BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001P12

Length=566
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009761975.1|  PREDICTED: 40S ribosomal protein SA-like           293   4e-96   Nicotiana sylvestris
ref|XP_009602638.1|  PREDICTED: 40S ribosomal protein SA {ECO:000...    293   4e-96   Nicotiana tomentosiformis
ref|XP_009772296.1|  PREDICTED: 40S ribosomal protein SA-like iso...    293   5e-96   Nicotiana sylvestris
ref|XP_004241486.1|  PREDICTED: 40S ribosomal protein SA isoform X1     293   5e-96   
ref|XP_010322515.1|  PREDICTED: 40S ribosomal protein SA isoform X2     292   6e-96   
ref|XP_009772295.1|  PREDICTED: 40S ribosomal protein SA-like iso...    292   7e-96   Nicotiana sylvestris
ref|XP_006347389.1|  PREDICTED: 40S ribosomal protein SA-like iso...    292   8e-96   Solanum tuberosum [potatoes]
ref|XP_006347388.1|  PREDICTED: 40S ribosomal protein SA-like iso...    292   9e-96   Solanum tuberosum [potatoes]
gb|EPS72151.1|  hypothetical protein M569_02606                         291   1e-95   Genlisea aurea
ref|XP_009594850.1|  PREDICTED: 40S ribosomal protein Sa-2-like i...    292   1e-95   Nicotiana tomentosiformis
ref|XP_009594852.1|  PREDICTED: 40S ribosomal protein SA {ECO:000...    291   1e-95   Nicotiana tomentosiformis
ref|XP_009594851.1|  PREDICTED: 40S ribosomal protein SA {ECO:000...    291   1e-95   Nicotiana tomentosiformis
ref|XP_009594849.1|  PREDICTED: 40S ribosomal protein Sa-2-like i...    292   2e-95   Nicotiana tomentosiformis
gb|KJB67081.1|  hypothetical protein B456_010G173800                    289   2e-95   Gossypium raimondii
ref|XP_004165149.1|  PREDICTED: 40S ribosomal protein SA-like           291   2e-95   
ref|XP_011086761.1|  PREDICTED: 40S ribosomal protein SA-like           291   3e-95   Sesamum indicum [beniseed]
gb|KDP40652.1|  hypothetical protein JCGZ_24651                         291   5e-95   Jatropha curcas
gb|KJB67082.1|  hypothetical protein B456_010G173800                    290   1e-94   Gossypium raimondii
ref|XP_008453731.1|  PREDICTED: 40S ribosomal protein SA-like           289   1e-94   Cucumis melo [Oriental melon]
ref|XP_002268664.1|  PREDICTED: 40S ribosomal protein SA                289   2e-94   Vitis vinifera
gb|KHG23357.1|  40S ribosomal SA                                        289   2e-94   Gossypium arboreum [tree cotton]
gb|AFK36852.1|  unknown                                                 284   3e-94   Medicago truncatula
ref|XP_004149157.1|  PREDICTED: 40S ribosomal protein SA-like           288   3e-94   
gb|KDP29482.1|  hypothetical protein JCGZ_19441                         288   3e-94   Jatropha curcas
ref|XP_002529989.1|  40S ribosomal protein sa, putative                 288   3e-94   Ricinus communis
gb|KHG05910.1|  40S ribosomal SA                                        288   4e-94   Gossypium arboreum [tree cotton]
gb|KJB70073.1|  hypothetical protein B456_011G056700                    288   4e-94   Gossypium raimondii
gb|KJB70074.1|  hypothetical protein B456_011G056700                    288   6e-94   Gossypium raimondii
ref|XP_011076899.1|  PREDICTED: 40S ribosomal protein SA-like           287   7e-94   Sesamum indicum [beniseed]
ref|XP_009789865.1|  PREDICTED: 40S ribosomal protein SA-like           287   8e-94   Nicotiana sylvestris
ref|XP_004162167.1|  PREDICTED: 40S ribosomal protein SA-like           287   9e-94   
ref|XP_009631471.1|  PREDICTED: 40S ribosomal protein SA {ECO:000...    287   9e-94   
ref|XP_004138372.1|  PREDICTED: 40S ribosomal protein SA-like           287   9e-94   Cucumis sativus [cucumbers]
ref|XP_008463065.1|  PREDICTED: 40S ribosomal protein SA-like           287   1e-93   Cucumis melo [Oriental melon]
ref|XP_011087109.1|  PREDICTED: 40S ribosomal protein SA-like           285   1e-93   
ref|XP_004165738.1|  PREDICTED: 40S ribosomal protein SA-like           286   2e-93   
ref|XP_004144441.1|  PREDICTED: 40S ribosomal protein SA-like           286   2e-93   Cucumis sativus [cucumbers]
ref|XP_010029483.1|  PREDICTED: 40S ribosomal protein SA-like iso...    286   3e-93   Eucalyptus grandis [rose gum]
ref|XP_010029484.1|  PREDICTED: 40S ribosomal protein SA-like iso...    286   4e-93   Eucalyptus grandis [rose gum]
gb|KCW56412.1|  hypothetical protein EUGRSUZ_I02137                     286   4e-93   Eucalyptus grandis [rose gum]
ref|XP_010932352.1|  PREDICTED: 40S ribosomal protein SA-like           285   4e-93   Elaeis guineensis
ref|XP_007024738.1|  40s ribosomal protein SA                           286   4e-93   
ref|XP_010101261.1|  40S ribosomal protein SA                           285   5e-93   Morus notabilis
ref|XP_010273906.1|  PREDICTED: 40S ribosomal protein SA-like           285   6e-93   Nelumbo nucifera [Indian lotus]
ref|XP_010531882.1|  PREDICTED: 40S ribosomal protein Sa-1-like         285   6e-93   Tarenaya hassleriana [spider flower]
ref|NP_001275039.1|  40S ribosomal protein SA-like                      285   7e-93   Solanum tuberosum [potatoes]
ref|XP_010261714.1|  PREDICTED: 40S ribosomal protein SA                285   7e-93   Nelumbo nucifera [Indian lotus]
ref|XP_004234315.1|  PREDICTED: 40S ribosomal protein SA-like           285   8e-93   Solanum lycopersicum
ref|XP_010101256.1|  40S ribosomal protein SA                           285   8e-93   Morus notabilis
ref|XP_004303733.1|  PREDICTED: 40S ribosomal protein Sa-2              285   9e-93   Fragaria vesca subsp. vesca
sp|O80377.1|RSSA_DAUCA  RecName: Full=40S ribosomal protein SA; A...    284   1e-92   Daucus carota [carrots]
ref|XP_008783010.1|  PREDICTED: 40S ribosomal protein SA-like           284   1e-92   Phoenix dactylifera
ref|XP_006426770.1|  hypothetical protein CICLE_v10026113mg             285   1e-92   Citrus clementina [clementine]
ref|XP_010917402.1|  PREDICTED: 40S ribosomal protein SA-like           284   1e-92   Elaeis guineensis
ref|XP_009334275.1|  PREDICTED: 40S ribosomal protein SA-like iso...    284   1e-92   Pyrus x bretschneideri [bai li]
ref|XP_006426769.1|  hypothetical protein CICLE_v10026113mg             285   1e-92   Citrus clementina [clementine]
ref|XP_008372546.1|  PREDICTED: 40S ribosomal protein SA-like           284   1e-92   
ref|XP_006465826.1|  PREDICTED: 40S ribosomal protein SA-like iso...    285   2e-92   Citrus sinensis [apfelsine]
ref|XP_009340328.1|  PREDICTED: 40S ribosomal protein Sa-2-like         284   2e-92   Pyrus x bretschneideri [bai li]
ref|XP_009372196.1|  PREDICTED: 40S ribosomal protein SA-like           284   2e-92   Pyrus x bretschneideri [bai li]
ref|XP_006465827.1|  PREDICTED: 40S ribosomal protein SA-like iso...    284   2e-92   Citrus sinensis [apfelsine]
ref|NP_001237424.1|  40S ribosomal protein SA                           284   2e-92   Glycine max [soybeans]
ref|XP_009334274.1|  PREDICTED: 40S ribosomal protein SA-like iso...    284   2e-92   Pyrus x bretschneideri [bai li]
ref|XP_008348972.1|  PREDICTED: 40S ribosomal protein SA-like           284   2e-92   Malus domestica [apple tree]
ref|XP_003547867.1|  PREDICTED: 40S ribosomal protein SA                284   2e-92   Glycine max [soybeans]
ref|XP_008784360.1|  PREDICTED: 40S ribosomal protein SA-like           284   2e-92   Phoenix dactylifera
gb|ABK26340.1|  unknown                                                 284   2e-92   Picea sitchensis
ref|XP_004985475.1|  PREDICTED: 40S ribosomal protein SA-like           284   2e-92   Setaria italica
ref|XP_008800462.1|  PREDICTED: 40S ribosomal protein SA-like           284   2e-92   Phoenix dactylifera
gb|ABK24517.1|  unknown                                                 284   3e-92   Picea sitchensis
ref|XP_010101328.1|  40S ribosomal protein SA                           283   4e-92   
ref|XP_010937280.1|  PREDICTED: 40S ribosomal protein SA-like           283   4e-92   Elaeis guineensis
ref|XP_003602573.1|  40S ribosomal protein SA                           283   4e-92   Medicago truncatula
gb|ACJ84512.1|  unknown                                                 283   4e-92   Medicago truncatula
ref|XP_003602572.1|  40S ribosomal protein SA                           283   5e-92   
ref|XP_004287064.1|  PREDICTED: 40S ribosomal protein Sa-2-like         283   5e-92   Fragaria vesca subsp. vesca
ref|XP_007135387.1|  hypothetical protein PHAVU_010G125100g             283   5e-92   Phaseolus vulgaris [French bean]
ref|XP_007135386.1|  hypothetical protein PHAVU_010G125100g             283   5e-92   Phaseolus vulgaris [French bean]
ref|XP_007135385.1|  hypothetical protein PHAVU_010G125100g             283   6e-92   Phaseolus vulgaris [French bean]
gb|KHN01455.1|  40S ribosomal protein SA                                283   7e-92   Glycine soja [wild soybean]
ref|XP_010540101.1|  PREDICTED: 40S ribosomal protein SA-like           282   9e-92   Tarenaya hassleriana [spider flower]
ref|NP_001149295.1|  40S ribosomal protein SA                           282   9e-92   Zea mays [maize]
ref|XP_008228346.1|  PREDICTED: 40S ribosomal protein Sa-2-like         282   9e-92   Prunus mume [ume]
ref|XP_009357906.1|  PREDICTED: 40S ribosomal protein SA-like           282   9e-92   Pyrus x bretschneideri [bai li]
ref|XP_008660474.1|  PREDICTED: 40S ribosomal protein SA-like           282   1e-91   Zea mays [maize]
ref|XP_011036520.1|  PREDICTED: 40S ribosomal protein Sa-2-like         282   1e-91   Populus euphratica
ref|XP_004984085.1|  PREDICTED: 40S ribosomal protein SA-like           282   1e-91   Setaria italica
ref|XP_008460335.1|  PREDICTED: 40S ribosomal protein SA-like iso...    285   1e-91   
ref|XP_009357926.1|  PREDICTED: 40S ribosomal protein SA-like           281   1e-91   Pyrus x bretschneideri [bai li]
ref|XP_008392094.1|  PREDICTED: 40S ribosomal protein SA-like           281   1e-91   Malus domestica [apple tree]
ref|XP_008460336.1|  PREDICTED: 40S ribosomal protein SA-like iso...    284   2e-91   
ref|XP_009338332.1|  PREDICTED: 40S ribosomal protein SA-like           281   2e-91   Pyrus x bretschneideri [bai li]
ref|XP_008380754.1|  PREDICTED: 40S ribosomal protein SA-like           281   2e-91   
ref|XP_002303327.2|  hypothetical protein POPTR_0003s06880g             281   2e-91   Populus trichocarpa [western balsam poplar]
ref|XP_007200516.1|  hypothetical protein PRUPE_ppa009383mg             281   2e-91   
ref|XP_007217253.1|  hypothetical protein PRUPE_ppa008193mg             282   2e-91   
ref|NP_001141003.1|  acidic ribosomal protein P40                       281   2e-91   Zea mays [maize]
gb|KHN21343.1|  40S ribosomal protein SA                                281   2e-91   Glycine soja [wild soybean]
ref|NP_001242462.1|  uncharacterized protein LOC100786575               281   2e-91   
ref|XP_008244692.1|  PREDICTED: 40S ribosomal protein SA-like iso...    281   3e-91   
ref|XP_008244693.1|  PREDICTED: 40S ribosomal protein SA-like iso...    281   3e-91   Prunus mume [ume]
gb|ABK92504.1|  unknown                                                 281   3e-91   Populus trichocarpa [western balsam poplar]
ref|XP_006369096.1|  hypothetical protein POPTR_0001s16430g             281   3e-91   Populus trichocarpa [western balsam poplar]
gb|KDO45739.1|  hypothetical protein CISIN_1g018448mg                   282   3e-91   Citrus sinensis [apfelsine]
gb|AFC88836.1|  40S ribosomal protein SA-like protein                   280   4e-91   Miscanthus sinensis
ref|XP_006827109.1|  hypothetical protein AMTR_s00010p00244660          280   4e-91   Amborella trichopoda
ref|XP_010537651.1|  PREDICTED: 40S ribosomal protein Sa-1              280   4e-91   Tarenaya hassleriana [spider flower]
ref|XP_002322328.1|  40S ribosomal protein SA                           280   5e-91   Populus trichocarpa [western balsam poplar]
ref|XP_003638087.1|  40S ribosomal protein SA                           280   7e-91   
gb|EMT31083.1|  40S ribosomal protein SA                                280   7e-91   
tpg|DAA43716.1|  TPA: hypothetical protein ZEAMMB73_272794              280   8e-91   
ref|XP_004958311.1|  PREDICTED: 40S ribosomal protein SA-like           280   8e-91   Setaria italica
gb|EPS72131.1|  hypothetical protein M569_02626                         279   8e-91   Genlisea aurea
gb|ACG32965.1|  40S ribosomal protein SA                                280   8e-91   Zea mays [maize]
ref|XP_011048610.1|  PREDICTED: 40S ribosomal protein SA                280   9e-91   Populus euphratica
ref|XP_007149128.1|  hypothetical protein PHAVU_005G043400g             280   1e-90   Phaseolus vulgaris [French bean]
pdb|3J60|A  Chain A, Localization Of The Small Subunit Ribosomal ...    278   1e-90   Triticum aestivum [Canadian hard winter wheat]
gb|KCW53364.1|  hypothetical protein EUGRSUZ_J02605                     280   1e-90   Eucalyptus grandis [rose gum]
gb|EAY90376.1|  hypothetical protein OsI_11954                          279   1e-90   Oryza sativa Indica Group [Indian rice]
ref|XP_010033665.1|  PREDICTED: 40S ribosomal protein Sa-2-like         280   1e-90   Eucalyptus grandis [rose gum]
gb|ABK93980.1|  unknown                                                 280   1e-90   Populus trichocarpa [western balsam poplar]
ref|XP_008797377.1|  PREDICTED: 40S ribosomal protein SA-like           279   1e-90   Phoenix dactylifera
gb|ABF94326.1|  40S ribosomal protein SA, putative, expressed           278   2e-90   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001141088.1|  uncharacterized protein LOC100273170               279   2e-90   Zea mays [maize]
ref|XP_004502915.1|  PREDICTED: 40S ribosomal protein SA-like           278   2e-90   
gb|EAY88799.1|  hypothetical protein OsI_10272                          278   2e-90   Oryza sativa Indica Group [Indian rice]
gb|AAK92638.1|AC079633_18  Putative 40S Ribosomal protein               278   2e-90   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006851847.1|  hypothetical protein AMTR_s00041p00084080          279   2e-90   Amborella trichopoda
ref|NP_001060277.1|  Os07g0616600                                       278   2e-90   
gb|EAZ04711.1|  hypothetical protein OsI_26872                          278   2e-90   Oryza sativa Indica Group [Indian rice]
ref|XP_006650178.1|  PREDICTED: 40S ribosomal protein SA-like           278   3e-90   Oryza brachyantha
ref|XP_003557751.1|  PREDICTED: 40S ribosomal protein SA-like           278   3e-90   Brachypodium distachyon [annual false brome]
ref|XP_002463182.1|  hypothetical protein SORBIDRAFT_02g039270          278   3e-90   Sorghum bicolor [broomcorn]
emb|CDO98217.1|  unnamed protein product                                278   4e-90   Coffea canephora [robusta coffee]
gb|ADE77919.1|  unknown                                                 279   4e-90   Picea sitchensis
ref|NP_001242344.1|  uncharacterized protein LOC100818292               278   5e-90   
gb|ACG32855.1|  40S ribosomal protein SA                                278   5e-90   Zea mays [maize]
ref|XP_003558658.1|  PREDICTED: 40S ribosomal protein SA-like           277   7e-90   Brachypodium distachyon [annual false brome]
ref|XP_010685248.1|  PREDICTED: 40S ribosomal protein SA-like           277   7e-90   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006390667.1|  hypothetical protein EUTSA_v10018783mg             277   7e-90   
ref|XP_004502927.1|  PREDICTED: 40S ribosomal protein SA-like           277   9e-90   Cicer arietinum [garbanzo]
ref|XP_008668036.1|  PREDICTED: 40S ribosomal protein SA isoform X1     277   1e-89   
emb|CDY03641.1|  BnaA02g15960D                                          276   1e-89   
tpg|DAA43205.1|  TPA: 40S ribosomal protein SA                          279   1e-89   
ref|XP_009127928.1|  PREDICTED: 40S ribosomal protein SA-like           276   1e-89   Brassica rapa
ref|XP_008386277.1|  PREDICTED: LOW QUALITY PROTEIN: 40S ribosoma...    275   1e-89   
ref|NP_001266097.1|  40S ribosomal protein SA                           276   1e-89   Cicer arietinum [garbanzo]
gb|KJB67080.1|  hypothetical protein B456_010G173800                    277   1e-89   Gossypium raimondii
gb|ACG27786.1|  40S ribosomal protein SA                                276   1e-89   Zea mays [maize]
emb|CDX82152.1|  BnaC02g21380D                                          276   1e-89   
ref|XP_009414830.1|  PREDICTED: 40S ribosomal protein SA-like           276   2e-89   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006302619.1|  hypothetical protein CARUB_v10020725mg             276   2e-89   Capsella rubella
ref|XP_002884469.1|  hypothetical protein ARALYDRAFT_477746             277   2e-89   
ref|NP_001031267.1|  40S ribosomal protein Sa-1                         276   2e-89   Arabidopsis thaliana [mouse-ear cress]
ref|NP_177381.1|  40S ribosomal protein Sa-1                            276   2e-89   Arabidopsis thaliana [mouse-ear cress]
emb|CDY46144.1|  BnaA04g14320D                                          276   2e-89   Brassica napus [oilseed rape]
emb|CDY20307.1|  BnaC04g36490D                                          276   2e-89   Brassica napus [oilseed rape]
ref|XP_011074611.1|  PREDICTED: LOW QUALITY PROTEIN: 40S ribosoma...    276   2e-89   
ref|XP_002888871.1|  hypothetical protein ARALYDRAFT_895089             276   2e-89   Arabidopsis lyrata subsp. lyrata
ref|XP_006390664.1|  hypothetical protein EUTSA_v10018783mg             277   3e-89   
ref|XP_009140544.1|  PREDICTED: 40S ribosomal protein Sa-1-like i...    275   4e-89   Brassica rapa
ref|XP_009408973.1|  PREDICTED: 40S ribosomal protein Sa-2-like         275   5e-89   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009140545.1|  PREDICTED: 40S ribosomal protein SA-like iso...    275   5e-89   Brassica rapa
gb|KFK41658.1|  hypothetical protein AALP_AA2G156100                    275   5e-89   Arabis alpina [alpine rockcress]
ref|XP_003562847.1|  PREDICTED: 40S ribosomal protein Sa-2-like         275   6e-89   Brachypodium distachyon [annual false brome]
ref|NP_187128.1|  40S ribosomal protein Sa-2                            274   7e-89   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003562657.1|  PREDICTED: 40S ribosomal protein Sa-2-like         275   7e-89   Brachypodium distachyon [annual false brome]
emb|CAA48794.1|  laminin receptor homologue                             275   7e-89   Arabidopsis thaliana [mouse-ear cress]
emb|CAA61547.1|  40kD protein                                           274   1e-88   Arabidopsis thaliana [mouse-ear cress]
gb|EMT25827.1|  40S ribosomal protein SA                                274   1e-88   
ref|XP_011040351.1|  PREDICTED: 40S ribosomal protein SA-like           274   1e-88   Populus euphratica
ref|XP_010669330.1|  PREDICTED: 40S ribosomal protein Sa-2-like         273   1e-88   Beta vulgaris subsp. vulgaris [field beet]
gb|EMS59326.1|  40S ribosomal protein SA                                274   2e-88   Triticum urartu
emb|CDY50642.1|  BnaC06g24350D                                          273   2e-88   Brassica napus [oilseed rape]
gb|EYU25918.1|  hypothetical protein MIMGU_mgv1a0106061mg               268   2e-88   Erythranthe guttata [common monkey flower]
emb|CDX68268.1|  BnaA07g23080D                                          273   3e-88   
ref|XP_010428118.1|  PREDICTED: 40S ribosomal protein Sa-1-like         273   4e-88   
ref|NP_001149804.1|  40S ribosomal protein SA                           273   4e-88   
ref|XP_006298231.1|  hypothetical protein CARUB_v10014291mg             272   4e-88   Capsella rubella
gb|AAM64971.1|  putative 40S ribosomal protein                          272   4e-88   Arabidopsis thaliana [mouse-ear cress]
ref|NP_850515.1|  40S ribosomal protein Sa-2                            273   5e-88   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011001300.1|  PREDICTED: 40S ribosomal protein Sa-2-like i...    272   6e-88   Populus euphratica
ref|XP_010463964.1|  PREDICTED: 40S ribosomal protein Sa-2              271   6e-88   Camelina sativa [gold-of-pleasure]
ref|XP_011001299.1|  PREDICTED: 40S ribosomal protein SA-like iso...    272   6e-88   Populus euphratica
ref|XP_002966682.1|  hypothetical protein SELMODRAFT_36118              269   7e-88   
emb|CDX72910.1|  BnaC06g33580D                                          271   8e-88   
sp|Q9ZSR8.1|RSSA_BRANA  RecName: Full=40S ribosomal protein SA; A...    271   9e-88   Brassica napus [oilseed rape]
ref|XP_010415982.1|  PREDICTED: 40S ribosomal protein Sa-1-like         271   1e-87   Camelina sativa [gold-of-pleasure]
ref|XP_006376986.1|  hypothetical protein POPTR_0012s11830g             271   2e-87   Populus trichocarpa [western balsam poplar]
ref|XP_010471264.1|  PREDICTED: 40S ribosomal protein Sa-1              271   2e-87   Camelina sativa [gold-of-pleasure]
ref|XP_009104860.1|  PREDICTED: 40S ribosomal protein SA-like           270   2e-87   Brassica rapa
gb|AAN18120.1|  At3g04770/F7O18_26                                      271   3e-87   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009387628.1|  PREDICTED: 40S ribosomal protein Sa-2-like i...    270   3e-87   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAL77699.1|  AT3g04770/F7O18_26                                      271   3e-87   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009387629.1|  PREDICTED: 40S ribosomal protein Sa-2-like i...    270   3e-87   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABA81872.1|  ribosome-associated protein p40-like                    268   1e-86   Solanum tuberosum [potatoes]
ref|XP_010939863.1|  PREDICTED: 40S ribosomal protein SA-like           268   2e-86   
gb|KHN49065.1|  40S ribosomal protein SA                                267   4e-86   Glycine soja [wild soybean]
gb|KFK37891.1|  hypothetical protein AALP_AA3G042600                    267   4e-86   Arabis alpina [alpine rockcress]
ref|XP_006408150.1|  hypothetical protein EUTSA_v10022011mg             264   4e-85   
ref|XP_009117134.1|  PREDICTED: 40S ribosomal protein SA-like           260   1e-83   Brassica rapa
ref|XP_001763188.1|  predicted protein                                  259   6e-83   
ref|XP_001761349.1|  predicted protein                                  258   2e-82   
ref|XP_001776650.1|  predicted protein                                  258   2e-82   
ref|XP_001774174.1|  predicted protein                                  256   5e-82   
ref|XP_005645300.1|  ribosomal protein S2                               255   3e-81   Coccomyxa subellipsoidea C-169
ref|XP_010485861.1|  PREDICTED: 40S ribosomal protein Sa-2-like         254   3e-81   Camelina sativa [gold-of-pleasure]
emb|CDY34776.1|  BnaA09g41430D                                          265   6e-80   Brassica napus [oilseed rape]
ref|XP_002499912.1|  predicted protein                                  248   1e-78   Micromonas commoda
gb|EMS60591.1|  40S ribosomal protein SA                                246   2e-78   Triticum urartu
ref|XP_003055242.1|  predicted protein                                  243   4e-77   Micromonas pusilla CCMP1545
ref|XP_002947037.1|  component of cytosolic 80S ribosome and 40S ...    244   4e-77   Volvox carteri f. nagariensis
ref|XP_001702485.1|  ribosomal protein Sa, component of cytosolic...    243   1e-76   Chlamydomonas reinhardtii
ref|XP_009105896.1|  PREDICTED: LOW QUALITY PROTEIN: 40S ribosoma...    243   1e-76   Brassica rapa
gb|KIZ04526.1|  small subunit ribosomal protein SAe                     241   6e-76   Monoraphidium neglectum
ref|XP_001776686.1|  predicted protein                                  229   1e-73   
emb|CBI35816.3|  unnamed protein product                                234   2e-73   Vitis vinifera
ref|XP_003078238.1|  B1056G08.113 gene product (ISS)                    233   2e-72   
sp|Q01CH5.2|RSSA_OSTTA  RecName: Full=40S ribosomal protein SA          231   3e-72   Ostreococcus tauri
emb|CBX25070.1|  40S ribosomal protein SA                               231   3e-72   Polytomella sp. Pringsheim 198.80
ref|XP_006649508.1|  PREDICTED: 40S ribosomal protein SA-like           231   8e-72   
ref|XP_007511079.1|  predicted protein                                  230   1e-71   Bathycoccus prasinos
ref|XP_006657956.1|  PREDICTED: 40S ribosomal protein SA-like           228   3e-71   
ref|XP_005847675.1|  hypothetical protein CHLNCDRAFT_134066             228   7e-71   Chlorella variabilis
ref|XP_001416686.1|  Ribosomal protein Sa, component of cytosolic...    227   2e-70   Ostreococcus lucimarinus CCE9901
emb|CBN08645.1|  small nucleolar RNA, H/ACA box 62                      217   1e-66   Microcosmus squamiger
ref|XP_008868945.1|  ribosomal protein S2                               216   3e-66   Aphanomyces invadans
gb|AGH70213.1|  40S ribosomal protein SA                                214   3e-66   Placozoa sp. H4
emb|CDY55242.1|  BnaC02g44920D                                          215   3e-66   Brassica napus [oilseed rape]
ref|XP_002181180.1|  predicted protein                                  214   4e-66   Phaeodactylum tricornutum CCAP 1055/1
ref|XP_009037182.1|  hypothetical protein AURANDRAFT_4875               211   3e-65   Aureococcus anophagefferens
ref|XP_005767823.1|  hypothetical protein EMIHUDRAFT_356503             213   3e-65   Emiliania huxleyi CCMP1516
ref|XP_008619402.1|  30S ribosomal protein SAe                          213   3e-65   Saprolegnia diclina VS20
ref|XP_011399769.1|  40S ribosomal protein Sa-2                         213   3e-65   Auxenochlorella protothecoides
ref|XP_009827016.1|  ribosomal protein S2                               213   4e-65   Aphanomyces astaci
ref|XP_006825592.1|  PREDICTED: 40S ribosomal protein SA-like           214   8e-65   Saccoglossus kowalevskii
gb|KDD76664.1|  ribosomal protein S2                                    210   8e-65   Helicosporidium sp. ATCC 50920
gb|EJU04455.1|  ribosomal protein S2                                    211   4e-64   Dacryopinax primogenitus
ref|XP_008915584.1|  ribosomal protein S2                               211   4e-64   Phytophthora parasitica INRA-310
ref|XP_002288449.1|  40S ribosomal protein-like protein                 209   5e-64   Thalassiosira pseudonana CCMP1335
gb|EUC64123.1|  40S ribosomal protein S0                                210   5e-64   Rhizoctonia solani AG-3 Rhs1AP
ref|XP_009523936.1|  hypothetical protein PHYSODRAFT_285573             210   6e-64   Phytophthora sojae
ref|XP_008482046.1|  PREDICTED: 40S ribosomal protein SA                207   9e-64   
gb|KDN49777.1|  hypothetical protein RSAG8_01842                        209   1e-63   Rhizoctonia solani AG-8 WAC10335
ref|XP_002908512.1|  40S ribosomal protein SA                           209   1e-63   Phytophthora infestans T30-4
emb|CBJ28597.1|  conserved unknown protein                              211   2e-63   Ectocarpus siliculosus
tpg|DAA34051.1|  TPA: 40S ribosomal protein SA                          207   2e-63   Amblyomma variegatum
ref|XP_005828150.1|  small subunit ribosomal protein SAe, cytopla...    208   3e-63   Guillardia theta CCMP2712
gb|ADV40166.1|  putative ribosomal protein SA                           209   3e-63   Latrodectus hesperus [black widow]
ref|XP_005828149.1|  hypothetical protein GUITHDRAFT_189772             208   3e-63   Guillardia theta CCMP2712
ref|XP_002109553.1|  expressed hypothetical protein                     208   4e-63   Trichoplax adhaerens
emb|CEL60785.1|  40S ribosomal protein S0 OS=Coprinopsis cinerea ...    208   4e-63   Rhizoctonia solani AG-1 IB
sp|Q0PXX8.1|RSSA_DIACI  RecName: Full=40S ribosomal protein SA          208   6e-63   Diaphorina citri
ref|XP_002397228.1|  hypothetical protein MPER_02384                    206   6e-63   
gb|KIJ68039.1|  hypothetical protein HYDPIDRAFT_71583                   204   8e-63   Hydnomerulius pinastri MD-312
gb|KEP54436.1|  40S ribosomal protein S0                                207   8e-63   Rhizoctonia solani 123E
ref|XP_001830732.1|  40S ribosomal protein S0                           207   9e-63   Coprinopsis cinerea okayama7#130
gb|AFR96845.1|  small subunit ribosomal protein S0                      207   9e-63   Cryptococcus neoformans var. grubii H99
ref|XP_007349567.1|  ribosomal protein S2                               207   1e-62   
ref|XP_007855226.1|  40s ribosomal protein s0                           207   1e-62   
gb|KDQ27344.1|  hypothetical protein PLEOSDRAFT_28314                   207   1e-62   Pleurotus ostreatus PC15
gb|KGB77085.1|  40S ribosomal protein S2                                207   1e-62   Cryptococcus gattii VGII R265
gb|KIR47603.1|  40S ribosomal protein S0                                207   1e-62   Cryptococcus gattii CA1280
ref|XP_572918.1|  40S ribosomal protein S0                              207   1e-62   Cryptococcus neoformans var. neoformans JEC21
ref|XP_003195934.1|  40S ribosomal protein S0                           207   2e-62   Cryptococcus gattii WM276
gb|KFH68178.1|  40S ribosomal protein S0                                206   2e-62   Mortierella verticillata NRRL 6337
gb|KJE01380.1|  40S ribosomal protein S0                                206   2e-62   Cryptococcus gattii NT-10
gb|EJK48596.1|  hypothetical protein THAOC_32592                        206   2e-62   Thalassiosira oceanica
gb|KIM45409.1|  hypothetical protein M413DRAFT_66339                    205   2e-62   Hebeloma cylindrosporum h7
ref|XP_006681266.1|  hypothetical protein BATDEDRAFT_90776              206   3e-62   Batrachochytrium dendrobatidis JAM81
gb|KDQ55698.1|  hypothetical protein JAAARDRAFT_37113                   206   3e-62   Jaapia argillacea MUCL 33604
ref|XP_007864283.1|  40S ribosomal protein S2                           206   3e-62   Gloeophyllum trabeum ATCC 11539
gb|ABO26619.1|  raminin receptor                                        207   3e-62   Haliotis discus discus
gb|KDQ21168.1|  hypothetical protein BOTBODRAFT_40065                   205   3e-62   Botryobasidium botryosum FD-172 SS1
ref|XP_007308068.1|  40S ribosomal protein S2                           206   4e-62   Stereum hirsutum FP-91666 SS1
gb|AAR10093.1|  similar to Drosophila melanogaster sta                  203   4e-62   Drosophila yakuba
ref|XP_001640103.1|  predicted protein                                  206   4e-62   Nematostella vectensis
emb|CCA70551.1|  probable 40S ribosomal protein s0                      205   5e-62   Serendipita indica DSM 11827
gb|KIP02583.1|  hypothetical protein PHLGIDRAFT_78940                   205   7e-62   Phlebiopsis gigantea 11061_1 CR5-6
dbj|BAB20389.1|  stubarista                                             203   7e-62   
dbj|BAB20388.1|  stubarista                                             203   7e-62   
dbj|BAB20387.1|  stubarista                                             203   7e-62   
gb|KIK69389.1|  hypothetical protein GYMLUDRAFT_153379                  205   7e-62   
gb|AFM87705.1|  40S ribosomal protein SA                                206   9e-62   
ref|XP_004521040.1|  PREDICTED: 40S ribosomal protein SA-like iso...    204   9e-62   
ref|XP_009547791.1|  hypothetical protein HETIRDRAFT_434917             205   9e-62   
ref|XP_009388357.1|  PREDICTED: 40S ribosomal protein SA-like           204   9e-62   
ref|XP_001877481.1|  40S ribosomal protein S0                           204   1e-61   
ref|XP_007318106.1|  hypothetical protein SERLADRAFT_466878             204   1e-61   
ref|XP_011213359.1|  PREDICTED: 40S ribosomal protein SA                204   1e-61   
ref|XP_007767238.1|  40S ribosomal protein S0                           204   1e-61   
gb|EJT48815.1|  40S ribosomal protein S0                                204   1e-61   
ref|NP_476750.1|  stubarista, isoform A                                 204   1e-61   
gb|AFM89239.1|  40S ribosomal protein SA                                205   2e-61   
ref|XP_001982520.1|  sta                                                204   2e-61   
ref|XP_005539390.1|  40S ribosomal protein SA                           204   2e-61   
gb|ACR24958.1|  ribosomal protein SA                                    202   2e-61   
gb|KIK09760.1|  hypothetical protein K443DRAFT_671082                   204   2e-61   
ref|XP_006460697.1|  hypothetical protein AGABI2DRAFT_192310            204   2e-61   
gb|AFM87728.1|  40S ribosomal protein SA                                205   2e-61   
ref|XP_011190522.1|  PREDICTED: 40S ribosomal protein SA                203   3e-61   
gb|KIK43918.1|  hypothetical protein CY34DRAFT_803251                   204   3e-61   
gb|KJA20040.1|  hypothetical protein HYPSUDRAFT_43658                   204   3e-61   
gb|KIY62223.1|  ribosomal protein S2                                    203   3e-61   
gb|KIM69624.1|  hypothetical protein SCLCIDRAFT_1208099                 203   4e-61   
emb|CCI41323.1|  unnamed protein product                                203   4e-61   
gb|KIK94558.1|  hypothetical protein PAXRUDRAFT_142569                  203   4e-61   
ref|XP_007397583.1|  hypothetical protein PHACADRAFT_259076             203   4e-61   
gb|AFM90952.1|  40S ribosomal protein SA                                204   4e-61   
ref|XP_002475905.1|  40S ribosomal protein S0                           200   5e-61   
gb|AFM87948.1|  40S ribosomal protein SA                                204   5e-61   
gb|AFM85544.1|  40S ribosomal protein SA                                204   5e-61   
emb|CDO76057.1|  hypothetical protein BN946_scf184696.g9                203   5e-61   
gb|AFM88817.1|  40S ribosomal protein SA                                204   5e-61   
ref|XP_970069.1|  PREDICTED: 40S ribosomal protein SA                   203   5e-61   
gb|AFM87058.1|  40S ribosomal protein SA                                204   5e-61   
gb|AFM87646.1|  40S ribosomal protein SA                                204   5e-61   
gb|AFM89164.1|  40S ribosomal protein SA                                204   6e-61   
gb|AFM86476.1|  40S ribosomal protein SA                                204   6e-61   
gb|AFM87149.1|  40S ribosomal protein SA                                204   6e-61   
ref|NP_001279647.1|  ribosomal protein SA                               204   6e-61   
gb|AFM86536.1|  40S ribosomal protein SA                                204   6e-61   
gb|AFM87602.1|  40S ribosomal protein SA                                204   7e-61   
sp|P38980.1|RSSA_TRIGR  RecName: Full=40S ribosomal protein SA          203   7e-61   
gb|AFM85772.1|  40S ribosomal protein SA                                204   7e-61   
gb|AFM86197.1|  40S ribosomal protein SA                                203   7e-61   
gb|AFM86406.1|  40S ribosomal protein SA                                203   7e-61   
gb|AFM88508.1|  40S ribosomal protein SA                                203   7e-61   
gb|KIJ18519.1|  hypothetical protein PAXINDRAFT_167126                  202   8e-61   
gb|KIM78842.1|  hypothetical protein PILCRDRAFT_98271                   202   9e-61   
ref|XP_004343581.2|  40S ribosomal protein SA                           202   9e-61   
gb|AFM89272.1|  40S ribosomal protein SA                                203   1e-60   
gb|KIJ39422.1|  hypothetical protein M422DRAFT_32682                    202   1e-60   
gb|EPZ35235.1|  40S ribosomal protein S0                                201   1e-60   
gb|AFM90103.1|  40S ribosomal protein SA                                203   1e-60   
gb|ACU12388.1|  RE42047p                                                202   1e-60   
sp|P38979.2|RSSA_DROME  RecName: Full=40S ribosomal protein SA; A...    202   1e-60   
ref|XP_005177620.1|  PREDICTED: 40S ribosomal protein SA                201   1e-60   
gb|AFM90458.1|  40S ribosomal protein SA                                203   1e-60   
gb|AFM87805.1|  40S ribosomal protein SA                                202   1e-60   
gb|EMD33737.1|  hypothetical protein CERSUDRAFT_117828                  202   1e-60   
ref|XP_002021930.1|  GL14373                                            201   1e-60   
gb|KIK24741.1|  hypothetical protein PISMIDRAFT_677816                  202   2e-60   
emb|CCA13922.1|  40S ribosomal protein SA putative                      201   2e-60   
gb|KDR75054.1|  hypothetical protein GALMADRAFT_268597                  202   2e-60   
ref|XP_009701855.1|  PREDICTED: 40S ribosomal protein SA isoform X3     197   2e-60   
ref|XP_008155328.1|  PREDICTED: 40S ribosomal protein SA                197   2e-60   
gb|ELK36285.1|  40S ribosomal protein SA                                198   2e-60   
gb|AFM90842.1|  40S ribosomal protein SA                                202   2e-60   
gb|AFM87076.1|  40S ribosomal protein SA                                202   2e-60   
gb|AAR09833.1|  similar to Drosophila melanogaster sta                  198   2e-60   
ref|XP_001964078.1|  GF21363                                            201   2e-60   
ref|XP_007361860.1|  40S ribosomal protein S2                           201   2e-60   
ref|XP_005691725.1|  PREDICTED: 40S ribosomal protein SA-like           197   3e-60   
ref|XP_792396.2|  PREDICTED: 40S ribosomal protein SA-like              197   3e-60   
gb|KIO09399.1|  hypothetical protein M404DRAFT_996227                   201   3e-60   
ref|XP_002126356.1|  PREDICTED: 40S ribosomal protein SA-like           201   3e-60   
gb|EAW64587.1|  ribosomal protein SA, isoform CRA_c                     197   3e-60   
gb|AFM90467.1|  40S ribosomal protein SA                                202   3e-60   
ref|XP_001995792.1|  GH17574                                            200   3e-60   
gb|AFM90622.1|  40S ribosomal protein SA                                202   3e-60   
ref|XP_002011364.1|  GI16040                                            200   3e-60   
gb|AFM88577.1|  40S ribosomal protein SA                                202   4e-60   
ref|XP_008366516.1|  PREDICTED: LOW QUALITY PROTEIN: 40S ribosoma...    198   4e-60   
ref|XP_007002593.1|  hypothetical protein TREMEDRAFT_43075              201   4e-60   
gb|ABZ04275.1|  ribosomal protein rpsA                                  199   5e-60   
ref|XP_002472771.1|  40S ribosomal protein S2                           200   5e-60   
gb|ELK28177.1|  40S ribosomal protein SA                                198   6e-60   
gb|AFM88174.1|  40S ribosomal protein SA                                201   6e-60   
ref|XP_006765902.1|  PREDICTED: 40S ribosomal protein SA-like           197   7e-60   
gb|EGW00844.1|  40S ribosomal protein SA                                196   8e-60   
ref|XP_008033543.1|  hypothetical protein TRAVEDRAFT_26398              200   8e-60   
ref|XP_009701854.1|  PREDICTED: 40S ribosomal protein SA isoform X2     197   9e-60   
ref|XP_002427526.1|  40S ribosomal protein SA, putative                 199   9e-60   
ref|XP_002782805.1|  40S ribosomal protein S0-B, putative               199   9e-60   
gb|KFW61041.1|  40S ribosomal protein SA                                197   9e-60   
ref|XP_009701853.1|  PREDICTED: 40S ribosomal protein SA isoform X1     197   9e-60   
ref|XP_002769858.1|  40S ribosomal protein S0-B, putative               199   1e-59   
gb|AFM85977.1|  40S ribosomal protein SA                                201   1e-59   
gb|KIM31563.1|  hypothetical protein M408DRAFT_261781                   199   1e-59   
gb|KIM22985.1|  hypothetical protein M408DRAFT_267633                   199   1e-59   
ref|XP_002261786.1|  40s ribosomal protein                              198   1e-59   
gb|KGG52834.1|  40S ribosomal protein S0                                199   1e-59   
ref|XP_002716404.1|  PREDICTED: 40S ribosomal protein SA                199   1e-59   
ref|XP_007380752.1|  40S ribosomal protein S2                           199   1e-59   
gb|AFM89480.1|  40S ribosomal protein SA                                200   2e-59   
ref|XP_004412174.1|  PREDICTED: 40S ribosomal protein SA                197   2e-59   
gb|KJE97271.1|  40S ribosomal protein SA                                200   2e-59   
ref|XP_006755671.1|  PREDICTED: 40S ribosomal protein SA-like           196   2e-59   
ref|XP_006755373.1|  PREDICTED: 40S ribosomal protein SA-like           196   2e-59   
sp|A6NA00.1|RSSA_ORNPR  RecName: Full=40S ribosomal protein SA          199   2e-59   
ref|XP_002075534.1|  GK14587                                            198   2e-59   
ref|XP_006636998.1|  PREDICTED: 40S ribosomal protein SA-like           199   2e-59   
gb|EAW84950.1|  similar to Laminin receptor 1, isoform CRA_a            196   2e-59   
ref|XP_003029681.1|  40S ribosomal protein S0                           199   2e-59   
gb|EPS97594.1|  hypothetical protein FOMPIDRAFT_1128428                 199   2e-59   
ref|XP_001608501.1|  40S ribosomal protein                              197   2e-59   
gb|AFM87117.1|  40S ribosomal protein SA                                199   3e-59   
gb|KFQ75259.1|  40S ribosomal protein SA                                197   3e-59   
gb|ABX44772.1|  putative 40S ribosomal protein RPSA                     194   3e-59   
ref|XP_008817226.1|  40S ribosomal protein SA                           197   3e-59   
gb|AAA39413.1|  laminin receptor                                        198   3e-59   
ref|NP_001089106.1|  40S ribosomal protein SA                           199   3e-59   
ref|XP_009920779.1|  PREDICTED: 40S ribosomal protein SA isoform X1     198   3e-59   
ref|XP_009081190.1|  PREDICTED: 40S ribosomal protein SA isoform X1     198   3e-59   
ref|XP_008491396.1|  PREDICTED: 40S ribosomal protein SA                198   4e-59   
ref|XP_009813180.1|  PREDICTED: 40S ribosomal protein SA                197   4e-59   
ref|NP_001232377.1|  40S ribosomal protein SA                           198   4e-59   
gb|KFP21952.1|  40S ribosomal protein SA                                198   4e-59   
gb|KFP59484.1|  40S ribosomal protein SA                                197   4e-59   
ref|XP_009462732.1|  PREDICTED: 40S ribosomal protein SA                198   4e-59   
ref|NP_001007824.1|  40S ribosomal protein SA                           198   4e-59   
ref|XP_005016997.1|  PREDICTED: 40S ribosomal protein SA isoform X2     198   4e-59   
ref|XP_003224007.1|  PREDICTED: 40S ribosomal protein SA                198   4e-59   
gb|KFV44035.1|  40S ribosomal protein SA                                197   4e-59   
ref|XP_004640708.1|  PREDICTED: 40S ribosomal protein SA                198   4e-59   
ref|XP_007432737.1|  PREDICTED: 40S ribosomal protein SA-like           198   4e-59   
ref|XP_008203004.1|  PREDICTED: 40S ribosomal protein SA                199   4e-59   
ref|XP_005802860.1|  PREDICTED: 40S ribosomal protein SA-like           198   4e-59   
ref|XP_010304779.1|  PREDICTED: 40S ribosomal protein SA isoform X1     198   4e-59   
ref|XP_009999990.1|  PREDICTED: 40S ribosomal protein SA                198   4e-59   
gb|ETE59642.1|  40S ribosomal protein SA                                198   5e-59   
ref|XP_009500164.1|  PREDICTED: 40S ribosomal protein SA                197   5e-59   
ref|XP_009644429.1|  PREDICTED: 40S ribosomal protein SA                198   5e-59   
gb|KIY53599.1|  ribosomal protein S2                                    198   5e-59   
pdb|4UQ4|A  Chain A, Mammalian 80s Hcv-ires Initiation Complex Wi...    197   5e-59   
ref|XP_004673223.1|  PREDICTED: LOW QUALITY PROTEIN: ribosomal pr...    197   6e-59   
gb|AAH70263.1|  Ribosomal protein SA                                    197   6e-59   
ref|XP_006005254.1|  PREDICTED: 40S ribosomal protein SA-like iso...    198   6e-59   
dbj|BAM19404.1|  stubarista                                             196   6e-59   
pdb|3BCH|A  Chain A, Crystal Structure Of The Human Laminin Recep...    196   6e-59   
gb|EDL11947.1|  mCG2650                                                 197   6e-59   
gb|KHJ48313.1|  ribosomal protein S2                                    197   6e-59   
gb|AGL08671.1|  laminin receptor 1                                      198   6e-59   
ref|XP_009990473.1|  PREDICTED: 40S ribosomal protein SA isoform X2     197   6e-59   
ref|XP_007664325.1|  PREDICTED: 40S ribosomal protein SA isoform X2     197   6e-59   
gb|AEB31270.1|  40S ribosomal protein Sa-like protein                   196   7e-59   
gb|ACB59248.1|  laminin receptor                                        197   7e-59   
ref|XP_004377367.1|  PREDICTED: 40S ribosomal protein SA                197   7e-59   
ref|NP_001098733.1|  40S ribosomal protein SA                           197   7e-59   
ref|XP_001516915.1|  PREDICTED: 40S ribosomal protein SA isoform X1     197   7e-59   
ref|XP_006121824.1|  PREDICTED: 40S ribosomal protein SA-like           199   7e-59   
ref|XP_005519084.1|  PREDICTED: 40S ribosomal protein SA-like iso...    197   7e-59   
ref|NP_001080730.1|  ribosomal protein SA                               198   7e-59   
ref|XP_009084446.1|  PREDICTED: 40S ribosomal protein SA isoform X2     197   7e-59   
ref|XP_010369821.1|  PREDICTED: 40S ribosomal protein SA                197   7e-59   
gb|AAH66941.1|  Ribosomal protein SA                                    197   7e-59   
gb|ACJ13448.1|  laminin receptor                                        197   7e-59   
gb|AAH50688.1|  Ribosomal protein SA                                    197   7e-59   
ref|XP_009319483.1|  PREDICTED: 40S ribosomal protein SA                197   7e-59   
ref|XP_005926767.1|  PREDICTED: 40S ribosomal protein SA-like           199   7e-59   
ref|XP_006194760.1|  PREDICTED: 40S ribosomal protein SA-like iso...    197   7e-59   
prf||1405340A  protein 40kD                                             197   7e-59
ref|NP_989068.1|  40S ribosomal protein SA                              198   7e-59   
ref|NP_001032223.1|  40S ribosomal protein SA                           197   7e-59   
gb|AAB22299.1|  67 kda laminin receptor                                 197   7e-59   
ref|XP_005242282.1|  PREDICTED: 40S ribosomal protein SA isoform X2     197   7e-59   
ref|XP_009212401.1|  PREDICTED: 40S ribosomal protein SA-like           197   7e-59   
ref|XP_005865250.1|  PREDICTED: 40S ribosomal protein SA-like           197   7e-59   
ref|NP_058834.1|  40S ribosomal protein SA                              197   7e-59   
ref|NP_001137423.1|  40S ribosomal protein SA                           197   7e-59   
ref|XP_006770607.1|  PREDICTED: 40S ribosomal protein SA-like           197   7e-59   
ref|NP_001182409.1|  uncharacterized protein LOC693293                  197   7e-59   
ref|NP_001091273.1|  uncharacterized protein LOC100037080               197   7e-59   
ref|XP_005348170.1|  PREDICTED: 40S ribosomal protein SA-like           197   7e-59   
ref|XP_004835182.1|  PREDICTED: 40S ribosomal protein SA                197   7e-59   
ref|XP_003415744.1|  PREDICTED: 40S ribosomal protein SA                197   7e-59   
ref|XP_008927802.1|  PREDICTED: 40S ribosomal protein SA isoform X2     197   7e-59   
ref|XP_008764894.1|  PREDICTED: 40S ribosomal protein SA isoform X1     197   7e-59   
gb|AAH92041.1|  Ribosomal protein SA                                    197   8e-59   
ref|XP_009081191.1|  PREDICTED: 40S ribosomal protein SA isoform X2     197   8e-59   
ref|NP_001230962.1|  40S ribosomal protein SA                           197   8e-59   
ref|XP_005317458.1|  PREDICTED: 40S ribosomal protein SA                197   8e-59   
ref|NP_001272678.1|  laminin receptor 1                                 197   8e-59   
ref|XP_010364062.1|  PREDICTED: 40S ribosomal protein SA-like           197   8e-59   
gb|AAP36925.1|  Homo sapiens laminin receptor 1 (ribosomal protei...    197   8e-59   
ref|NP_002286.2|  40S ribosomal protein SA isoform 1                    197   8e-59   
ref|XP_003443122.2|  PREDICTED: 40S ribosomal protein SA-like           199   8e-59   
ref|XP_004446478.1|  PREDICTED: 40S ribosomal protein SA-like           197   8e-59   
ref|XP_010121831.1|  PREDICTED: 40S ribosomal protein SA isoform X2     197   8e-59   
dbj|BAC38701.1|  unnamed protein product                                197   9e-59   
ref|XP_007119636.1|  PREDICTED: 40S ribosomal protein SA-like           197   9e-59   
gb|EDL24612.1|  mCG18671                                                194   9e-59   
ref|XP_010304781.1|  PREDICTED: 40S ribosomal protein SA isoform X2     197   9e-59   
ref|XP_010368998.1|  PREDICTED: 40S ribosomal protein SA-like           197   9e-59   
ref|XP_010219375.1|  PREDICTED: 40S ribosomal protein SA isoform X2     197   1e-58   
ref|XP_009477783.1|  PREDICTED: 40S ribosomal protein SA isoform X2     197   1e-58   
ref|XP_005321085.1|  PREDICTED: 40S ribosomal protein SA-like           197   1e-58   
gb|KFB50253.1|  AGAP011777-PA-like protein                              197   1e-58   
gb|AAP20147.1|  40S ribosomal protein Sa                                194   1e-58   
ref|XP_009920780.1|  PREDICTED: 40S ribosomal protein SA isoform X2     196   1e-58   
ref|XP_008632109.1|  PREDICTED: 40S ribosomal protein SA isoform X2     197   1e-58   
gb|EDL76884.1|  rCG25653, isoform CRA_g                                 195   1e-58   
gb|ACN10574.1|  40S ribosomal protein SA                                194   1e-58   
ref|XP_002173396.1|  40S ribosomal protein S0A                          196   1e-58   
ref|XP_010293938.1|  PREDICTED: 40S ribosomal protein SA isoform X2     197   1e-58   
gb|ENN77710.1|  hypothetical protein YQE_05782                          197   1e-58   
ref|XP_005880769.1|  PREDICTED: 40S ribosomal protein SA-like           197   1e-58   
gb|AIC58232.1|  RPSAP58                                                 197   1e-58   
gb|ADT80677.1|  ribosomal protein SA                                    197   1e-58   



