95686.1| hypothetical protein SORBIDRAFT_01g050310 [Sorghum bicolor]
 tpg|DAA42821.1| TPA: beta tubulin1 isoform 1 [Zea mays]
 tpg|DAA42822.1| TPA: beta tubulin1 isoform 2 [Zea mays]
Length=446

 Score =   291 bits (745),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 136/140 (97%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVCAEHGID TGRY GDSDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDATGRYGGDSDLQLERVNVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGPYG IFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGHIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCHSLG  526
            RKEAENCDCLQGFQVCHSLG
Sbjct  121  RKEAENCDCLQGFQVCHSLG  140



>ref|XP_008811481.1| PREDICTED: tubulin beta-8 chain-like [Phoenix dactylifera]
Length=446

 Score =   291 bits (744),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 136/140 (97%), Positives = 136/140 (97%), Gaps = 0/140 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVC EHGID TG YHG SDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCTEHGIDATGGYHGSSDLQLERVNVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCHSLG  526
            RKEAENCDCLQGFQVCHSLG
Sbjct  121  RKEAENCDCLQGFQVCHSLG  140



>ref|XP_004986075.1| PREDICTED: tubulin beta-2 chain-like [Setaria italica]
 emb|CAE52517.1| beta tubulin [Setaria viridis]
Length=448

 Score =   291 bits (744),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 136/140 (97%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVCAEHGID TGRY GDSDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDATGRYGGDSDLQLERVNVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGPYG IFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGNIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCHSLG  526
            RKEAENCDCLQGFQVCHSLG
Sbjct  121  RKEAENCDCLQGFQVCHSLG  140



>ref|XP_003516925.1| PREDICTED: tubulin beta-2 chain-like [Glycine max]
Length=449

 Score =   291 bits (744),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 135/140 (96%), Positives = 138/140 (99%), Gaps = 0/140 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVCAEHGID TGRY GDS+LQLER+NVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDPTGRYGGDSELQLERINVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCHSLG  526
            RKEAENCDCLQGFQVCHSLG
Sbjct  121  RKEAENCDCLQGFQVCHSLG  140



>ref|XP_004302651.1| PREDICTED: tubulin beta-1 chain-like [Fragaria vesca subsp. vesca]
Length=447

 Score =   291 bits (744),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 135/140 (96%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVCAEHGID TGRY GDS LQLER+NVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDGTGRYEGDSPLQLERINVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCHSLG  526
            RKEAENCDCLQGFQVCHSLG
Sbjct  121  RKEAENCDCLQGFQVCHSLG  140



>ref|XP_010483981.1| PREDICTED: tubulin beta-2 chain-like [Camelina sativa]
Length=451

 Score =   291 bits (745),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 135/140 (96%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVCAEHGID TGRY GDSDLQLER+NVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDPTGRYTGDSDLQLERINVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGPYGQ FRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSLRSGPYGQTFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCHSLG  526
            RKEAENCDCLQGFQVCHSLG
Sbjct  121  RKEAENCDCLQGFQVCHSLG  140



>gb|KFK28005.1| hypothetical protein AALP_AA8G459200 [Arabis alpina]
Length=450

 Score =   291 bits (744),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 135/140 (96%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVCAEHGID TGRY GDSDLQLER+NVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDPTGRYVGDSDLQLERINVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGPYGQ FRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSLRSGPYGQTFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCHSLG  526
            RKEAENCDCLQGFQVCHSLG
Sbjct  121  RKEAENCDCLQGFQVCHSLG  140



>ref|XP_006404432.1| hypothetical protein EUTSA_v10010368mg [Eutrema salsugineum]
 ref|XP_006404433.1| hypothetical protein EUTSA_v10010369mg [Eutrema salsugineum]
 dbj|BAJ33671.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ45885.1| hypothetical protein EUTSA_v10010368mg [Eutrema salsugineum]
 gb|ESQ45886.1| hypothetical protein EUTSA_v10010369mg [Eutrema salsugineum]
Length=449

 Score =   291 bits (744),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 135/140 (96%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVCAEHGID TGRY GDSDLQLER+NVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDPTGRYIGDSDLQLERINVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGPYGQ FRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSLRSGPYGQTFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCHSLG  526
            RKEAENCDCLQGFQVCHSLG
Sbjct  121  RKEAENCDCLQGFQVCHSLG  140



>gb|KFK34015.1| hypothetical protein AALP_AA5G090900 [Arabis alpina]
Length=450

 Score =   291 bits (744),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 135/140 (96%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVCAEHGID TGRY GDSDLQLER+NVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDPTGRYVGDSDLQLERINVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGPYGQ FRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSLRSGPYGQTFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCHSLG  526
            RKEAENCDCLQGFQVCHSLG
Sbjct  121  RKEAENCDCLQGFQVCHSLG  140



>sp|Q8H7U1.1|TBB2_ORYSJ RecName: Full=Tubulin beta-2 chain; AltName: Full=Beta-2-tubulin 
[Oryza sativa Japonica Group]
 gb|AAN60482.1| Putative beta tubulin [Oryza sativa Japonica Group]
 gb|ABF93527.1| Tubulin beta-2 chain, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAH01676.1| unnamed protein product [Oryza sativa Japonica Group]
Length=447

 Score =   290 bits (743),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 135/140 (96%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVCAEHGID TGRY GDSDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDATGRYDGDSDLQLERVNVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGPYG IFRPDNFVFGQSGAGNNWAKGHYTEGAELID+VLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGHIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDAVLDVV  120

Query  467  RKEAENCDCLQGFQVCHSLG  526
            RKEAENCDCLQGFQVCHSLG
Sbjct  121  RKEAENCDCLQGFQVCHSLG  140



>gb|AGN95064.1| putative tubulin beta-2-like protein [Physaria fendleri]
Length=450

 Score =   291 bits (744),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 135/140 (96%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVCAEHGID TGRY GDSDLQLER+NVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDPTGRYIGDSDLQLERINVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGPYGQ FRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSLRSGPYGQTFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCHSLG  526
            RKEAENCDCLQGFQVCHSLG
Sbjct  121  RKEAENCDCLQGFQVCHSLG  140



>sp|P37392.1|TBB1_LUPAL RecName: Full=Tubulin beta-1 chain; AltName: Full=Beta-1-tubulin 
[Lupinus albus]
 emb|CAA49736.1| Beta tubulin 1 [Lupinus albus]
Length=447

 Score =   290 bits (743),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 135/140 (96%), Positives = 138/140 (99%), Gaps = 0/140 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVCAEHGID TGRY GD++LQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDSTGRYGGDNELQLERVNVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCHSLG  526
            RKEAENCDCLQGFQVCHSLG
Sbjct  121  RKEAENCDCLQGFQVCHSLG  140



>ref|XP_009396166.1| PREDICTED: tubulin beta-1 chain [Musa acuminata subsp. malaccensis]
Length=446

 Score =   290 bits (743),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 135/140 (96%), Positives = 138/140 (99%), Gaps = 0/140 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVCAEHGID TGRY GD+DLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDATGRYGGDNDLQLERVNVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELID+VLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDAVLDVV  120

Query  467  RKEAENCDCLQGFQVCHSLG  526
            RKEAENCDCLQGFQVCHSLG
Sbjct  121  RKEAENCDCLQGFQVCHSLG  140



>ref|XP_004308083.1| PREDICTED: tubulin beta-1 chain [Fragaria vesca subsp. vesca]
Length=447

 Score =   290 bits (743),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 135/140 (96%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVCAEHGID TGRY GD +LQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDSTGRYGGDDELQLERVNVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCHSLG  526
            RKEAENCDCLQGFQVCHSLG
Sbjct  121  RKEAENCDCLQGFQVCHSLG  140



>gb|AAY43798.1| tubulin [Gossypium hirsutum]
Length=445

 Score =   290 bits (742),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 134/140 (96%), Positives = 138/140 (99%), Gaps = 0/140 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVCAEHGID TGR+ GDS+LQLER+NVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDSTGRHGGDSELQLERINVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCHSLG  526
            RKEAENCDCLQGFQVCHSLG
Sbjct  121  RKEAENCDCLQGFQVCHSLG  140



>emb|CAM58986.1| beta tubulin 8 [Hordeum vulgare subsp. vulgare]
 dbj|BAK00571.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gb|EMS50212.1| Tubulin beta-2 chain [Triticum urartu]
Length=447

 Score =   290 bits (742),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 135/140 (96%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVCAEHGID TGRY GD+DLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDPTGRYAGDTDLQLERVNVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGPYG IFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGGIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCHSLG  526
            RKEAENCDCLQGFQVCHSLG
Sbjct  121  RKEAENCDCLQGFQVCHSLG  140



>gb|AGV54374.1| tubulin beta-2 chain-like protein [Phaseolus vulgaris]
Length=422

 Score =   289 bits (739),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 135/140 (96%), Positives = 138/140 (99%), Gaps = 0/140 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVCAEHGID TGRY GDS+LQLER+NVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDPTGRYDGDSELQLERINVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCHSLG  526
            RKEAENCDCLQGFQVCHSLG
Sbjct  121  RKEAENCDCLQGFQVCHSLG  140



>gb|EMT08428.1| Tubulin beta-1 chain [Aegilops tauschii]
Length=448

 Score =   290 bits (741),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 135/140 (96%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVCAEHGID TGRY GD+DLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDPTGRYAGDTDLQLERVNVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGPYG IFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGGIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCHSLG  526
            RKEAENCDCLQGFQVCHSLG
Sbjct  121  RKEAENCDCLQGFQVCHSLG  140



>gb|AFR42136.1| beta-tubulin, partial [Populus trichocarpa]
 gb|AFR42138.1| beta-tubulin, partial [Populus trichocarpa]
 gb|AFR42139.1| beta-tubulin, partial [Populus trichocarpa]
 gb|AFR42140.1| beta-tubulin, partial [Populus alba]
 gb|AFR42141.1| beta-tubulin, partial [Populus alba]
 gb|AFR42142.1| beta-tubulin, partial [Populus alba]
 gb|AFR42143.1| beta-tubulin, partial [Populus alba]
 gb|AFR42144.1| beta-tubulin, partial [Populus alba]
 gb|AFR42146.1| beta-tubulin, partial [Populus alba]
 gb|AFR42147.1| beta-tubulin, partial [Populus fremontii]
 gb|AFR42148.1| beta-tubulin, partial [Populus fremontii]
 gb|AFR42149.1| beta-tubulin, partial [Populus fremontii]
 gb|AFR42150.1| beta-tubulin, partial [Populus fremontii]
 gb|AFR42151.1| beta-tubulin, partial [Populus fremontii]
 gb|AFR42152.1| beta-tubulin, partial [Populus fremontii]
 gb|AFR42153.1| beta-tubulin, partial [Populus fremontii]
 gb|AFR42154.1| beta-tubulin, partial [Populus fremontii]
 gb|AFR42155.1| beta-tubulin, partial [Populus fremontii]
 gb|AFR42158.1| beta-tubulin, partial [Populus fremontii]
 gb|AFR42159.1| beta-tubulin, partial [Populus fremontii]
 gb|AFR42161.1| beta-tubulin, partial [Populus nigra]
 gb|AFR42162.1| beta-tubulin, partial [Populus nigra]
 gb|AFR42163.1| beta-tubulin, partial [Populus nigra]
 gb|AFR42165.1| beta-tubulin, partial [Populus nigra]
 gb|AFR42166.1| beta-tubulin, partial [Populus nigra]
 gb|AFR42168.1| beta-tubulin, partial [Populus nigra]
 gb|AFR42169.1| beta-tubulin, partial [Populus nigra]
 gb|AFR42170.1| beta-tubulin, partial [Populus nigra]
 gb|AFR42171.1| beta-tubulin, partial [Populus nigra]
 gb|AFR42172.1| beta-tubulin, partial [Populus nigra]
 gb|AFR42173.1| beta-tubulin, partial [Populus nigra]
 gb|AFR42174.1| beta-tubulin, partial [Populus nigra]
Length=138