>ref|XP_009761975.1| PREDICTED: 40S ribosomal protein SA-like [Nicotiana sylvestris]
Length=296

 Score =   293 bits (749),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 137/148 (93%), Positives = 143/148 (97%), Gaps = 0/148 (0%)
 Frame = +2

Query  122  MALSTMALSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQM  301
            MA     LSTKE+DIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQM
Sbjct  1    MAAEGRTLSTKEADIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQM  60

Query  302  AARVIVAIQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPR  481
            AARVIVAI+NP+DI+VQSARPYGQRAVLKFAQYTGA+AIAGRHTPGTFTNQLQTSY+EPR
Sbjct  61   AARVIVAIENPKDIIVQSARPYGQRAVLKFAQYTGANAIAGRHTPGTFTNQLQTSYSEPR  120

Query  482  LLILTDPRTDHQPIKEAALGNIPTIAFC  565
            LLILTDPRTDHQPIKEAALGNIPTIAFC
Sbjct  121  LLILTDPRTDHQPIKEAALGNIPTIAFC  148



>ref|XP_009602638.1| PREDICTED: 40S ribosomal protein SA {ECO:0000255|HAMAP-Rule:MF_03015}-like 
[Nicotiana tomentosiformis]
Length=296

 Score =   293 bits (749),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 137/148 (93%), Positives = 143/148 (97%), Gaps = 0/148 (0%)
 Frame = +2

Query  122  MALSTMALSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQM  301
            MA     LSTKE+DIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQM
Sbjct  1    MAAEGRTLSTKEADIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQM  60

Query  302  AARVIVAIQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPR  481
            AARVIVAI+NP+DI+VQSARPYGQRAVLKFAQYTGA+AIAGRHTPGTFTNQLQTSY+EPR
Sbjct  61   AARVIVAIENPKDIIVQSARPYGQRAVLKFAQYTGANAIAGRHTPGTFTNQLQTSYSEPR  120

Query  482  LLILTDPRTDHQPIKEAALGNIPTIAFC  565
            LLILTDPRTDHQPIKEAALGNIPTIAFC
Sbjct  121  LLILTDPRTDHQPIKEAALGNIPTIAFC  148



>ref|XP_009772296.1| PREDICTED: 40S ribosomal protein SA-like isoform X2 [Nicotiana 
sylvestris]
Length=296

 Score =   293 bits (749),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 137/148 (93%), Positives = 143/148 (97%), Gaps = 0/148 (0%)
 Frame = +2

Query  122  MALSTMALSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQM  301
            MA     LSTKE+DIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQM
Sbjct  1    MAAEGRTLSTKEADIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQM  60

Query  302  AARVIVAIQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPR  481
            AARVIVAI+NP+DI+VQSARPYGQRAVLKFAQYTGA+AIAGRHTPGTFTNQLQTSY+EPR
Sbjct  61   AARVIVAIENPKDIIVQSARPYGQRAVLKFAQYTGANAIAGRHTPGTFTNQLQTSYSEPR  120

Query  482  LLILTDPRTDHQPIKEAALGNIPTIAFC  565
            LLILTDPRTDHQPIKEAALGNIPTIAFC
Sbjct  121  LLILTDPRTDHQPIKEAALGNIPTIAFC  148



>ref|XP_004241486.1| PREDICTED: 40S ribosomal protein SA isoform X1 [Solanum lycopersicum]
Length=296

 Score =   293 bits (749),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 136/141 (96%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  143  LSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIVA  322
            LSTKE+DIQMMLAAEVHLGTKNCDFQMERY FKRRNDGIYIINLGKTWEKLQMAARVIVA
Sbjct  9    LSTKEADIQMMLAAEVHLGTKNCDFQMERYAFKRRNDGIYIINLGKTWEKLQMAARVIVA  68

Query  323  IQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTDP  502
            I+NPQDI+VQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSY+EPRLLILTDP
Sbjct  69   IENPQDIIVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYSEPRLLILTDP  128

Query  503  RTDHQPIKEAALGNIPTIAFC  565
            RTDHQPIKEAALGNIPTIAFC
Sbjct  129  RTDHQPIKEAALGNIPTIAFC  149



>ref|XP_010322515.1| PREDICTED: 40S ribosomal protein SA isoform X2 [Solanum lycopersicum]
Length=295

 Score =   292 bits (748),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 136/141 (96%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  143  LSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIVA  322
            LSTKE+DIQMMLAAEVHLGTKNCDFQMERY FKRRNDGIYIINLGKTWEKLQMAARVIVA
Sbjct  9    LSTKEADIQMMLAAEVHLGTKNCDFQMERYAFKRRNDGIYIINLGKTWEKLQMAARVIVA  68

Query  323  IQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTDP  502
            I+NPQDI+VQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSY+EPRLLILTDP
Sbjct  69   IENPQDIIVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYSEPRLLILTDP  128

Query  503  RTDHQPIKEAALGNIPTIAFC  565
            RTDHQPIKEAALGNIPTIAFC
Sbjct  129  RTDHQPIKEAALGNIPTIAFC  149



>ref|XP_009772295.1| PREDICTED: 40S ribosomal protein SA-like isoform X1 [Nicotiana 
sylvestris]
Length=297

 Score =   292 bits (748),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 137/148 (93%), Positives = 143/148 (97%), Gaps = 0/148 (0%)
 Frame = +2

Query  122  MALSTMALSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQM  301
            MA     LSTKE+DIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQM
Sbjct  1    MAAEGRTLSTKEADIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQM  60

Query  302  AARVIVAIQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPR  481
            AARVIVAI+NP+DI+VQSARPYGQRAVLKFAQYTGA+AIAGRHTPGTFTNQLQTSY+EPR
Sbjct  61   AARVIVAIENPKDIIVQSARPYGQRAVLKFAQYTGANAIAGRHTPGTFTNQLQTSYSEPR  120

Query  482  LLILTDPRTDHQPIKEAALGNIPTIAFC  565
            LLILTDPRTDHQPIKEAALGNIPTIAFC
Sbjct  121  LLILTDPRTDHQPIKEAALGNIPTIAFC  148



>ref|XP_006347389.1| PREDICTED: 40S ribosomal protein SA-like isoform X2 [Solanum 
tuberosum]
Length=295

 Score =   292 bits (747),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 136/141 (96%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  143  LSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIVA  322
            LSTKE+DIQMMLAAEVHLGTKNCDFQMERY FKRRNDGIYIINLGKTWEKLQMAARVIVA
Sbjct  9    LSTKEADIQMMLAAEVHLGTKNCDFQMERYAFKRRNDGIYIINLGKTWEKLQMAARVIVA  68

Query  323  IQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTDP  502
            I+NPQDI+VQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSY+EPRLLILTDP
Sbjct  69   IENPQDIIVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYSEPRLLILTDP  128

Query  503  RTDHQPIKEAALGNIPTIAFC  565
            RTDHQPIKEAALGNIPTIAFC
Sbjct  129  RTDHQPIKEAALGNIPTIAFC  149



>ref|XP_006347388.1| PREDICTED: 40S ribosomal protein SA-like isoform X1 [Solanum 
tuberosum]
Length=296

 Score =   292 bits (747),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 136/141 (96%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  143  LSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIVA  322
            LSTKE+DIQMMLAAEVHLGTKNCDFQMERY FKRRNDGIYIINLGKTWEKLQMAARVIVA
Sbjct  9    LSTKEADIQMMLAAEVHLGTKNCDFQMERYAFKRRNDGIYIINLGKTWEKLQMAARVIVA  68

Query  323  IQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTDP  502
            I+NPQDI+VQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSY+EPRLLILTDP
Sbjct  69   IENPQDIIVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYSEPRLLILTDP  128

Query  503  RTDHQPIKEAALGNIPTIAFC  565
            RTDHQPIKEAALGNIPTIAFC
Sbjct  129  RTDHQPIKEAALGNIPTIAFC  149



>gb|EPS72151.1| hypothetical protein M569_02606, partial [Genlisea aurea]
Length=282

 Score =   291 bits (746),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 136/150 (91%), Positives = 144/150 (96%), Gaps = 0/150 (0%)
 Frame = +2

Query  116  TTMALSTMALSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKL  295
            + MA +  ALSTKE DI+MMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIIN+GKTWEKL
Sbjct  1    SNMATTKRALSTKEDDIRMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINIGKTWEKL  60

Query  296  QMAARVIVAIQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNE  475
            Q+AARVIVAI+NPQDI+VQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTS+NE
Sbjct  61   QLAARVIVAIENPQDIIVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSFNE  120

Query  476  PRLLILTDPRTDHQPIKEAALGNIPTIAFC  565
            PRLLILTDPRTDHQPIKEAAL NIPTIAFC
Sbjct  121  PRLLILTDPRTDHQPIKEAALSNIPTIAFC  150



>ref|XP_009594850.1| PREDICTED: 40S ribosomal protein Sa-2-like isoform X2 [Nicotiana 
tomentosiformis]
Length=314

 Score =   292 bits (748),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 136/148 (92%), Positives = 143/148 (97%), Gaps = 0/148 (0%)
 Frame = +2