 Score =   279 bits (713),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 131/138 (95%), Positives = 135/138 (98%), Gaps = 0/138 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIG+KFWEVVCAEHGID TG+Y G SDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGSKFWEVVCAEHGIDPTGKYTGSSDLQLERVNVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+R+GPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCHS  520
            RKEAENCDCLQGFQVCHS
Sbjct  121  RKEAENCDCLQGFQVCHS  138



>gb|KHG21113.1| Tubulin beta-9 chain [Gossypium arboreum]
Length=221

 Score =   282 bits (721),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 129/137 (94%), Positives = 135/137 (99%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREI+H+QGGQCGNQIGAKFWEVVCAEHGID TGRY GDS+LQLER+NVYYNEASCGRFV
Sbjct  1    MREIVHVQGGQCGNQIGAKFWEVVCAEHGIDSTGRYQGDSELQLERINVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCH  517
            RKE+ENCDCLQGFQVCH
Sbjct  121  RKESENCDCLQGFQVCH  137



>ref|XP_010520236.1| PREDICTED: tubulin beta-2 chain-like [Tarenaya hassleriana]
Length=448

 Score =   290 bits (741),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 135/140 (96%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVCAEHGID TGRY GDSDLQLER+NVYYNEA+ GRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDPTGRYQGDSDLQLERINVYYNEATHGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCHSLG  526
            RKEAENCDCLQGFQVCHSLG
Sbjct  121  RKEAENCDCLQGFQVCHSLG  140



>gb|ABY86654.1| beta-tubulin 2 [Gossypium hirsutum]
 gb|KJB55793.1| hypothetical protein B456_009G094600 [Gossypium raimondii]
Length=446

 Score =   289 bits (740),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 135/140 (96%), Positives = 136/140 (97%), Gaps = 0/140 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVCAEHGID TGRY GD DLQLER+NVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDATGRYQGDLDLQLERINVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDSIRSGP GQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSIRSGPVGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCHSLG  526
            RKEAENCDCLQGFQVCHSLG
Sbjct  121  RKEAENCDCLQGFQVCHSLG  140



>gb|AGQ43300.1| TUBB3, partial [Oryza nivara]
 gb|AGQ43301.1| TUBB3, partial [Oryza rufipogon]
 gb|AGQ43302.1| TUBB3, partial [Oryza glumipatula]
 gb|AGQ43303.1| TUBB3, partial [Oryza longistaminata]
 gb|AGQ43304.1| TUBB3, partial [Oryza barthii]
 gb|AGQ43305.1| TUBB3, partial [Oryza meridionalis]
 gb|AGQ43306.1| TUBB3, partial [Oryza glaberrima]
 gb|AGQ43307.1| TUBB3, partial [Oryza sativa Indica Group]
 gb|AGQ43308.1| TUBB3, partial [Oryza sativa Japonica Group]
 gb|AGQ43309.1| TUBB3, partial [Oryza punctata]
 gb|AGQ43310.1| TUBB3, partial [Oryza officinalis]
 gb|AGQ43311.1| TUBB3, partial [Oryza australiensis]
Length=145

 Score =   278 bits (711),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 131/140 (94%), Positives = 136/140 (97%), Gaps = 0/140 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEV+C EHGID TG+Y GDSDLQLER+NVYYNEAS GR+V
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVICDEHGIDHTGKYSGDSDLQLERINVYYNEASGGRYV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCHSLG  526
            RKEAENCDCLQGFQVCHSLG
Sbjct  121  RKEAENCDCLQGFQVCHSLG  140



>gb|KJB36870.1| hypothetical protein B456_006G179900 [Gossypium raimondii]
Length=445

 Score =   288 bits (738),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 131/137 (96%), Positives = 136/137 (99%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWE+VCAEHGID TG+YHGDSDLQLER+NVYYNEASCGR+V
Sbjct  1    MREILHIQGGQCGNQIGAKFWEMVCAEHGIDSTGKYHGDSDLQLERINVYYNEASCGRYV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCH  517
            RKEAENCDCLQGFQVCH
Sbjct  121  RKEAENCDCLQGFQVCH  137



>ref|XP_007040195.1| Tubulin beta 8 [Theobroma cacao]
 gb|EOY24696.1| Tubulin beta 8 [Theobroma cacao]
Length=445

 Score =   288 bits (737),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 130/137 (95%), Positives = 135/137 (99%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILH+QGGQCGNQIGAKFWEVVC EHGID TGRYHGDS+LQLER+NVYYNEASCGRFV
Sbjct  1    MREILHVQGGQCGNQIGAKFWEVVCTEHGIDSTGRYHGDSELQLERINVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRA+LMDLEPGTMDS+RSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAILMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCH  517
            RKEAENCDCLQGFQVCH
Sbjct  121  RKEAENCDCLQGFQVCH  137



>gb|AFR42167.1| beta-tubulin, partial [Populus nigra]
Length=137

 Score =   277 bits (708),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 130/137 (95%), Positives = 134/137 (98%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIG+KFWEVVCAEHGID TG+Y G SDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGSKFWEVVCAEHGIDPTGKYTGSSDLQLERVNVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+R+GPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCH  517
            RKEAENCDCLQGFQVCH
Sbjct  121  RKEAENCDCLQGFQVCH  137



>ref|XP_010530505.1| PREDICTED: tubulin beta-8 chain, partial [Tarenaya hassleriana]
Length=442

 Score =   287 bits (735),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 132/137 (96%), Positives = 135/137 (99%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVCAEHGID TG+Y GD+DLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDSTGKYKGDNDLQLERVNVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCH  517
            RKEAENCDCLQGFQVCH
Sbjct  121  RKEAENCDCLQGFQVCH  137



>emb|CAL46265.1| beta-tubulin 6 [Oryza sativa Indica Group]
Length=138

 Score =   276 bits (707),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 131/138 (95%), Positives = 134/138 (97%), Gaps = 0/138 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIG+KFWEVVC EHGID TGRY G SDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGSKFWEVVCDEHGIDPTGRYAGTSDLQLERVNVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+R+GPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCHS  520
            RKEAENCDCLQGFQVCHS
Sbjct  121  RKEAENCDCLQGFQVCHS  138



>gb|ABY86662.1| beta-tubulin 16 [Gossypium hirsutum]
Length=445

 Score =   287 bits (735),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 131/137 (96%), Positives = 135/137 (99%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVCAEHGID TG+YHGDSDLQLER+NVYYNEASCGR+V
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDSTGKYHGDSDLQLERINVYYNEASCGRYV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMD +RSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDGVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCH  517
            RKEAENCDCLQGFQVCH
Sbjct  121  RKEAENCDCLQGFQVCH  137



>ref|XP_002267380.1| PREDICTED: tubulin beta-1 chain [Vitis vinifera]
Length=449

 Score =   287 bits (735),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 131/137 (96%), Positives = 135/137 (99%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILH+QGGQCGNQIGAKFWEVVCAEHGID TGRY GD++LQLERVNVYYNEASCGRFV
Sbjct  1    MREILHVQGGQCGNQIGAKFWEVVCAEHGIDSTGRYQGDTELQLERVNVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCH  517
            RKEAENCDCLQGFQVCH
Sbjct  121  RKEAENCDCLQGFQVCH  137



>ref|XP_007038700.1| Tubulin beta 8 [Theobroma cacao]
 gb|EOY23201.1| Tubulin beta 8 [Theobroma cacao]
Length=448

 Score =   287 bits (735),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 132/137 (96%), Positives = 135/137 (99%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVCAEHGID TGRY GD++LQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDSTGRYQGDNELQLERVNVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCH  517
            RKEAENCDCLQGFQVCH
Sbjct  121  RKEAENCDCLQGFQVCH  137



>ref|XP_003592284.1| Tubulin beta chain [Medicago truncatula]
 gb|AES62535.1| tubulin beta-1 chain [Medicago truncatula]
Length=449

 Score =   287 bits (735),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 132/137 (96%), Positives = 135/137 (99%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVCAEHGID TGRY G++DLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDSTGRYQGNNDLQLERVNVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCH  517
            RKEAENCDCLQGFQVCH
Sbjct  121  RKEAENCDCLQGFQVCH  137



>ref|XP_009803077.1| PREDICTED: tubulin beta-1 chain-like [Nicotiana sylvestris]
Length=447

 Score =   287 bits (734),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 131/137 (96%), Positives = 135/137 (99%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEV+CAEHGID TGRY GD+DLQLER+NVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVICAEHGIDSTGRYQGDNDLQLERLNVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCH  517
            RKEAENCDCLQGFQVCH
Sbjct  121  RKEAENCDCLQGFQVCH  137



>ref|XP_010035138.1| PREDICTED: tubulin beta-1 chain [Eucalyptus grandis]
 gb|KCW46432.1| hypothetical protein EUGRSUZ_K00264 [Eucalyptus grandis]
Length=447

 Score =   287 bits (734),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 132/137 (96%), Positives = 135/137 (99%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVCAEHGID TGRY G++DLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDSTGRYQGNNDLQLERVNVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCH  517
            RKEAENCDCLQGFQVCH
Sbjct  121  RKEAENCDCLQGFQVCH  137



>ref|XP_004496560.1| PREDICTED: tubulin beta-1 chain-like [Cicer arietinum]
Length=448

 Score =   287 bits (734),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 132/137 (96%), Positives = 135/137 (99%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVCAEHGID TGRY G++DLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDSTGRYQGNNDLQLERVNVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCH  517
            RKEAENCDCLQGFQVCH
Sbjct  121  RKEAENCDCLQGFQVCH  137



>gb|AAK96884.1| beta tubulin [Arabidopsis thaliana]
 gb|AAM10035.1| beta tubulin [Arabidopsis thaliana]
Length=449

 Score =   287 bits (734),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 132/137 (96%), Positives = 134/137 (98%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVCAEHGID TGRY G+ DLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDSTGRYQGEKDLQLERVNVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCH  517
            RKEAENCDCLQGFQVCH
Sbjct  121  RKEAENCDCLQGFQVCH  137



>ref|XP_006287738.1| hypothetical protein CARUB_v10000948mg [Capsella rubella]
 ref|XP_010421190.1| PREDICTED: tubulin beta-8 chain [Camelina sativa]
 ref|XP_010454670.1| PREDICTED: tubulin beta-8 chain [Camelina sativa]
 gb|EOA20636.1| hypothetical protein CARUB_v10000948mg [Capsella rubella]
Length=449

 Score =   287 bits (734),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 132/137 (96%), Positives = 135/137 (99%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVCAEHGID TGRY G++DLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDSTGRYQGENDLQLERVNVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCH  517
            RKEAENCDCLQGFQVCH
Sbjct  121  RKEAENCDCLQGFQVCH  137



>ref|NP_568437.1| tubulin beta-8 chain [Arabidopsis thaliana]
 ref|NP_001190373.1| tubulin beta-8 chain [Arabidopsis thaliana]
 sp|P29516.2|TBB8_ARATH RecName: Full=Tubulin beta-8 chain; AltName: Full=Beta-8-tubulin 
[Arabidopsis thaliana]
 dbj|BAB10059.1| beta tubulin [Arabidopsis thaliana]
 gb|AED93223.1| tubulin beta-8 chain [Arabidopsis thaliana]
 gb|AED93224.1| tubulin beta-8 chain [Arabidopsis thaliana]
Length=449

 Score =   287 bits (734),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 132/137 (96%), Positives = 135/137 (99%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVCAEHGID TGRY G++DLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDSTGRYQGENDLQLERVNVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCH  517
            RKEAENCDCLQGFQVCH
Sbjct  121  RKEAENCDCLQGFQVCH  137



>gb|KHG02753.1| Tubulin beta-2/beta-3 chain -like protein [Gossypium arboreum]
Length=237

 Score =   280 bits (715),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 131/137 (96%), Positives = 133/137 (97%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVC+EHGID TGRY GD DLQLER+NVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCSEHGIDPTGRYQGDLDLQLERINVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDSIRSGP GQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSIRSGPVGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCH  517
            RKEAENCDCLQGFQVCH
Sbjct  121  RKEAENCDCLQGFQVCH  137