Query  122  MALSTMALSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQM  301
            MA     +STKE+DIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQM
Sbjct  1    MAAEGRTMSTKEADIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQM  60

Query  302  AARVIVAIQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPR  481
            AARVIVAI+NP+DI+VQSARPYGQRAVLKFAQYTGA+AIAGRHTPGTFTNQLQTSY+EPR
Sbjct  61   AARVIVAIENPKDIIVQSARPYGQRAVLKFAQYTGANAIAGRHTPGTFTNQLQTSYSEPR  120

Query  482  LLILTDPRTDHQPIKEAALGNIPTIAFC  565
            LLILTDPRTDHQPIKEAALGNIPTIAFC
Sbjct  121  LLILTDPRTDHQPIKEAALGNIPTIAFC  148



>ref|XP_009594852.1| PREDICTED: 40S ribosomal protein SA {ECO:0000255|HAMAP-Rule:MF_03015}-like 
isoform X4 [Nicotiana tomentosiformis]
Length=292

 Score =   291 bits (746),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 136/148 (92%), Positives = 143/148 (97%), Gaps = 0/148 (0%)
 Frame = +2

Query  122  MALSTMALSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQM  301
            MA     +STKE+DIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQM
Sbjct  1    MAAEGRTMSTKEADIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQM  60

Query  302  AARVIVAIQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPR  481
            AARVIVAI+NP+DI+VQSARPYGQRAVLKFAQYTGA+AIAGRHTPGTFTNQLQTSY+EPR
Sbjct  61   AARVIVAIENPKDIIVQSARPYGQRAVLKFAQYTGANAIAGRHTPGTFTNQLQTSYSEPR  120

Query  482  LLILTDPRTDHQPIKEAALGNIPTIAFC  565
            LLILTDPRTDHQPIKEAALGNIPTIAFC
Sbjct  121  LLILTDPRTDHQPIKEAALGNIPTIAFC  148



>ref|XP_009594851.1| PREDICTED: 40S ribosomal protein SA {ECO:0000255|HAMAP-Rule:MF_03015}-like 
isoform X3 [Nicotiana tomentosiformis]
Length=293

 Score =   291 bits (746),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 136/148 (92%), Positives = 143/148 (97%), Gaps = 0/148 (0%)
 Frame = +2

Query  122  MALSTMALSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQM  301
            MA     +STKE+DIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQM
Sbjct  1    MAAEGRTMSTKEADIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQM  60

Query  302  AARVIVAIQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPR  481
            AARVIVAI+NP+DI+VQSARPYGQRAVLKFAQYTGA+AIAGRHTPGTFTNQLQTSY+EPR
Sbjct  61   AARVIVAIENPKDIIVQSARPYGQRAVLKFAQYTGANAIAGRHTPGTFTNQLQTSYSEPR  120

Query  482  LLILTDPRTDHQPIKEAALGNIPTIAFC  565
            LLILTDPRTDHQPIKEAALGNIPTIAFC
Sbjct  121  LLILTDPRTDHQPIKEAALGNIPTIAFC  148



>ref|XP_009594849.1| PREDICTED: 40S ribosomal protein Sa-2-like isoform X1 [Nicotiana 
tomentosiformis]
Length=315

 Score =   292 bits (747),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 136/148 (92%), Positives = 143/148 (97%), Gaps = 0/148 (0%)
 Frame = +2

Query  122  MALSTMALSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQM  301
            MA     +STKE+DIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQM
Sbjct  1    MAAEGRTMSTKEADIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQM  60

Query  302  AARVIVAIQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPR  481
            AARVIVAI+NP+DI+VQSARPYGQRAVLKFAQYTGA+AIAGRHTPGTFTNQLQTSY+EPR
Sbjct  61   AARVIVAIENPKDIIVQSARPYGQRAVLKFAQYTGANAIAGRHTPGTFTNQLQTSYSEPR  120

Query  482  LLILTDPRTDHQPIKEAALGNIPTIAFC  565
            LLILTDPRTDHQPIKEAALGNIPTIAFC
Sbjct  121  LLILTDPRTDHQPIKEAALGNIPTIAFC  148



>gb|KJB67081.1| hypothetical protein B456_010G173800 [Gossypium raimondii]
Length=231

 Score =   289 bits (739),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 135/150 (90%), Positives = 143/150 (95%), Gaps = 0/150 (0%)
 Frame = +2

Query  116  TTMALSTMALSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKL  295
            TT+  +   LS KE+DIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKL
Sbjct  4    TTVPAAARQLSPKEADIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKL  63

Query  296  QMAARVIVAIQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNE  475
            Q+AARVIVAI+NPQDI+VQSARPYGQRAVLKFAQYTG HAIAGRHTPGTFTNQLQTS++E
Sbjct  64   QLAARVIVAIENPQDIIVQSARPYGQRAVLKFAQYTGCHAIAGRHTPGTFTNQLQTSFSE  123

Query  476  PRLLILTDPRTDHQPIKEAALGNIPTIAFC  565
            PRLLILTDPRTDHQPIKEAALGNIPTIAFC
Sbjct  124  PRLLILTDPRTDHQPIKEAALGNIPTIAFC  153



>ref|XP_004165149.1| PREDICTED: 40S ribosomal protein SA-like [Cucumis sativus]
 gb|KGN53260.1| hypothetical protein Csa_4G038770 [Cucumis sativus]
Length=298

 Score =   291 bits (745),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 136/141 (96%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  143  LSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIVA  322
            LS KE+DIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIVA
Sbjct  10   LSQKEADIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIVA  69

Query  323  IQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTDP  502
            I+NPQDI+VQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTS+NEPRLLILTDP
Sbjct  70   IENPQDIIVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSFNEPRLLILTDP  129

Query  503  RTDHQPIKEAALGNIPTIAFC  565
            RTDHQPIKEAALGNIPTIAFC
Sbjct  130  RTDHQPIKEAALGNIPTIAFC  150



>ref|XP_011086761.1| PREDICTED: 40S ribosomal protein SA-like [Sesamum indicum]
Length=299

 Score =   291 bits (744),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 136/148 (92%), Positives = 143/148 (97%), Gaps = 0/148 (0%)
 Frame = +2

Query  122  MALSTMALSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQM  301
            MA +   LSTKESDI+MMLA+EVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQM
Sbjct  1    MATAQRVLSTKESDIRMMLASEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQM  60

Query  302  AARVIVAIQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPR  481
            AARVIVAI+NPQDI+VQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTS++EPR
Sbjct  61   AARVIVAIENPQDIIVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSFSEPR  120

Query  482  LLILTDPRTDHQPIKEAALGNIPTIAFC  565
            LLILTDPRTDHQPIKEAAL NIPTIAFC
Sbjct  121  LLILTDPRTDHQPIKEAALSNIPTIAFC  148



>gb|KDP40652.1| hypothetical protein JCGZ_24651 [Jatropha curcas]
Length=309

 Score =   291 bits (744),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 138/149 (93%), Positives = 142/149 (95%), Gaps = 0/149 (0%)
 Frame = +2

Query  119  TMALSTMALSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQ  298
            T A  T ALS KE DIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKL 
Sbjct  5    TTAAPTRALSQKELDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLL  64

Query  299  MAARVIVAIQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEP  478
            +AARVIVAI+NPQDI+VQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTS+NEP
Sbjct  65   LAARVIVAIENPQDIIVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSFNEP  124

Query  479  RLLILTDPRTDHQPIKEAALGNIPTIAFC  565
            RLLILTDPRTDHQPIKEAALGNIPTIAFC
Sbjct  125  RLLILTDPRTDHQPIKEAALGNIPTIAFC  153



>gb|KJB67082.1| hypothetical protein B456_010G173800 [Gossypium raimondii]
Length=307

 Score =   290 bits (741),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 135/150 (90%), Positives = 143/150 (95%), Gaps = 0/150 (0%)
 Frame = +2

Query  116  TTMALSTMALSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKL  295
            TT+  +   LS KE+DIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKL
Sbjct  4    TTVPAAARQLSPKEADIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKL  63

Query  296  QMAARVIVAIQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNE  475
            Q+AARVIVAI+NPQDI+VQSARPYGQRAVLKFAQYTG HAIAGRHTPGTFTNQLQTS++E
Sbjct  64   QLAARVIVAIENPQDIIVQSARPYGQRAVLKFAQYTGCHAIAGRHTPGTFTNQLQTSFSE  123

Query  476  PRLLILTDPRTDHQPIKEAALGNIPTIAFC  565
            PRLLILTDPRTDHQPIKEAALGNIPTIAFC
Sbjct  124  PRLLILTDPRTDHQPIKEAALGNIPTIAFC  153



>ref|XP_008453731.1| PREDICTED: 40S ribosomal protein SA-like [Cucumis melo]
Length=298

 Score =   289 bits (740),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 135/141 (96%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  143  LSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIVA  322
            LS KE+DIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIVA
Sbjct  10   LSQKEADIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIVA  69

Query  323  IQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTDP  502
            I+NP+DI+VQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTS+NEPRLLILTDP
Sbjct  70   IENPRDIIVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSFNEPRLLILTDP  129

Query  503  RTDHQPIKEAALGNIPTIAFC  565
            RTDHQPIKEAALGNIPTIAFC
Sbjct  130  RTDHQPIKEAALGNIPTIAFC  150



>ref|XP_002268664.1| PREDICTED: 40S ribosomal protein SA [Vitis vinifera]
 sp|A5BUU4.1|RSSA_VITVI RecName: Full=40S ribosomal protein SA [Vitis vinifera]
 emb|CAN61790.1| hypothetical protein VITISV_015795 [Vitis vinifera]
Length=312

 Score =   289 bits (740),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 136/148 (92%), Positives = 143/148 (97%), Gaps = 0/148 (0%)
 Frame = +2

Query  122  MALSTMALSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQM  301
            MA  T ALS KE DIQMMLAAEVHLGTKNC+FQMERYVFKRRNDGIYIINLGKTWEKLQ+
Sbjct  1    MATPTRALSQKEQDIQMMLAAEVHLGTKNCNFQMERYVFKRRNDGIYIINLGKTWEKLQL  60

Query  302  AARVIVAIQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPR  481
            AARVIVAI+NP+DI+VQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTS++EPR
Sbjct  61   AARVIVAIENPKDIIVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSFSEPR  120

Query  482  LLILTDPRTDHQPIKEAALGNIPTIAFC  565
            LLILTDPRTDHQPIKEAALGNIPTIAFC
Sbjct  121  LLILTDPRTDHQPIKEAALGNIPTIAFC  148



>gb|KHG23357.1| 40S ribosomal SA [Gossypium arboreum]
Length=313

 Score =   289 bits (740),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 135/150 (90%), Positives = 143/150 (95%), Gaps = 0/150 (0%)
 Frame = +2

Query  116  TTMALSTMALSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKL  295
            TT+  +   LS KE+DIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKL
Sbjct  4    TTVPAAARQLSPKEADIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKL  63

Query  296  QMAARVIVAIQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNE  475
            Q+AARVIVAI+NPQDI+VQSARPYGQRAVLKFAQYTG HAIAGRHTPGTFTNQLQTS++E
Sbjct  64   QLAARVIVAIENPQDIIVQSARPYGQRAVLKFAQYTGCHAIAGRHTPGTFTNQLQTSFSE  123

Query  476  PRLLILTDPRTDHQPIKEAALGNIPTIAFC  565
            PRLLILTDPRTDHQPIKEAALGNIPTIAFC
Sbjct  124  PRLLILTDPRTDHQPIKEAALGNIPTIAFC  153



>gb|AFK36852.1| unknown [Medicago truncatula]
Length=172

 Score =   284 bits (726),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 131/149 (88%), Positives = 142/149 (95%), Gaps = 0/149 (0%)
 Frame = +2

Query  119  TMALSTMALSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQ  298
            T  LS+  LS KE+DIQMMLAA+VHLGTKNCDFQMERY FKRRNDGIYIINLGKTWEKLQ
Sbjct  3    TEQLSSRQLSQKEADIQMMLAADVHLGTKNCDFQMERYCFKRRNDGIYIINLGKTWEKLQ  62

Query  299  MAARVIVAIQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEP  478
            +AARV+VAI+NPQDI+VQSARPYGQRAVLKFAQYTGA+AIAGRHTPGTFTNQ+Q S++EP
Sbjct  63   LAARVVVAIENPQDIIVQSARPYGQRAVLKFAQYTGANAIAGRHTPGTFTNQMQVSFSEP  122

Query  479  RLLILTDPRTDHQPIKEAALGNIPTIAFC  565
            RLLILTDPRTDHQPIKEAALGNIPTIAFC
Sbjct  123  RLLILTDPRTDHQPIKEAALGNIPTIAFC  151



>ref|XP_004149157.1| PREDICTED: 40S ribosomal protein SA-like [Cucumis sativus]
Length=298

 Score =   288 bits (737),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 135/141 (96%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  143  LSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIVA  322
            LS KE+DIQMMLAAEV+LGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIVA
Sbjct  10   LSQKEADIQMMLAAEVNLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIVA  69

Query  323  IQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTDP  502
            I+NPQDI+VQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTS+NEPRLLILTDP
Sbjct  70   IENPQDIIVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSFNEPRLLILTDP  129

Query  503  RTDHQPIKEAALGNIPTIAFC  565
            RTDHQPIKEAALGNIPTIAFC
Sbjct  130  RTDHQPIKEAALGNIPTIAFC  150



>gb|KDP29482.1| hypothetical protein JCGZ_19441 [Jatropha curcas]
Length=304

 Score =   288 bits (738),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 135/141 (96%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  143  LSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIVA  322
            LS KE+DIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQ+AARVIVA
Sbjct  14   LSQKEADIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQLAARVIVA  73

Query  323  IQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTDP  502
            I+NPQDI+VQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTS+NEPRLLILTDP
Sbjct  74   IENPQDIIVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSFNEPRLLILTDP  133

Query  503  RTDHQPIKEAALGNIPTIAFC  565
            RTDHQPIKEAALGNIPTIAFC
Sbjct  134  RTDHQPIKEAALGNIPTIAFC  154



>ref|XP_002529989.1| 40S ribosomal protein sa, putative [Ricinus communis]
 gb|EEF32394.1| 40S ribosomal protein sa, putative [Ricinus communis]
Length=309

 Score =   288 bits (738),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 133/141 (94%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  143  LSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIVA  322
            LS KE+DIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQ+AARVIV+
Sbjct  16   LSQKEADIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQLAARVIVS  75

Query  323  IQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTDP  502
            I+NPQDI+VQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTS++EPRLLILTDP
Sbjct  76   IENPQDIIVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSFSEPRLLILTDP  135

Query  503  RTDHQPIKEAALGNIPTIAFC  565
            RTDHQPIKEAALGNIPTIAFC
Sbjct  136  RTDHQPIKEAALGNIPTIAFC  156



>gb|KHG05910.1| 40S ribosomal SA [Gossypium arboreum]
Length=303

 Score =   288 bits (737),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 134/149 (90%), Positives = 142/149 (95%), Gaps = 0/149 (0%)
 Frame = +2

Query  119  TMALSTMALSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQ  298
            T+  +   LS KE+DIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQ
Sbjct  5    TVPAAARQLSPKEADIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQ  64

Query  299  MAARVIVAIQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEP  478
            +AARVIVAI+NPQDI+VQSARPYGQRAVLKFAQYTG HAIAGRHTPGTFTNQLQTS++EP
Sbjct  65   LAARVIVAIENPQDIIVQSARPYGQRAVLKFAQYTGCHAIAGRHTPGTFTNQLQTSFSEP  124

Query  479  RLLILTDPRTDHQPIKEAALGNIPTIAFC  565
            RLLILTDPRTDHQPIKEAALGNIPTIAFC
Sbjct  125  RLLILTDPRTDHQPIKEAALGNIPTIAFC  153



>gb|KJB70073.1| hypothetical protein B456_011G056700 [Gossypium raimondii]
Length=309

 Score =   288 bits (737),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 134/149 (90%), Positives = 142/149 (95%), Gaps = 0/149 (0%)
 Frame = +2

Query  119  TMALSTMALSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQ  298
            T+  +   LS KE+DIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQ
Sbjct  5    TVPAAARQLSPKEADIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQ  64

Query  299  MAARVIVAIQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEP  478
            +AARVIVAI+NPQDI+VQSARPYGQRAVLKFAQYTG HAIAGRHTPGTFTNQLQTS++EP
Sbjct  65   LAARVIVAIENPQDIIVQSARPYGQRAVLKFAQYTGCHAIAGRHTPGTFTNQLQTSFSEP  124

Query  479  RLLILTDPRTDHQPIKEAALGNIPTIAFC  565
            RLLILTDPRTDHQPIKEAALGNIPTIAFC
Sbjct  125  RLLILTDPRTDHQPIKEAALGNIPTIAFC  153



>gb|KJB70074.1| hypothetical protein B456_011G056700 [Gossypium raimondii]
Length=307

 Score =   288 bits (736),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 134/149 (90%), Positives = 142/149 (95%), Gaps = 0/149 (0%)
 Frame = +2

Query  119  TMALSTMALSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQ  298
            T+  +   LS KE+DIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQ
Sbjct  5    TVPAAARQLSPKEADIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQ  64

Query  299  MAARVIVAIQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEP  478
            +AARVIVAI+NPQDI+VQSARPYGQRAVLKFAQYTG HAIAGRHTPGTFTNQLQTS++EP
Sbjct  65   LAARVIVAIENPQDIIVQSARPYGQRAVLKFAQYTGCHAIAGRHTPGTFTNQLQTSFSEP  124

Query  479  RLLILTDPRTDHQPIKEAALGNIPTIAFC  565
            RLLILTDPRTDHQPIKEAALGNIPTIAFC
Sbjct  125  RLLILTDPRTDHQPIKEAALGNIPTIAFC  153



>ref|XP_011076899.1| PREDICTED: 40S ribosomal protein SA-like [Sesamum indicum]
Length=298

 Score =   287 bits (735),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 134/148 (91%), Positives = 142/148 (96%), Gaps = 0/148 (0%)
 Frame = +2

Query  122  MALSTMALSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQM  301
            MA +   LSTKE DI+MMLA+EVHLGTKNCDFQMERYVFKRRNDGIYIIN+GKTWEKLQM
Sbjct  1    MATAQRILSTKEDDIRMMLASEVHLGTKNCDFQMERYVFKRRNDGIYIINVGKTWEKLQM  60

Query  302  AARVIVAIQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPR  481
            AARVIVAI+NPQDI+VQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTS++EPR
Sbjct  61   AARVIVAIENPQDIIVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSFSEPR  120

Query  482  LLILTDPRTDHQPIKEAALGNIPTIAFC  565
            LLILTDPRTDHQPIKEAAL NIPTIAFC
Sbjct  121  LLILTDPRTDHQPIKEAALSNIPTIAFC  148



>ref|XP_009789865.1| PREDICTED: 40S ribosomal protein SA-like [Nicotiana sylvestris]
Length=301

 Score =   287 bits (735),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 134/141 (95%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +2

Query  143  LSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIVA  322
            L+TKE+DIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIVA
Sbjct  10   LTTKEADIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIVA  69

Query  323  IQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTDP  502
            I+NP+DI+VQSARPYGQRAVLKFAQYTGA+AIAGRHTPGTFTNQLQTSY+EPRLLILTDP
Sbjct  70   IENPKDIIVQSARPYGQRAVLKFAQYTGANAIAGRHTPGTFTNQLQTSYSEPRLLILTDP  129

Query  503  RTDHQPIKEAALGNIPTIAFC  565
            RTDHQPIKEAALGNIPTIAFC
Sbjct  130  RTDHQPIKEAALGNIPTIAFC  150



>ref|XP_004162167.1| PREDICTED: 40S ribosomal protein SA-like [Cucumis sativus]
Length=308

 Score =   287 bits (735),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 133/141 (94%), Positives = 139/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  143  LSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIVA  322
            LS KE+DIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQ+AARVIV 
Sbjct  11   LSQKEADIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQLAARVIVG  70

Query  323  IQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTDP  502
            I+NPQDI+VQSARPYGQRAVLKFAQ+TGAHAIAGRHTPGTFTNQLQTS+NEPRLLILTDP
Sbjct  71   IENPQDIIVQSARPYGQRAVLKFAQHTGAHAIAGRHTPGTFTNQLQTSFNEPRLLILTDP  130

Query  503  RTDHQPIKEAALGNIPTIAFC  565
            RTDHQPIKEAALGNIPTIAFC
Sbjct  131  RTDHQPIKEAALGNIPTIAFC  151



>ref|XP_009631471.1| PREDICTED: 40S ribosomal protein SA {ECO:0000255|HAMAP-Rule:MF_03015}-like 
[Nicotiana tomentosiformis]
Length=303

 Score =   287 bits (734),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 134/141 (95%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +2

Query  143  LSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIVA  322
            L+TKE+DIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIVA
Sbjct  10   LTTKEADIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIVA  69

Query  323  IQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTDP  502
            I+NP+DI+VQSARPYGQRAVLKFAQYTGA+AIAGRHTPGTFTNQLQTSY+EPRLLILTDP
Sbjct  70   IENPKDIIVQSARPYGQRAVLKFAQYTGANAIAGRHTPGTFTNQLQTSYSEPRLLILTDP  129

Query  503  RTDHQPIKEAALGNIPTIAFC  565
            RTDHQPIKEAALGNIPTIAFC
Sbjct  130  RTDHQPIKEAALGNIPTIAFC  150



>ref|XP_004138372.1| PREDICTED: 40S ribosomal protein SA-like [Cucumis sativus]
 gb|KGN45883.1| hypothetical protein Csa_6G016990 [Cucumis sativus]
Length=308

 Score =   287 bits (735),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 133/141 (94%), Positives = 139/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  143  LSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIVA  322
            LS KE+DIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQ+AARVIV 
Sbjct  11   LSQKEADIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQLAARVIVG  70

Query  323  IQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTDP  502
            I+NPQDI+VQSARPYGQRAVLKFAQ+TGAHAIAGRHTPGTFTNQLQTS+NEPRLLILTDP
Sbjct  71   IENPQDIIVQSARPYGQRAVLKFAQHTGAHAIAGRHTPGTFTNQLQTSFNEPRLLILTDP  130

Query  503  RTDHQPIKEAALGNIPTIAFC  565
            RTDHQPIKEAALGNIPTIAFC
Sbjct  131  RTDHQPIKEAALGNIPTIAFC  151



>ref|XP_008463065.1| PREDICTED: 40S ribosomal protein SA-like [Cucumis melo]
Length=307

 Score =   287 bits (734),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 133/141 (94%), Positives = 139/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  143  LSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIVA  322
            LS KE+DIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQ+AARVIV 
Sbjct  11   LSQKEADIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQLAARVIVG  70

Query  323  IQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTDP  502
            I+NPQDI+VQSARPYGQRAVLKFAQ+TGAHAIAGRHTPGTFTNQLQTS+NEPRLLILTDP
Sbjct  71   IENPQDIIVQSARPYGQRAVLKFAQHTGAHAIAGRHTPGTFTNQLQTSFNEPRLLILTDP  130

Query  503  RTDHQPIKEAALGNIPTIAFC  565
            RTDHQPIKEAALGNIPTIAFC
Sbjct  131  RTDHQPIKEAALGNIPTIAFC  151



>ref|XP_011087109.1| PREDICTED: 40S ribosomal protein SA-like [Sesamum indicum]
Length=265

 Score =   285 bits (730),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 134/148 (91%), Positives = 142/148 (96%), Gaps = 0/148 (0%)
 Frame = +2

Query  122  MALSTMALSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQM  301
            MA +   LSTKESD +MMLA+EVHLGTKNCDFQMERYVFKR+NDGIYIINLGKTWEKLQM
Sbjct  1    MATAQRVLSTKESDSRMMLASEVHLGTKNCDFQMERYVFKRQNDGIYIINLGKTWEKLQM  60

Query  302  AARVIVAIQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPR  481
            AARVIVAI+NPQDI+VQSARPYGQRAVLKFAQYTGA+AIAGRHTPGTFTNQLQTS+NEPR
Sbjct  61   AARVIVAIENPQDIIVQSARPYGQRAVLKFAQYTGANAIAGRHTPGTFTNQLQTSFNEPR  120

Query  482  LLILTDPRTDHQPIKEAALGNIPTIAFC  565
            LLILTDPRTDHQPIKEAAL NIPTIAFC
Sbjct  121  LLILTDPRTDHQPIKEAALSNIPTIAFC  148



>ref|XP_004165738.1| PREDICTED: 40S ribosomal protein SA-like [Cucumis sativus]
Length=309

 Score =   286 bits (733),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 133/141 (94%), Positives = 139/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  143  LSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIVA  322
            LS KE+DIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQ+AARVIV 
Sbjct  10   LSQKEADIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQLAARVIVG  69

Query  323  IQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTDP  502
            I+NPQDI+VQSARPYGQRAVLKFAQ+TGAHAIAGRHTPGTFTNQLQTS+NEPRLLILTDP
Sbjct  70   IENPQDIIVQSARPYGQRAVLKFAQHTGAHAIAGRHTPGTFTNQLQTSFNEPRLLILTDP  129

Query  503  RTDHQPIKEAALGNIPTIAFC  565
            RTDHQPIKEAALGNIPTIAFC
Sbjct  130  RTDHQPIKEAALGNIPTIAFC  150



>ref|XP_004144441.1| PREDICTED: 40S ribosomal protein SA-like [Cucumis sativus]
 gb|KGN58465.1| hypothetical protein Csa_3G646520 [Cucumis sativus]
Length=309

 Score =   286 bits (733),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 133/141 (94%), Positives = 139/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  143  LSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIVA  322
            LS KE+DIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQ+AARVIV 
Sbjct  10   LSQKEADIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQLAARVIVG  69

Query  323  IQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTDP  502
            I+NPQDI+VQSARPYGQRAVLKFAQ+TGAHAIAGRHTPGTFTNQLQTS+NEPRLLILTDP
Sbjct  70   IENPQDIIVQSARPYGQRAVLKFAQHTGAHAIAGRHTPGTFTNQLQTSFNEPRLLILTDP  129

Query  503  RTDHQPIKEAALGNIPTIAFC  565
            RTDHQPIKEAALGNIPTIAFC
Sbjct  130  RTDHQPIKEAALGNIPTIAFC  150



>ref|XP_010029483.1| PREDICTED: 40S ribosomal protein SA-like isoform X1 [Eucalyptus 
grandis]
 gb|KCW56410.1| hypothetical protein EUGRSUZ_I02137 [Eucalyptus grandis]
Length=312

 Score =   286 bits (732),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 134/150 (89%), Positives = 141/150 (94%), Gaps = 0/150 (0%)
 Frame = +2

Query  116  TTMALSTMALSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKL  295
            TT A     LS KE+DIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKL
Sbjct  6    TTAAAPARQLSQKEADIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKL  65

Query  296  QMAARVIVAIQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNE  475
            Q+AARVIVAI+NPQDI+VQSARPYGQRAVLKFAQYT  HAIAGRHTPGTFTNQLQTS++E
Sbjct  66   QLAARVIVAIENPQDIIVQSARPYGQRAVLKFAQYTNTHAIAGRHTPGTFTNQLQTSFSE  125

Query  476  PRLLILTDPRTDHQPIKEAALGNIPTIAFC  565
            PRLLILTDPRTDHQPIKE+ALGNIPTIAFC
Sbjct  126  PRLLILTDPRTDHQPIKESALGNIPTIAFC  155



>ref|XP_010029484.1| PREDICTED: 40S ribosomal protein SA-like isoform X2 [Eucalyptus 
grandis]
 gb|KCW56411.1| hypothetical protein EUGRSUZ_I02137 [Eucalyptus grandis]
Length=311

 Score =   286 bits (731),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 134/150 (89%), Positives = 141/150 (94%), Gaps = 0/150 (0%)
 Frame = +2

Query  116  TTMALSTMALSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKL  295
            TT A     LS KE+DIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKL
Sbjct  6    TTAAAPARQLSQKEADIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKL  65

Query  296  QMAARVIVAIQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNE  475
            Q+AARVIVAI+NPQDI+VQSARPYGQRAVLKFAQYT  HAIAGRHTPGTFTNQLQTS++E
Sbjct  66   QLAARVIVAIENPQDIIVQSARPYGQRAVLKFAQYTNTHAIAGRHTPGTFTNQLQTSFSE  125

Query  476  PRLLILTDPRTDHQPIKEAALGNIPTIAFC  565
            PRLLILTDPRTDHQPIKE+ALGNIPTIAFC
Sbjct  126  PRLLILTDPRTDHQPIKESALGNIPTIAFC  155



>gb|KCW56412.1| hypothetical protein EUGRSUZ_I02137 [Eucalyptus grandis]
Length=307

 Score =   286 bits (731),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 134/150 (89%), Positives = 141/150 (94%), Gaps = 0/150 (0%)
 Frame = +2

Query  116  TTMALSTMALSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKL  295
            TT A     LS KE+DIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKL
Sbjct  6    TTAAAPARQLSQKEADIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKL  65

Query  296  QMAARVIVAIQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNE  475
            Q+AARVIVAI+NPQDI+VQSARPYGQRAVLKFAQYT  HAIAGRHTPGTFTNQLQTS++E
Sbjct  66   QLAARVIVAIENPQDIIVQSARPYGQRAVLKFAQYTNTHAIAGRHTPGTFTNQLQTSFSE  125

Query  476  PRLLILTDPRTDHQPIKEAALGNIPTIAFC  565
            PRLLILTDPRTDHQPIKE+ALGNIPTIAFC
Sbjct  126  PRLLILTDPRTDHQPIKESALGNIPTIAFC  155



>ref|XP_010932352.1| PREDICTED: 40S ribosomal protein SA-like [Elaeis guineensis]
Length=303

 Score =   285 bits (730),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 132/146 (90%), Positives = 143/146 (98%), Gaps = 0/146 (0%)
 Frame = +2

Query  128  LSTMALSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAA  307
            ++T ALS KE DIQMMLAAEVHLGTKNCDFQMERYVFKRR+DGI+IINLG+TWEKLQ+AA
Sbjct  1    MATKALSQKEQDIQMMLAAEVHLGTKNCDFQMERYVFKRRSDGIFIINLGRTWEKLQLAA  60

Query  308  RVIVAIQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLL  487
            RVIVAI+NPQDI+VQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTS++EPRLL
Sbjct  61   RVIVAIENPQDIIVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSFSEPRLL  120

Query  488  ILTDPRTDHQPIKEAALGNIPTIAFC  565
            ILTDPRTDHQPIKE+ALGNIPTIAFC
Sbjct  121  ILTDPRTDHQPIKESALGNIPTIAFC  146



>ref|XP_007024738.1| 40s ribosomal protein SA [Theobroma cacao]
 gb|EOY27360.1| 40s ribosomal protein SA [Theobroma cacao]
Length=313

 Score =   286 bits (731),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 134/150 (89%), Positives = 142/150 (95%), Gaps = 0/150 (0%)
 Frame = +2