>gb|EYU19549.1| hypothetical protein MIMGU_mgv1a006353mg [Erythranthe guttata]
Length=447

 Score =   286 bits (733),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 131/137 (96%), Positives = 134/137 (98%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQ GQCGNQIGAKFWEVVCAEHGID TGRY GD+DLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQAGQCGNQIGAKFWEVVCAEHGIDSTGRYSGDTDLQLERVNVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSV+DVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVMDVV  120

Query  467  RKEAENCDCLQGFQVCH  517
            RKEAENCDCLQGFQVCH
Sbjct  121  RKEAENCDCLQGFQVCH  137



>ref|XP_002872076.1| tubulin beta-8 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48335.1| tubulin beta-8 [Arabidopsis lyrata subsp. lyrata]
Length=449

 Score =   286 bits (733),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 131/137 (96%), Positives = 135/137 (99%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVCAEHGID TGRY G++DLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDSTGRYQGENDLQLERVNVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGPYGQIFRPDNF+FGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFIFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCH  517
            RKEAENCDCLQGFQVCH
Sbjct  121  RKEAENCDCLQGFQVCH  137



>ref|XP_009767718.1| PREDICTED: tubulin beta-1 chain [Nicotiana sylvestris]
Length=447

 Score =   286 bits (733),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 131/137 (96%), Positives = 135/137 (99%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEV+CAEHGID TGRY GD+DLQLER+NVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVICAEHGIDSTGRYAGDNDLQLERLNVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCH  517
            RKEAENCDCLQGFQVCH
Sbjct  121  RKEAENCDCLQGFQVCH  137



>ref|XP_009596463.1| PREDICTED: tubulin beta-1 chain [Nicotiana tomentosiformis]
Length=447

 Score =   286 bits (733),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 131/137 (96%), Positives = 135/137 (99%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEV+CAEHGID TGRY GD+DLQLER+NVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVICAEHGIDSTGRYAGDNDLQLERLNVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCH  517
            RKEAENCDCLQGFQVCH
Sbjct  121  RKEAENCDCLQGFQVCH  137



>gb|KHN27008.1| Tubulin beta-1 chain [Glycine soja]
Length=448

 Score =   286 bits (732),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 135/141 (96%), Positives = 138/141 (98%), Gaps = 1/141 (1%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGR-F  283
            MREILHIQGGQCGNQIGAKFWEVVCAEHGID TGRY GDS+LQLER+NVYYNEASCGR F
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDPTGRYGGDSELQLERINVYYNEASCGRRF  60

Query  284  VPRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDV  463
            VPRAVLMDLEPGTMDS+RSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDV
Sbjct  61   VPRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDV  120

Query  464  VRKEAENCDCLQGFQVCHSLG  526
            VRKEAENCDCLQGFQVCHSLG
Sbjct  121  VRKEAENCDCLQGFQVCHSLG  141



>sp|P18025.1|TBB1_MAIZE RecName: Full=Tubulin beta-1 chain; AltName: Full=Beta-1-tubulin 
[Zea mays]
 emb|CAA37060.1| beta 1 tubulin [Zea mays]
Length=446

 Score =   286 bits (732),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 135/140 (96%), Positives = 136/140 (97%), Gaps = 0/140 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVCAEHGID TGRY GDSDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDATGRYGGDSDLQLERVNVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGPYG IFRPDNFVFGQSGAGNN AKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGHIFRPDNFVFGQSGAGNNSAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCHSLG  526
            RKEAENCDCLQGFQVCHSLG
Sbjct  121  RKEAENCDCLQGFQVCHSLG  140



>ref|XP_004970293.1| PREDICTED: LOW QUALITY PROTEIN: tubulin beta-4 chain-like [Setaria 
italica]
Length=498

 Score =   288 bits (736),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 132/138 (96%), Positives = 135/138 (98%), Gaps = 0/138 (0%)
 Frame = +2

Query  104  KMREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRF  283
            KMREILHIQGGQCGNQIGAKFWEVVC EHGID TGRY G+SDLQLERVNVYYNEASCGRF
Sbjct  50   KMREILHIQGGQCGNQIGAKFWEVVCDEHGIDPTGRYTGNSDLQLERVNVYYNEASCGRF  109

Query  284  VPRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDV  463
            VPRAVLMDLEPGTMDS+R+GPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDV
Sbjct  110  VPRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDV  169

Query  464  VRKEAENCDCLQGFQVCH  517
            VRKEAENCDCLQGFQVCH
Sbjct  170  VRKEAENCDCLQGFQVCH  187



>ref|NP_001167651.1| uncharacterized protein LOC100381281 [Zea mays]
 ref|XP_008673428.1| PREDICTED: tubulin beta-6 chain isoform X2 [Zea mays]
 gb|ACF85464.1| unknown [Zea mays]
 tpg|DAA57203.1| TPA: beta tubulin6 isoform 1 [Zea mays]
 tpg|DAA57204.1| TPA: beta tubulin6 isoform 2 [Zea mays]
Length=496

 Score =   288 bits (736),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 132/138 (96%), Positives = 135/138 (98%), Gaps = 0/138 (0%)
 Frame = +2

Query  104  KMREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRF  283
            KMREILHIQGGQCGNQIGAKFWEVVC EHGID TGRY G+SDLQLERVNVYYNEASCGRF
Sbjct  50   KMREILHIQGGQCGNQIGAKFWEVVCDEHGIDPTGRYTGNSDLQLERVNVYYNEASCGRF  109

Query  284  VPRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDV  463
            VPRAVLMDLEPGTMDS+R+GPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDV
Sbjct  110  VPRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDV  169

Query  464  VRKEAENCDCLQGFQVCH  517
            VRKEAENCDCLQGFQVCH
Sbjct  170  VRKEAENCDCLQGFQVCH  187



>ref|XP_009141007.1| PREDICTED: tubulin beta-7 chain-like [Brassica rapa]
Length=449

 Score =   286 bits (732),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 131/137 (96%), Positives = 135/137 (99%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIG+KFWEVVCAEHGID TGRY GDSDLQL+RVNVYYNEASCGR+V
Sbjct  1    MREILHIQGGQCGNQIGSKFWEVVCAEHGIDQTGRYQGDSDLQLDRVNVYYNEASCGRYV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCH  517
            RKEAENCDCLQGFQVCH
Sbjct  121  RKEAENCDCLQGFQVCH  137



>gb|AGH08238.1| beta-tubulin 2 [Salix arbutifolia]
Length=451

 Score =   286 bits (732),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 131/137 (96%), Positives = 134/137 (98%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVCAEHGID TGRY GDS LQ+ER+NVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDSTGRYQGDSPLQIERINVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCH  517
            RKEAENCDCLQGFQVCH
Sbjct  121  RKEAENCDCLQGFQVCH  137



>emb|CDY67078.1| BnaAnng23580D, partial [Brassica napus]
Length=394

 Score =   284 bits (727),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 131/137 (96%), Positives = 134/137 (98%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVCAEHGID TGRY GDSDLQLER+NVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDPTGRYTGDSDLQLERINVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGP+GQ FRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSLRSGPFGQTFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCH  517
            RKEAENCDCLQGFQVCH
Sbjct  121  RKEAENCDCLQGFQVCH  137



>ref|XP_011032195.1| PREDICTED: tubulin beta-2 chain-like [Populus euphratica]
Length=450

 Score =   286 bits (732),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 131/137 (96%), Positives = 134/137 (98%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVCAEHGID TGRY GDS LQLER+NVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDSTGRYQGDSPLQLERINVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PR+VLMDLEPGTMDS+RSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRSVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCH  517
            RKEAENCDCLQGFQVCH
Sbjct  121  RKEAENCDCLQGFQVCH  137



>gb|KFK27675.1| hypothetical protein AALP_AA8G414100 [Arabis alpina]
Length=449

 Score =   286 bits (731),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 131/137 (96%), Positives = 135/137 (99%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVCAEHGID TGRY G++DLQ+ERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDSTGRYQGENDLQIERVNVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCH  517
            RKEAENCDCLQGFQVCH
Sbjct  121  RKEAENCDCLQGFQVCH  137



>ref|XP_007026823.1| Tubulin beta 8 [Theobroma cacao]
 gb|EOY07325.1| Tubulin beta 8 [Theobroma cacao]
Length=444

 Score =   286 bits (731),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 130/137 (95%), Positives = 135/137 (99%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVC EHGID TG+Y+GDSDLQLER+NVYYNEASCGR+V
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCTEHGIDSTGKYNGDSDLQLERINVYYNEASCGRYV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCH  517
            RKEAENCDCLQGFQVCH
Sbjct  121  RKEAENCDCLQGFQVCH  137



>emb|CDY51360.1| BnaA04g28540D [Brassica napus]
 emb|CDX97877.1| BnaC04g40620D [Brassica napus]
Length=449

 Score =   286 bits (731),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 131/137 (96%), Positives = 135/137 (99%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIG+KFWEVVCAEHGID TGRY GDSDLQL+RVNVYYNEASCGR+V
Sbjct  1    MREILHIQGGQCGNQIGSKFWEVVCAEHGIDQTGRYQGDSDLQLDRVNVYYNEASCGRYV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCH  517
            RKEAENCDCLQGFQVCH
Sbjct  121  RKEAENCDCLQGFQVCH  137



>ref|XP_006294210.1| hypothetical protein CARUB_v10023206mg [Capsella rubella]
 gb|EOA27108.1| hypothetical protein CARUB_v10023206mg [Capsella rubella]
Length=449

 Score =   286 bits (731),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 131/137 (96%), Positives = 135/137 (99%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIG+KFWEVVCAEHGID TGRY GDS+LQLERVNVYYNEASCGR+V
Sbjct  1    MREILHIQGGQCGNQIGSKFWEVVCAEHGIDQTGRYQGDSELQLERVNVYYNEASCGRYV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCH  517
            RKEAENCDCLQGFQVCH
Sbjct  121  RKEAENCDCLQGFQVCH  137



>emb|CBI32808.3| unnamed protein product [Vitis vinifera]
Length=276

 Score =   280 bits (716),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 130/138 (94%), Positives = 134/138 (97%), Gaps = 0/138 (0%)
 Frame = +2

Query  104  KMREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRF  283
            KMREILH+QGGQCGNQIG+KFWEVVC EHGID TGRY G SDLQLERVNVYYNEASCGRF
Sbjct  21   KMREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRF  80

Query  284  VPRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDV  463
            VPRAVLMDLEPGTMDS+R+GPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDV
Sbjct  81   VPRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDV  140

Query  464  VRKEAENCDCLQGFQVCH  517
            VRKEAENCDCLQGFQVCH
Sbjct  141  VRKEAENCDCLQGFQVCH  158



>ref|XP_006387289.1| hypothetical protein POPTR_1327s00200g [Populus trichocarpa]
 gb|ERP46203.1| hypothetical protein POPTR_1327s00200g [Populus trichocarpa]
Length=273

 Score =   280 bits (715),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 130/137 (95%), Positives = 134/137 (98%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIG+KFWEVVCAEHGID TG+Y G SDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGSKFWEVVCAEHGIDPTGKYTGSSDLQLERVNVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+R+GPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCH  517
            RKEAENCDCLQGFQVCH
Sbjct  121  RKEAENCDCLQGFQVCH  137



>ref|XP_003559023.1| PREDICTED: tubulin beta-2 chain [Brachypodium distachyon]
Length=448

 Score =   286 bits (731),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 135/141 (96%), Positives = 137/141 (97%), Gaps = 1/141 (1%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDS-DLQLERVNVYYNEASCGRF  283
            MREILHIQGGQCGNQIGAKFWEVVCAEHGID TGRY GD+ DLQLERVNVYYNEASCGRF
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDATGRYGGDTPDLQLERVNVYYNEASCGRF  60