Query  116  TTMALSTMALSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKL  295
            TT       LS KE+DIQMMLAAEVHLGTKNCD+QMERYVFKRRNDGIYIINLGKTWEKL
Sbjct  4    TTAPAGARQLSPKEADIQMMLAAEVHLGTKNCDYQMERYVFKRRNDGIYIINLGKTWEKL  63

Query  296  QMAARVIVAIQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNE  475
            Q+AARVIVAI+NPQDI+VQSARPYGQRAVLKFAQ+TGAHAIAGRHTPGTFTNQLQTS++E
Sbjct  64   QLAARVIVAIENPQDIIVQSARPYGQRAVLKFAQHTGAHAIAGRHTPGTFTNQLQTSFSE  123

Query  476  PRLLILTDPRTDHQPIKEAALGNIPTIAFC  565
            PRLLILTDPRTDHQPIKEAALGNIPTIAFC
Sbjct  124  PRLLILTDPRTDHQPIKEAALGNIPTIAFC  153



>ref|XP_010101261.1| 40S ribosomal protein SA [Morus notabilis]
 gb|EXB88188.1| 40S ribosomal protein SA [Morus notabilis]
Length=308

 Score =   285 bits (730),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 134/141 (95%), Positives = 138/141 (98%), Gaps = 0/141 (0%)
 Frame = +2

Query  143  LSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIVA  322
            LS KE+DIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQ+AARVIVA
Sbjct  13   LSQKEADIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQLAARVIVA  72

Query  323  IQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTDP  502
            I+NPQDI VQSARPYGQRAVLKFAQYTGA AIAGRHTPGTFTNQLQTS+NEPRLLILTDP
Sbjct  73   IENPQDITVQSARPYGQRAVLKFAQYTGAQAIAGRHTPGTFTNQLQTSFNEPRLLILTDP  132

Query  503  RTDHQPIKEAALGNIPTIAFC  565
            RTDHQPIKEAALGNIPTIAFC
Sbjct  133  RTDHQPIKEAALGNIPTIAFC  153



>ref|XP_010273906.1| PREDICTED: 40S ribosomal protein SA-like [Nelumbo nucifera]
Length=300

 Score =   285 bits (729),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 132/148 (89%), Positives = 141/148 (95%), Gaps = 0/148 (0%)
 Frame = +2

Query  122  MALSTMALSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQM  301
            MA +T  LS KE+DIQMMLAA+VHLGTKNCDFQMERYVFKRR DGI+IINLGKTWEKLQ+
Sbjct  1    MATATKGLSQKEADIQMMLAADVHLGTKNCDFQMERYVFKRRTDGIFIINLGKTWEKLQL  60

Query  302  AARVIVAIQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPR  481
            AARVIVAI+NPQDI+VQSARPYGQRAVLKFAQYTGAH IAGRHTPGTFTNQLQTS++EPR
Sbjct  61   AARVIVAIENPQDIIVQSARPYGQRAVLKFAQYTGAHPIAGRHTPGTFTNQLQTSFSEPR  120

Query  482  LLILTDPRTDHQPIKEAALGNIPTIAFC  565
            LLILTDPRTDHQPIKEAAL NIPTIAFC
Sbjct  121  LLILTDPRTDHQPIKEAALSNIPTIAFC  148



>ref|XP_010531882.1| PREDICTED: 40S ribosomal protein Sa-1-like [Tarenaya hassleriana]
Length=298

 Score =   285 bits (729),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 132/147 (90%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +2

Query  125  ALSTMALSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMA  304
            AL+T  LS KE+DIQMML+AEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQ+A
Sbjct  6    ALATRQLSQKEADIQMMLSAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQLA  65

Query  305  ARVIVAIQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRL  484
            ARVIV I+NPQDI+VQSARPYGQRAVLKFAQ+TGA+AIAGRHTPGTFTNQ+QTS++EPRL
Sbjct  66   ARVIVGIENPQDIIVQSARPYGQRAVLKFAQFTGANAIAGRHTPGTFTNQMQTSFSEPRL  125

Query  485  LILTDPRTDHQPIKEAALGNIPTIAFC  565
            LILTDPRTDHQPIKEAALGNIPTIAFC
Sbjct  126  LILTDPRTDHQPIKEAALGNIPTIAFC  152



>ref|NP_001275039.1| 40S ribosomal protein SA-like [Solanum tuberosum]
 gb|ABB29931.1| P40-like protein [Solanum tuberosum]
Length=300

 Score =   285 bits (728),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 131/141 (93%), Positives = 139/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  143  LSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIVA  322
            L+TKE+DIQ+MLAAEVHLGTKNCDFQMERYVFKRRNDGIYIIN GKTW+KL MAARVIV+
Sbjct  11   LTTKEADIQLMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINAGKTWDKLHMAARVIVS  70

Query  323  IQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTDP  502
            I+NPQDI+VQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSY+EPRLLILTDP
Sbjct  71   IENPQDIIVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYSEPRLLILTDP  130

Query  503  RTDHQPIKEAALGNIPTIAFC  565
            RTDHQPIKEAALGNIPTIAFC
Sbjct  131  RTDHQPIKEAALGNIPTIAFC  151



>ref|XP_010261714.1| PREDICTED: 40S ribosomal protein SA [Nelumbo nucifera]
Length=305

 Score =   285 bits (729),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 132/148 (89%), Positives = 142/148 (96%), Gaps = 0/148 (0%)
 Frame = +2

Query  122  MALSTMALSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQM  301
            MA +T  LS KE+DIQMMLAA+VHLGTKNCDFQMERYVFKRR DGI+IINLGKTWEKLQ+
Sbjct  1    MANATRGLSQKEADIQMMLAADVHLGTKNCDFQMERYVFKRRTDGIFIINLGKTWEKLQL  60

Query  302  AARVIVAIQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPR  481
            AARVIVAI+NPQDI+VQSARPYGQRAVLKFAQYTGAH IAGRHTPGTFTNQ+QTS++EPR
Sbjct  61   AARVIVAIENPQDIIVQSARPYGQRAVLKFAQYTGAHPIAGRHTPGTFTNQMQTSFSEPR  120

Query  482  LLILTDPRTDHQPIKEAALGNIPTIAFC  565
            LLILTDPRTDHQPIKEAALGNIPTIAFC
Sbjct  121  LLILTDPRTDHQPIKEAALGNIPTIAFC  148



>ref|XP_004234315.1| PREDICTED: 40S ribosomal protein SA-like [Solanum lycopersicum]
Length=298

 Score =   285 bits (728),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 131/141 (93%), Positives = 139/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  143  LSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIVA  322
            L+TKE+DIQ+MLAAEVHLGTKNCDFQMERYVFKRRNDGIYIIN GKTW+KL MAARVIV+
Sbjct  11   LTTKEADIQLMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINAGKTWDKLHMAARVIVS  70

Query  323  IQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTDP  502
            I+NPQDI+VQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSY+EPRLLILTDP
Sbjct  71   IENPQDIIVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYSEPRLLILTDP  130

Query  503  RTDHQPIKEAALGNIPTIAFC  565
            RTDHQPIKEAALGNIPTIAFC
Sbjct  131  RTDHQPIKEAALGNIPTIAFC  151



>ref|XP_010101256.1| 40S ribosomal protein SA [Morus notabilis]
 gb|EXB88183.1| 40S ribosomal protein SA [Morus notabilis]
Length=307

 Score =   285 bits (729),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 133/141 (94%), Positives = 138/141 (98%), Gaps = 0/141 (0%)
 Frame = +2

Query  143  LSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIVA  322
            LS KE+DIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQ+AARVIVA
Sbjct  13   LSQKEADIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQLAARVIVA  72

Query  323  IQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTDP  502
            I+NPQDI+VQSARPYGQRAVLKFAQYTGA AIAGRHTPGTFTNQLQTS+NEPRLLILTDP
Sbjct  73   IENPQDIIVQSARPYGQRAVLKFAQYTGAQAIAGRHTPGTFTNQLQTSFNEPRLLILTDP  132

Query  503  RTDHQPIKEAALGNIPTIAFC  565
            RTDHQPIKE ALGNIPTIAFC
Sbjct  133  RTDHQPIKEGALGNIPTIAFC  153



>ref|XP_004303733.1| PREDICTED: 40S ribosomal protein Sa-2 [Fragaria vesca subsp. 
vesca]
Length=302

 Score =   285 bits (728),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 134/150 (89%), Positives = 142/150 (95%), Gaps = 0/150 (0%)
 Frame = +2

Query  116  TTMALSTMALSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKL  295
            TT A     LS KE+DIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKL
Sbjct  3    TTTAAPPRQLSDKEADIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKL  62

Query  296  QMAARVIVAIQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNE  475
            Q+AARVIVAI+NP+DI+VQSARPYGQRAVLKFAQ+TG +AIAGRHTPGTFTNQLQTS+NE
Sbjct  63   QLAARVIVAIENPKDIIVQSARPYGQRAVLKFAQHTGVNAIAGRHTPGTFTNQLQTSFNE  122

Query  476  PRLLILTDPRTDHQPIKEAALGNIPTIAFC  565
            PRLLILTDPRTDHQPIKEAALGNIPTIAFC
Sbjct  123  PRLLILTDPRTDHQPIKEAALGNIPTIAFC  152



>sp|O80377.1|RSSA_DAUCA RecName: Full=40S ribosomal protein SA; AltName: Full=p40 [Daucus 
carota]
 dbj|BAA32821.1| P40-like protein [Daucus carota]
Length=297

 Score =   284 bits (727),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 133/148 (90%), Positives = 140/148 (95%), Gaps = 0/148 (0%)
 Frame = +2

Query  122  MALSTMALSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQM  301
            MA     LST E+DIQMM AAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKL +
Sbjct  1    MASGARELSTMEADIQMMCAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLML  60

Query  302  AARVIVAIQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPR  481
            AARVIV+I+NPQDI+VQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTS++EPR
Sbjct  61   AARVIVSIENPQDIIVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSFSEPR  120

Query  482  LLILTDPRTDHQPIKEAALGNIPTIAFC  565
            LLILTDPRTDHQPIKEAALGNIPTIAFC
Sbjct  121  LLILTDPRTDHQPIKEAALGNIPTIAFC  148



>ref|XP_008783010.1| PREDICTED: 40S ribosomal protein SA-like [Phoenix dactylifera]
Length=299

 Score =   284 bits (727),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 132/145 (91%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = +2

Query  131  STMALSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAAR  310
            +T  LS KE DIQMMLAAEVHLGTKNCDFQMERYVFKRR+DGI+IINLGKTWEKLQ+AAR
Sbjct  3    TTRMLSQKEQDIQMMLAAEVHLGTKNCDFQMERYVFKRRSDGIFIINLGKTWEKLQLAAR  62

Query  311  VIVAIQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLI  490
            VIVAI+NPQDI+VQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTS++EPRLLI
Sbjct  63   VIVAIENPQDIIVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSFSEPRLLI  122

Query  491  LTDPRTDHQPIKEAALGNIPTIAFC  565
            LTDPRTDHQPIKE+ALGNIPTIAFC
Sbjct  123  LTDPRTDHQPIKESALGNIPTIAFC  147



>ref|XP_006426770.1| hypothetical protein CICLE_v10026113mg [Citrus clementina]
 gb|ESR40010.1| hypothetical protein CICLE_v10026113mg [Citrus clementina]
Length=316

 Score =   285 bits (728),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 134/150 (89%), Positives = 141/150 (94%), Gaps = 0/150 (0%)
 Frame = +2

Query  116  TTMALSTMALSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKL  295
            T  A +   LS KE+DIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKL
Sbjct  3    TGTATAPRQLSQKEADIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKL  62

Query  296  QMAARVIVAIQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNE  475
            QMAARVIVAI+NP DI+VQSARPYGQRAVLKFA+YT AHAIAGRHTPGTFTNQ+QTS+NE
Sbjct  63   QMAARVIVAIENPGDIIVQSARPYGQRAVLKFAKYTHAHAIAGRHTPGTFTNQMQTSFNE  122

Query  476  PRLLILTDPRTDHQPIKEAALGNIPTIAFC  565
            PRLLILTDPRTDHQPIKEAALGNIPTIAFC
Sbjct  123  PRLLILTDPRTDHQPIKEAALGNIPTIAFC  152



>ref|XP_010917402.1| PREDICTED: 40S ribosomal protein SA-like [Elaeis guineensis]
Length=305

 Score =   284 bits (727),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 132/146 (90%), Positives = 143/146 (98%), Gaps = 0/146 (0%)
 Frame = +2

Query  128  LSTMALSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAA  307
            ++T ALS KE DIQMMLAAEVHLGTKNCDFQMERYVFKRR+DGI+IINLG+TWEKLQ+AA
Sbjct  1    MATRALSQKELDIQMMLAAEVHLGTKNCDFQMERYVFKRRSDGIFIINLGRTWEKLQLAA  60

Query  308  RVIVAIQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLL  487
            RVIVAI+NPQDI+VQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTS++EPRLL
Sbjct  61   RVIVAIENPQDIIVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSFSEPRLL  120

Query  488  ILTDPRTDHQPIKEAALGNIPTIAFC  565
            ILTDPRTDHQPIKE+ALGNIPTIAFC
Sbjct  121  ILTDPRTDHQPIKESALGNIPTIAFC  146



>ref|XP_009334275.1| PREDICTED: 40S ribosomal protein SA-like isoform X2 [Pyrus x 
bretschneideri]
Length=293

 Score =   284 bits (726),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 134/150 (89%), Positives = 143/150 (95%), Gaps = 0/150 (0%)
 Frame = +2

Query  116  TTMALSTMALSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKL  295
            TT A +   LS KE+DIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTW+KL
Sbjct  3    TTTAAAPRQLSQKEADIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWDKL  62

Query  296  QMAARVIVAIQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNE  475
            QMAARVIVAI+NP+DI+VQSARPYGQRAVLKFAQ+TGA+AIAGRHTPGTFTNQLQTS+NE
Sbjct  63   QMAARVIVAIENPKDIIVQSARPYGQRAVLKFAQHTGANAIAGRHTPGTFTNQLQTSFNE  122

Query  476  PRLLILTDPRTDHQPIKEAALGNIPTIAFC  565
            PRLLILTDPRTD QPIKEAALGNIPTIAFC
Sbjct  123  PRLLILTDPRTDAQPIKEAALGNIPTIAFC  152



>ref|XP_006426769.1| hypothetical protein CICLE_v10026113mg [Citrus clementina]
 gb|ESR40009.1| hypothetical protein CICLE_v10026113mg [Citrus clementina]
Length=315

 Score =   285 bits (728),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 134/150 (89%), Positives = 141/150 (94%), Gaps = 0/150 (0%)
 Frame = +2

Query  116  TTMALSTMALSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKL  295
            T  A +   LS KE+DIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKL
Sbjct  3    TGTATAPRQLSQKEADIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKL  62

Query  296  QMAARVIVAIQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNE  475
            QMAARVIVAI+NP DI+VQSARPYGQRAVLKFA+YT AHAIAGRHTPGTFTNQ+QTS+NE
Sbjct  63   QMAARVIVAIENPGDIIVQSARPYGQRAVLKFAKYTHAHAIAGRHTPGTFTNQMQTSFNE  122

Query  476  PRLLILTDPRTDHQPIKEAALGNIPTIAFC  565
            PRLLILTDPRTDHQPIKEAALGNIPTIAFC
Sbjct  123  PRLLILTDPRTDHQPIKEAALGNIPTIAFC  152



>ref|XP_008372546.1| PREDICTED: 40S ribosomal protein SA-like [Malus domestica]
Length=304

 Score =   284 bits (727),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 134/150 (89%), Positives = 143/150 (95%), Gaps = 0/150 (0%)
 Frame = +2

Query  116  TTMALSTMALSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKL  295
            TT A +   LS KE+DIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTW+KL
Sbjct  3    TTTAAAPRQLSQKEADIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWDKL  62

Query  296  QMAARVIVAIQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNE  475
            QMAARVIVAI+NP+DI+VQSARPYGQRAVLKFAQ+TGA+AIAGRHTPGTFTNQLQTS+NE
Sbjct  63   QMAARVIVAIENPKDIIVQSARPYGQRAVLKFAQHTGANAIAGRHTPGTFTNQLQTSFNE  122

Query  476  PRLLILTDPRTDHQPIKEAALGNIPTIAFC  565
            PRLLILTDPRTD QPIKEAALGNIPTIAFC
Sbjct  123  PRLLILTDPRTDAQPIKEAALGNIPTIAFC  152



>ref|XP_006465826.1| PREDICTED: 40S ribosomal protein SA-like isoform X1 [Citrus sinensis]
 gb|KDO45740.1| hypothetical protein CISIN_1g018448mg [Citrus sinensis]
Length=316

 Score =   285 bits (728),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 134/150 (89%), Positives = 141/150 (94%), Gaps = 0/150 (0%)
 Frame = +2

Query  116  TTMALSTMALSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKL  295
            T  A +   LS KE+DIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKL
Sbjct  3    TGTATAPRQLSQKEADIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKL  62

Query  296  QMAARVIVAIQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNE  475
            QMAARVIVAI+NP DI+VQSARPYGQRAVLKFA+YT AHAIAGRHTPGTFTNQ+QTS+NE
Sbjct  63   QMAARVIVAIENPGDIIVQSARPYGQRAVLKFAKYTHAHAIAGRHTPGTFTNQMQTSFNE  122

Query  476  PRLLILTDPRTDHQPIKEAALGNIPTIAFC  565
            PRLLILTDPRTDHQPIKEAALGNIPTIAFC
Sbjct  123  PRLLILTDPRTDHQPIKEAALGNIPTIAFC  152



>ref|XP_009340328.1| PREDICTED: 40S ribosomal protein Sa-2-like [Pyrus x bretschneideri]
Length=305

 Score =   284 bits (727),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 134/150 (89%), Positives = 143/150 (95%), Gaps = 0/150 (0%)
 Frame = +2

Query  116  TTMALSTMALSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKL  295
            TT A +   LS KE+DIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTW+KL
Sbjct  3    TTTAAAPRRLSQKEADIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWDKL  62

Query  296  QMAARVIVAIQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNE  475
            QMAARVIVAI+NP+DI+VQSARPYGQRAVLKFAQ+TGA+AIAGRHTPGTFTNQLQTS+NE
Sbjct  63   QMAARVIVAIENPKDIIVQSARPYGQRAVLKFAQHTGANAIAGRHTPGTFTNQLQTSFNE  122

Query  476  PRLLILTDPRTDHQPIKEAALGNIPTIAFC  565
            PRLLILTDPRTD QPIKEAALGNIPTIAFC
Sbjct  123  PRLLILTDPRTDAQPIKEAALGNIPTIAFC  152



>ref|XP_009372196.1| PREDICTED: 40S ribosomal protein SA-like [Pyrus x bretschneideri]
Length=304

 Score =   284 bits (726),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 134/150 (89%), Positives = 143/150 (95%), Gaps = 0/150 (0%)
 Frame = +2

Query  116  TTMALSTMALSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKL  295
            TT A +   LS KE+DIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTW+KL
Sbjct  3    TTTAAAPRQLSQKEADIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWDKL  62

Query  296  QMAARVIVAIQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNE  475
            QMAARVIVAI+NP+DI+VQSARPYGQRAVLKFAQ+TGA+AIAGRHTPGTFTNQLQTS+NE
Sbjct  63   QMAARVIVAIENPKDIIVQSARPYGQRAVLKFAQHTGANAIAGRHTPGTFTNQLQTSFNE  122

Query  476  PRLLILTDPRTDHQPIKEAALGNIPTIAFC  565
            PRLLILTDPRTD QPIKEAALGNIPTIAFC
Sbjct  123  PRLLILTDPRTDAQPIKEAALGNIPTIAFC  152



>ref|XP_006465827.1| PREDICTED: 40S ribosomal protein SA-like isoform X2 [Citrus sinensis]
 gb|KDO45741.1| hypothetical protein CISIN_1g018448mg [Citrus sinensis]
Length=315

 Score =   284 bits (727),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 134/150 (89%), Positives = 141/150 (94%), Gaps = 0/150 (0%)
 Frame = +2

Query  116  TTMALSTMALSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKL  295
            T  A +   LS KE+DIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKL
Sbjct  3    TGTATAPRQLSQKEADIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKL  62

Query  296  QMAARVIVAIQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNE  475
            QMAARVIVAI+NP DI+VQSARPYGQRAVLKFA+YT AHAIAGRHTPGTFTNQ+QTS+NE
Sbjct  63   QMAARVIVAIENPGDIIVQSARPYGQRAVLKFAKYTHAHAIAGRHTPGTFTNQMQTSFNE  122

Query  476  PRLLILTDPRTDHQPIKEAALGNIPTIAFC  565
            PRLLILTDPRTDHQPIKEAALGNIPTIAFC
Sbjct  123  PRLLILTDPRTDHQPIKEAALGNIPTIAFC  152



>ref|NP_001237424.1| 40S ribosomal protein SA [Glycine max]
 sp|O22518.1|RSSA_SOYBN RecName: Full=40S ribosomal protein SA; AltName: Full=p40 [Glycine 
max]
 gb|AAB82659.1| ribosome-associated protein p40 [Glycine max]
Length=310

 Score =   284 bits (727),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 132/141 (94%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  143  LSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIVA  322
            LS KE+DIQMMLAA+VHLGTKNCDFQMERY+FKRRNDGIYIINLGKTWEKLQ+AARVIVA
Sbjct  15   LSQKEADIQMMLAADVHLGTKNCDFQMERYIFKRRNDGIYIINLGKTWEKLQLAARVIVA  74

Query  323  IQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTDP  502
            I+NPQDI+VQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTS++EPRLLILTDP
Sbjct  75   IENPQDIIVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSFSEPRLLILTDP  134

Query  503  RTDHQPIKEAALGNIPTIAFC  565
            RTDHQPIKEAALGNIPTIAFC
Sbjct  135  RTDHQPIKEAALGNIPTIAFC  155



>ref|XP_009334274.1| PREDICTED: 40S ribosomal protein SA-like isoform X1 [Pyrus x 
bretschneideri]
Length=304

 Score =   284 bits (726),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 134/150 (89%), Positives = 143/150 (95%), Gaps = 0/150 (0%)
 Frame = +2

Query  116  TTMALSTMALSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKL  295
            TT A +   LS KE+DIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTW+KL
Sbjct  3    TTTAAAPRQLSQKEADIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWDKL  62

Query  296  QMAARVIVAIQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNE  475
            QMAARVIVAI+NP+DI+VQSARPYGQRAVLKFAQ+TGA+AIAGRHTPGTFTNQLQTS+NE
Sbjct  63   QMAARVIVAIENPKDIIVQSARPYGQRAVLKFAQHTGANAIAGRHTPGTFTNQLQTSFNE  122

Query  476  PRLLILTDPRTDHQPIKEAALGNIPTIAFC  565
            PRLLILTDPRTD QPIKEAALGNIPTIAFC
Sbjct  123  PRLLILTDPRTDAQPIKEAALGNIPTIAFC  152



>ref|XP_008348972.1| PREDICTED: 40S ribosomal protein SA-like [Malus domestica]
Length=304

 Score =   284 bits (726),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 134/150 (89%), Positives = 143/150 (95%), Gaps = 0/150 (0%)
 Frame = +2

Query  116  TTMALSTMALSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKL  295
            TT A +   LS KE+DIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTW+KL
Sbjct  3    TTTAAAPRQLSQKEADIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWDKL  62

Query  296  QMAARVIVAIQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNE  475
            QMAARVIVAI+NP+DI+VQSARPYGQRAVLKFAQ+TGA+AIAGRHTPGTFTNQLQTS+NE
Sbjct  63   QMAARVIVAIENPKDIIVQSARPYGQRAVLKFAQHTGANAIAGRHTPGTFTNQLQTSFNE  122

Query  476  PRLLILTDPRTDHQPIKEAALGNIPTIAFC  565
            PRLLILTDPRTD QPIKEAALGNIPTIAFC
Sbjct  123  PRLLILTDPRTDAQPIKEAALGNIPTIAFC  152



>ref|XP_003547867.1| PREDICTED: 40S ribosomal protein SA [Glycine max]
 gb|KHN39587.1| 40S ribosomal protein SA [Glycine soja]
Length=311

 Score =   284 bits (726),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 132/141 (94%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  143  LSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIVA  322
            LS KE+DIQMMLAA+VHLGTKNCDFQMERY+FKRRNDGIYIINLGKTWEKLQ+AARVIVA
Sbjct  15   LSQKEADIQMMLAADVHLGTKNCDFQMERYIFKRRNDGIYIINLGKTWEKLQLAARVIVA  74

Query  323  IQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTDP  502
            I+NPQDI+VQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTS++EPRLLILTDP
Sbjct  75   IENPQDIIVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSFSEPRLLILTDP  134

Query  503  RTDHQPIKEAALGNIPTIAFC  565
            RTDHQPIKEAALGNIPTIAFC
Sbjct  135  RTDHQPIKEAALGNIPTIAFC  155



>ref|XP_008784360.1| PREDICTED: 40S ribosomal protein SA-like [Phoenix dactylifera]
Length=311

 Score =   284 bits (726),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 131/146 (90%), Positives = 143/146 (98%), Gaps = 0/146 (0%)
 Frame = +2

Query  128  LSTMALSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAA  307
            ++T ALS KE DIQM+LAA+VHLGTKNCDFQMERYVFKRR+DGI+IINLGKTWEKLQ+AA
Sbjct  1    MATRALSQKEQDIQMLLAADVHLGTKNCDFQMERYVFKRRSDGIFIINLGKTWEKLQLAA  60

Query  308  RVIVAIQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLL  487
            RVIVAI+NPQDI+VQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTS++EPRLL
Sbjct  61   RVIVAIENPQDIIVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSFSEPRLL  120

Query  488  ILTDPRTDHQPIKEAALGNIPTIAFC  565
            ILTDPRTDHQPIKE+ALGNIPTIAFC
Sbjct  121  ILTDPRTDHQPIKESALGNIPTIAFC  146



>gb|ABK26340.1| unknown [Picea sitchensis]
 gb|ACN40308.1| unknown [Picea sitchensis]
Length=319

 Score =   284 bits (727),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 131/148 (89%), Positives = 142/148 (96%), Gaps = 0/148 (0%)
 Frame = +2

Query  122  MALSTMALSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQM  301
            MA     LS KE+DIQMMLAA+VHLGTKNCDFQMERYV+KRR+DGI+IINLGKTWEKLQ+
Sbjct  1    MAQKMGGLSQKEADIQMMLAADVHLGTKNCDFQMERYVYKRRSDGIFIINLGKTWEKLQL  60

Query  302  AARVIVAIQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPR  481
            AARVIVAI+NPQDI+VQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQ+QTS+NEPR
Sbjct  61   AARVIVAIENPQDIIVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQMQTSFNEPR  120

Query  482  LLILTDPRTDHQPIKEAALGNIPTIAFC  565
            LLILTDPRTDHQPI+EAALGNIPTIAFC
Sbjct  121  LLILTDPRTDHQPIREAALGNIPTIAFC  148



>ref|XP_004985475.1| PREDICTED: 40S ribosomal protein SA-like [Setaria italica]
Length=309

 Score =   284 bits (726),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 132/142 (93%), Positives = 140/142 (99%), Gaps = 0/142 (0%)
 Frame = +2

Query  140  ALSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIV  319
            ALS KE+DIQMMLAA+VHLGTKNCDFQMERYVFKRR DGIYIINLGKTWEKLQ+AARVIV
Sbjct  12   ALSQKETDIQMMLAADVHLGTKNCDFQMERYVFKRRTDGIYIINLGKTWEKLQLAARVIV  71

Query  320  AIQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTD  499
            AI+NPQDI+VQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTS++EPRLLILTD
Sbjct  72   AIENPQDIIVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSFSEPRLLILTD  131

Query  500  PRTDHQPIKEAALGNIPTIAFC  565
            PRTDHQPIKE+ALGNIPTIAFC
Sbjct  132  PRTDHQPIKESALGNIPTIAFC  153



>ref|XP_008800462.1| PREDICTED: 40S ribosomal protein SA-like [Phoenix dactylifera]
Length=307

 Score =   284 bits (726),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 131/145 (90%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = +2

Query  131  STMALSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAAR  310
            +T  LS KE DIQMMLAA+VHLGTKNCDFQMERYVFKRR+DGI+IINLGKTWEKLQ+AAR
Sbjct  3    TTRVLSQKEQDIQMMLAADVHLGTKNCDFQMERYVFKRRSDGIFIINLGKTWEKLQLAAR  62

Query  311  VIVAIQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLI  490
            VIVAI+NPQDI+VQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTS++EPRLLI
Sbjct  63   VIVAIENPQDIIVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSFSEPRLLI  122

Query  491  LTDPRTDHQPIKEAALGNIPTIAFC  565
            LTDPRTDHQPIKE+ALGNIPTIAFC
Sbjct  123  LTDPRTDHQPIKESALGNIPTIAFC  147



>gb|ABK24517.1| unknown [Picea sitchensis]
 gb|ACN40658.1| unknown [Picea sitchensis]
Length=319

 Score =   284 bits (726),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 130/148 (88%), Positives = 142/148 (96%), Gaps = 0/148 (0%)
 Frame = +2

Query  122  MALSTMALSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQM  301
            MA     LS KE+D+QMMLAA+VHLGTKNCDFQMERYV+KRR+DGI+IINLGKTWEKLQ+
Sbjct  1    MAQKMGGLSQKEADVQMMLAADVHLGTKNCDFQMERYVYKRRSDGIFIINLGKTWEKLQL  60

Query  302  AARVIVAIQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPR  481
            AARVIVAI+NPQDI+VQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQ+QTS+NEPR
Sbjct  61   AARVIVAIENPQDIIVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQMQTSFNEPR  120

Query  482  LLILTDPRTDHQPIKEAALGNIPTIAFC  565
            LLILTDPRTDHQPI+EAALGNIPTIAFC
Sbjct  121  LLILTDPRTDHQPIREAALGNIPTIAFC  148



>ref|XP_010101328.1| 40S ribosomal protein SA [Morus notabilis]
 gb|EXB88275.1| 40S ribosomal protein SA [Morus notabilis]
Length=294

 Score =   283 bits (723),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 130/146 (89%), Positives = 141/146 (97%), Gaps = 0/146 (0%)
 Frame = +2

Query  128  LSTMALSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAA  307
            ++   LS KE+DIQMMLAAEVHLGTKNCDFQM+RYVFKRRNDGIYIINLGKTWEKLQ+AA
Sbjct  1    MAVRELSQKEADIQMMLAAEVHLGTKNCDFQMDRYVFKRRNDGIYIINLGKTWEKLQLAA  60

Query  308  RVIVAIQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLL  487
            RVIVAI+NPQD++VQSARPYGQ AVLKFAQYTGAHAIAGRHTPGTFTNQLQTS++EPRLL
Sbjct  61   RVIVAIENPQDMIVQSARPYGQTAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSFSEPRLL  120

Query  488  ILTDPRTDHQPIKEAALGNIPTIAFC  565
            ILTDPRTDHQPIKEA+LGNIPTIAFC
Sbjct  121  ILTDPRTDHQPIKEASLGNIPTIAFC  146