Query  284  VPRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDV  463
            VPRAVLMDLEPGTMDS+RSGPYG IFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDV
Sbjct  61   VPRAVLMDLEPGTMDSVRSGPYGHIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDV  120

Query  464  VRKEAENCDCLQGFQVCHSLG  526
            VRKEAENCDCLQGFQVCHSLG
Sbjct  121  VRKEAENCDCLQGFQVCHSLG  141



>ref|XP_008370041.1| PREDICTED: tubulin beta chain [Malus domestica]
 ref|XP_009370237.1| PREDICTED: tubulin beta chain [Pyrus x bretschneideri]
 ref|XP_009370255.1| PREDICTED: tubulin beta chain [Pyrus x bretschneideri]
Length=447

 Score =   285 bits (730),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 131/137 (96%), Positives = 135/137 (99%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVCAEHGID TGRY GDS+LQLER+NVYYNEASCGR+V
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDGTGRYEGDSELQLERINVYYNEASCGRYV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCH  517
            RKEAENCDCLQGFQVCH
Sbjct  121  RKEAENCDCLQGFQVCH  137



>ref|XP_010535429.1| PREDICTED: tubulin beta-2 chain [Tarenaya hassleriana]
Length=449

 Score =   285 bits (730),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 131/137 (96%), Positives = 134/137 (98%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEV+CAEHGID TGRY GDSDLQ ER+NVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVICAEHGIDPTGRYQGDSDLQRERINVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSLRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCH  517
            RKEAENCDCLQGFQVCH
Sbjct  121  RKEAENCDCLQGFQVCH  137



>gb|KJB20686.1| hypothetical protein B456_003G159400 [Gossypium raimondii]
Length=445

 Score =   285 bits (729),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 129/137 (94%), Positives = 135/137 (99%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREI+H+QGGQCGNQIGAKFWEVVCAEHGID TGRY GDS+LQLER+NVYYNEASCGRFV
Sbjct  1    MREIVHVQGGQCGNQIGAKFWEVVCAEHGIDSTGRYQGDSELQLERINVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCH  517
            RKE+ENCDCLQGFQVCH
Sbjct  121  RKESENCDCLQGFQVCH  137



>ref|XP_007143420.1| hypothetical protein PHAVU_007G070800g [Phaseolus vulgaris]
 gb|ESW15414.1| hypothetical protein PHAVU_007G070800g [Phaseolus vulgaris]
Length=449

 Score =   285 bits (730),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 131/137 (96%), Positives = 135/137 (99%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVCAEHGID TGRY G+++LQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDSTGRYQGNNELQLERVNVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCH  517
            RKEAENCDCLQGFQVCH
Sbjct  121  RKEAENCDCLQGFQVCH  137



>ref|XP_007205196.1| hypothetical protein PRUPE_ppa005693mg [Prunus persica]
 ref|XP_008239841.1| PREDICTED: tubulin beta chain-like [Prunus mume]
 gb|EMJ06395.1| hypothetical protein PRUPE_ppa005693mg [Prunus persica]
Length=447

 Score =   285 bits (729),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 131/137 (96%), Positives = 135/137 (99%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVCAEHGID TGRY GDS+LQLER+NVYYNEASCGR+V
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDGTGRYEGDSELQLERINVYYNEASCGRYV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCH  517
            RKEAENCDCLQGFQVCH
Sbjct  121  RKEAENCDCLQGFQVCH  137



>gb|KHG11026.1| Tubulin beta-8 chain -like protein [Gossypium arboreum]
Length=246

 Score =   278 bits (711),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 131/137 (96%), Positives = 133/137 (97%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVCAEHGID TGRY G+ DLQLER+NVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDATGRYQGNLDLQLERINVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDSIRSGP GQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSIRSGPVGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCH  517
            RKEAENCDCLQGFQVCH
Sbjct  121  RKEAENCDCLQGFQVCH  137



>gb|AFR42164.1| beta-tubulin, partial [Populus nigra]
Length=136

 Score =   274 bits (701),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 129/136 (95%), Positives = 133/136 (98%), Gaps = 0/136 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIG+KFWEVVCAEHGID TG+Y G SDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGSKFWEVVCAEHGIDPTGKYTGSSDLQLERVNVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+R+GPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVC  514
            RKEAENCDCLQGFQVC
Sbjct  121  RKEAENCDCLQGFQVC  136



>gb|AGE44289.1| beta-tubulin [Dimocarpus longan]
Length=446

 Score =   285 bits (729),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 131/137 (96%), Positives = 134/137 (98%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVCAEHGID TGRY G ++LQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDSTGRYQGTNELQLERVNVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCH  517
            RKEAENCDCLQGFQVCH
Sbjct  121  RKEAENCDCLQGFQVCH  137



>ref|XP_006339000.1| PREDICTED: tubulin beta-8 chain-like [Solanum tuberosum]
Length=447

 Score =   285 bits (729),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 131/137 (96%), Positives = 134/137 (98%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVCAEHGID TGRY GD+DLQLER+NVYYNEA+CGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDSTGRYAGDADLQLERINVYYNEATCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDSIRSG YGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSIRSGTYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCH  517
            RKEAENCDCLQGFQVCH
Sbjct  121  RKEAENCDCLQGFQVCH  137



>ref|XP_004234396.1| PREDICTED: tubulin beta-1 chain [Solanum lycopersicum]
Length=445

 Score =   285 bits (728),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 131/137 (96%), Positives = 134/137 (98%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVCAEHGID TGRY G+SDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDSTGRYKGESDLQLERVNVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSV+DVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVMDVV  120

Query  467  RKEAENCDCLQGFQVCH  517
            RKEAEN DCLQGFQVCH
Sbjct  121  RKEAENSDCLQGFQVCH  137



>emb|CDY53366.1| BnaC04g54460D [Brassica napus]
Length=449

 Score =   285 bits (728),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 131/137 (96%), Positives = 134/137 (98%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIG+KFWEVVCAEHGID TGRY GDSDLQLERVNVYYNEASCG +V
Sbjct  1    MREILHIQGGQCGNQIGSKFWEVVCAEHGIDQTGRYQGDSDLQLERVNVYYNEASCGMYV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCH  517
            RKEAENCDCLQGFQVCH
Sbjct  121  RKEAENCDCLQGFQVCH  137



>gb|KJB21246.1| hypothetical protein B456_003G126300 [Gossypium raimondii]
Length=388

 Score =   283 bits (723),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 131/137 (96%), Positives = 133/137 (97%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVC+EHGID TGRY GD DLQLER+NVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCSEHGIDPTGRYQGDLDLQLERINVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDSIRSGP GQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSIRSGPVGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCH  517
            RKEAENCDCLQGFQVCH
Sbjct  121  RKEAENCDCLQGFQVCH  137



>ref|NP_001274811.1| uncharacterized protein LOC102577679 [Solanum tuberosum]
 gb|ABA46773.1| unknown [Solanum tuberosum]
Length=447

 Score =   285 bits (728),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 130/137 (95%), Positives = 134/137 (98%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEV+CAEHGID +GRY GDSDLQLER+NVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVICAEHGIDSSGRYQGDSDLQLERLNVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCH  517
            RKEAENCDCLQGFQV H
Sbjct  121  RKEAENCDCLQGFQVAH  137



>ref|XP_004240734.1| PREDICTED: tubulin beta-1 chain [Solanum lycopersicum]
Length=447

 Score =   285 bits (728),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 130/137 (95%), Positives = 134/137 (98%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEV+CAEHGID TGRY GDSDLQLER+NVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVICAEHGIDSTGRYQGDSDLQLERLNVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGP+GQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCH  517
            RKEAENCDCLQGFQV H
Sbjct  121  RKEAENCDCLQGFQVAH  137



>gb|AAA32886.1| beta-8 tubulin [Arabidopsis thaliana]
Length=449

 Score =   285 bits (728),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 131/137 (96%), Positives = 134/137 (98%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVCAEHGID TGRY G++DLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDSTGRYQGENDLQLERVNVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCH  517
            RKE ENCDCLQGFQVCH
Sbjct  121  RKERENCDCLQGFQVCH  137



>gb|AGV54311.1| tubulin beta chain [Phaseolus vulgaris]
Length=449

 Score =   285 bits (728),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 131/137 (96%), Positives = 135/137 (99%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVCAEHGID TGRY G+++LQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDSTGRYQGNNELQLERVNVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCH  517
            RKEAENCDCLQGFQVCH
Sbjct  121  RKEAENCDCLQGFQVCH  137



>gb|EEC71666.1| hypothetical protein OsI_04129 [Oryza sativa Indica Group]
Length=496

 Score =   286 bits (732),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 132/138 (96%), Positives = 135/138 (98%), Gaps = 0/138 (0%)
 Frame = +2

Query  104  KMREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRF  283
            KMREILHIQGGQCGNQIGAKFWEVVC EHGID TGRY G+SDLQLERVNVYYNEASCGRF
Sbjct  49   KMREILHIQGGQCGNQIGAKFWEVVCDEHGIDPTGRYTGNSDLQLERVNVYYNEASCGRF  108

Query  284  VPRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDV  463
            VPRAVLMDLEPGTMDS+R+GPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDV
Sbjct  109  VPRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDV  168

Query  464  VRKEAENCDCLQGFQVCH  517
            VRKEAENCDCLQGFQVCH
Sbjct  169  VRKEAENCDCLQGFQVCH  186



>ref|XP_006353299.1| PREDICTED: tubulin beta-1 chain-like isoform X1 [Solanum tuberosum]
 ref|XP_006353300.1| PREDICTED: tubulin beta-1 chain-like isoform X2 [Solanum tuberosum]
Length=447

 Score =   285 bits (728),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 131/137 (96%), Positives = 134/137 (98%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVCAEHGID TGRY G+SDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDSTGRYKGESDLQLERVNVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSV+DVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVMDVV  120

Query  467  RKEAENCDCLQGFQVCH  517
            RKEAEN DCLQGFQVCH
Sbjct  121  RKEAENSDCLQGFQVCH  137



>ref|XP_006394642.1| hypothetical protein EUTSA_v10004208mg [Eutrema salsugineum]
 gb|ESQ31928.1| hypothetical protein EUTSA_v10004208mg [Eutrema salsugineum]
Length=450

 Score =   285 bits (728),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 131/137 (96%), Positives = 134/137 (98%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVCAEH ID TGRY G++DLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHEIDSTGRYQGENDLQLERVNVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCH  517
            RKEAENCDCLQGFQVCH
Sbjct  121  RKEAENCDCLQGFQVCH  137



>gb|AGH08233.1| beta-tubulin 1 [Salix arbutifolia]
Length=449

 Score =   285 bits (728),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 131/137 (96%), Positives = 133/137 (97%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVCAEHGID TG Y GDS LQLER+NVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDSTGSYQGDSPLQLERINVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSLRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCH  517
            RKEAENCDCLQGFQVCH
Sbjct  121  RKEAENCDCLQGFQVCH  137



>ref|XP_010685649.1| PREDICTED: tubulin beta-1 chain [Beta vulgaris subsp. vulgaris]
Length=445

 Score =   284 bits (727),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 128/137 (93%), Positives = 135/137 (99%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIG+KFWEVVCAEHG+D TG+YHGD+D+QLER+NVYYNEA CGRFV
Sbjct  1    MREILHIQGGQCGNQIGSKFWEVVCAEHGVDTTGKYHGDTDIQLERINVYYNEAGCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDSIRSGP+GQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSIRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCH  517
            RKEAENCDCLQGFQVCH
Sbjct  121  RKEAENCDCLQGFQVCH  137



>gb|EMT00232.1| Tubulin beta-2 chain [Aegilops tauschii]
Length=466

 Score =   285 bits (729),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 132/138 (96%), Positives = 134/138 (97%), Gaps = 0/138 (0%)
 Frame = +2

Query  104  KMREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRF  283
            KMREILHIQGGQCGNQIGAKFWEVVC EHGID TGRY G SDLQLERVNVYYNEASCGRF
Sbjct  19   KMREILHIQGGQCGNQIGAKFWEVVCDEHGIDPTGRYTGTSDLQLERVNVYYNEASCGRF  78

Query  284  VPRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDV  463
            VPRAVLMDLEPGTMDS+R+GPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDV
Sbjct  79   VPRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDV  138

Query  464  VRKEAENCDCLQGFQVCH  517
            VRKEAENCDCLQGFQVCH
Sbjct  139  VRKEAENCDCLQGFQVCH  156



>gb|AIS84174.1| beta-tubulin 7a [Linum usitatissimum]
Length=450

 Score =   284 bits (727),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 130/137 (95%), Positives = 134/137 (98%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEV+C EHGID TGRY GDS+LQLER+NVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVICNEHGIDSTGRYDGDSELQLERINVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCH  517
            RKEAENCDCLQGFQVCH
Sbjct  121  RKEAENCDCLQGFQVCH  137



>ref|XP_008388103.1| PREDICTED: tubulin beta chain-like [Malus domestica]
 ref|XP_008359774.1| PREDICTED: tubulin beta chain [Malus domestica]
 ref|XP_009358821.1| PREDICTED: tubulin beta chain-like [Pyrus x bretschneideri]
Length=447

 Score =   284 bits (727),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 130/137 (95%), Positives = 135/137 (99%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVCAEHGID TGRY GD++LQLER+NVYYNEASCGR+V
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDGTGRYEGDAELQLERINVYYNEASCGRYV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCH  517
            RKEAENCDCLQGFQVCH
Sbjct  121  RKEAENCDCLQGFQVCH  137



>gb|ACU22866.1| unknown [Glycine max]
Length=381

 Score =   282 bits (722),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 131/137 (96%), Positives = 134/137 (98%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVCAEHGID TGRY GDS+LQLER+NVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDPTGRYGGDSELQLERINVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCH  517
            RKEAENCDCLQGF VCH
Sbjct  121  RKEAENCDCLQGFHVCH  137



>gb|AGH08235.1| beta-tubulin 11 [Salix arbutifolia]
Length=451

 Score =   284 bits (727),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 131/137 (96%), Positives = 133/137 (97%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVCAEHGID TG Y GDS LQLER+NVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDSTGSYQGDSPLQLERINVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSLRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCH  517
            RKEAENCDCLQGFQVCH
Sbjct  121  RKEAENCDCLQGFQVCH  137



>gb|AIA09927.1| beta-tubulin [Quercus suber]
Length=446

 Score =   284 bits (727),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 131/137 (96%), Positives = 134/137 (98%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVCAEHGID TG+Y GDSDLQLER+NVYYNEASCGR+V
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDPTGKYQGDSDLQLERINVYYNEASCGRYV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDSIRSG YGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSIRSGTYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCH  517
            RKEAENCDCLQGFQVCH
Sbjct  121  RKEAENCDCLQGFQVCH  137



>ref|XP_003604816.1| Tubulin beta chain [Medicago truncatula]
 gb|AES87013.1| tubulin beta-1 chain [Medicago truncatula]
Length=449

 Score =   284 bits (727),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 130/137 (95%), Positives = 134/137 (98%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVCAEHGID TGRY G S+LQLER+NVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDPTGRYSGTSELQLERINVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRA+LMDLEPGTMDS+RSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAILMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCH  517
            RKEAENCDCLQGFQVCH
Sbjct  121  RKEAENCDCLQGFQVCH  137



>tpg|DAA57202.1| TPA: beta tubulin6 [Zea mays]
Length=488

 Score =   285 bits (730),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 132/138 (96%), Positives = 135/138 (98%), Gaps = 0/138 (0%)
 Frame = +2

Query  104  KMREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRF  283
            KMREILHIQGGQCGNQIGAKFWEVVC EHGID TGRY G+SDLQLERVNVYYNEASCGRF
Sbjct  42   KMREILHIQGGQCGNQIGAKFWEVVCDEHGIDPTGRYTGNSDLQLERVNVYYNEASCGRF  101

Query  284  VPRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDV  463
            VPRAVLMDLEPGTMDS+R+GPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDV
Sbjct  102  VPRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDV  161

Query  464  VRKEAENCDCLQGFQVCH  517
            VRKEAENCDCLQGFQVCH
Sbjct  162  VRKEAENCDCLQGFQVCH  179



>ref|NP_001105317.1| tubulin beta-6 chain [Zea mays]
 ref|XP_008673429.1| PREDICTED: tubulin beta-6 chain isoform X1 [Zea mays]
 sp|Q41783.1|TBB6_MAIZE RecName: Full=Tubulin beta-6 chain; AltName: Full=Beta-6-tubulin 
[Zea mays]
 gb|AAA20186.1| beta-6 tubulin [Zea mays]
 gb|ACL53189.1| unknown [Zea mays]
 tpg|DAA57200.1| TPA: beta tubulin6 isoform 1 [Zea mays]
 tpg|DAA57201.1| TPA: beta tubulin6 isoform 2 [Zea mays]
Length=446

 Score =   284 bits (726),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 131/137 (96%), Positives = 134/137 (98%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVC EHGID TGRY G+SDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCDEHGIDPTGRYTGNSDLQLERVNVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+R+GPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCH  517
            RKEAENCDCLQGFQVCH
Sbjct  121  RKEAENCDCLQGFQVCH  137



>ref|XP_010087906.1| Tubulin beta-1 chain [Morus notabilis]
 gb|EXB30492.1| Tubulin beta-1 chain [Morus notabilis]
Length=448

 Score =   284 bits (726),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 131/137 (96%), Positives = 134/137 (98%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVCAEHGID TGR+HG+SDLQLER+NVYYNEAS GRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDPTGRFHGESDLQLERINVYYNEASTGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDSIRSGPYG IFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSIRSGPYGPIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCH  517
            RKEAENCDCLQGFQVCH
Sbjct  121  RKEAENCDCLQGFQVCH  137



>gb|AGH08240.1| beta-tubulin 15 [Salix arbutifolia]
Length=445

 Score =   284 bits (726),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 130/137 (95%), Positives = 134/137 (98%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIG+KFWEVVCAEHGID TG+Y G SDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGSKFWEVVCAEHGIDPTGKYTGTSDLQLERVNVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+R+GPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCH  517
            RKEAENCDCLQGFQVCH
Sbjct  121  RKEAENCDCLQGFQVCH  137



>ref|XP_006429261.1| hypothetical protein CICLE_v10011723mg [Citrus clementina]
 gb|ESR42501.1| hypothetical protein CICLE_v10011723mg [Citrus clementina]
 gb|KDO58028.1| hypothetical protein CISIN_1g013335mg [Citrus sinensis]
Length=445

 Score =   284 bits (726),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 128/137 (93%), Positives = 135/137 (99%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIG+KFWEVVCAEHGID TG+Y GD+DLQLER+NVYYNEASCGR+V
Sbjct  1    MREILHIQGGQCGNQIGSKFWEVVCAEHGIDPTGKYQGDTDLQLERINVYYNEASCGRYV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGPYGQ+FRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQVFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCH  517
            RKEAENCDCLQGFQVCH
Sbjct  121  RKEAENCDCLQGFQVCH  137



>ref|NP_001044565.1| Os01g0805900 [Oryza sativa Japonica Group]
 sp|P45960.1|TBB4_ORYSJ RecName: Full=Tubulin beta-4 chain; AltName: Full=Beta-4-tubulin 
[Oryza sativa Japonica Group]
 dbj|BAA06381.1| beta-tubulin [Oryza sativa Japonica Group]
 dbj|BAB92274.1| beta-tubulin [Oryza sativa Japonica Group]
 dbj|BAF06479.1| Os01g0805900 [Oryza sativa Japonica Group]
 dbj|BAG93002.1| unnamed protein product [Oryza sativa Japonica Group]
Length=447

 Score =   284 bits (726),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 131/137 (96%), Positives = 134/137 (98%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVC EHGID TGRY G+SDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCDEHGIDPTGRYTGNSDLQLERVNVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+R+GPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCH  517
            RKEAENCDCLQGFQVCH
Sbjct  121  RKEAENCDCLQGFQVCH  137



>emb|CAA55022.1| beta tubulin [Oryza sativa Japonica Group]
Length=447

 Score =   284 bits (726),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 131/137 (96%), Positives = 134/137 (98%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVC EHGID TGRY G+SDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCDEHGIDPTGRYTGNSDLQLERVNVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+R+GPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCH  517
            RKEAENCDCLQGFQVCH
Sbjct  121  RKEAENCDCLQGFQVCH  137



>ref|XP_002298455.1| hypothetical protein POPTR_0001s27960g [Populus trichocarpa]
 ref|XP_011025005.1| PREDICTED: tubulin beta-4 chain-like [Populus euphratica]
 gb|EEE83260.1| hypothetical protein POPTR_0001s27960g [Populus trichocarpa]
Length=445

 Score =   284 bits (726),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 130/137 (95%), Positives = 134/137 (98%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIG+KFWEVVCAEHGID TG+Y G SDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGSKFWEVVCAEHGIDPTGKYTGSSDLQLERVNVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+R+GPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCH  517
            RKEAENCDCLQGFQVCH
Sbjct  121  RKEAENCDCLQGFQVCH  137



>gb|KDP25455.1| hypothetical protein JCGZ_20611 [Jatropha curcas]
Length=447

 Score =   284 bits (726),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 131/137 (96%), Positives = 134/137 (98%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILH+QGGQCGNQIGAKFWEVVCAEHGID TGRY GDSDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHVQGGQCGNQIGAKFWEVVCAEHGIDSTGRYQGDSDLQLERVNVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGP GQ+FRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSLRSGPCGQMFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCH  517
            RKEAENCDCLQGFQVCH
Sbjct  121  RKEAENCDCLQGFQVCH  137



>ref|XP_010673793.1| PREDICTED: tubulin beta-4 chain [Beta vulgaris subsp. vulgaris]
Length=446

 Score =   284 bits (726),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 130/137 (95%), Positives = 134/137 (98%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIG+KFWEVVCAEHGID TG+Y G SDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGSKFWEVVCAEHGIDPTGKYSGSSDLQLERVNVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+R+GPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCH  517
            RKEAENCDCLQGFQVCH
Sbjct  121  RKEAENCDCLQGFQVCH  137



>gb|AAA66495.1| beta-tubulin [Oryza sativa]
Length=447

 Score =   284 bits (726),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 131/137 (96%), Positives = 134/137 (98%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVC EHGID TGRY G+SDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCDEHGIDPTGRYTGNSDLQLERVNVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+R+GPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCH  517
            RKEAENCDCLQGFQVCH
Sbjct  121  RKEAENCDCLQGFQVCH  137



>ref|XP_002881057.1| tubulin beta-7 chain [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57316.1| tubulin beta-7 chain [Arabidopsis lyrata subsp. lyrata]
Length=449

 Score =   284 bits (726),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 131/137 (96%), Positives = 134/137 (98%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIG+KFWEVV  EHGID TGRYHGDSDLQLERVNVYYNEASCGR+V
Sbjct  1    MREILHIQGGQCGNQIGSKFWEVVNLEHGIDQTGRYHGDSDLQLERVNVYYNEASCGRYV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCH  517
            RKEAENCDCLQGFQVCH
Sbjct  121  RKEAENCDCLQGFQVCH  137



>gb|AIS84176.1| beta-tubulin 7c [Linum usitatissimum]
Length=450

 Score =   284 bits (726),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 129/137 (94%), Positives = 134/137 (98%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILH+QGGQCGNQIGAKFWEV+C EHGID TGRY GDS+LQLER+NVYYNEASCGRFV
Sbjct  1    MREILHVQGGQCGNQIGAKFWEVICNEHGIDSTGRYDGDSELQLERINVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCH  517
            RKEAENCDCLQGFQVCH
Sbjct  121  RKEAENCDCLQGFQVCH  137



>ref|XP_010232467.1| PREDICTED: tubulin beta chain [Brachypodium distachyon]
Length=447