>ref|XP_010937280.1| PREDICTED: 40S ribosomal protein SA-like [Elaeis guineensis]
Length=317

 Score =   283 bits (725),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 131/145 (90%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = +2

Query  131  STMALSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAAR  310
            +T  LS KE DIQMMLAAEVHLGTKNCDFQMERYVFKRR+DGI+IINLG+TWEKLQ+AAR
Sbjct  3    TTRVLSQKEQDIQMMLAAEVHLGTKNCDFQMERYVFKRRSDGIFIINLGRTWEKLQLAAR  62

Query  311  VIVAIQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLI  490
            VIVAI+NPQDI+VQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTS++EPRLLI
Sbjct  63   VIVAIENPQDIIVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSFSEPRLLI  122

Query  491  LTDPRTDHQPIKEAALGNIPTIAFC  565
            LTDPRTDHQPIKE+ALGNIPTIAFC
Sbjct  123  LTDPRTDHQPIKESALGNIPTIAFC  147



>ref|XP_003602573.1| 40S ribosomal protein SA [Medicago truncatula]
 gb|AES72824.1| 40S ribosomal SA-like protein [Medicago truncatula]
 gb|AFK39242.1| unknown [Medicago truncatula]
Length=299

 Score =   283 bits (723),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 132/149 (89%), Positives = 142/149 (95%), Gaps = 0/149 (0%)
 Frame = +2

Query  119  TMALSTMALSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQ  298
            T  LS+  LS KE+DIQMMLAA+VHLGTKNCDFQMERY FKRRNDGIYIINLGKTWEKLQ
Sbjct  3    TEQLSSRQLSQKEADIQMMLAADVHLGTKNCDFQMERYCFKRRNDGIYIINLGKTWEKLQ  62

Query  299  MAARVIVAIQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEP  478
            +AARVIVAI+NPQDI+VQSARPYGQRAVLKFAQYTGA+AIAGRHTPGTFTNQ+Q S++EP
Sbjct  63   LAARVIVAIENPQDIIVQSARPYGQRAVLKFAQYTGANAIAGRHTPGTFTNQMQVSFSEP  122

Query  479  RLLILTDPRTDHQPIKEAALGNIPTIAFC  565
            RLLILTDPRTDHQPIKEAALGNIPTIAFC
Sbjct  123  RLLILTDPRTDHQPIKEAALGNIPTIAFC  151



>gb|ACJ84512.1| unknown [Medicago truncatula]
Length=299

 Score =   283 bits (723),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 132/149 (89%), Positives = 142/149 (95%), Gaps = 0/149 (0%)
 Frame = +2

Query  119  TMALSTMALSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQ  298
            T  LS+  LS KE+DIQMMLAA+VHLGTKNCDFQMERY FKRRNDGIYIINLGKTWEKLQ
Sbjct  3    TEQLSSRQLSQKEADIQMMLAADVHLGTKNCDFQMERYCFKRRNDGIYIINLGKTWEKLQ  62

Query  299  MAARVIVAIQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEP  478
            +AARVIVAI+NPQDI+VQSARPYGQRAVLKFAQYTGA+AIAGRHTPGTFTNQ+Q S++EP
Sbjct  63   LAARVIVAIENPQDIIVQSARPYGQRAVLKFAQYTGANAIAGRHTPGTFTNQMQVSFSEP  122

Query  479  RLLILTDPRTDHQPIKEAALGNIPTIAFC  565
            RLLILTDPRTDHQPIKEAALGNIPTIAFC
Sbjct  123  RLLILTDPRTDHQPIKEAALGNIPTIAFC  151



>ref|XP_003602572.1| 40S ribosomal protein SA [Medicago truncatula]
 gb|AES72823.1| 40S ribosomal SA-like protein [Medicago truncatula]
Length=297

 Score =   283 bits (723),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 132/149 (89%), Positives = 142/149 (95%), Gaps = 0/149 (0%)
 Frame = +2

Query  119  TMALSTMALSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQ  298
            T  LS+  LS KE+DIQMMLAA+VHLGTKNCDFQMERY FKRRNDGIYIINLGKTWEKLQ
Sbjct  3    TEQLSSRQLSQKEADIQMMLAADVHLGTKNCDFQMERYCFKRRNDGIYIINLGKTWEKLQ  62

Query  299  MAARVIVAIQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEP  478
            +AARVIVAI+NPQDI+VQSARPYGQRAVLKFAQYTGA+AIAGRHTPGTFTNQ+Q S++EP
Sbjct  63   LAARVIVAIENPQDIIVQSARPYGQRAVLKFAQYTGANAIAGRHTPGTFTNQMQVSFSEP  122

Query  479  RLLILTDPRTDHQPIKEAALGNIPTIAFC  565
            RLLILTDPRTDHQPIKEAALGNIPTIAFC
Sbjct  123  RLLILTDPRTDHQPIKEAALGNIPTIAFC  151



>ref|XP_004287064.1| PREDICTED: 40S ribosomal protein Sa-2-like [Fragaria vesca subsp. 
vesca]
Length=305

 Score =   283 bits (723),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 132/141 (94%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  143  LSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIVA  322
            LS KE+DIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQ+AARVIVA
Sbjct  12   LSQKEADIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQLAARVIVA  71

Query  323  IQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTDP  502
            I+NP+DI+VQSARPYGQRAVLKFAQ+TGA+AIAGRHTPGTFTNQLQTS+NEPRLLILTDP
Sbjct  72   IENPKDIIVQSARPYGQRAVLKFAQHTGANAIAGRHTPGTFTNQLQTSFNEPRLLILTDP  131

Query  503  RTDHQPIKEAALGNIPTIAFC  565
            RTDHQPIKEAALGNIPTIAFC
Sbjct  132  RTDHQPIKEAALGNIPTIAFC  152



>ref|XP_007135387.1| hypothetical protein PHAVU_010G125100g [Phaseolus vulgaris]
 gb|ESW07381.1| hypothetical protein PHAVU_010G125100g [Phaseolus vulgaris]
Length=310

 Score =   283 bits (723),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 131/141 (93%), Positives = 139/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  143  LSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIVA  322
            LS KE+DIQMMLAA+VHLGTKNCDFQMERY+FKRRNDGIYIINLGKTWEKLQ+AARVIVA
Sbjct  15   LSQKEADIQMMLAADVHLGTKNCDFQMERYIFKRRNDGIYIINLGKTWEKLQLAARVIVA  74

Query  323  IQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTDP  502
            I+NPQDI+VQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTS++EPRLLILTDP
Sbjct  75   IENPQDIIVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSFSEPRLLILTDP  134

Query  503  RTDHQPIKEAALGNIPTIAFC  565
            RTDHQPIKE ALGNIPTIAFC
Sbjct  135  RTDHQPIKEGALGNIPTIAFC  155



>ref|XP_007135386.1| hypothetical protein PHAVU_010G125100g [Phaseolus vulgaris]
 gb|ESW07380.1| hypothetical protein PHAVU_010G125100g [Phaseolus vulgaris]
Length=312

 Score =   283 bits (724),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 131/141 (93%), Positives = 139/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  143  LSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIVA  322
            LS KE+DIQMMLAA+VHLGTKNCDFQMERY+FKRRNDGIYIINLGKTWEKLQ+AARVIVA
Sbjct  15   LSQKEADIQMMLAADVHLGTKNCDFQMERYIFKRRNDGIYIINLGKTWEKLQLAARVIVA  74

Query  323  IQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTDP  502
            I+NPQDI+VQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTS++EPRLLILTDP
Sbjct  75   IENPQDIIVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSFSEPRLLILTDP  134

Query  503  RTDHQPIKEAALGNIPTIAFC  565
            RTDHQPIKE ALGNIPTIAFC
Sbjct  135  RTDHQPIKEGALGNIPTIAFC  155



>ref|XP_007135385.1| hypothetical protein PHAVU_010G125100g [Phaseolus vulgaris]
 gb|ESW07379.1| hypothetical protein PHAVU_010G125100g [Phaseolus vulgaris]
Length=308

 Score =   283 bits (723),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 131/141 (93%), Positives = 139/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  143  LSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIVA  322
            LS KE+DIQMMLAA+VHLGTKNCDFQMERY+FKRRNDGIYIINLGKTWEKLQ+AARVIVA
Sbjct  15   LSQKEADIQMMLAADVHLGTKNCDFQMERYIFKRRNDGIYIINLGKTWEKLQLAARVIVA  74

Query  323  IQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTDP  502
            I+NPQDI+VQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTS++EPRLLILTDP
Sbjct  75   IENPQDIIVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSFSEPRLLILTDP  134

Query  503  RTDHQPIKEAALGNIPTIAFC  565
            RTDHQPIKE ALGNIPTIAFC
Sbjct  135  RTDHQPIKEGALGNIPTIAFC  155



>gb|KHN01455.1| 40S ribosomal protein SA [Glycine soja]
Length=310

 Score =   283 bits (723),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 131/141 (93%), Positives = 139/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  143  LSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIVA  322
            LS KE+DIQMMLA +VHLGTKNCDFQMERY+FKRRNDGIYIINLGKTWEKLQ+AARVIVA
Sbjct  15   LSQKEADIQMMLAVDVHLGTKNCDFQMERYIFKRRNDGIYIINLGKTWEKLQLAARVIVA  74

Query  323  IQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTDP  502
            I+NPQDI+VQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTS++EPRLLILTDP
Sbjct  75   IENPQDIIVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSFSEPRLLILTDP  134

Query  503  RTDHQPIKEAALGNIPTIAFC  565
            RTDHQPIKEAALGNIPTIAFC
Sbjct  135  RTDHQPIKEAALGNIPTIAFC  155



>ref|XP_010540101.1| PREDICTED: 40S ribosomal protein SA-like [Tarenaya hassleriana]
Length=299

 Score =   282 bits (721),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 130/147 (88%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +2

Query  125  ALSTMALSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMA  304
            A +T  LS KE+DIQMML+AEVHLGTKNCD+QMERYVFKRRNDGIYIINLGKTWEKLQ+A
Sbjct  6    APATKQLSQKEADIQMMLSAEVHLGTKNCDYQMERYVFKRRNDGIYIINLGKTWEKLQLA  65

Query  305  ARVIVAIQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRL  484
            ARVIV I+NPQDI+VQSARPYGQRAVLKFAQ+TGA+AIAGRHTPGTFTNQ+QTS++EPRL
Sbjct  66   ARVIVGIENPQDIIVQSARPYGQRAVLKFAQFTGANAIAGRHTPGTFTNQMQTSFSEPRL  125

Query  485  LILTDPRTDHQPIKEAALGNIPTIAFC  565
            LILTDPRTDHQPIKEAALGNIPTIAFC
Sbjct  126  LILTDPRTDHQPIKEAALGNIPTIAFC  152



>ref|NP_001149295.1| 40S ribosomal protein SA [Zea mays]
 gb|ACF88137.1| unknown [Zea mays]
 gb|ACG34897.1| 40S ribosomal protein SA [Zea mays]
Length=308

 Score =   282 bits (722),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 131/142 (92%), Positives = 139/142 (98%), Gaps = 0/142 (0%)
 Frame = +2

Query  140  ALSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIV  319
            ALS KE DIQMMLAA+VHLGTKNCDFQMERYVFKRR DGIYIINLGKTW+KLQ+AARVIV
Sbjct  12   ALSQKEQDIQMMLAADVHLGTKNCDFQMERYVFKRRTDGIYIINLGKTWDKLQLAARVIV  71

Query  320  AIQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTD  499
            AI+NPQDI+VQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTS++EPRLLILTD
Sbjct  72   AIENPQDIIVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSFSEPRLLILTD  131

Query  500  PRTDHQPIKEAALGNIPTIAFC  565
            PRTDHQPIKE+ALGNIPTIAFC
Sbjct  132  PRTDHQPIKESALGNIPTIAFC  153



>ref|XP_008228346.1| PREDICTED: 40S ribosomal protein Sa-2-like [Prunus mume]
Length=297

 Score =   282 bits (721),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 132/150 (88%), Positives = 142/150 (95%), Gaps = 0/150 (0%)
 Frame = +2

Query  116  TTMALSTMALSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKL  295
            T  A     LS KE+DIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTW+KL
Sbjct  3    TNAAAPPRQLSQKEADIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWDKL  62

Query  296  QMAARVIVAIQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNE  475
            Q+AARVIVAI+NP+DI+VQSARPYGQRAVLKFAQ+TGA+AIAGRHTPGTFTNQ+QTS+NE
Sbjct  63   QLAARVIVAIENPKDIIVQSARPYGQRAVLKFAQHTGANAIAGRHTPGTFTNQMQTSFNE  122

Query  476  PRLLILTDPRTDHQPIKEAALGNIPTIAFC  565
            PRLLILTDPRTDHQPIKEAALGNIPTIAFC
Sbjct  123  PRLLILTDPRTDHQPIKEAALGNIPTIAFC  152



>ref|XP_009357906.1| PREDICTED: 40S ribosomal protein SA-like [Pyrus x bretschneideri]
Length=299

 Score =   282 bits (721),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 132/149 (89%), Positives = 142/149 (95%), Gaps = 0/149 (0%)
 Frame = +2

Query  119  TMALSTMALSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQ  298
            T A +   LS KE+DIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTW+KLQ
Sbjct  3    TTAAAPRQLSQKEADIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWDKLQ  62

Query  299  MAARVIVAIQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEP  478
            +AARVIVAI+NP+DI+VQSARPYGQRAVLKFAQ+TGA+AIAGRHTPGTFTNQLQTS+NEP
Sbjct  63   LAARVIVAIENPKDIIVQSARPYGQRAVLKFAQHTGANAIAGRHTPGTFTNQLQTSFNEP  122

Query  479  RLLILTDPRTDHQPIKEAALGNIPTIAFC  565
            RLLILTDPRTD QPIKEAALGNIPTIAFC
Sbjct  123  RLLILTDPRTDSQPIKEAALGNIPTIAFC  151



>ref|XP_008660474.1| PREDICTED: 40S ribosomal protein SA-like [Zea mays]
 gb|AFW89454.1| 40S ribosomal protein SA [Zea mays]
Length=308

 Score =   282 bits (722),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 131/142 (92%), Positives = 139/142 (98%), Gaps = 0/142 (0%)
 Frame = +2

Query  140  ALSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIV  319
            ALS KE DIQMMLAA+VHLGTKNCDFQMERYVFKRR DGIYIINLGKTW+KLQ+AARVIV
Sbjct  12   ALSQKEQDIQMMLAADVHLGTKNCDFQMERYVFKRRTDGIYIINLGKTWDKLQLAARVIV  71

Query  320  AIQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTD  499
            AI+NPQDI+VQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTS++EPRLLILTD
Sbjct  72   AIENPQDIIVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSFSEPRLLILTD  131

Query  500  PRTDHQPIKEAALGNIPTIAFC  565
            PRTDHQPIKE+ALGNIPTIAFC
Sbjct  132  PRTDHQPIKESALGNIPTIAFC  153



>ref|XP_011036520.1| PREDICTED: 40S ribosomal protein Sa-2-like [Populus euphratica]
Length=316

 Score =   282 bits (722),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 132/141 (94%), Positives = 138/141 (98%), Gaps = 0/141 (0%)
 Frame = +2

Query  143  LSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIVA  322
            LS KE DIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKL +AARVIVA
Sbjct  16   LSQKELDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLLLAARVIVA  75

Query  323  IQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTDP  502
            I+NPQDI+VQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQ+QTS++EPRLLILTDP
Sbjct  76   IENPQDIIVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQMQTSFSEPRLLILTDP  135

Query  503  RTDHQPIKEAALGNIPTIAFC  565
            RTDHQPIKEAALGNIPTIAFC
Sbjct  136  RTDHQPIKEAALGNIPTIAFC  156



>ref|XP_004984085.1| PREDICTED: 40S ribosomal protein SA-like [Setaria italica]
Length=309

 Score =   282 bits (721),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 131/142 (92%), Positives = 139/142 (98%), Gaps = 0/142 (0%)
 Frame = +2

Query  140  ALSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIV  319
            ALS KE DIQMMLAA+VHLGTKNCDFQMERYVFKRR DGI+IINLGKTWEKLQ+AARVIV
Sbjct  12   ALSQKEQDIQMMLAADVHLGTKNCDFQMERYVFKRRTDGIFIINLGKTWEKLQLAARVIV  71

Query  320  AIQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTD  499
            AI+NPQDI+VQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTS++EPRLLILTD
Sbjct  72   AIENPQDIIVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSFSEPRLLILTD  131

Query  500  PRTDHQPIKEAALGNIPTIAFC  565
            PRTDHQPIKE+ALGNIPTIAFC
Sbjct  132  PRTDHQPIKESALGNIPTIAFC  153



>ref|XP_008460335.1| PREDICTED: 40S ribosomal protein SA-like isoform X1 [Cucumis 
melo]
Length=380

 Score =   285 bits (728),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 133/141 (94%), Positives = 139/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  143  LSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIVA  322
            LS KE+DIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQ+AARVIV 
Sbjct  82   LSQKEADIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQLAARVIVG  141

Query  323  IQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTDP  502
            I+NPQDI+VQSARPYGQRAVLKFAQ+TGAHAIAGRHTPGTFTNQLQTS+NEPRLLILTDP
Sbjct  142  IENPQDIIVQSARPYGQRAVLKFAQHTGAHAIAGRHTPGTFTNQLQTSFNEPRLLILTDP  201

Query  503  RTDHQPIKEAALGNIPTIAFC  565
            RTDHQPIKEAALGNIPTIAFC
Sbjct  202  RTDHQPIKEAALGNIPTIAFC  222



>ref|XP_009357926.1| PREDICTED: 40S ribosomal protein SA-like [Pyrus x bretschneideri]
Length=299

 Score =   281 bits (720),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 132/149 (89%), Positives = 142/149 (95%), Gaps = 0/149 (0%)
 Frame = +2

Query  119  TMALSTMALSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQ  298
            T A +   LS KE+DIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTW+KLQ
Sbjct  3    TTAAAPRQLSQKEADIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWDKLQ  62

Query  299  MAARVIVAIQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEP  478
            +AARVIVAI+NP+DI+VQSARPYGQRAVLKFAQ+TGA+AIAGRHTPGTFTNQLQTS+NEP
Sbjct  63   LAARVIVAIENPKDIIVQSARPYGQRAVLKFAQHTGANAIAGRHTPGTFTNQLQTSFNEP  122

Query  479  RLLILTDPRTDHQPIKEAALGNIPTIAFC  565
            RLLILTDPRTD QPIKEAALGNIPTIAFC
Sbjct  123  RLLILTDPRTDSQPIKEAALGNIPTIAFC  151



>ref|XP_008392094.1| PREDICTED: 40S ribosomal protein SA-like [Malus domestica]
Length=299

 Score =   281 bits (720),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 132/149 (89%), Positives = 142/149 (95%), Gaps = 0/149 (0%)
 Frame = +2

Query  119  TMALSTMALSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQ  298
            T A +   LS KE+DIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTW+KLQ
Sbjct  3    TTAAAPRQLSQKEADIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWDKLQ  62

Query  299  MAARVIVAIQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEP  478
            +AARVIVAI+NP+DI+VQSARPYGQRAVLKFAQ+TGA+AIAGRHTPGTFTNQLQTS+NEP
Sbjct  63   LAARVIVAIENPKDIIVQSARPYGQRAVLKFAQHTGANAIAGRHTPGTFTNQLQTSFNEP  122

Query  479  RLLILTDPRTDHQPIKEAALGNIPTIAFC  565
            RLLILTDPRTD QPIKEAALGNIPTIAFC
Sbjct  123  RLLILTDPRTDSQPIKEAALGNIPTIAFC  151



>ref|XP_008460336.1| PREDICTED: 40S ribosomal protein SA-like isoform X2 [Cucumis 
melo]
Length=379

 Score =   284 bits (727),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 133/141 (94%), Positives = 139/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  143  LSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIVA  322
            LS KE+DIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQ+AARVIV 
Sbjct  82   LSQKEADIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQLAARVIVG  141

Query  323  IQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTDP  502
            I+NPQDI+VQSARPYGQRAVLKFAQ+TGAHAIAGRHTPGTFTNQLQTS+NEPRLLILTDP
Sbjct  142  IENPQDIIVQSARPYGQRAVLKFAQHTGAHAIAGRHTPGTFTNQLQTSFNEPRLLILTDP  201

Query  503  RTDHQPIKEAALGNIPTIAFC  565
            RTDHQPIKEAALGNIPTIAFC
Sbjct  202  RTDHQPIKEAALGNIPTIAFC  222



>ref|XP_009338332.1| PREDICTED: 40S ribosomal protein SA-like [Pyrus x bretschneideri]
Length=299

 Score =   281 bits (719),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 132/149 (89%), Positives = 142/149 (95%), Gaps = 0/149 (0%)
 Frame = +2

Query  119  TMALSTMALSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQ  298
            T A +   LS KE+DIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTW+KLQ
Sbjct  3    TTAAAPRQLSQKEADIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWDKLQ  62

Query  299  MAARVIVAIQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEP  478
            +AARVIVAI+NP+DI+VQSARPYGQRAVLKFAQ+TGA+AIAGRHTPGTFTNQLQTS+NEP
Sbjct  63   LAARVIVAIENPKDIIVQSARPYGQRAVLKFAQHTGANAIAGRHTPGTFTNQLQTSFNEP  122

Query  479  RLLILTDPRTDHQPIKEAALGNIPTIAFC  565
            RLLILTDPRTD QPIKEAALGNIPTIAFC
Sbjct  123  RLLILTDPRTDSQPIKEAALGNIPTIAFC  151



>ref|XP_008380754.1| PREDICTED: 40S ribosomal protein SA-like [Malus domestica]
Length=300

 Score =   281 bits (719),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 132/149 (89%), Positives = 142/149 (95%), Gaps = 0/149 (0%)
 Frame = +2

Query  119  TMALSTMALSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQ  298
            T A +   LS KE+DIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTW+KLQ
Sbjct  3    TTAAAPRQLSQKEADIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWDKLQ  62

Query  299  MAARVIVAIQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEP  478
            +AARVIVAI+NP+DI+VQSARPYGQRAVLKFAQ+TGA+AIAGRHTPGTFTNQLQTS+NEP
Sbjct  63   LAARVIVAIENPKDIIVQSARPYGQRAVLKFAQHTGANAIAGRHTPGTFTNQLQTSFNEP  122

Query  479  RLLILTDPRTDHQPIKEAALGNIPTIAFC  565
            RLLILTDPRTD QPIKEAALGNIPTIAFC
Sbjct  123  RLLILTDPRTDSQPIKEAALGNIPTIAFC  151



>ref|XP_002303327.2| hypothetical protein POPTR_0003s06880g [Populus trichocarpa]
 gb|ABK92859.1| unknown [Populus trichocarpa]
 gb|EEE78306.2| hypothetical protein POPTR_0003s06880g [Populus trichocarpa]
Length=316

 Score =   281 bits (720),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 131/141 (93%), Positives = 138/141 (98%), Gaps = 0/141 (0%)
 Frame = +2

Query  143  LSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIVA  322
            LS KE DIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKL +AARVIVA
Sbjct  16   LSQKELDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLLLAARVIVA  75

Query  323  IQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTDP  502
            I+NPQD++VQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQ+QTS++EPRLLILTDP
Sbjct  76   IENPQDMIVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQMQTSFSEPRLLILTDP  135

Query  503  RTDHQPIKEAALGNIPTIAFC  565
            RTDHQPIKEAALGNIPTIAFC
Sbjct  136  RTDHQPIKEAALGNIPTIAFC  156



>ref|XP_007200516.1| hypothetical protein PRUPE_ppa009383mg [Prunus persica]
 gb|EMJ01715.1| hypothetical protein PRUPE_ppa009383mg [Prunus persica]
Length=295

 Score =   281 bits (718),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 131/141 (93%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  143  LSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIVA  322
            LS KE+DIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTW+KLQ+AARVIVA
Sbjct  10   LSQKEADIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWDKLQLAARVIVA  69

Query  323  IQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTDP  502
            I+NP+DI+VQSARPYGQRAVLKFAQ+TGA+AIAGRHTPGTFTNQLQTS+NEPRLLILTDP
Sbjct  70   IENPKDIIVQSARPYGQRAVLKFAQHTGANAIAGRHTPGTFTNQLQTSFNEPRLLILTDP  129

Query  503  RTDHQPIKEAALGNIPTIAFC  565
            RTDHQPIKEAALGNIPTIAFC
Sbjct  130  RTDHQPIKEAALGNIPTIAFC  150



>ref|XP_007217253.1| hypothetical protein PRUPE_ppa008193mg [Prunus persica]
 gb|EMJ18452.1| hypothetical protein PRUPE_ppa008193mg [Prunus persica]
Length=342

 Score =   282 bits (722),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 132/150 (88%), Positives = 142/150 (95%), Gaps = 0/150 (0%)
 Frame = +2

Query  116  TTMALSTMALSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKL  295
            T  A     LS KE+DIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTW+KL
Sbjct  39   TNAAAPPRQLSQKEADIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWDKL  98

Query  296  QMAARVIVAIQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNE  475
            Q+AARVIVAI+NP+DI+VQSARPYGQRAVLKFAQ+TGA+AIAGRHTPGTFTNQ+QTS+NE
Sbjct  99   QLAARVIVAIENPKDIIVQSARPYGQRAVLKFAQHTGANAIAGRHTPGTFTNQMQTSFNE  158

Query  476  PRLLILTDPRTDHQPIKEAALGNIPTIAFC  565
            PRLLILTDPRTDHQPIKEAALGNIPTIAFC
Sbjct  159  PRLLILTDPRTDHQPIKEAALGNIPTIAFC  188



>ref|NP_001141003.1| acidic ribosomal protein P40 [Zea mays]
 gb|ACF85147.1| unknown [Zea mays]
 gb|AFW89599.1| hypothetical protein ZEAMMB73_104102 [Zea mays]
Length=310

 Score =   281 bits (719),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 131/142 (92%), Positives = 138/142 (97%), Gaps = 0/142 (0%)
 Frame = +2

Query  140  ALSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIV  319
            ALS KE DIQMMLAA+VHLGTKNCDFQMERY FKRR DGIYIINLGKTWEKLQ+AARVIV
Sbjct  12   ALSQKEQDIQMMLAADVHLGTKNCDFQMERYAFKRRTDGIYIINLGKTWEKLQLAARVIV  71

Query  320  AIQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTD  499
            AI+NPQDI+VQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTS++EPRLLILTD
Sbjct  72   AIENPQDIIVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSFSEPRLLILTD  131

Query  500  PRTDHQPIKEAALGNIPTIAFC  565
            PRTDHQPIKE+ALGNIPTIAFC
Sbjct  132  PRTDHQPIKESALGNIPTIAFC  153



>gb|KHN21343.1| 40S ribosomal protein SA [Glycine soja]
Length=313

 Score =   281 bits (720),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 129/141 (91%), Positives = 137/141 (97%), Gaps = 0/141 (0%)
 Frame = +2

Query  143  LSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIVA  322
            LS +E+DIQMMLAA+VHLGTKNCDFQMERYVFKRR DGIYIINLGKTWEKLQ+AAR+IVA
Sbjct  14   LSQRETDIQMMLAADVHLGTKNCDFQMERYVFKRRTDGIYIINLGKTWEKLQLAARIIVA  73

Query  323  IQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTDP  502
            I+NPQDI+VQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQ+Q SYNEPRLLILTDP
Sbjct  74   IENPQDIIVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQMQQSYNEPRLLILTDP  133

Query  503  RTDHQPIKEAALGNIPTIAFC  565
            RTDHQPIKE ALGNIPTIAFC
Sbjct  134  RTDHQPIKEGALGNIPTIAFC  154



>ref|NP_001242462.1| uncharacterized protein LOC100786575 [Glycine max]
 gb|ACU20248.1| unknown [Glycine max]
Length=313

 Score =   281 bits (719),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 129/141 (91%), Positives = 137/141 (97%), Gaps = 0/141 (0%)
 Frame = +2

Query  143  LSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIVA  322
            LS +E+DIQMMLAA+VHLGTKNCDFQMERYVFKRR DGIYIINLGKTWEKLQ+AAR+IVA
Sbjct  14   LSQRETDIQMMLAADVHLGTKNCDFQMERYVFKRRTDGIYIINLGKTWEKLQLAARIIVA  73

Query  323  IQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTDP  502
            I+NPQDI+VQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQ+Q SYNEPRLLILTDP
Sbjct  74   IENPQDIIVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQMQQSYNEPRLLILTDP  133

Query  503  RTDHQPIKEAALGNIPTIAFC  565
            RTDHQPIKE ALGNIPTIAFC
Sbjct  134  RTDHQPIKEGALGNIPTIAFC  154



>ref|XP_008244692.1| PREDICTED: 40S ribosomal protein SA-like isoform X1 [Prunus mume]
Length=302

 Score =   281 bits (718),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 131/141 (93%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  143  LSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIVA  322
            LS KE+DIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTW+KLQ+AARVIVA
Sbjct  10   LSQKEADIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWDKLQLAARVIVA  69

Query  323  IQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTDP  502
            I+NP+DI+VQSARPYGQRAVLKFAQ+TGA+AIAGRHTPGTFTNQLQTS+NEPRLLILTDP
Sbjct  70   IENPKDIIVQSARPYGQRAVLKFAQHTGANAIAGRHTPGTFTNQLQTSFNEPRLLILTDP  129

Query  503  RTDHQPIKEAALGNIPTIAFC  565
            RTDHQPIKEAALGNIPTIAFC
Sbjct  130  RTDHQPIKEAALGNIPTIAFC  150



>ref|XP_008244693.1| PREDICTED: 40S ribosomal protein SA-like isoform X2 [Prunus mume]
Length=301

 Score =   281 bits (718),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 131/141 (93%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  143  LSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIVA  322
            LS KE+DIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTW+KLQ+AARVIVA
Sbjct  10   LSQKEADIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWDKLQLAARVIVA  69

Query  323  IQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTDP  502
            I+NP+DI+VQSARPYGQRAVLKFAQ+TGA+AIAGRHTPGTFTNQLQTS+NEPRLLILTDP
Sbjct  70   IENPKDIIVQSARPYGQRAVLKFAQHTGANAIAGRHTPGTFTNQLQTSFNEPRLLILTDP  129

Query  503  RTDHQPIKEAALGNIPTIAFC  565
            RTDHQPIKEAALGNIPTIAFC
Sbjct  130  RTDHQPIKEAALGNIPTIAFC  150



>gb|ABK92504.1| unknown [Populus trichocarpa]
Length=310

 Score =   281 bits (719),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 131/141 (93%), Positives = 137/141 (97%), Gaps = 0/141 (0%)
 Frame = +2

Query  143  LSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIVA  322
            LS KE DIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKL +AARVIVA
Sbjct  16   LSQKELDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLLLAARVIVA  75

Query  323  IQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTDP  502
            I+NPQDI+VQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQ+QTS++EPRLLILTDP
Sbjct  76   IENPQDIIVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQMQTSFSEPRLLILTDP  135

Query  503  RTDHQPIKEAALGNIPTIAFC  565
            RTDHQPI EAALGNIPTIAFC
Sbjct  136  RTDHQPIMEAALGNIPTIAFC  156



>ref|XP_006369096.1| hypothetical protein POPTR_0001s16430g [Populus trichocarpa]
 gb|ERP65665.1| hypothetical protein POPTR_0001s16430g [Populus trichocarpa]
Length=314

 Score =   281 bits (719),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 131/141 (93%), Positives = 137/141 (97%), Gaps = 0/141 (0%)
 Frame = +2

Query  143  LSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIVA  322
            LS KE DIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKL +AARVIVA
Sbjct  16   LSQKELDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLLLAARVIVA  75

Query  323  IQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTDP  502
            I+NPQDI+VQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQ+QTS++EPRLLILTDP
Sbjct  76   IENPQDIIVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQMQTSFSEPRLLILTDP  135

Query  503  RTDHQPIKEAALGNIPTIAFC  565
            RTDHQPI EAALGNIPTIAFC
Sbjct  136  RTDHQPIMEAALGNIPTIAFC  156



>gb|KDO45739.1| hypothetical protein CISIN_1g018448mg [Citrus sinensis]
Length=355

 Score =   282 bits (722),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 134/150 (89%), Positives = 141/150 (94%), Gaps = 0/150 (0%)
 Frame = +2

Query  116  TTMALSTMALSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKL  295
            T  A +   LS KE+DIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKL
Sbjct  3    TGTATAPRQLSQKEADIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKL  62

Query  296  QMAARVIVAIQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNE  475
            QMAARVIVAI+NP DI+VQSARPYGQRAVLKFA+YT AHAIAGRHTPGTFTNQ+QTS+NE
Sbjct  63   QMAARVIVAIENPGDIIVQSARPYGQRAVLKFAKYTHAHAIAGRHTPGTFTNQMQTSFNE  122

Query  476  PRLLILTDPRTDHQPIKEAALGNIPTIAFC  565
            PRLLILTDPRTDHQPIKEAALGNIPTIAFC
Sbjct  123  PRLLILTDPRTDHQPIKEAALGNIPTIAFC  152



>gb|AFC88836.1| 40S ribosomal protein SA-like protein, partial [Miscanthus sinensis]
Length=281

 Score =   280 bits (715),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 130/142 (92%), Positives = 139/142 (98%), Gaps = 0/142 (0%)
 Frame = +2

Query  140  ALSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIV  319
            ALS +E DIQMMLAA+VHLGTKNCDFQMERYV+KRR DGIYIINLGKTWEKLQ+AARVIV
Sbjct  2    ALSQREQDIQMMLAADVHLGTKNCDFQMERYVYKRRTDGIYIINLGKTWEKLQLAARVIV  61

Query  320  AIQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTD  499
            AI+NPQDI+VQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTS++EPRLLILTD
Sbjct  62   AIENPQDIIVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSFSEPRLLILTD  121

Query  500  PRTDHQPIKEAALGNIPTIAFC  565
            PRTDHQPIKE+ALGNIPTIAFC
Sbjct  122  PRTDHQPIKESALGNIPTIAFC  143



>ref|XP_006827109.1| hypothetical protein AMTR_s00010p00244660 [Amborella trichopoda]
 gb|ERM94346.1| hypothetical protein AMTR_s00010p00244660 [Amborella trichopoda]
Length=298

 Score =   280 bits (717),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 131/141 (93%), Positives = 136/141 (96%), Gaps = 0/141 (0%)
 Frame = +2

Query  143  LSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIVA  322
            LS KE+DIQMMLAA+VHLGTKNCDFQMERYVFKRR DGIYIINLGKTWEKLQMAARVIVA
Sbjct  4    LSQKEADIQMMLAADVHLGTKNCDFQMERYVFKRRTDGIYIINLGKTWEKLQMAARVIVA  63

Query  323  IQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTDP  502
            I+NPQDI+VQSARPYGQRAVLKFA Y GAH IAGRHTPGTFTNQLQTSY+EPRLLILTDP
Sbjct  64   IENPQDIIVQSARPYGQRAVLKFAHYVGAHPIAGRHTPGTFTNQLQTSYSEPRLLILTDP  123

Query  503  RTDHQPIKEAALGNIPTIAFC  565
            RTDHQPIKEAALGNIPTIAFC
Sbjct  124  RTDHQPIKEAALGNIPTIAFC  144



>ref|XP_010537651.1| PREDICTED: 40S ribosomal protein Sa-1 [Tarenaya hassleriana]
Length=298

 Score =   280 bits (717),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 129/141 (91%), Positives = 139/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  143  LSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIVA  322
            LS KE+DIQMML+AEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQ+AARVIV 
Sbjct  12   LSQKEADIQMMLSAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQLAARVIVG  71

Query  323  IQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTDP  502
            I+NPQDI+VQSARPYGQRAVLKFAQ+TGA+AIAGRHTPGTFTNQ+QTS++EPRLLILTDP
Sbjct  72   IENPQDIIVQSARPYGQRAVLKFAQFTGANAIAGRHTPGTFTNQMQTSFSEPRLLILTDP  131

Query  503  RTDHQPIKEAALGNIPTIAFC  565
            RTDHQPIKEAALGNIPTIAFC
Sbjct  132  RTDHQPIKEAALGNIPTIAFC  152



>ref|XP_002322328.1| 40S ribosomal protein SA [Populus trichocarpa]
 gb|ABK92594.1| unknown [Populus trichocarpa]
 gb|EEF06455.1| 40S ribosomal protein SA [Populus trichocarpa]
Length=312

 Score =   280 bits (717),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 131/141 (93%), Positives = 138/141 (98%), Gaps = 0/141 (0%)
 Frame = +2

Query  143  LSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIVA  322
            LS KE+DIQMMLAAEVHLGTKNC+FQMERYVFKRRNDGIYIINLGKTWEKL +AARVIVA
Sbjct  17   LSQKEADIQMMLAAEVHLGTKNCNFQMERYVFKRRNDGIYIINLGKTWEKLLLAARVIVA  76

Query  323  IQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTDP  502
            I+NPQDI+VQSARPYGQRAVLKFAQYTGAH IAGRHTPGTFTNQLQTS++EPRLLILTDP
Sbjct  77   IENPQDIIVQSARPYGQRAVLKFAQYTGAHPIAGRHTPGTFTNQLQTSFSEPRLLILTDP  136

Query  503  RTDHQPIKEAALGNIPTIAFC  565
            RTDHQPIKEAALGNIPTIAFC
Sbjct  137  RTDHQPIKEAALGNIPTIAFC  157



>ref|XP_003638087.1| 40S ribosomal protein SA [Medicago truncatula]
 gb|KEH24342.1| 40S ribosomal SA-like protein [Medicago truncatula]
Length=297

 Score =   280 bits (715),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 129/141 (91%), Positives = 139/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  143  LSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIVA  322
            LS KE+DIQMMLAA+VHLGTKNCDFQMERY+FKRRNDGIYIINLGKTWEKLQ+AARVIVA
Sbjct  7    LSQKEADIQMMLAADVHLGTKNCDFQMERYIFKRRNDGIYIINLGKTWEKLQLAARVIVA  66

Query  323  IQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTDP  502
            I+NPQDI+VQSARPYGQRAVLKFAQYTGA+AIAGRHTPGTFTNQ+Q S++EPRLLILTDP
Sbjct  67   IENPQDIIVQSARPYGQRAVLKFAQYTGANAIAGRHTPGTFTNQMQVSFSEPRLLILTDP  126

Query  503  RTDHQPIKEAALGNIPTIAFC  565
            RTDHQPIKEAALGNIPTIAFC
Sbjct  127  RTDHQPIKEAALGNIPTIAFC  147



>gb|EMT31083.1| 40S ribosomal protein SA [Aegilops tauschii]
Length=306

 Score =   280 bits (716),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 129/142 (91%), Positives = 139/142 (98%), Gaps = 0/142 (0%)
 Frame = +2

Query  140  ALSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIV  319
            ALS +E DIQMMLAA+VHLGTKNCDFQMERYV+KRR DGIYIINLGKTWEKLQMAARVIV
Sbjct  10   ALSQREQDIQMMLAADVHLGTKNCDFQMERYVYKRRTDGIYIINLGKTWEKLQMAARVIV  69

Query  320  AIQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTD  499
            AI+NPQDI+VQSARPYGQRAVLKFAQYTGA+AIAGRHTPGTFTNQ+QTS++EPRLLILTD
Sbjct  70   AIENPQDIIVQSARPYGQRAVLKFAQYTGANAIAGRHTPGTFTNQMQTSFSEPRLLILTD  129

Query  500  PRTDHQPIKEAALGNIPTIAFC  565
            PRTDHQPIKE+ALGNIPTIAFC
Sbjct  130  PRTDHQPIKESALGNIPTIAFC  151



>tpg|DAA43716.1| TPA: hypothetical protein ZEAMMB73_272794 [Zea mays]
Length=310

 Score =   280 bits (716),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 130/141 (92%), Positives = 138/141 (98%), Gaps = 0/141 (0%)
 Frame = +2

Query  143  LSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIVA  322
            LS KE DIQMMLAA+VHLGTKNCDFQMERYVFKRR DGIYIINLGKTWEKLQ+AARVIVA
Sbjct  14   LSQKEQDIQMMLAADVHLGTKNCDFQMERYVFKRRTDGIYIINLGKTWEKLQLAARVIVA  73

Query  323  IQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTDP  502
            I+NPQD++VQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTS++EPRLLILTDP
Sbjct  74   IENPQDMIVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSFSEPRLLILTDP  133

Query  503  RTDHQPIKEAALGNIPTIAFC  565
            RTDHQPIKE+ALGNIPTIAFC
Sbjct  134  RTDHQPIKESALGNIPTIAFC  154



>ref|XP_004958311.1| PREDICTED: 40S ribosomal protein SA-like [Setaria italica]
Length=309

 Score =   280 bits (716),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 131/141 (93%), Positives = 138/141 (98%), Gaps = 0/141 (0%)
 Frame = +2

Query  143  LSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIVA  322
            LS KE DIQMMLAA+VHLGTKNCDFQMERYVFKRR DGIYIINLGKTWEKLQ+AARVIVA
Sbjct  13   LSQKELDIQMMLAADVHLGTKNCDFQMERYVFKRRTDGIYIINLGKTWEKLQLAARVIVA  72

Query  323  IQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTDP  502
            I+NPQDI+VQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTS++EPRLLILTDP
Sbjct  73   IENPQDIIVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSFSEPRLLILTDP  132

Query  503  RTDHQPIKEAALGNIPTIAFC  565
            RTDHQPIKE+ALGNIPTIAFC
Sbjct  133  RTDHQPIKESALGNIPTIAFC  153



>gb|EPS72131.1| hypothetical protein M569_02626, partial [Genlisea aurea]
Length=286

 Score =   279 bits (714),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 130/141 (92%), Positives = 139/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  143  LSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIVA  322
            LSTKE+DI+MMLAAEVHLGTKNCDFQMERYVFKRRNDGI+IIN+GKTWEKLQMAARVIVA
Sbjct  1    LSTKEADIRMMLAAEVHLGTKNCDFQMERYVFKRRNDGIFIINIGKTWEKLQMAARVIVA  60

Query  323  IQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTDP  502
            I+NPQDI+VQSARPYGQRAVLKFAQYTGA AIAGRHTPGTFTNQLQTS++EPRLLILTDP
Sbjct  61   IENPQDIIVQSARPYGQRAVLKFAQYTGAQAIAGRHTPGTFTNQLQTSFSEPRLLILTDP  120

Query  503  RTDHQPIKEAALGNIPTIAFC  565
            RTDHQPIKEAAL +IPTIAFC
Sbjct  121  RTDHQPIKEAALSSIPTIAFC  141



>gb|ACG32965.1| 40S ribosomal protein SA [Zea mays]
Length=308

 Score =   280 bits (715),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 130/142 (92%), Positives = 139/142 (98%), Gaps = 0/142 (0%)
 Frame = +2

Query  140  ALSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIV  319
            ALS KE DIQMMLAA+VHLGTKNCDFQ ERYVFKRR+DGIYIINLGKTW+KLQ+AARVIV
Sbjct  12   ALSQKEQDIQMMLAADVHLGTKNCDFQTERYVFKRRSDGIYIINLGKTWDKLQLAARVIV  71

Query  320  AIQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTD  499
            AI+NPQDI+VQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTS++EPRLLILTD
Sbjct  72   AIENPQDIIVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSFSEPRLLILTD  131

Query  500  PRTDHQPIKEAALGNIPTIAFC  565
            PRTDHQPIKE+ALGNIPTIAFC
Sbjct  132  PRTDHQPIKESALGNIPTIAFC  153



>ref|XP_011048610.1| PREDICTED: 40S ribosomal protein SA [Populus euphratica]
Length=308

 Score =   280 bits (715),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 130/141 (92%), Positives = 137/141 (97%), Gaps = 0/141 (0%)
 Frame = +2

Query  143  LSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIVA  322
            LS KE DIQ+MLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKL +AARVIVA
Sbjct  16   LSQKELDIQLMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLLLAARVIVA  75

Query  323  IQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTDP  502
            I+NPQDI+VQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQ+QTS++EP LLILTDP
Sbjct  76   IENPQDIIVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQMQTSFSEPHLLILTDP  135

Query  503  RTDHQPIKEAALGNIPTIAFC  565
            RTDHQPIKEAALGNIPTIAFC
Sbjct  136  RTDHQPIKEAALGNIPTIAFC  156



>ref|XP_007149128.1| hypothetical protein PHAVU_005G043400g [Phaseolus vulgaris]
 gb|ESW21122.1| hypothetical protein PHAVU_005G043400g [Phaseolus vulgaris]
Length=313

 Score =   280 bits (715),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 129/141 (91%), Positives = 136/141 (96%), Gaps = 0/141 (0%)
 Frame = +2

Query  143  LSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIVA  322
            LS KE+DIQMMLAA+VHLGTKNCDFQMERYVFKRR DGIYIINLGKTWEKL  AAR+IVA
Sbjct  15   LSQKETDIQMMLAADVHLGTKNCDFQMERYVFKRRTDGIYIINLGKTWEKLHQAARIIVA  74

Query  323  IQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTDP  502
            I+NPQDI+VQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQ+QTSYNEPRLL+LTDP
Sbjct  75   IENPQDIIVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQMQTSYNEPRLLVLTDP  134

Query  503  RTDHQPIKEAALGNIPTIAFC  565
            RTDHQPIKE ALGNIPTIAFC
Sbjct  135  RTDHQPIKEGALGNIPTIAFC  155



>pdb|3J60|A Chain A, Localization Of The Small Subunit Ribosomal Proteins 
Into A 5.5 A Cryo-em Map Of Triticum Aestivum Translating 80s 
Ribosome
Length=260

 Score =   278 bits (710),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 129/141 (91%), Positives = 138/141 (98%), Gaps = 0/141 (0%)
 Frame = +2

Query  143  LSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIVA  322
            LS +E DIQMMLAA+VHLGTKNCDFQMERYV+KRR DGIYIINLGKTWEKLQ+AARVIVA
Sbjct  12   LSQREQDIQMMLAADVHLGTKNCDFQMERYVYKRRTDGIYIINLGKTWEKLQLAARVIVA  71

Query  323  IQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTDP  502
            I+NPQDI+VQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTS++EPRLLILTDP
Sbjct  72   IENPQDIIVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSFSEPRLLILTDP  131

Query  503  RTDHQPIKEAALGNIPTIAFC  565
            RTDHQPIKE+ALGNIPTIAFC
Sbjct  132  RTDHQPIKESALGNIPTIAFC  152



>gb|KCW53364.1| hypothetical protein EUGRSUZ_J02605 [Eucalyptus grandis]
Length=313

 Score =   280 bits (715),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 129/141 (91%), Positives = 138/141 (98%), Gaps = 0/141 (0%)
 Frame = +2

Query  143  LSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIVA  322
            LS KE+DIQMMLAA+VHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQ+AARVIVA
Sbjct  21   LSQKEADIQMMLAAQVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQLAARVIVA  80

Query  323  IQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTDP  502
            I+NPQDI+VQSARPYGQRA+LKFAQYTGA AIAGRHTPGTFTNQ+QTS+ EPRLLILTDP
Sbjct  81   IENPQDIIVQSARPYGQRAILKFAQYTGAQAIAGRHTPGTFTNQMQTSFCEPRLLILTDP  140

Query  503  RTDHQPIKEAALGNIPTIAFC  565
            RTDHQPIKE+ALGNIPTIAFC
Sbjct  141  RTDHQPIKESALGNIPTIAFC  161



>gb|EAY90376.1| hypothetical protein OsI_11954 [Oryza sativa Indica Group]
Length=310

 Score =   279 bits (714),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 129/142 (91%), Positives = 140/142 (99%), Gaps = 0/142 (0%)
 Frame = +2

Query  140  ALSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIV  319
            ALS +E DIQMMLAA+VHLGTKNCDFQMERYV+KRR+DGI+IINLGKTWEKLQ+AARVIV
Sbjct  13   ALSQREQDIQMMLAADVHLGTKNCDFQMERYVYKRRSDGIFIINLGKTWEKLQLAARVIV  72

Query  320  AIQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTD  499
            AI+NPQDI+VQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTS++EPRLLILTD
Sbjct  73   AIENPQDIIVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSFSEPRLLILTD  132

Query  500  PRTDHQPIKEAALGNIPTIAFC  565
            PRTDHQPIKE+ALGNIPTIAFC
Sbjct  133  PRTDHQPIKESALGNIPTIAFC  154



>ref|XP_010033665.1| PREDICTED: 40S ribosomal protein Sa-2-like [Eucalyptus grandis]
 gb|KCW53365.1| hypothetical protein EUGRSUZ_J02605 [Eucalyptus grandis]
Length=315

 Score =   280 bits (715),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 129/141 (91%), Positives = 138/141 (98%), Gaps = 0/141 (0%)
 Frame = +2

Query  143  LSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIVA  322
            LS KE+DIQMMLAA+VHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQ+AARVIVA
Sbjct  21   LSQKEADIQMMLAAQVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQLAARVIVA  80

Query  323  IQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTDP  502
            I+NPQDI+VQSARPYGQRA+LKFAQYTGA AIAGRHTPGTFTNQ+QTS+ EPRLLILTDP
Sbjct  81   IENPQDIIVQSARPYGQRAILKFAQYTGAQAIAGRHTPGTFTNQMQTSFCEPRLLILTDP  140

Query  503  RTDHQPIKEAALGNIPTIAFC  565
            RTDHQPIKE+ALGNIPTIAFC
Sbjct  141  RTDHQPIKESALGNIPTIAFC  161



>gb|ABK93980.1| unknown [Populus trichocarpa]
Length=316

 Score =   280 bits (715),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 130/141 (92%), Positives = 137/141 (97%), Gaps = 0/141 (0%)
 Frame = +2

Query  143  LSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIVA  322
            LS KE DIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKL +AARVIVA
Sbjct  16   LSQKELDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLLLAARVIVA  75

Query  323  IQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTDP  502
            I+NPQD++VQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQ+QTS++EPRLLILTDP
Sbjct  76   IENPQDMIVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQMQTSFSEPRLLILTDP  135

Query  503  RTDHQPIKEAALGNIPTIAFC  565
            RTDHQPIKEAALGNIPTIA C
Sbjct  136  RTDHQPIKEAALGNIPTIALC  156



>ref|XP_008797377.1| PREDICTED: 40S ribosomal protein SA-like [Phoenix dactylifera]
Length=310

 Score =   279 bits (714),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 131/146 (90%), Positives = 142/146 (97%), Gaps = 0/146 (0%)
 Frame = +2

Query  128  LSTMALSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAA  307
            ++T ALS KE DIQMMLAA+VHLGTKNCDFQMERYVFKRR+DGI+IINLGKT EKLQ+AA
Sbjct  1    MATRALSQKEEDIQMMLAADVHLGTKNCDFQMERYVFKRRSDGIFIINLGKTREKLQLAA  60

Query  308  RVIVAIQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLL  487
            RVIVAI+NPQDI+VQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTS++EPRLL
Sbjct  61   RVIVAIENPQDIIVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSFSEPRLL  120

Query  488  ILTDPRTDHQPIKEAALGNIPTIAFC  565
            ILTDPRTDHQPIKE+ALGNIPTIAFC
Sbjct  121  ILTDPRTDHQPIKESALGNIPTIAFC  146



>gb|ABF94326.1| 40S ribosomal protein SA, putative, expressed [Oryza sativa Japonica 
Group]
Length=269

 Score =   278 bits (710),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 128/141 (91%), Positives = 138/141 (98%), Gaps = 0/141 (0%)
 Frame = +2

Query  143  LSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIVA  322
            LS  E D+QMMLAA+VHLGTKNCDFQMERYV+KRR+DGIYIINLGKTWEKLQ+AARVIVA
Sbjct  12   LSQAEQDVQMMLAADVHLGTKNCDFQMERYVYKRRSDGIYIINLGKTWEKLQLAARVIVA  71

Query  323  IQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTDP  502
            I+NPQDI+VQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTS++EPRLLILTDP
Sbjct  72   IENPQDIIVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSFSEPRLLILTDP  131

Query  503  RTDHQPIKEAALGNIPTIAFC  565
            RTDHQPIKE+ALGNIPTIAFC
Sbjct  132  RTDHQPIKESALGNIPTIAFC  152



>ref|NP_001141088.1| uncharacterized protein LOC100273170 [Zea mays]
 gb|ACF85375.1| unknown [Zea mays]
Length=308

 Score =   279 bits (713),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 130/142 (92%), Positives = 138/142 (97%), Gaps = 0/142 (0%)
 Frame = +2

Query  140  ALSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIV  319
            ALS KE DIQMMLAA+VHLGTKNCDFQ ERYVFKRR DGIYIINLGKTW+KLQ+AARVIV
Sbjct  12   ALSQKEQDIQMMLAADVHLGTKNCDFQTERYVFKRRTDGIYIINLGKTWDKLQLAARVIV  71

Query  320  AIQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTD  499
            AI+NPQDI+VQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTS++EPRLLILTD
Sbjct  72   AIENPQDIIVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSFSEPRLLILTD  131

Query  500  PRTDHQPIKEAALGNIPTIAFC  565
            PRTDHQPIKE+ALGNIPTIAFC
Sbjct  132  PRTDHQPIKESALGNIPTIAFC  153



>ref|XP_004502915.1| PREDICTED: 40S ribosomal protein SA-like [Cicer arietinum]
Length=300

 Score =   278 bits (712),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 128/141 (91%), Positives = 138/141 (98%), Gaps = 0/141 (0%)
 Frame = +2

Query  143  LSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIVA  322
            LS KE+DIQMMLAA+VHLGTKNC+FQMERY+FKRRNDGIYIINLGKTW+KL +AARVIVA
Sbjct  11   LSQKEADIQMMLAADVHLGTKNCNFQMERYIFKRRNDGIYIINLGKTWDKLNLAARVIVA  70

Query  323  IQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTDP  502
            I+N QDI+VQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTS++EPRLLILTDP
Sbjct  71   IENSQDIIVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSFSEPRLLILTDP  130

Query  503  RTDHQPIKEAALGNIPTIAFC  565
            RTDHQPIKEAALGNIPTIAFC
Sbjct  131  RTDHQPIKEAALGNIPTIAFC  151



>gb|EAY88799.1| hypothetical protein OsI_10272 [Oryza sativa Indica Group]
Length=305

 Score =   278 bits (712),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 128/141 (91%), Positives = 138/141 (98%), Gaps = 0/141 (0%)
 Frame = +2

Query  143  LSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIVA  322
            LS  E D+QMMLAA+VHLGTKNCDFQMERYV+KRR+DGIYIINLGKTWEKLQ+AARVIVA
Sbjct  12   LSQAEQDVQMMLAADVHLGTKNCDFQMERYVYKRRSDGIYIINLGKTWEKLQLAARVIVA  71

Query  323  IQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTDP  502
            I+NPQDI+VQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTS++EPRLLILTDP
Sbjct  72   IENPQDIIVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSFSEPRLLILTDP  131

Query  503  RTDHQPIKEAALGNIPTIAFC  565
            RTDHQPIKE+ALGNIPTIAFC
Sbjct  132  RTDHQPIKESALGNIPTIAFC  152



>gb|AAK92638.1|AC079633_18 Putative 40S Ribosomal protein [Oryza sativa Japonica Group]
 gb|ABF94325.1| 40S ribosomal protein SA, putative, expressed [Oryza sativa Japonica 
Group]
 gb|EAZ25828.1| hypothetical protein OsJ_09668 [Oryza sativa Japonica Group]
 gb|ACJ54906.1| 40S ribosomal protein [Oryza sativa Japonica Group]
 dbj|BAG92203.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96572.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96840.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96989.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|AEP20530.1| 40S ribosomal protein [Oryza sativa Japonica Group]
Length=305

 Score =   278 bits (712),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 128/141 (91%), Positives = 138/141 (98%), Gaps = 0/141 (0%)
 Frame = +2

Query  143  LSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIVA  322
            LS  E D+QMMLAA+VHLGTKNCDFQMERYV+KRR+DGIYIINLGKTWEKLQ+AARVIVA
Sbjct  12   LSQAEQDVQMMLAADVHLGTKNCDFQMERYVYKRRSDGIYIINLGKTWEKLQLAARVIVA  71

Query  323  IQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTDP  502
            I+NPQDI+VQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTS++EPRLLILTDP
Sbjct  72   IENPQDIIVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSFSEPRLLILTDP  131

Query  503  RTDHQPIKEAALGNIPTIAFC  565
            RTDHQPIKE+ALGNIPTIAFC
Sbjct  132  RTDHQPIKESALGNIPTIAFC  152



>ref|XP_006851847.1| hypothetical protein AMTR_s00041p00084080 [Amborella trichopoda]
 gb|ERN13314.1| hypothetical protein AMTR_s00041p00084080 [Amborella trichopoda]
Length=312

 Score =   279 bits (713),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 132/148 (89%), Positives = 138/148 (93%), Gaps = 1/148 (1%)
 Frame = +2

Query  122  MALSTMALSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQM  301
            MA  T  LS KE+DIQMMLAA+VHLGTKNCDFQMERY FKRR DGIYIINLGKTWEKLQ+
Sbjct  1    MATKT-GLSQKEADIQMMLAADVHLGTKNCDFQMERYAFKRRTDGIYIINLGKTWEKLQL  59

Query  302  AARVIVAIQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPR  481
            AARVIVAI+NPQDI+VQSARPYGQRAVLKFA Y GAH IAGRHTPGTFTNQLQTS+NEPR
Sbjct  60   AARVIVAIENPQDIIVQSARPYGQRAVLKFAHYIGAHPIAGRHTPGTFTNQLQTSFNEPR  119

Query  482  LLILTDPRTDHQPIKEAALGNIPTIAFC  565
            LLILTDPRTDHQPIKEAALGNIPTIAFC
Sbjct  120  LLILTDPRTDHQPIKEAALGNIPTIAFC  147



>ref|NP_001060277.1| Os07g0616600 [Oryza sativa Japonica Group]
 dbj|BAC79991.1| putative 40S ribosomal protein [Oryza sativa Japonica Group]
 dbj|BAF22191.1| Os07g0616600 [Oryza sativa Japonica Group]
 gb|EAZ40661.1| hypothetical protein OsJ_25132 [Oryza sativa Japonica Group]
 dbj|BAG96340.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG95697.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97472.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG86656.1| unnamed protein product [Oryza sativa Japonica Group]
Length=305

 Score =   278 bits (712),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 129/141 (91%), Positives = 138/141 (98%), Gaps = 0/141 (0%)
 Frame = +2

Query  143  LSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIVA  322
            LS +E DIQMMLAA+VHLGTKNCDFQMERYV+KRR DGIYIINLGKTWEKLQ+AARVIVA
Sbjct  12   LSQREQDIQMMLAADVHLGTKNCDFQMERYVYKRRTDGIYIINLGKTWEKLQLAARVIVA  71

Query  323  IQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTDP  502
            I+NPQDI+VQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTS++EPRLLILTDP
Sbjct  72   IENPQDIIVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSFSEPRLLILTDP  131

Query  503  RTDHQPIKEAALGNIPTIAFC  565
            RTDHQPIKE+ALGNIPTIAFC
Sbjct  132  RTDHQPIKESALGNIPTIAFC  152



>gb|EAZ04711.1| hypothetical protein OsI_26872 [Oryza sativa Indica Group]
Length=305

 Score =   278 bits (712),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 129/141 (91%), Positives = 138/141 (98%), Gaps = 0/141 (0%)
 Frame = +2

Query  143  LSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIVA  322
            LS +E DIQMMLAA+VHLGTKNCDFQMERYV+KRR DGIYIINLGKTWEKLQ+AARVIVA
Sbjct  12   LSQREQDIQMMLAADVHLGTKNCDFQMERYVYKRRTDGIYIINLGKTWEKLQLAARVIVA  71

Query  323  IQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTDP  502
            I+NPQDI+VQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTS++EPRLLILTDP
Sbjct  72   IENPQDIIVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSFSEPRLLILTDP  131

Query  503  RTDHQPIKEAALGNIPTIAFC  565
            RTDHQPIKE+ALGNIPTIAFC
Sbjct  132  RTDHQPIKESALGNIPTIAFC  152



>ref|XP_006650178.1| PREDICTED: 40S ribosomal protein SA-like [Oryza brachyantha]
Length=307

 Score =   278 bits (712),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 129/142 (91%), Positives = 139/142 (98%), Gaps = 0/142 (0%)
 Frame = +2

Query  140  ALSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIV  319
            ALS +E D+QMMLAA+VHLGTKNCDFQMERYVFKRR+DGIYIINLGKTWEKL +AARVIV
Sbjct  12   ALSQQEKDVQMMLAADVHLGTKNCDFQMERYVFKRRSDGIYIINLGKTWEKLYLAARVIV  71

Query  320  AIQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTD  499
            AI+NPQDI+VQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTS++EPRLLILTD
Sbjct  72   AIENPQDIIVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSFSEPRLLILTD  131

Query  500  PRTDHQPIKEAALGNIPTIAFC  565
            PRTDHQPIKE+ALGNIPTIAFC
Sbjct  132  PRTDHQPIKESALGNIPTIAFC  153



>ref|XP_003557751.1| PREDICTED: 40S ribosomal protein SA-like [Brachypodium distachyon]
Length=301

 Score =   278 bits (711),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 129/142 (91%), Positives = 140/142 (99%), Gaps = 0/142 (0%)
 Frame = +2

Query  140  ALSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIV  319
            ALS +E DIQMMLAA+VHLGTKNCDFQMERYVFKRR+DGIYIINLGKTWEKLQ+AARVIV
Sbjct  12   ALSQREQDIQMMLAADVHLGTKNCDFQMERYVFKRRSDGIYIINLGKTWEKLQLAARVIV  71

Query  320  AIQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTD  499
            AI+NPQDI+VQSARPYGQRAVLKFAQ+TGA+AIAGRHTPGTFTNQLQTS++EPRLLILTD
Sbjct  72   AIENPQDIIVQSARPYGQRAVLKFAQHTGANAIAGRHTPGTFTNQLQTSFSEPRLLILTD  131

Query  500  PRTDHQPIKEAALGNIPTIAFC  565
            PRTDHQPIKE+ALGNIPTIAFC
Sbjct  132  PRTDHQPIKESALGNIPTIAFC  153



>ref|XP_002463182.1| hypothetical protein SORBIDRAFT_02g039270 [Sorghum bicolor]
 gb|EER99703.1| hypothetical protein SORBIDRAFT_02g039270 [Sorghum bicolor]
Length=306

 Score =   278 bits (712),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 129/141 (91%), Positives = 138/141 (98%), Gaps = 0/141 (0%)
 Frame = +2

Query  143  LSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIVA  322
            LS +E DIQMMLAA+VHLGTKNCDFQMERYV+KRR DGIYIINLGKTWEKLQ+AARVIVA
Sbjct  13   LSQREQDIQMMLAADVHLGTKNCDFQMERYVYKRRTDGIYIINLGKTWEKLQLAARVIVA  72

Query  323  IQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTDP  502
            I+NPQDI+VQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTS++EPRLLILTDP
Sbjct  73   IENPQDIIVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSFSEPRLLILTDP  132

Query  503  RTDHQPIKEAALGNIPTIAFC  565
            RTDHQPIKE+ALGNIPTIAFC
Sbjct  133  RTDHQPIKESALGNIPTIAFC  153



>emb|CDO98217.1| unnamed protein product [Coffea canephora]
Length=302

 Score =   278 bits (710),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 130/141 (92%), Positives = 136/141 (96%), Gaps = 0/141 (0%)
 Frame = +2

Query  143  LSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIVA  322
            LSTKE+DIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGI+IINL KTWEKLQMAAR IVA
Sbjct  10   LSTKEADIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIHIINLAKTWEKLQMAARAIVA  69

Query  323  IQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTDP  502
            I+NPQDI+VQSARPYGQRAVLKFAQYT  HAIAGRHTPGTFTNQLQTS++EPRLLILTDP
Sbjct  70   IENPQDIIVQSARPYGQRAVLKFAQYTHTHAIAGRHTPGTFTNQLQTSFSEPRLLILTDP  129

Query  503  RTDHQPIKEAALGNIPTIAFC  565
            RTDHQPIKEAAL NIPTIAFC
Sbjct  130  RTDHQPIKEAALSNIPTIAFC  150



>gb|ADE77919.1| unknown [Picea sitchensis]
Length=330

 Score =   279 bits (713),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 127/141 (90%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  143  LSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIVA  322
            LS +E+DIQMMLAA+VHLGTKNCDFQMERYV+KRR+DGI+IINLGKTWEKLQ+AARVIVA
Sbjct  7    LSQREADIQMMLAADVHLGTKNCDFQMERYVYKRRSDGIFIINLGKTWEKLQIAARVIVA  66

Query  323  IQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTDP  502
            I+NPQDI+VQSARPYGQRAVLKFAQ+TGAHAIAGRHTPGTFTNQLQTS++EPRLLILTDP
Sbjct  67   IENPQDIIVQSARPYGQRAVLKFAQFTGAHAIAGRHTPGTFTNQLQTSFSEPRLLILTDP  126

Query  503  RTDHQPIKEAALGNIPTIAFC  565
            RTDHQPI+EAALGNIPTIAFC
Sbjct  127  RTDHQPIREAALGNIPTIAFC  147



>ref|NP_001242344.1| uncharacterized protein LOC100818292 [Glycine max]
 gb|ACU20764.1| unknown [Glycine max]
Length=311

 Score =   278 bits (710),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 128/141 (91%), Positives = 136/141 (96%), Gaps = 0/141 (0%)
 Frame = +2

Query  143  LSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIVA  322
            LS +E+DIQMMLAA+VHLGTKNCDFQMERYVFKRR DGIYIINLGKTWEKLQ+AAR+IVA
Sbjct  14   LSQRETDIQMMLAADVHLGTKNCDFQMERYVFKRRTDGIYIINLGKTWEKLQLAARIIVA  73

Query  323  IQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTDP  502
            I+NPQDI+VQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQ+Q SYNEPR LILTDP
Sbjct  74   IENPQDIIVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQMQQSYNEPRRLILTDP  133

Query  503  RTDHQPIKEAALGNIPTIAFC  565
            RTDHQPIKE ALGNIPTIAFC
Sbjct  134  RTDHQPIKEGALGNIPTIAFC  154



>gb|ACG32855.1| 40S ribosomal protein SA [Zea mays]
Length=308

 Score =   278 bits (710),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 129/142 (91%), Positives = 138/142 (97%), Gaps = 0/142 (0%)
 Frame = +2

Query  140  ALSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIV  319
            ALS KE DIQMMLAA+VHLGTKNCDFQ ERYVFKRR+DGIYIINLGKTW+KLQ+AA VIV
Sbjct  12   ALSQKEQDIQMMLAADVHLGTKNCDFQTERYVFKRRSDGIYIINLGKTWDKLQLAAXVIV  71

Query  320  AIQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTD  499
            AI+NPQDI+VQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTS++EPRLLILTD
Sbjct  72   AIENPQDIIVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSFSEPRLLILTD  131

Query  500  PRTDHQPIKEAALGNIPTIAFC  565
            PRTDHQPIKE+ALGNIPTIAFC
Sbjct  132  PRTDHQPIKESALGNIPTIAFC  153



>ref|XP_003558658.1| PREDICTED: 40S ribosomal protein SA-like [Brachypodium distachyon]
Length=306

 Score =   277 bits (709),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 128/145 (88%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = +2

Query  131  STMALSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAAR  310
            S  A+S +E DIQMMLAA+VHLGTKNCDFQMERYVFKRR+DGIYIINLGKTWEKLQ+AAR
Sbjct  8    SPRAMSQREQDIQMMLAADVHLGTKNCDFQMERYVFKRRSDGIYIINLGKTWEKLQLAAR  67

Query  311  VIVAIQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLI  490
            VIVAI+NPQDI+VQSARPYGQRAVLKFAQ+TGA+AIAGRHTPGTFTNQ+QTS++EPRLLI
Sbjct  68   VIVAIENPQDIIVQSARPYGQRAVLKFAQHTGANAIAGRHTPGTFTNQMQTSFSEPRLLI  127

Query  491  LTDPRTDHQPIKEAALGNIPTIAFC  565
            LTDPRTDHQPIKE+ALGNIPTIAFC
Sbjct  128  LTDPRTDHQPIKESALGNIPTIAFC  152



>ref|XP_010685248.1| PREDICTED: 40S ribosomal protein SA-like [Beta vulgaris subsp. 
vulgaris]
Length=304

 Score =   277 bits (709),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 129/141 (91%), Positives = 138/141 (98%), Gaps = 0/141 (0%)
 Frame = +2

Query  143  LSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIVA  322
            L+ KE+DIQMMLAA VHLGTKNCDFQMERYV+KRR+DGI+IINL KTWEKLQMAARVIVA
Sbjct  5    LTQKEADIQMMLAAHVHLGTKNCDFQMERYVYKRRSDGIHIINLAKTWEKLQMAARVIVA  64

Query  323  IQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTDP  502
            I+NPQDI+VQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTS++EPRLLILTDP
Sbjct  65   IENPQDIIVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSFSEPRLLILTDP  124

Query  503  RTDHQPIKEAALGNIPTIAFC  565
            RTDHQPIKEAALGNIPTIAFC
Sbjct  125  RTDHQPIKEAALGNIPTIAFC  145



>ref|XP_006390667.1| hypothetical protein EUTSA_v10018783mg [Eutrema salsugineum]
 ref|XP_006390668.1| hypothetical protein EUTSA_v10018783mg [Eutrema salsugineum]
 gb|ESQ27953.1| hypothetical protein EUTSA_v10018783mg [Eutrema salsugineum]
 gb|ESQ27954.1| hypothetical protein EUTSA_v10018783mg [Eutrema salsugineum]
Length=297

 Score =   277 bits (708),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 128/150 (85%), Positives = 140/150 (93%), Gaps = 0/150 (0%)
 Frame = +2

Query  116  TTMALSTMALSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKL  295
            T +  S+  LS KE+DI+MM AAEVHLGTKNC++QMERYVFKRRNDGIYI NLGKTWEKL
Sbjct  3    TDLTASSGQLSQKEADIRMMCAAEVHLGTKNCNYQMERYVFKRRNDGIYIFNLGKTWEKL  62

Query  296  QMAARVIVAIQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNE  475
            QMAARVIVAI+NPQDI+VQSARPYGQRAVLKFAQYTGA+AIAGRHTPGTFTNQ+QTS++E
Sbjct  63   QMAARVIVAIENPQDIIVQSARPYGQRAVLKFAQYTGANAIAGRHTPGTFTNQMQTSFSE  122

Query  476  PRLLILTDPRTDHQPIKEAALGNIPTIAFC  565
            PRLLILTDPRTDHQPIKE ALGNIP IAFC
Sbjct  123  PRLLILTDPRTDHQPIKEGALGNIPIIAFC  152



>ref|XP_004502927.1| PREDICTED: 40S ribosomal protein SA-like [Cicer arietinum]
Length=302

 Score =   277 bits (708),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 131/150 (87%), Positives = 142/150 (95%), Gaps = 1/150 (1%)
 Frame = +2

Query  116  TTMALSTMALSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKL  295
            TT A S   LS KE+DIQ+MLAA+VHLGTKNC+FQMERY+FKRRNDGIYIINLGKTW+KL
Sbjct  3    TTTAPSRQ-LSQKEADIQIMLAADVHLGTKNCNFQMERYIFKRRNDGIYIINLGKTWDKL  61

Query  296  QMAARVIVAIQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNE  475
             +AARVIVAI+N QDI+VQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTS++E
Sbjct  62   NLAARVIVAIENSQDIIVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSFSE  121

Query  476  PRLLILTDPRTDHQPIKEAALGNIPTIAFC  565
            PRLLILTDPRTDHQPIKEAALGNIPTIAFC
Sbjct  122  PRLLILTDPRTDHQPIKEAALGNIPTIAFC  151



>ref|XP_008668036.1| PREDICTED: 40S ribosomal protein SA isoform X1 [Zea mays]
 gb|ACF87427.1| unknown [Zea mays]
 tpg|DAA41456.1| TPA: 40S ribosomal protein SA isoform 1 [Zea mays]
 tpg|DAA41457.1| TPA: 40S ribosomal protein SA isoform 2 [Zea mays]
Length=307

 Score =   277 bits (708),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 128/142 (90%), Positives = 139/142 (98%), Gaps = 0/142 (0%)
 Frame = +2

Query  140  ALSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIV  319
            ALS +E DIQMMLAA+VHLGTKNCDFQ+ERYV+KRR DGIYIINLGKTW+KLQ+AARVIV
Sbjct  12   ALSQREQDIQMMLAADVHLGTKNCDFQVERYVYKRRTDGIYIINLGKTWDKLQLAARVIV  71

Query  320  AIQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTD  499
            AI+NPQDI+VQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTS++EPRLLILTD
Sbjct  72   AIENPQDIIVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSFSEPRLLILTD  131

Query  500  PRTDHQPIKEAALGNIPTIAFC  565
            PRTDHQPIKE+ALGNIPTIAFC
Sbjct  132  PRTDHQPIKESALGNIPTIAFC  153



>emb|CDY03641.1| BnaA02g15960D [Brassica napus]
Length=295

 Score =   276 bits (707),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 128/150 (85%), Positives = 140/150 (93%), Gaps = 0/150 (0%)
 Frame = +2

Query  116  TTMALSTMALSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKL  295
            T  + +T  LS KE+DI+MM AAEVHLGTKNC++QMERYVFKRRNDGIYI NLGKTWEKL
Sbjct  3    TNGSATTGQLSQKEADIKMMCAAEVHLGTKNCNYQMERYVFKRRNDGIYIFNLGKTWEKL  62

Query  296  QMAARVIVAIQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNE  475
            QMAARVIVAI+NPQDI+VQSARPYGQRAVLKFAQYTGA+AIAGRHTPGTFTNQ+QTS++E
Sbjct  63   QMAARVIVAIENPQDIIVQSARPYGQRAVLKFAQYTGANAIAGRHTPGTFTNQMQTSFSE  122

Query  476  PRLLILTDPRTDHQPIKEAALGNIPTIAFC  565
            PRLLILTDPRTDHQPIKE ALGNIP IAFC
Sbjct  123  PRLLILTDPRTDHQPIKEGALGNIPIIAFC  152



>tpg|DAA43205.1| TPA: 40S ribosomal protein SA [Zea mays]
Length=378

 Score =   279 bits (714),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 130/142 (92%), Positives = 138/142 (97%), Gaps = 0/142 (0%)
 Frame = +2

Query  140  ALSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIV  319
            ALS KE DIQMMLAA+VHLGTKNCDFQ ERYVFKRR DGIYIINLGKTW+KLQ+AARVIV
Sbjct  82   ALSQKEQDIQMMLAADVHLGTKNCDFQTERYVFKRRTDGIYIINLGKTWDKLQLAARVIV  141

Query  320  AIQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTD  499
            AI+NPQDI+VQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTS++EPRLLILTD
Sbjct  142  AIENPQDIIVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSFSEPRLLILTD  201

Query  500  PRTDHQPIKEAALGNIPTIAFC  565
            PRTDHQPIKE+ALGNIPTIAFC
Sbjct  202  PRTDHQPIKESALGNIPTIAFC  223



>ref|XP_009127928.1| PREDICTED: 40S ribosomal protein SA-like [Brassica rapa]
Length=296

 Score =   276 bits (707),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 128/150 (85%), Positives = 140/150 (93%), Gaps = 0/150 (0%)
 Frame = +2

Query  116  TTMALSTMALSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKL  295
            T  + +T  LS KE+DI+MM AAEVHLGTKNC++QMERYVFKRRNDGIYI NLGKTWEKL
Sbjct  3    TNGSATTGQLSQKEADIKMMCAAEVHLGTKNCNYQMERYVFKRRNDGIYIFNLGKTWEKL  62

Query  296  QMAARVIVAIQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNE  475
            QMAARVIVAI+NPQDI+VQSARPYGQRAVLKFAQYTGA+AIAGRHTPGTFTNQ+QTS++E
Sbjct  63   QMAARVIVAIENPQDIIVQSARPYGQRAVLKFAQYTGANAIAGRHTPGTFTNQMQTSFSE  122

Query  476  PRLLILTDPRTDHQPIKEAALGNIPTIAFC  565
            PRLLILTDPRTDHQPIKE ALGNIP IAFC
Sbjct  123  PRLLILTDPRTDHQPIKEGALGNIPIIAFC  152



>ref|XP_008386277.1| PREDICTED: LOW QUALITY PROTEIN: 40S ribosomal protein SA-like 
[Malus domestica]
Length=247

 Score =   275 bits (702),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 129/149 (87%), Positives = 141/149 (95%), Gaps = 0/149 (0%)
 Frame = +2

Query  119  TMALSTMALSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQ  298
            T A +   LS KE+DIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTW+KLQ
Sbjct  4    TTAAAPRQLSQKEADIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWDKLQ  63

Query  299  MAARVIVAIQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEP  478
            +AARVIVAI+NP+DI+ QSARPYG+RAVLKFA++TGA+AIAGRHTPGTFTNQLQTS+NEP
Sbjct  64   LAARVIVAIENPKDILEQSARPYGRRAVLKFAKHTGANAIAGRHTPGTFTNQLQTSFNEP  123

Query  479  RLLILTDPRTDHQPIKEAALGNIPTIAFC  565
            RLLILTDPRTD QPIKEAALGNIPTIAFC
Sbjct  124  RLLILTDPRTDSQPIKEAALGNIPTIAFC  152



>ref|NP_001266097.1| 40S ribosomal protein SA [Cicer arietinum]
 sp|O65751.1|RSSA_CICAR RecName: Full=40S ribosomal protein SA; AltName: Full=p40 [Cicer 
arietinum]
 emb|CAA07226.1| ribosome-associated protein p40 [Cicer arietinum]
Length=300

 Score =   276 bits (707),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 126/141 (89%), Positives = 138/141 (98%), Gaps = 0/141 (0%)
 Frame = +2

Query  143  LSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIVA  322
            L+ KE+DIQMMLAA+VHLGTKNC+FQMERY+FKRRNDGIYIINLGKTW+KL +AAR+IVA
Sbjct  11   LTQKEADIQMMLAADVHLGTKNCNFQMERYIFKRRNDGIYIINLGKTWDKLNLAARIIVA  70

Query  323  IQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTDP  502
            I+N QDI+VQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTS++EPRLLILTDP
Sbjct  71   IENSQDIIVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSFSEPRLLILTDP  130

Query  503  RTDHQPIKEAALGNIPTIAFC  565
            RTDHQPIKEAALGNIPTIAFC
Sbjct  131  RTDHQPIKEAALGNIPTIAFC  151



>gb|KJB67080.1| hypothetical protein B456_010G173800 [Gossypium raimondii]
Length=327

 Score =   277 bits (709),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 135/170 (79%), Positives = 143/170 (84%), Gaps = 20/170 (12%)
 Frame = +2

Query  116  TTMALSTMALSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRND--------------  253
            TT+  +   LS KE+DIQMMLAAEVHLGTKNCDFQMERYVFKRRND              
Sbjct  4    TTVPAAARQLSPKEADIQMMLAAEVHLGTKNCDFQMERYVFKRRNDALVICIGFCFSNGI  63

Query  254  ------GIYIINLGKTWEKLQMAARVIVAIQNPQDIVVQSARPYGQRAVLKFAQYTGAHA  415
                  GIYIINLGKTWEKLQ+AARVIVAI+NPQDI+VQSARPYGQRAVLKFAQYTG HA
Sbjct  64   IFLSSIGIYIINLGKTWEKLQLAARVIVAIENPQDIIVQSARPYGQRAVLKFAQYTGCHA  123

Query  416  IAGRHTPGTFTNQLQTSYNEPRLLILTDPRTDHQPIKEAALGNIPTIAFC  565
            IAGRHTPGTFTNQLQTS++EPRLLILTDPRTDHQPIKEAALGNIPTIAFC
Sbjct  124  IAGRHTPGTFTNQLQTSFSEPRLLILTDPRTDHQPIKEAALGNIPTIAFC  173



>gb|ACG27786.1| 40S ribosomal protein SA [Zea mays]
Length=307

 Score =   276 bits (707),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 128/142 (90%), Positives = 139/142 (98%), Gaps = 0/142 (0%)
 Frame = +2

Query  140  ALSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIV  319
            ALS +E DIQMMLAA+VHLGTKNCDFQ+ERYV+KRR DGIYIINLGKTW+KLQ+AARVIV
Sbjct  12   ALSQREQDIQMMLAADVHLGTKNCDFQVERYVYKRRTDGIYIINLGKTWDKLQLAARVIV  71

Query  320  AIQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTD  499
            AI+NPQDI+VQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTS++EPRLLILTD
Sbjct  72   AIENPQDIIVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSFSEPRLLILTD  131

Query  500  PRTDHQPIKEAALGNIPTIAFC  565
            PRTDHQPIKE+ALGNIPTIAFC
Sbjct  132  PRTDHQPIKESALGNIPTIAFC  153



>emb|CDX82152.1| BnaC02g21380D [Brassica napus]
Length=296

 Score =   276 bits (706),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 128/150 (85%), Positives = 140/150 (93%), Gaps = 0/150 (0%)
 Frame = +2

Query  116  TTMALSTMALSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKL  295
            T  + +T  LS KE+DI+MM AAEVHLGTKNC++QMERYVFKRRNDGIYI NLGKTWEKL
Sbjct  3    TNGSATTGQLSQKEADIKMMCAAEVHLGTKNCNYQMERYVFKRRNDGIYIFNLGKTWEKL  62

Query  296  QMAARVIVAIQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNE  475
            QMAARVIVAI+NPQDI+VQSARPYGQRAVLKFAQYTGA+AIAGRHTPGTFTNQ+QTS++E
Sbjct  63   QMAARVIVAIENPQDIIVQSARPYGQRAVLKFAQYTGANAIAGRHTPGTFTNQMQTSFSE  122

Query  476  PRLLILTDPRTDHQPIKEAALGNIPTIAFC  565
            PRLLILTDPRTDHQPIKE ALGNIP IAFC
Sbjct  123  PRLLILTDPRTDHQPIKEGALGNIPIIAFC  152



>ref|XP_009414830.1| PREDICTED: 40S ribosomal protein SA-like [Musa acuminata subsp. 
malaccensis]
Length=305

 Score =   276 bits (707),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 126/146 (86%), Positives = 139/146 (95%), Gaps = 0/146 (0%)
 Frame = +2

Query  128  LSTMALSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAA  307
            ++T  LS KE DIQMMLAA VHLG +NCDFQMERYV+KRR+DG++IINLGKTWEKLQ+AA
Sbjct  1    MATRVLSPKEQDIQMMLAANVHLGARNCDFQMERYVYKRRSDGVHIINLGKTWEKLQLAA  60

Query  308  RVIVAIQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLL  487
            RVIVAI+NPQDI+VQSARPYGQRAVLKFAQYTGAH IAGRHTPGTFTNQLQTS++EPRLL
Sbjct  61   RVIVAIENPQDIIVQSARPYGQRAVLKFAQYTGAHPIAGRHTPGTFTNQLQTSFSEPRLL  120

Query  488  ILTDPRTDHQPIKEAALGNIPTIAFC  565
            ILTDPRTDHQPIKE+ALGNIPTIAFC
Sbjct  121  ILTDPRTDHQPIKESALGNIPTIAFC  146



>ref|XP_006302619.1| hypothetical protein CARUB_v10020725mg [Capsella rubella]
 gb|EOA35517.1| hypothetical protein CARUB_v10020725mg [Capsella rubella]
Length=296

 Score =   276 bits (706),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 128/150 (85%), Positives = 140/150 (93%), Gaps = 0/150 (0%)
 Frame = +2

Query  116  TTMALSTMALSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKL  295
            T  + S+  LS KE+DI+MM AAEVHLGTKNC++QMERYVFKRRNDGIYI NLGKTWEKL
Sbjct  3    TNGSASSAQLSQKEADIRMMCAAEVHLGTKNCNYQMERYVFKRRNDGIYIFNLGKTWEKL  62

Query  296  QMAARVIVAIQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNE  475
            QMAARVIVAI+NPQDI+VQSARPYGQRAVLKFAQYTGA+AIAGRHTPGTFTNQ+QTS++E
Sbjct  63   QMAARVIVAIENPQDIIVQSARPYGQRAVLKFAQYTGANAIAGRHTPGTFTNQMQTSFSE  122

Query  476  PRLLILTDPRTDHQPIKEAALGNIPTIAFC  565
            PRLLILTDPRTDHQPIKE ALGNIP IAFC
Sbjct  123  PRLLILTDPRTDHQPIKEGALGNIPIIAFC  152



>ref|XP_002884469.1| hypothetical protein ARALYDRAFT_477746 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60728.1| hypothetical protein ARALYDRAFT_477746 [Arabidopsis lyrata subsp. 
lyrata]
Length=318

 Score =   277 bits (708),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 126/141 (89%), Positives = 139/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  143  LSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIVA  322
            LS KE+DIQMML+A+VHLGTKNC++QMERYVFKRRNDGIYIINLGKTW+KLQMAARVIVA
Sbjct  13   LSEKEADIQMMLSADVHLGTKNCNYQMERYVFKRRNDGIYIINLGKTWDKLQMAARVIVA  72

Query  323  IQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTDP  502
            I+NP+DI+VQSARPYGQRAVLKFAQYTGA+AIAGRHTPGTFTNQ+QTS++EPRLLILTDP
Sbjct  73   IENPKDIIVQSARPYGQRAVLKFAQYTGANAIAGRHTPGTFTNQMQTSFSEPRLLILTDP  132

Query  503  RTDHQPIKEAALGNIPTIAFC  565
            RTDHQPIKE ALGNIPTIAFC
Sbjct  133  RTDHQPIKEGALGNIPTIAFC  153



>ref|NP_001031267.1| 40S ribosomal protein Sa-1 [Arabidopsis thaliana]
 dbj|BAH19684.1| AT1G72370 [Arabidopsis thaliana]
 gb|AEE35314.1| 40S ribosomal protein Sa-1 [Arabidopsis thaliana]
Length=294

 Score =   276 bits (705),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 127/150 (85%), Positives = 140/150 (93%), Gaps = 0/150 (0%)
 Frame = +2

Query  116  TTMALSTMALSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKL  295
            T  + S+  LS KE+D++MM AAEVHLGTKNC++QMERYVFKRRNDGIYI NLGKTWEKL
Sbjct  3    TNGSASSAQLSQKEADVRMMCAAEVHLGTKNCNYQMERYVFKRRNDGIYIFNLGKTWEKL  62

Query  296  QMAARVIVAIQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNE  475
            QMAARVIVAI+NPQDI+VQSARPYGQRAVLKFAQYTGA+AIAGRHTPGTFTNQ+QTS++E
Sbjct  63   QMAARVIVAIENPQDIIVQSARPYGQRAVLKFAQYTGANAIAGRHTPGTFTNQMQTSFSE  122

Query  476  PRLLILTDPRTDHQPIKEAALGNIPTIAFC  565
            PRLLILTDPRTDHQPIKE ALGNIP IAFC
Sbjct  123  PRLLILTDPRTDHQPIKEGALGNIPIIAFC  152



>ref|NP_177381.1| 40S ribosomal protein Sa-1 [Arabidopsis thaliana]
 sp|Q08682.3|RSSA1_ARATH RecName: Full=40S ribosomal protein Sa-1; AltName: Full=Laminin 
receptor homolog; AltName: Full=p40 [Arabidopsis thaliana]
 gb|AAG52587.1|AC016529_18 putative 40S ribosomal protein SA (laminin receptor-like protein); 
68387-70081 [Arabidopsis thaliana]
 gb|AAA53425.1| laminin receptor-like protein [Arabidopsis thaliana]
 gb|AAL06872.1| At1g72370/T10D10_16 [Arabidopsis thaliana]
 gb|AAL24271.1| At1g72370/T10D10_16 [Arabidopsis thaliana]
 gb|AAL38272.1| putative 40S ribosomal protein SA (laminin receptor-like protein) 
[Arabidopsis thaliana]
 gb|AAL79591.1| At1g72370/T10D10_16 [Arabidopsis thaliana]
 gb|AAM47880.1| putative 40S ribosomal protein SA (laminin receptor-like protein) 
[Arabidopsis thaliana]
 gb|AAM65523.1| putative 40S ribosomal protein SA (laminin receptor-like protein) 
[Arabidopsis thaliana]
 gb|AAM96990.1| putative 40S ribosomal protein SA (laminin receptor-like protein) 
[Arabidopsis thaliana]
 gb|AAN15740.1| putative 40S ribosomal protein SA (laminin receptor-like protein) 
[Arabidopsis thaliana]
 gb|AEE35313.1| 40S ribosomal protein Sa-1 [Arabidopsis thaliana]
Length=298

 Score =   276 bits (705),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 127/150 (85%), Positives = 140/150 (93%), Gaps = 0/150 (0%)
 Frame = +2

Query  116  TTMALSTMALSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKL  295
            T  + S+  LS KE+D++MM AAEVHLGTKNC++QMERYVFKRRNDGIYI NLGKTWEKL
Sbjct  3    TNGSASSAQLSQKEADVRMMCAAEVHLGTKNCNYQMERYVFKRRNDGIYIFNLGKTWEKL  62

Query  296  QMAARVIVAIQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNE  475
            QMAARVIVAI+NPQDI+VQSARPYGQRAVLKFAQYTGA+AIAGRHTPGTFTNQ+QTS++E
Sbjct  63   QMAARVIVAIENPQDIIVQSARPYGQRAVLKFAQYTGANAIAGRHTPGTFTNQMQTSFSE  122

Query  476  PRLLILTDPRTDHQPIKEAALGNIPTIAFC  565
            PRLLILTDPRTDHQPIKE ALGNIP IAFC
Sbjct  123  PRLLILTDPRTDHQPIKEGALGNIPIIAFC  152



>emb|CDY46144.1| BnaA04g14320D [Brassica napus]
Length=292

 Score =   276 bits (705),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 127/145 (88%), Positives = 138/145 (95%), Gaps = 0/145 (0%)
 Frame = +2

Query  131  STMALSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAAR  310
            + + LS KESDI+MM AAEVHLGTKNC++QMERYVFKRRNDGIYI NLGKTWEKLQMAAR
Sbjct  3    TNVQLSQKESDIKMMCAAEVHLGTKNCNYQMERYVFKRRNDGIYIFNLGKTWEKLQMAAR  62

Query  311  VIVAIQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLI  490
            VIVAI+NPQDI+VQSARPYGQRAVLKFAQYTGA+AIAGRHTPGTFTNQ+QTS++EPRLLI
Sbjct  63   VIVAIENPQDIIVQSARPYGQRAVLKFAQYTGANAIAGRHTPGTFTNQMQTSFSEPRLLI  122

Query  491  LTDPRTDHQPIKEAALGNIPTIAFC  565
            LTDPRTDHQPIKE ALGNIP IAFC
Sbjct  123  LTDPRTDHQPIKEGALGNIPIIAFC  147



>emb|CDY20307.1| BnaC04g36490D [Brassica napus]
Length=292

 Score =   276 bits (705),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 127/145 (88%), Positives = 138/145 (95%), Gaps = 0/145 (0%)
 Frame = +2

Query  131  STMALSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAAR  310
            + + LS KESDI+MM AAEVHLGTKNC++QMERYVFKRRNDGIYI NLGKTWEKLQMAAR
Sbjct  3    TNVQLSQKESDIKMMCAAEVHLGTKNCNYQMERYVFKRRNDGIYIFNLGKTWEKLQMAAR  62

Query  311  VIVAIQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLI  490
            VIVAI+NPQDI+VQSARPYGQRAVLKFAQYTGA+AIAGRHTPGTFTNQ+QTS++EPRLLI
Sbjct  63   VIVAIENPQDIIVQSARPYGQRAVLKFAQYTGANAIAGRHTPGTFTNQMQTSFSEPRLLI  122

Query  491  LTDPRTDHQPIKEAALGNIPTIAFC  565
            LTDPRTDHQPIKE ALGNIP IAFC
Sbjct  123  LTDPRTDHQPIKEGALGNIPIIAFC  147



>ref|XP_011074611.1| PREDICTED: LOW QUALITY PROTEIN: 40S ribosomal protein SA-like 
[Sesamum indicum]
Length=312

 Score =   276 bits (706),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 130/148 (88%), Positives = 138/148 (93%), Gaps = 0/148 (0%)
 Frame = +2

Query  122  MALSTMALSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQM  301
            MA +   LS KE DI+MMLA+EVHLGTKNCDFQMERYVFKRRNDGIYIIN+GKTWEKLQM
Sbjct  1    MATAQWILSMKEDDIRMMLASEVHLGTKNCDFQMERYVFKRRNDGIYIINVGKTWEKLQM  60