 Score =   284 bits (726),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 131/137 (96%), Positives = 133/137 (97%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVC EHGID TGRY G SDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCDEHGIDPTGRYTGTSDLQLERVNVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+R+GPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCH  517
            RKEAENCDCLQGFQVCH
Sbjct  121  RKEAENCDCLQGFQVCH  137



>gb|KHG13886.1| Tubulin beta-3 chain [Gossypium arboreum]
Length=221

 Score =   276 bits (706),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 128/137 (93%), Positives = 133/137 (97%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILH+QGGQCGNQIG+KFWEVVC EHGID TGRY G SDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYIGSSDLQLERVNVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+R+GPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELID+VLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDAVLDVV  120

Query  467  RKEAENCDCLQGFQVCH  517
            RKEAENCDCLQGFQVCH
Sbjct  121  RKEAENCDCLQGFQVCH  137



>pir||JC2510 beta-tubulin R1623 - rice
Length=446

 Score =   284 bits (726),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 131/137 (96%), Positives = 134/137 (98%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVC EHGID TGRY G+SDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCDEHGIDPTGRYTGNSDLQLERVNVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+R+GPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCH  517
            RKEAENCDCLQGFQVCH
Sbjct  121  RKEAENCDCLQGFQVCH  137



>gb|ADE76978.1| unknown [Picea sitchensis]
Length=445

 Score =   284 bits (726),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 130/137 (95%), Positives = 133/137 (97%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVC EHGID TGRY G SDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCDEHGIDPTGRYQGTSDLQLERVNVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+R+GPYGQ+FRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGQVFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCH  517
            RKEAENCDCLQGFQVCH
Sbjct  121  RKEAENCDCLQGFQVCH  137



>ref|XP_004240391.1| PREDICTED: tubulin beta-8 chain-like [Solanum lycopersicum]
Length=445

 Score =   283 bits (725),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 131/137 (96%), Positives = 134/137 (98%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVCAEHGID TG YHG+SD+QLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDATGAYHGESDIQLERVNVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSG YGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGTYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCH  517
            RKEAENCDCLQGFQVCH
Sbjct  121  RKEAENCDCLQGFQVCH  137



>emb|CAE52516.1| beta tubulin [Setaria viridis]
Length=448

 Score =   284 bits (726),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 131/137 (96%), Positives = 134/137 (98%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVC EHGID TGRY G+SDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCDEHGIDPTGRYTGNSDLQLERVNVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+R+GPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCH  517
            RKEAENCDCLQGFQVCH
Sbjct  121  RKEAENCDCLQGFQVCH  137



>ref|XP_006481398.1| PREDICTED: tubulin beta-2 chain [Citrus sinensis]
Length=432

 Score =   283 bits (724),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 128/137 (93%), Positives = 135/137 (99%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIG+KFWEVVCAEHGID TG+Y GD+DLQLER+NVYYNEASCGR+V
Sbjct  1    MREILHIQGGQCGNQIGSKFWEVVCAEHGIDPTGKYQGDTDLQLERINVYYNEASCGRYV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGPYGQ+FRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQVFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCH  517
            RKEAENCDCLQGFQVCH
Sbjct  121  RKEAENCDCLQGFQVCH  137



>ref|XP_010101838.1| Tubulin beta-1 chain [Morus notabilis]
 gb|EXB89975.1| Tubulin beta-1 chain [Morus notabilis]
Length=447

 Score =   283 bits (725),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 131/137 (96%), Positives = 135/137 (99%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVCAEHGID TG+Y+GDS+LQLER+NVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDSTGKYNGDSELQLERINVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDSIRSG YGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSIRSGLYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCH  517
            RKEAENCDCLQGFQVCH
Sbjct  121  RKEAENCDCLQGFQVCH  137



>gb|AIS84175.1| beta-tubulin 7b [Linum usitatissimum]
Length=450

 Score =   284 bits (726),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 129/137 (94%), Positives = 134/137 (98%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILH+QGGQCGNQIGAKFWEV+C EHGID TGRY GDS+LQLER+NVYYNEASCGRFV
Sbjct  1    MREILHVQGGQCGNQIGAKFWEVICNEHGIDSTGRYDGDSELQLERINVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCH  517
            RKEAENCDCLQGFQVCH
Sbjct  121  RKEAENCDCLQGFQVCH  137



>ref|XP_010676480.1| PREDICTED: tubulin beta-1 chain [Beta vulgaris subsp. vulgaris]
Length=445

 Score =   283 bits (725),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 131/137 (96%), Positives = 133/137 (97%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQ GQCGNQIGAKFWEVVCAEHGID TG+Y G+SDLQ ERVNVYYNEASCGRFV
Sbjct  1    MREILHIQAGQCGNQIGAKFWEVVCAEHGIDPTGQYKGESDLQFERVNVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCH  517
            RKEAENCDCLQGFQVCH
Sbjct  121  RKEAENCDCLQGFQVCH  137



>gb|AIC33036.1| beta-tubulin, partial [Panax ginseng]
Length=300

 Score =   279 bits (713),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 128/137 (93%), Positives = 133/137 (97%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEV+CAEHGID TGRY GDSD+QLER+NVYYNEAS  R+V
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVICAEHGIDSTGRYQGDSDIQLERINVYYNEASSQRYV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSLRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCH  517
            RKEAENCDCLQGFQVCH
Sbjct  121  RKEAENCDCLQGFQVCH  137



>ref|NP_001168511.1| hypothetical protein [Zea mays]
 gb|ACN28480.1| unknown [Zea mays]
 gb|AFW84813.1| hypothetical protein ZEAMMB73_647337 [Zea mays]
 gb|AFW84814.1| hypothetical protein ZEAMMB73_647337 [Zea mays]
Length=448

 Score =   283 bits (725),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 131/137 (96%), Positives = 133/137 (97%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVC EHGID TGRY G SDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCDEHGIDTTGRYTGTSDLQLERVNVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+R+GPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCH  517
            RKEAENCDCLQGFQVCH
Sbjct  121  RKEAENCDCLQGFQVCH  137



>gb|AFN53689.1| putative tubulin beta-1 chain protein [Linum usitatissimum]
 gb|AIS84163.1| beta-tubulin 1a [Linum usitatissimum]
 gb|AIS84164.1| beta-tubulin 1b [Linum usitatissimum]
Length=449

 Score =   283 bits (725),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 130/137 (95%), Positives = 134/137 (98%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVCAEHGID TGRY GD++ Q+ERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDSTGRYQGDNEQQIERVNVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCH  517
            RKEAENCDCLQGFQVCH
Sbjct  121  RKEAENCDCLQGFQVCH  137



>sp|Q9ZRB1.1|TBB2_WHEAT RecName: Full=Tubulin beta-2 chain; AltName: Full=Beta-2-tubulin 
[Triticum aestivum]
 gb|AAD10488.1| beta-tubulin 2 [Triticum aestivum]
Length=447

 Score =   283 bits (725),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 131/137 (96%), Positives = 133/137 (97%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVC EHGID TGRY G SDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCDEHGIDPTGRYTGTSDLQLERVNVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+R+GPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCH  517
            RKEAENCDCLQGFQVCH
Sbjct  121  RKEAENCDCLQGFQVCH  137



>emb|CDM85842.1| unnamed protein product [Triticum aestivum]
Length=447

 Score =   283 bits (725),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 131/137 (96%), Positives = 133/137 (97%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVC EHGID TGRY G SDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCDEHGIDPTGRYTGTSDLQLERVNVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+R+GPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCH  517
            RKEAENCDCLQGFQVCH
Sbjct  121  RKEAENCDCLQGFQVCH  137



>gb|AGH08239.1| beta-tubulin 13 [Salix arbutifolia]
Length=447

 Score =   283 bits (725),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 130/137 (95%), Positives = 134/137 (98%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIG+KFWEVVCAEHGID TG+Y G SDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGSKFWEVVCAEHGIDPTGKYTGTSDLQLERVNVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+R+GPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCH  517
            RKEAENCDCLQGFQVCH
Sbjct  121  RKEAENCDCLQGFQVCH  137



>sp|P93176.1|TBB_HORVU RecName: Full=Tubulin beta chain; AltName: Full=Beta-tubulin 
[Hordeum vulgare]
 emb|CAA70891.1| beta-tubulin 1 [Hordeum vulgare subsp. vulgare]
 emb|CAM58979.1| beta tubulin 1 [Hordeum vulgare subsp. vulgare]
 dbj|BAJ87463.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ92333.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ93445.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=447

 Score =   283 bits (725),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 131/137 (96%), Positives = 133/137 (97%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVC EHGID TGRY G SDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCDEHGIDPTGRYTGTSDLQLERVNVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+R+GPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCH  517
            RKEAENCDCLQGFQVCH
Sbjct  121  RKEAENCDCLQGFQVCH  137



>ref|XP_010905373.1| PREDICTED: tubulin beta-8 chain-like [Elaeis guineensis]
Length=448

 Score =   283 bits (725),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 132/137 (96%), Positives = 134/137 (98%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVCAEHGID TGRY G+SDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDATGRYDGNSDLQLERVNVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSG YGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGLYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCH  517
            RKEAENCDCLQGFQVCH
Sbjct  121  RKEAENCDCLQGFQVCH  137



>gb|ABY86665.1| beta-tubulin 19 [Gossypium hirsutum]
 gb|KJB21245.1| hypothetical protein B456_003G126300 [Gossypium raimondii]
Length=444

 Score =   283 bits (724),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 131/137 (96%), Positives = 133/137 (97%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVC+EHGID TGRY GD DLQLER+NVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCSEHGIDPTGRYQGDLDLQLERINVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDSIRSGP GQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSIRSGPVGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCH  517
            RKEAENCDCLQGFQVCH
Sbjct  121  RKEAENCDCLQGFQVCH  137



>gb|ABY86664.1| beta-tubulin 18 [Gossypium hirsutum]
Length=444

 Score =   283 bits (724),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 131/137 (96%), Positives = 133/137 (97%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVC+EHGID TGRY GD DLQLER+NVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCSEHGIDPTGRYQGDLDLQLERINVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDSIRSGP GQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSIRSGPVGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCH  517
            RKEAENCDCLQGFQVCH
Sbjct  121  RKEAENCDCLQGFQVCH  137



>gb|AGH08237.1| beta-tubulin 16 [Salix arbutifolia]
Length=445

 Score =   283 bits (724),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 130/140 (93%), Positives = 135/140 (96%), Gaps = 0/140 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILH+QGGQCGNQIG+KFWEVVC EHGID TG+Y G SDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGKYVGTSDLQLERVNVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+R+ PYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTSPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCHSLG  526
            RKEAENCDCLQGFQVCHSLG
Sbjct  121  RKEAENCDCLQGFQVCHSLG  140



>gb|AIZ74332.1| beta-tubulin [Pinus massoniana]
Length=446

 Score =   283 bits (724),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 130/137 (95%), Positives = 133/137 (97%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVCAEHGID TG Y G +D+QLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDPTGSYQGTTDIQLERVNVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCH  517
            RKEAENCDCLQGFQVCH
Sbjct  121  RKEAENCDCLQGFQVCH  137



>emb|CDX69693.1| BnaA10g20420D [Brassica napus]
Length=461

 Score =   284 bits (726),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 129/140 (92%), Positives = 136/140 (97%), Gaps = 0/140 (0%)
 Frame = +2

Query  98   QPKMREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCG  277
            Q KMREILHIQGGQCGNQIG+KFWEVVC EHGID TGRY G+SDLQLERVNVYYNEASCG
Sbjct  11   QSKMREILHIQGGQCGNQIGSKFWEVVCDEHGIDPTGRYTGNSDLQLERVNVYYNEASCG  70

Query  278  RFVPRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVL  457
            R+VPRA+LMDLEPGTMDS+R+GPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELID+VL
Sbjct  71   RYVPRAILMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDAVL  130

Query  458  DVVRKEAENCDCLQGFQVCH  517
            DVVRKEAENCDCLQGFQVCH
Sbjct  131  DVVRKEAENCDCLQGFQVCH  150



>ref|XP_002456503.1| hypothetical protein SORBIDRAFT_03g037490 [Sorghum bicolor]
 gb|EES01623.1| hypothetical protein SORBIDRAFT_03g037490 [Sorghum bicolor]
Length=447

 Score =   283 bits (724),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 131/137 (96%), Positives = 133/137 (97%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVC EHGID TGRY G SDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCDEHGIDPTGRYTGTSDLQLERVNVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+R+GPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCH  517
            RKEAENCDCLQGFQVCH
Sbjct  121  RKEAENCDCLQGFQVCH  137



>ref|XP_008448943.1| PREDICTED: tubulin beta chain-like [Cucumis melo]
Length=446

 Score =   283 bits (724),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 130/137 (95%), Positives = 134/137 (98%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILH+QGGQCGNQIGAKFWEVVCAEHGID TG+Y GDSDLQLER+NVYYNEASCGR+V
Sbjct  1    MREILHVQGGQCGNQIGAKFWEVVCAEHGIDTTGKYQGDSDLQLERINVYYNEASCGRYV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDSIRSG YGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSIRSGLYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCH  517
            RKEAENCDCLQGFQVCH
Sbjct  121  RKEAENCDCLQGFQVCH  137



>ref|XP_004172348.1| PREDICTED: tubulin beta-1 chain-like [Cucumis sativus]
Length=446

 Score =   283 bits (724),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 130/137 (95%), Positives = 134/137 (98%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILH+QGGQCGNQIGAKFWEVVCAEHGID TG+Y GDSDLQLER+NVYYNEASCGR+V
Sbjct  1    MREILHVQGGQCGNQIGAKFWEVVCAEHGIDTTGKYQGDSDLQLERINVYYNEASCGRYV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDSIRSG YGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSIRSGLYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCH  517
            RKEAENCDCLQGFQVCH
Sbjct  121  RKEAENCDCLQGFQVCH  137



>ref|XP_006644872.1| PREDICTED: tubulin beta-4 chain-like [Oryza brachyantha]
Length=448

 Score =   283 bits (724),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 131/137 (96%), Positives = 133/137 (97%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVC EHGID TGRY G SDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCDEHGIDPTGRYTGSSDLQLERVNVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+R+GPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCH  517
            RKEAENCDCLQGFQVCH
Sbjct  121  RKEAENCDCLQGFQVCH  137



>ref|XP_004147894.1| PREDICTED: tubulin beta-1 chain-like [Cucumis sativus]
 gb|KGN54346.1| hypothetical protein Csa_4G307390 [Cucumis sativus]
Length=446

 Score =   283 bits (724),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 130/137 (95%), Positives = 134/137 (98%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILH+QGGQCGNQIGAKFWEVVCAEHGID TG+Y GDSDLQLER+NVYYNEASCGR+V
Sbjct  1    MREILHVQGGQCGNQIGAKFWEVVCAEHGIDTTGKYQGDSDLQLERINVYYNEASCGRYV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDSIRSG YGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSIRSGLYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCH  517
            RKEAENCDCLQGFQVCH
Sbjct  121  RKEAENCDCLQGFQVCH  137



>sp|Q9ZPN9.1|TBB2_ELEIN RecName: Full=Tubulin beta-2 chain; AltName: Full=Beta-2-tubulin 
[Eleusine indica]
 gb|AAD20179.1| beta-tubulin 2 [Eleusine indica]
Length=448

 Score =   283 bits (724),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 131/137 (96%), Positives = 133/137 (97%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVC EHGID TGRY G SDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCDEHGIDPTGRYTGTSDLQLERVNVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+R+GPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCH  517
            RKEAENCDCLQGFQVCH
Sbjct  121  RKEAENCDCLQGFQVCH  137



>gb|AAU14217.1| TUB8 [Quercus petraea]
Length=446

 Score =   283 bits (724),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 131/137 (96%), Positives = 134/137 (98%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVCAEHGID TG+Y GDSDLQLER+NVYYNEASCGR+V
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDPTGKYQGDSDLQLERINVYYNEASCGRYV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDSIRSG YGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSIRSGTYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCH  517
            RKEAENCDCLQGFQVCH
Sbjct  121  RKEAENCDCLQGFQVCH  137



>gb|EYU18601.1| hypothetical protein MIMGU_mgv1a005215mg [Erythranthe guttata]
Length=493

 Score =   284 bits (727),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 131/138 (95%), Positives = 134/138 (97%), Gaps = 0/138 (0%)
 Frame = +2

Query  104  KMREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRF  283
            KMREILHIQGGQCGNQIG+KFWEVVC EHGID TGRY G SDLQLERVNVYYNEASCGRF
Sbjct  46   KMREILHIQGGQCGNQIGSKFWEVVCDEHGIDQTGRYVGTSDLQLERVNVYYNEASCGRF  105

Query  284  VPRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDV  463
            VPRAVLMDLEPGTMDS+R+GPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDV
Sbjct  106  VPRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDV  165

Query  464  VRKEAENCDCLQGFQVCH  517
            VRKEAENCDCLQGFQVCH
Sbjct  166  VRKEAENCDCLQGFQVCH  183



>ref|XP_007016239.1| Tubulin beta 8 [Theobroma cacao]
 gb|EOY33858.1| Tubulin beta 8 [Theobroma cacao]
Length=444

 Score =   283 bits (723),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 131/137 (96%), Positives = 132/137 (96%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVC EHGID TGRY GD DLQLER+NVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCTEHGIDPTGRYQGDLDLQLERINVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDSIRSGP GQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSIRSGPVGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCH  517
            RKEAENCDCLQGFQVCH
Sbjct  121  RKEAENCDCLQGFQVCH  137



>ref|XP_010662749.1| PREDICTED: tubulin beta-1 chain-like [Vitis vinifera]
Length=183

 Score =   274 bits (700),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 127/137 (93%), Positives = 132/137 (96%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILH+QGGQCGNQIGAKFWEVVCAEH ID TGRY GD++LQLERVNVYYNEASCGR V
Sbjct  1    MREILHVQGGQCGNQIGAKFWEVVCAEHDIDSTGRYQGDTELQLERVNVYYNEASCGRLV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGPYGQIFRPDNFVFGQSGAGNNWAKGHYT+ AELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTKRAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCH  517
            RKEAENCDCLQGFQVCH
Sbjct  121  RKEAENCDCLQGFQVCH  137



>ref|XP_008777278.1| PREDICTED: tubulin beta-8 chain-like [Phoenix dactylifera]
Length=448

 Score =   283 bits (723),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 131/137 (96%), Positives = 133/137 (97%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVCAEHGID TGRYHG S LQLERV+VYYNEA CGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDATGRYHGTSHLQLERVDVYYNEAGCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCH  517
            RKEAENCDCLQGFQVCH
Sbjct  121  RKEAENCDCLQGFQVCH  137



>ref|XP_010654216.1| PREDICTED: tubulin beta-2 chain [Vitis vinifera]
Length=447

 Score =   283 bits (723),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 131/137 (96%), Positives = 134/137 (98%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVCAEHGID TGRY GDS+LQLER+NVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDVTGRYQGDSELQLERINVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDSIRSG YGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELID+VLDVV
Sbjct  61   PRAVLMDLEPGTMDSIRSGMYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDAVLDVV  120

Query  467  RKEAENCDCLQGFQVCH  517
            RKEAENCDCLQGFQVCH
Sbjct  121  RKEAENCDCLQGFQVCH  137



>ref|XP_011075464.1| PREDICTED: tubulin beta-5 chain isoform X1 [Sesamum indicum]
Length=456

 Score =   283 bits (724),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 130/138 (94%), Positives = 134/138 (97%), Gaps = 0/138 (0%)
 Frame = +2

Query  104  KMREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRF  283
            KMREILH+QGGQCGNQIG+KFWEVVC EHGID TGRY G SDLQLERVNVYYNEASCGRF
Sbjct  9    KMREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRF  68

Query  284  VPRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDV  463
            VPRAVLMDLEPGTMDS+R+GPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDV
Sbjct  69   VPRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDV  128

Query  464  VRKEAENCDCLQGFQVCH  517
            VRKEAENCDCLQGFQVCH
Sbjct  129  VRKEAENCDCLQGFQVCH  146



>gb|AFW84815.1| hypothetical protein ZEAMMB73_647337, partial [Zea mays]
Length=476

 Score =   283 bits (725),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 131/137 (96%), Positives = 133/137 (97%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVC EHGID TGRY G SDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCDEHGIDTTGRYTGTSDLQLERVNVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+R+GPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCH  517
            RKEAENCDCLQGFQVCH
Sbjct  121  RKEAENCDCLQGFQVCH  137



>gb|ABY86663.1| beta-tubulin 17 [Gossypium hirsutum]
 gb|KJB83702.1| hypothetical protein B456_013G261300 [Gossypium raimondii]
Length=444

 Score =   283 bits (723),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 130/137 (95%), Positives = 134/137 (98%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEV+CAEHGID TGRY+GD DLQLER+NVYYNE+SCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVICAEHGIDPTGRYNGDLDLQLERINVYYNESSCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDSIRSGP GQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSIRSGPVGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCH  517
            RKEAENCDCLQGFQVCH
Sbjct  121  RKEAENCDCLQGFQVCH  137



>gb|ABA46752.1| unknown [Solanum tuberosum]
Length=447

 Score =   283 bits (723),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 129/137 (94%), Positives = 134/137 (98%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEV+CAEHGID +GRY GDSDLQLER+NVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVICAEHGIDSSGRYQGDSDLQLERLNVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGP+GQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCH  517
            RKEAENCDCLQGFQV H
Sbjct  121  RKEAENCDCLQGFQVAH  137



>dbj|BAA82637.1| Beta-tubulin [Zinnia elegans]
Length=448

 Score =   283 bits (723),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 131/137 (96%), Positives = 133/137 (97%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVCAEHGID TGRY GD DLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDATGRYTGDQDLQLERVNVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRA+LMDLEPGTMDS+RSGP GQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAILMDLEPGTMDSVRSGPCGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCH  517
            RKEAENCDCLQGFQVCH
Sbjct  121  RKEAENCDCLQGFQVCH  137



>ref|XP_010909929.1| PREDICTED: tubulin beta-1 chain-like [Elaeis guineensis]
 ref|XP_010909930.1| PREDICTED: tubulin beta-1 chain-like [Elaeis guineensis]
 ref|XP_010909931.1| PREDICTED: tubulin beta-1 chain-like [Elaeis guineensis]
Length=446

 Score =   282 bits (722),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 129/137 (94%), Positives = 134/137 (98%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILH+QGGQCGNQIG+KFWEVVC EHGID TGRY G+SDLQLER+NVYYNEASCGRFV
Sbjct  1    MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYTGNSDLQLERINVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDSIR+GPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSIRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCH  517
            RKEAENCDCLQGFQVCH
Sbjct  121  RKEAENCDCLQGFQVCH  137



>gb|AGZ90159.1| tubulin beta, partial [Litsea cubeba]
Length=446

 Score =   282 bits (722),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 130/137 (95%), Positives = 133/137 (97%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIG+KFWEVVC EHGID TGRY G SDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGSKFWEVVCDEHGIDPTGRYTGTSDLQLERVNVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+R+GPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCH  517
            RKEAENCDCLQGFQVCH
Sbjct  121  RKEAENCDCLQGFQVCH  137



>ref|XP_011025004.1| PREDICTED: tubulin beta-4 chain-like [Populus euphratica]
Length=447

 Score =   282 bits (722),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 129/137 (94%), Positives = 134/137 (98%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIG+KFWEVVCAEHGID TG+Y G S+LQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGSKFWEVVCAEHGIDPTGKYTGSSELQLERVNVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+R+GPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCH  517
            RKEAENCDCLQGFQVCH
Sbjct  121  RKEAENCDCLQGFQVCH  137



>ref|XP_010088982.1| Tubulin beta-1 chain [Morus notabilis]
 gb|EXB37197.1| Tubulin beta-1 chain [Morus notabilis]
Length=446

 Score =   282 bits (721),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 129/137 (94%), Positives = 134/137 (98%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILH+QGGQCGNQIG+KFWEVVC EHGID TGRY G+SDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYTGNSDLQLERVNVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+R+GPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCH  517
            RKEAENCDCLQGFQVCH
Sbjct  121  RKEAENCDCLQGFQVCH  137



>ref|XP_002270069.1| PREDICTED: tubulin beta-4 chain [Vitis vinifera]
Length=446

 Score =   282 bits (721),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 129/137 (94%), Positives = 134/137 (98%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILH+QGGQCGNQIG+KFWEVVC EHGID TGRY G+SDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYTGNSDLQLERVNVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+R+GPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCH  517
            RKEAENCDCLQGFQVCH
Sbjct  121  RKEAENCDCLQGFQVCH  137



>gb|KEH28915.1| tubulin beta-1 chain [Medicago truncatula]
Length=449

 Score =   282 bits (722),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 131/137 (96%), Positives = 134/137 (98%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MR+ILHIQGGQCGNQIGAKFWEVVCAEHGID TGRY GDSDLQLER++VYYNEAS GRFV
Sbjct  1    MRQILHIQGGQCGNQIGAKFWEVVCAEHGIDPTGRYTGDSDLQLERIDVYYNEASGGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCH  517
            RKEAENCDCLQGFQVCH
Sbjct  121  RKEAENCDCLQGFQVCH  137



>gb|AAC84132.1| beta-tubulin [Cichorium intybus]
Length=173

 Score =   273 bits (697),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 129/137 (94%), Positives = 133/137 (97%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVCAEHGID TG+Y GDS+LQLER+NVYYNEAS GRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDVTGKYTGDSELQLERINVYYNEASGGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSG YGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSLRSGAYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCH  517
            RKEAENCDCLQGFQVCH
Sbjct  121  RKEAENCDCLQGFQVCH  137



>ref|XP_008798348.1| PREDICTED: tubulin beta-1 chain [Phoenix dactylifera]
Length=448

 Score =   282 bits (721),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 129/137 (94%), Positives = 134/137 (98%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILH+QGGQCGNQIG+KFWEVVC EHGID TGRY G+SDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYTGNSDLQLERVNVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+R+GPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCH  517
            RKEAENCDCLQGFQVCH
Sbjct  121  RKEAENCDCLQGFQVCH  137



>gb|AGH08224.1| beta-tubulin 6 [Salix arbutifolia]
Length=444

 Score =   282 bits (721),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 130/137 (95%), Positives = 135/137 (99%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVCAEHGID TG+Y+GDS+LQLER+NVYYNEAS GRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDATGKYNGDSELQLERINVYYNEASGGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCH  517
            RKEAENCDCLQGFQVCH
Sbjct  121  RKEAENCDCLQGFQVCH  137



>ref|XP_010909062.1| PREDICTED: tubulin beta-1 chain [Elaeis guineensis]
 ref|XP_010909063.1| PREDICTED: tubulin beta-1 chain [Elaeis guineensis]
 ref|XP_010909064.1| PREDICTED: tubulin beta-1 chain [Elaeis guineensis]
Length=447

 Score =   282 bits (721),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 129/137 (94%), Positives = 134/137 (98%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILH+QGGQCGNQIG+KFWEVVC EHGID TGRY G+SDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYTGNSDLQLERVNVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+R+GPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCH  517
            RKEAENCDCLQGFQVCH
Sbjct  121  RKEAENCDCLQGFQVCH  137



>ref|XP_003624927.1| Tubulin beta chain [Medicago truncatula]
Length=527

 Score =   284 bits (727),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 130/138 (94%), Positives = 135/138 (98%), Gaps = 0/138 (0%)
 Frame = +2

Query  104  KMREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRF  283
            KMREILH+QGGQCGNQIG+KFWEVVC EHGID TGRY G+SDLQLERVNVYYNEASCGRF
Sbjct  78   KMREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGNSDLQLERVNVYYNEASCGRF  137

Query  284  VPRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDV  463
            VPRAVLMDLEPGTMDS+R+GPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDV
Sbjct  138  VPRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDV  197

Query  464  VRKEAENCDCLQGFQVCH  517
            VRKEAENCDCLQGFQVCH
Sbjct  198  VRKEAENCDCLQGFQVCH  215



>ref|XP_010271905.1| PREDICTED: tubulin beta-1 chain [Nelumbo nucifera]
 ref|XP_010271906.1| PREDICTED: tubulin beta-1 chain [Nelumbo nucifera]
Length=446

 Score =   282 bits (721),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 129/137 (94%), Positives = 133/137 (97%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILH+QGGQCGNQIG+KFWEVVC EHGID TGRY G SDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHVQGGQCGNQIGSKFWEVVCDEHGIDPTGRYTGTSDLQLERVNVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+R+GPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCH  517
            RKEAENCDCLQGFQVCH
Sbjct  121  RKEAENCDCLQGFQVCH  137



>sp|Q9ZRA8.1|TBB5_WHEAT RecName: Full=Tubulin beta-5 chain; AltName: Full=Beta-5-tubulin 
[Triticum aestivum]
 gb|AAD10492.1| beta-tubulin 5 [Triticum aestivum]
 emb|CAM58982.1| beta tubulin 4 [Hordeum vulgare subsp. vulgare]
 gb|EMT33709.1| Tubulin beta-5 chain [Aegilops tauschii]
Length=447

 Score =   282 bits (721),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 130/137 (95%), Positives = 133/137 (97%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIG+KFWEVVC EHGID TGRY G SDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+R+GPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCH  517
            RKEAENCDCLQGFQVCH
Sbjct  121  RKEAENCDCLQGFQVCH  137



>ref|XP_009401585.1| PREDICTED: tubulin beta-1 chain-like [Musa acuminata subsp. malaccensis]
Length=447

 Score =   282 bits (721),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 130/137 (95%), Positives = 133/137 (97%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILH+QGGQCGNQIGAKFWEVVC EHGID TGRY G SDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHVQGGQCGNQIGAKFWEVVCDEHGIDATGRYIGKSDLQLERVNVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+R+GPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCH  517
            RKEAENCDCLQGFQVCH
Sbjct  121  RKEAENCDCLQGFQVCH  137



>ref|XP_003568202.1| PREDICTED: tubulin beta-5 chain-like [Brachypodium distachyon]
Length=447

 Score =   282 bits (721),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 130/137 (95%), Positives = 133/137 (97%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIG+KFWEVVC EHGID TGRY G SDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+R+GPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCH  517
            RKEAENCDCLQGFQVCH
Sbjct  121  RKEAENCDCLQGFQVCH  137



>ref|NP_001055546.1| Os05g0413200 [Oryza sativa Japonica Group]
 sp|Q76FS3.1|TBB6_ORYSJ RecName: Full=Tubulin beta-6 chain; AltName: Full=Beta-6-tubulin 
[Oryza sativa Japonica Group]
 dbj|BAC82429.1| beta-tubulin [Oryza sativa Japonica Group]
 gb|AAT94032.1| beta-tubulin [Oryza sativa Japonica Group]
 dbj|BAF17460.1| Os05g0413200 [Oryza sativa Japonica Group]
Length=444

 Score =   281 bits (720),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 130/137 (95%), Positives = 133/137 (97%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIG+KFWEVVC EHGID TGRY G SDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGSKFWEVVCDEHGIDPTGRYAGTSDLQLERVNVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+R+GPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCH  517
            RKEAENCDCLQGFQVCH
Sbjct  121  RKEAENCDCLQGFQVCH  137



>ref|XP_008442483.1| PREDICTED: tubulin beta chain-like [Cucumis melo]
Length=446

 Score =   282 bits (721),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 129/137 (94%), Positives = 133/137 (97%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVCAEHGID  G+Y GDSDLQL+R+NVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDPIGKYTGDSDLQLDRINVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPG MDSIRSGPYGQ+FRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGVMDSIRSGPYGQVFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCH  517
            RKEAENCDCLQGFQVCH
Sbjct  121  RKEAENCDCLQGFQVCH  137



>gb|AFC88825.1| putative tubulin beta-7 chain [Miscanthus sinensis]
Length=298

 Score =   277 bits (708),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 129/137 (94%), Positives = 133/137 (97%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEV+C EHGID TGRY GDSDLQLER+NVYYNEAS GRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVICDEHGIDATGRYAGDSDLQLERINVYYNEASGGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGP+GQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCH  517
            RKEAENCDCLQGFQVCH
Sbjct  121  RKEAENCDCLQGFQVCH  137



>sp|P29500.1|TBB1_PEA RecName: Full=Tubulin beta-1 chain; AltName: Full=Beta-1-tubulin 
[Pisum sativum]
 emb|CAA38613.1| beta-tubulin 1 [Pisum sativum]
Length=450

 Score =   282 bits (721),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 131/137 (96%), Positives = 134/137 (98%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MR+ILHIQGGQCGNQIGAKFWEVVCAEHGID TGRY GDSDLQLER++VYYNEAS GRFV
Sbjct  1    MRQILHIQGGQCGNQIGAKFWEVVCAEHGIDPTGRYTGDSDLQLERIDVYYNEASGGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCH  517
            RKEAENCDCLQGFQVCH
Sbjct  121  RKEAENCDCLQGFQVCH  137



>tpg|DAA54230.1| TPA: hypothetical protein ZEAMMB73_283964, partial [Zea mays]
Length=427

 Score =   281 bits (719),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 130/137 (95%), Positives = 133/137 (97%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIG+KFWEVVC EHGID TGRY G SDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+R+GPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCH  517
            RKEAENCDCLQGFQVCH
Sbjct  121  RKEAENCDCLQGFQVCH  137



>ref|XP_006644071.1| PREDICTED: tubulin beta-1 chain-like [Oryza brachyantha]
Length=447

 Score =   282 bits (721),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 130/137 (95%), Positives = 133/137 (97%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIG+KFWEVVC EHGID TGRY G SDLQLERVNVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+R+GPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCH  517
            RKEAENCDCLQGFQVCH
Sbjct  121  RKEAENCDCLQGFQVCH  137



>ref|XP_004137743.1| PREDICTED: tubulin beta-1 chain-like [Cucumis sativus]
 ref|XP_004168413.1| PREDICTED: tubulin beta-1 chain-like [Cucumis sativus]
 gb|KGN58809.1| hypothetical protein Csa_3G732650 [Cucumis sativus]
Length=446

 Score =   281 bits (720),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 129/137 (94%), Positives = 133/137 (97%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEVVCAEHGID  G+Y GDSDLQL+R+NVYYNEASCGRFV
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVVCAEHGIDPIGKYTGDSDLQLDRINVYYNEASCGRFV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPG MDSIRSGPYGQ+FRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGVMDSIRSGPYGQVFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCH  517
            RKEAENCDCLQGFQVCH
Sbjct  121  RKEAENCDCLQGFQVCH  137



>gb|ABK94893.1| unknown [Populus trichocarpa]
Length=232

 Score =   275 bits (702),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 127/137 (93%), Positives = 133/137 (97%), Gaps = 0/137 (0%)
 Frame = +2

Query  107  MREILHIQGGQCGNQIGAKFWEVVCAEHGIDDTGRYHGDSDLQLERVNVYYNEASCGRFV  286
            MREILHIQGGQCGNQIGAKFWEV+C EHGID +GRY GDSDLQLER+NVYYNEAS GR+V
Sbjct  1    MREILHIQGGQCGNQIGAKFWEVICDEHGIDQSGRYSGDSDLQLERINVYYNEASGGRYV  60

Query  287  PRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  466
            PRAVLMDLEPGTMDS+RSGP+GQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
Sbjct  61   PRAVLMDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV  120

Query  467  RKEAENCDCLQGFQVCH  517
            RKEAENCDCLQGFQVCH
Sbjct  121  RKEAENCDCLQGFQVCH  137



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 561572122600