Query  302  AARVIVAIQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPR  481
            AA VIVAI+NPQDI+VQSARPYGQRAVLKFAQYTGAHA AGRHTP TFTNQLQTS++EPR
Sbjct  61   AAXVIVAIENPQDIIVQSARPYGQRAVLKFAQYTGAHASAGRHTPRTFTNQLQTSFSEPR  120

Query  482  LLILTDPRTDHQPIKEAALGNIPTIAFC  565
            LLILTDPRTDHQPIKEAAL NIPTIAFC
Sbjct  121  LLILTDPRTDHQPIKEAALSNIPTIAFC  148



>ref|XP_002888871.1| hypothetical protein ARALYDRAFT_895089 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65130.1| hypothetical protein ARALYDRAFT_895089 [Arabidopsis lyrata subsp. 
lyrata]
Length=297

 Score =   276 bits (705),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 126/150 (84%), Positives = 140/150 (93%), Gaps = 0/150 (0%)
 Frame = +2

Query  116  TTMALSTMALSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKL  295
            T  + S+  LS KE+D++MM AAEVHLGTKNC++QMERYVFKRRNDGIYI NLGKTW+KL
Sbjct  3    TNGSASSAQLSQKEADVRMMCAAEVHLGTKNCNYQMERYVFKRRNDGIYIFNLGKTWDKL  62

Query  296  QMAARVIVAIQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNE  475
            QMAARVIVAI+NPQDI+VQSARPYGQRAVLKFAQYTGA+AIAGRHTPGTFTNQ+QTS++E
Sbjct  63   QMAARVIVAIENPQDIIVQSARPYGQRAVLKFAQYTGANAIAGRHTPGTFTNQMQTSFSE  122

Query  476  PRLLILTDPRTDHQPIKEAALGNIPTIAFC  565
            PRLLILTDPRTDHQPIKE ALGNIP IAFC
Sbjct  123  PRLLILTDPRTDHQPIKEGALGNIPIIAFC  152



>ref|XP_006390664.1| hypothetical protein EUTSA_v10018783mg [Eutrema salsugineum]
 ref|XP_006390665.1| hypothetical protein EUTSA_v10018783mg [Eutrema salsugineum]
 ref|XP_006390666.1| hypothetical protein EUTSA_v10018783mg [Eutrema salsugineum]
 gb|ESQ27950.1| hypothetical protein EUTSA_v10018783mg [Eutrema salsugineum]
 gb|ESQ27951.1| hypothetical protein EUTSA_v10018783mg [Eutrema salsugineum]
 gb|ESQ27952.1| hypothetical protein EUTSA_v10018783mg [Eutrema salsugineum]
Length=353

 Score =   277 bits (709),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 127/150 (85%), Positives = 142/150 (95%), Gaps = 0/150 (0%)
 Frame = +2

Query  116  TTMALSTMALSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKL  295
            + ++ S++ LS KE+DI+MM AAEVHLGTKNC++QMERYVFKRRNDGIYI NLGKTWEKL
Sbjct  59   SDLSASSVQLSQKEADIRMMCAAEVHLGTKNCNYQMERYVFKRRNDGIYIFNLGKTWEKL  118

Query  296  QMAARVIVAIQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNE  475
            QMAARVIVAI+NPQDI+VQSARPYGQRAVLKFAQYTGA+AIAGRHTPGTFTNQ+QTS++E
Sbjct  119  QMAARVIVAIENPQDIIVQSARPYGQRAVLKFAQYTGANAIAGRHTPGTFTNQMQTSFSE  178

Query  476  PRLLILTDPRTDHQPIKEAALGNIPTIAFC  565
            PRLLILTDPRTDHQPIKE ALGNIP IAFC
Sbjct  179  PRLLILTDPRTDHQPIKEGALGNIPIIAFC  208



>ref|XP_009140544.1| PREDICTED: 40S ribosomal protein Sa-1-like isoform X1 [Brassica 
rapa]
Length=292

 Score =   275 bits (703),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 127/141 (90%), Positives = 136/141 (96%), Gaps = 0/141 (0%)
 Frame = +2

Query  143  LSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIVA  322
            LS KESDI+MM AAEVHLGTKNC++QMERYVFKRRNDGIYI NLGKTWEKLQMAARVIVA
Sbjct  7    LSQKESDIKMMCAAEVHLGTKNCNYQMERYVFKRRNDGIYIFNLGKTWEKLQMAARVIVA  66

Query  323  IQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTDP  502
            I+NPQDI+VQSARPYGQRAVLKFAQYTGA+AIAGRHTPGTFTNQ+QTS++EPRLLILTDP
Sbjct  67   IENPQDIIVQSARPYGQRAVLKFAQYTGANAIAGRHTPGTFTNQMQTSFSEPRLLILTDP  126

Query  503  RTDHQPIKEAALGNIPTIAFC  565
            RTDHQPIKE ALGNIP IAFC
Sbjct  127  RTDHQPIKEGALGNIPIIAFC  147



>ref|XP_009408973.1| PREDICTED: 40S ribosomal protein Sa-2-like [Musa acuminata subsp. 
malaccensis]
Length=313

 Score =   275 bits (704),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 126/146 (86%), Positives = 139/146 (95%), Gaps = 0/146 (0%)
 Frame = +2

Query  128  LSTMALSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAA  307
            ++T  LS KE DIQMMLAA VHLG +NCDFQMERYV+KRRNDG++IINLGKTWEKLQ+AA
Sbjct  1    MATRVLSQKEQDIQMMLAAAVHLGARNCDFQMERYVYKRRNDGVHIINLGKTWEKLQLAA  60

Query  308  RVIVAIQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLL  487
            RVIVAI+NPQDI+VQSARPYGQRAVLKFAQYTGAH IAGRHTPGTFTNQLQTS++EPRLL
Sbjct  61   RVIVAIENPQDIIVQSARPYGQRAVLKFAQYTGAHPIAGRHTPGTFTNQLQTSFSEPRLL  120

Query  488  ILTDPRTDHQPIKEAALGNIPTIAFC  565
            ILTDPRTDHQPIKE+ALGNIPTI+FC
Sbjct  121  ILTDPRTDHQPIKESALGNIPTISFC  146



>ref|XP_009140545.1| PREDICTED: 40S ribosomal protein SA-like isoform X2 [Brassica 
rapa]
Length=289

 Score =   275 bits (702),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 127/141 (90%), Positives = 136/141 (96%), Gaps = 0/141 (0%)
 Frame = +2

Query  143  LSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIVA  322
            LS KESDI+MM AAEVHLGTKNC++QMERYVFKRRNDGIYI NLGKTWEKLQMAARVIVA
Sbjct  7    LSQKESDIKMMCAAEVHLGTKNCNYQMERYVFKRRNDGIYIFNLGKTWEKLQMAARVIVA  66

Query  323  IQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTDP  502
            I+NPQDI+VQSARPYGQRAVLKFAQYTGA+AIAGRHTPGTFTNQ+QTS++EPRLLILTDP
Sbjct  67   IENPQDIIVQSARPYGQRAVLKFAQYTGANAIAGRHTPGTFTNQMQTSFSEPRLLILTDP  126

Query  503  RTDHQPIKEAALGNIPTIAFC  565
            RTDHQPIKE ALGNIP IAFC
Sbjct  127  RTDHQPIKEGALGNIPIIAFC  147



>gb|KFK41658.1| hypothetical protein AALP_AA2G156100 [Arabis alpina]
Length=292

 Score =   275 bits (702),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 127/150 (85%), Positives = 139/150 (93%), Gaps = 0/150 (0%)
 Frame = +2

Query  116  TTMALSTMALSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKL  295
            T  + S+  LS +ESDI+MM AAEVHLGTKNC++QMERYVFKRRNDGIYI NLGKTWEKL
Sbjct  3    TNGSASSGQLSQRESDIKMMCAAEVHLGTKNCNYQMERYVFKRRNDGIYIFNLGKTWEKL  62

Query  296  QMAARVIVAIQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNE  475
             MAARVIVAI+NPQDI+VQSARPYGQRAVLKFAQYTGA+AIAGRHTPGTFTNQ+QTS++E
Sbjct  63   MMAARVIVAIENPQDIIVQSARPYGQRAVLKFAQYTGANAIAGRHTPGTFTNQMQTSFSE  122

Query  476  PRLLILTDPRTDHQPIKEAALGNIPTIAFC  565
            PRLLILTDPRTDHQPIKE ALGNIP IAFC
Sbjct  123  PRLLILTDPRTDHQPIKEGALGNIPIIAFC  152



>ref|XP_003562847.1| PREDICTED: 40S ribosomal protein Sa-2-like [Brachypodium distachyon]
Length=304

 Score =   275 bits (703),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 128/142 (90%), Positives = 138/142 (97%), Gaps = 0/142 (0%)
 Frame = +2

Query  140  ALSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIV  319
            AL+ ++ DIQMMLAA+VHLGTKNCDFQMERYVFKRR DGIYIINLGKTWEKL MAARVIV
Sbjct  10   ALTQQQQDIQMMLAADVHLGTKNCDFQMERYVFKRRTDGIYIINLGKTWEKLVMAARVIV  69

Query  320  AIQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTD  499
            AI+NPQDI+VQSARPYGQRAVLKFAQYTGA+AIAGRHTPGTFTNQ+QTS++EPRLLILTD
Sbjct  70   AIENPQDIIVQSARPYGQRAVLKFAQYTGANAIAGRHTPGTFTNQMQTSFSEPRLLILTD  129

Query  500  PRTDHQPIKEAALGNIPTIAFC  565
            PRTDHQPIKEAALGNIPTIAFC
Sbjct  130  PRTDHQPIKEAALGNIPTIAFC  151



>ref|NP_187128.1| 40S ribosomal protein Sa-2 [Arabidopsis thaliana]
 sp|Q8H173.2|RSSA2_ARATH RecName: Full=40S ribosomal protein Sa-2; AltName: Full=p40 protein 
homolog [Arabidopsis thaliana]
 gb|AAF04903.1|AC011437_18 putative 40S ribosomal protein [Arabidopsis thaliana]
 gb|AAB67866.1| p40 protein homolog [Arabidopsis thaliana]
 gb|AEE74134.1| 40S ribosomal protein Sa-2 [Arabidopsis thaliana]
Length=280

 Score =   274 bits (700),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 123/141 (87%), Positives = 138/141 (98%), Gaps = 0/141 (0%)
 Frame = +2

Query  143  LSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIVA  322
            +S KE+DIQMML+A+VHLGTKNC++QMERYVFKRR+DGIYIINLGKTW+KLQMAARVIVA
Sbjct  13   VSEKEADIQMMLSADVHLGTKNCNYQMERYVFKRRDDGIYIINLGKTWDKLQMAARVIVA  72

Query  323  IQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTDP  502
            I+NP+DI+VQSARPYGQRAVLKFAQYTG +AIAGRHTPGTFTNQ+QTS++EPRLLILTDP
Sbjct  73   IENPKDIIVQSARPYGQRAVLKFAQYTGVNAIAGRHTPGTFTNQMQTSFSEPRLLILTDP  132

Query  503  RTDHQPIKEAALGNIPTIAFC  565
            RTDHQPIKE ALGNIPTIAFC
Sbjct  133  RTDHQPIKEGALGNIPTIAFC  153



>ref|XP_003562657.1| PREDICTED: 40S ribosomal protein Sa-2-like [Brachypodium distachyon]
Length=304

 Score =   275 bits (702),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 128/142 (90%), Positives = 138/142 (97%), Gaps = 0/142 (0%)
 Frame = +2

Query  140  ALSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIV  319
            AL+ ++ DIQMMLAA+VHLGTKNCDFQMERYVFKRR DGIYIINLGKTWEKL MAARVIV
Sbjct  10   ALTQQQQDIQMMLAADVHLGTKNCDFQMERYVFKRRTDGIYIINLGKTWEKLVMAARVIV  69

Query  320  AIQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTD  499
            AI+NPQDI+VQSARPYGQRAVLKFAQYTGA+AIAGRHTPGTFTNQ+QTS++EPRLLILTD
Sbjct  70   AIENPQDIIVQSARPYGQRAVLKFAQYTGANAIAGRHTPGTFTNQMQTSFSEPRLLILTD  129

Query  500  PRTDHQPIKEAALGNIPTIAFC  565
            PRTDHQPIKEAALGNIPTIAFC
Sbjct  130  PRTDHQPIKEAALGNIPTIAFC  151



>emb|CAA48794.1| laminin receptor homologue [Arabidopsis thaliana]
Length=298

 Score =   275 bits (702),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 126/150 (84%), Positives = 140/150 (93%), Gaps = 0/150 (0%)
 Frame = +2

Query  116  TTMALSTMALSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKL  295
            T  + S+  +S KE+D++MM AAEVHLGTKNC++QMERYVFKRRNDGIYI NLGKTWEKL
Sbjct  3    TNGSASSAHVSQKEADVRMMCAAEVHLGTKNCNYQMERYVFKRRNDGIYIFNLGKTWEKL  62

Query  296  QMAARVIVAIQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNE  475
            QMAARVIVAI+NPQDI+VQSARPYGQRAVLKFAQYTGA+AIAGRHTPGTFTNQ+QTS++E
Sbjct  63   QMAARVIVAIENPQDIIVQSARPYGQRAVLKFAQYTGANAIAGRHTPGTFTNQMQTSFSE  122

Query  476  PRLLILTDPRTDHQPIKEAALGNIPTIAFC  565
            PRLLILTDPRTDHQPIKE ALGNIP IAFC
Sbjct  123  PRLLILTDPRTDHQPIKEGALGNIPIIAFC  152



>emb|CAA61547.1| 40kD protein [Arabidopsis thaliana]
 emb|CAA71407.1| unnamed protein product [Arabidopsis thaliana]
Length=298

 Score =   274 bits (701),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 126/150 (84%), Positives = 140/150 (93%), Gaps = 0/150 (0%)
 Frame = +2

Query  116  TTMALSTMALSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKL  295
            T  + S+  +S KE+D++MM AAEVHLGTKNC++QMERYVFKRRNDGIYI NLGKTWEKL
Sbjct  3    TNGSASSAHVSQKEADVRMMCAAEVHLGTKNCNYQMERYVFKRRNDGIYIFNLGKTWEKL  62

Query  296  QMAARVIVAIQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNE  475
            QMAARVIVAI+NPQDI+VQSARPYGQRAVLKFAQYTGA+AIAGRHTPGTFTNQ+QTS++E
Sbjct  63   QMAARVIVAIENPQDIIVQSARPYGQRAVLKFAQYTGANAIAGRHTPGTFTNQMQTSFSE  122

Query  476  PRLLILTDPRTDHQPIKEAALGNIPTIAFC  565
            PRLLILTDPRTDHQPIKE ALGNIP IAFC
Sbjct  123  PRLLILTDPRTDHQPIKEGALGNIPIIAFC  152



>gb|EMT25827.1| 40S ribosomal protein SA [Aegilops tauschii]
Length=308

 Score =   274 bits (701),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 126/141 (89%), Positives = 138/141 (98%), Gaps = 0/141 (0%)
 Frame = +2

Query  143  LSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIVA  322
            LS KE DIQMMLAA+VHLGTKNCDFQMERY +KRR+DGIYIINLGKTWEKLQ+AARVIVA
Sbjct  12   LSQKEQDIQMMLAADVHLGTKNCDFQMERYAYKRRSDGIYIINLGKTWEKLQLAARVIVA  71

Query  323  IQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTDP  502
            I+NPQDI+VQSARPYGQRAVLKFAQ+TGA+AIAGRHTPGTFTNQ+QTS++EPRLLILTDP
Sbjct  72   IENPQDIIVQSARPYGQRAVLKFAQHTGANAIAGRHTPGTFTNQMQTSFSEPRLLILTDP  131

Query  503  RTDHQPIKEAALGNIPTIAFC  565
            RTDHQPIKE+ALGNIPTIAFC
Sbjct  132  RTDHQPIKESALGNIPTIAFC  152



>ref|XP_011040351.1| PREDICTED: 40S ribosomal protein SA-like [Populus euphratica]
Length=312

 Score =   274 bits (701),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 129/141 (91%), Positives = 137/141 (97%), Gaps = 0/141 (0%)
 Frame = +2

Query  143  LSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIVA  322
            LS KE+DIQMMLAAEVHLGTKNC+FQMERYVFKRRNDGIYIINLGKTWEKL +AARVIVA
Sbjct  17   LSQKEADIQMMLAAEVHLGTKNCNFQMERYVFKRRNDGIYIINLGKTWEKLLLAARVIVA  76

Query  323  IQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTDP  502
            I+NPQDI+VQSARPYGQRAVLKFAQ TGA+AIAGRHTPGTFTNQLQTS+ EPRLL+LTDP
Sbjct  77   IENPQDIIVQSARPYGQRAVLKFAQCTGANAIAGRHTPGTFTNQLQTSFCEPRLLVLTDP  136

Query  503  RTDHQPIKEAALGNIPTIAFC  565
            RTDHQPIKEAALGNIPTIAFC
Sbjct  137  RTDHQPIKEAALGNIPTIAFC  157



>ref|XP_010669330.1| PREDICTED: 40S ribosomal protein Sa-2-like [Beta vulgaris subsp. 
vulgaris]
Length=293

 Score =   273 bits (699),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 128/145 (88%), Positives = 137/145 (94%), Gaps = 0/145 (0%)
 Frame = +2

Query  131  STMALSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAAR  310
            S   LS +E DIQMMLAA+VHLGTKNCDFQMERY+ KRR+DGIYIINLGKTWEKLQMAAR
Sbjct  3    SARGLSQREQDIQMMLAADVHLGTKNCDFQMERYIHKRRSDGIYIINLGKTWEKLQMAAR  62

Query  311  VIVAIQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLI  490
            VIVAI++P+DI+VQSARPYGQRAVLKFAQYTGA AIAGRHTPGTFTNQLQTS+ EPRLLI
Sbjct  63   VIVAIEDPRDIIVQSARPYGQRAVLKFAQYTGAQAIAGRHTPGTFTNQLQTSFCEPRLLI  122

Query  491  LTDPRTDHQPIKEAALGNIPTIAFC  565
            LTDPRTDHQPIKEAALGNIPTIAFC
Sbjct  123  LTDPRTDHQPIKEAALGNIPTIAFC  147



>gb|EMS59326.1| 40S ribosomal protein SA [Triticum urartu]
Length=313

 Score =   274 bits (701),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 126/141 (89%), Positives = 138/141 (98%), Gaps = 0/141 (0%)
 Frame = +2

Query  143  LSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIVA  322
            LS KE DIQMMLAA+VHLGTKNCDFQMERY +KRR+DGIYIINLGKTWEKLQ+AARVIVA
Sbjct  17   LSQKEQDIQMMLAADVHLGTKNCDFQMERYAYKRRSDGIYIINLGKTWEKLQLAARVIVA  76

Query  323  IQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTDP  502
            I+NPQDI+VQSARPYGQRAVLKFAQ+TGA+AIAGRHTPGTFTNQ+QTS++EPRLLILTDP
Sbjct  77   IENPQDIIVQSARPYGQRAVLKFAQHTGANAIAGRHTPGTFTNQMQTSFSEPRLLILTDP  136

Query  503  RTDHQPIKEAALGNIPTIAFC  565
            RTDHQPIKE+ALGNIPTIAFC
Sbjct  137  RTDHQPIKESALGNIPTIAFC  157



>emb|CDY50642.1| BnaC06g24350D [Brassica napus]
Length=288

 Score =   273 bits (698),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 125/146 (86%), Positives = 138/146 (95%), Gaps = 0/146 (0%)
 Frame = +2

Query  128  LSTMALSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAA  307
            ++T   + KE+DI+MM AAEVHLGTKNC++QMERYVFKRRNDGIYI NLGKTWEKLQMAA
Sbjct  1    MATQGSAQKEADIKMMCAAEVHLGTKNCNYQMERYVFKRRNDGIYIFNLGKTWEKLQMAA  60

Query  308  RVIVAIQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLL  487
            RVIVAI+NPQDI+VQSARPYGQRAVLKFAQYTGA+AIAGRHTPGTFTNQ+QTS++EPRLL
Sbjct  61   RVIVAIENPQDIIVQSARPYGQRAVLKFAQYTGANAIAGRHTPGTFTNQMQTSFSEPRLL  120

Query  488  ILTDPRTDHQPIKEAALGNIPTIAFC  565
            ILTDPRTDHQPIKE ALGNIP IAFC
Sbjct  121  ILTDPRTDHQPIKEGALGNIPIIAFC  146



>gb|EYU25918.1| hypothetical protein MIMGU_mgv1a0106061mg, partial [Erythranthe 
guttata]
Length=138

 Score =   268 bits (684),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 124/132 (94%), Positives = 131/132 (99%), Gaps = 0/132 (0%)
 Frame = +2

Query  143  LSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIVA  322
            LSTKE+DIQMMLAAEVHLGTKNC+FQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIV 
Sbjct  7    LSTKEADIQMMLAAEVHLGTKNCNFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIVG  66

Query  323  IQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTDP  502
            I+NPQDI+VQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTS++EPRLLILTDP
Sbjct  67   IENPQDIIVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSFSEPRLLILTDP  126

Query  503  RTDHQPIKEAAL  538
            RTDHQPIKE+AL
Sbjct  127  RTDHQPIKESAL  138



>emb|CDX68268.1| BnaA07g23080D [Brassica napus]
Length=288

 Score =   273 bits (697),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 125/146 (86%), Positives = 138/146 (95%), Gaps = 0/146 (0%)
 Frame = +2

Query  128  LSTMALSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAA  307
            ++T   + KE+DI+MM AAEVHLGTKNC++QMERYVFKRRNDGIYI NLGKTWEKLQMAA
Sbjct  1    MATQGSAQKEADIKMMCAAEVHLGTKNCNYQMERYVFKRRNDGIYIFNLGKTWEKLQMAA  60

Query  308  RVIVAIQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLL  487
            RVIVAI+NPQDI+VQSARPYGQRAVLKFAQYTGA+AIAGRHTPGTFTNQ+QTS++EPRLL
Sbjct  61   RVIVAIENPQDIIVQSARPYGQRAVLKFAQYTGANAIAGRHTPGTFTNQMQTSFSEPRLL  120

Query  488  ILTDPRTDHQPIKEAALGNIPTIAFC  565
            ILTDPRTDHQPIKE ALGNIP IAFC
Sbjct  121  ILTDPRTDHQPIKEGALGNIPIIAFC  146



>ref|XP_010428118.1| PREDICTED: 40S ribosomal protein Sa-1-like [Camelina sativa]
Length=304

 Score =   273 bits (698),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 126/150 (84%), Positives = 139/150 (93%), Gaps = 0/150 (0%)
 Frame = +2

Query  116  TTMALSTMALSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKL  295
            T  + S+  LS +E+DI+MM AAEVHLGTKNC++QMERYVFKRRNDGIYI NLGKTWEKL
Sbjct  9    TNGSASSAQLSQREADIRMMCAAEVHLGTKNCNYQMERYVFKRRNDGIYIFNLGKTWEKL  68

Query  296  QMAARVIVAIQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNE  475
             MAARVIVAI+NPQDI+VQSARPYGQRAVLKFAQYTGA+AIAGRHTPGTFTNQ+QTS++E
Sbjct  69   MMAARVIVAIENPQDIIVQSARPYGQRAVLKFAQYTGANAIAGRHTPGTFTNQMQTSFSE  128

Query  476  PRLLILTDPRTDHQPIKEAALGNIPTIAFC  565
            PRLLILTDPRTDHQPIKE ALGNIP IAFC
Sbjct  129  PRLLILTDPRTDHQPIKEGALGNIPIIAFC  158



>ref|NP_001149804.1| 40S ribosomal protein SA [Zea mays]
 gb|ACG36857.1| 40S ribosomal protein SA [Zea mays]
Length=312

 Score =   273 bits (698),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 127/142 (89%), Positives = 138/142 (97%), Gaps = 0/142 (0%)
 Frame = +2

Query  140  ALSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIV  319
            ALS +E DIQMMLAA+VHLGTKNCDFQ+ERYV+KRR DGIYIINLGKTW+KLQ+AARVIV
Sbjct  12   ALSQREQDIQMMLAADVHLGTKNCDFQVERYVYKRRTDGIYIINLGKTWDKLQLAARVIV  71

Query  320  AIQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTD  499
            AI+NPQDI+ QSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTS++EPRLLILTD
Sbjct  72   AIENPQDIIGQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSFSEPRLLILTD  131

Query  500  PRTDHQPIKEAALGNIPTIAFC  565
            PRTDHQPIKE+ALGNIPTIAFC
Sbjct  132  PRTDHQPIKESALGNIPTIAFC  153



>ref|XP_006298231.1| hypothetical protein CARUB_v10014291mg [Capsella rubella]
 gb|EOA31129.1| hypothetical protein CARUB_v10014291mg [Capsella rubella]
Length=293

 Score =   272 bits (696),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 124/141 (88%), Positives = 139/141 (99%), Gaps = 0/141 (0%)
 Frame = +2

Query  143  LSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIVA  322
            LS KE+DIQMML+A+VHLGTKNC++QM+RYVFKRRNDGIYIINLG+TW+KLQMAARVIVA
Sbjct  13   LSQKEADIQMMLSADVHLGTKNCNYQMDRYVFKRRNDGIYIINLGQTWDKLQMAARVIVA  72

Query  323  IQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTDP  502
            I+NP+DI+VQSARPYGQRAVLKFAQYTGA+AIAGRHTPGTFTNQ+QTS++EPRLLILTDP
Sbjct  73   IENPKDIIVQSARPYGQRAVLKFAQYTGANAIAGRHTPGTFTNQMQTSFSEPRLLILTDP  132

Query  503  RTDHQPIKEAALGNIPTIAFC  565
            RTDHQPIKE ALGNIPTIAFC
Sbjct  133  RTDHQPIKEGALGNIPTIAFC  153



>gb|AAM64971.1| putative 40S ribosomal protein [Arabidopsis thaliana]
Length=280

 Score =   272 bits (695),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 122/141 (87%), Positives = 137/141 (97%), Gaps = 0/141 (0%)
 Frame = +2

Query  143  LSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIVA  322
            +S KE+DIQMML+A+VHLGTKNC++ MERYVFKRR+DGIYIINLGKTW+KLQMAARVIVA
Sbjct  13   VSEKEADIQMMLSADVHLGTKNCNYHMERYVFKRRDDGIYIINLGKTWDKLQMAARVIVA  72

Query  323  IQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTDP  502
            I+NP+DI+VQSARPYGQRAVLKFAQYTG +AIAGRHTPGTFTNQ+QTS++EPRLLILTDP
Sbjct  73   IENPKDIIVQSARPYGQRAVLKFAQYTGVNAIAGRHTPGTFTNQMQTSFSEPRLLILTDP  132

Query  503  RTDHQPIKEAALGNIPTIAFC  565
            RTDHQPIKE ALGNIPTIAFC
Sbjct  133  RTDHQPIKEGALGNIPTIAFC  153



>ref|NP_850515.1| 40S ribosomal protein Sa-2 [Arabidopsis thaliana]
 gb|AEE74133.1| 40S ribosomal protein Sa-2 [Arabidopsis thaliana]
Length=332

 Score =   273 bits (699),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 123/141 (87%), Positives = 138/141 (98%), Gaps = 0/141 (0%)
 Frame = +2

Query  143  LSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIVA  322
            +S KE+DIQMML+A+VHLGTKNC++QMERYVFKRR+DGIYIINLGKTW+KLQMAARVIVA
Sbjct  13   VSEKEADIQMMLSADVHLGTKNCNYQMERYVFKRRDDGIYIINLGKTWDKLQMAARVIVA  72

Query  323  IQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTDP  502
            I+NP+DI+VQSARPYGQRAVLKFAQYTG +AIAGRHTPGTFTNQ+QTS++EPRLLILTDP
Sbjct  73   IENPKDIIVQSARPYGQRAVLKFAQYTGVNAIAGRHTPGTFTNQMQTSFSEPRLLILTDP  132

Query  503  RTDHQPIKEAALGNIPTIAFC  565
            RTDHQPIKE ALGNIPTIAFC
Sbjct  133  RTDHQPIKEGALGNIPTIAFC  153



>ref|XP_011001300.1| PREDICTED: 40S ribosomal protein Sa-2-like isoform X2 [Populus 
euphratica]
Length=303

 Score =   272 bits (696),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 128/141 (91%), Positives = 137/141 (97%), Gaps = 0/141 (0%)
 Frame = +2

Query  143  LSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIVA  322
            LS KE+DIQMMLAAEVHLGTKNC+FQMERYVFKRRNDGIYIINLGKTW+KL +AARVIVA
Sbjct  14   LSQKEADIQMMLAAEVHLGTKNCNFQMERYVFKRRNDGIYIINLGKTWDKLLLAARVIVA  73

Query  323  IQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTDP  502
            I+NPQDI+VQSARPYGQRAVLKFAQ TGA+AIAGRHTPGTFTNQLQTS+ EPRLL+LTDP
Sbjct  74   IENPQDIIVQSARPYGQRAVLKFAQCTGANAIAGRHTPGTFTNQLQTSFCEPRLLVLTDP  133

Query  503  RTDHQPIKEAALGNIPTIAFC  565
            RTDHQPIKEAALGNIPTIAFC
Sbjct  134  RTDHQPIKEAALGNIPTIAFC  154



>ref|XP_010463964.1| PREDICTED: 40S ribosomal protein Sa-2 [Camelina sativa]
Length=267

 Score =   271 bits (693),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 124/141 (88%), Positives = 137/141 (97%), Gaps = 0/141 (0%)
 Frame = +2

Query  143  LSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIVA  322
            LS KE+DIQMML+A+VHLGTKNC++QM+RYVF RRNDGIYIINLGKTW+KLQMAARVIVA
Sbjct  13   LSEKEADIQMMLSADVHLGTKNCNYQMDRYVFNRRNDGIYIINLGKTWDKLQMAARVIVA  72

Query  323  IQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTDP  502
            I+NP+DI+VQSARPYGQRAVLKFAQYTGA AIAGRHTPGTFTNQ+QTS++EPRLLILTDP
Sbjct  73   IENPKDIIVQSARPYGQRAVLKFAQYTGATAIAGRHTPGTFTNQMQTSFSEPRLLILTDP  132

Query  503  RTDHQPIKEAALGNIPTIAFC  565
            RTDHQPIKE ALGNIPTIAFC
Sbjct  133  RTDHQPIKEGALGNIPTIAFC  153



>ref|XP_011001299.1| PREDICTED: 40S ribosomal protein SA-like isoform X1 [Populus 
euphratica]
Length=304

 Score =   272 bits (696),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 128/141 (91%), Positives = 137/141 (97%), Gaps = 0/141 (0%)
 Frame = +2

Query  143  LSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIVA  322
            LS KE+DIQMMLAAEVHLGTKNC+FQMERYVFKRRNDGIYIINLGKTW+KL +AARVIVA
Sbjct  14   LSQKEADIQMMLAAEVHLGTKNCNFQMERYVFKRRNDGIYIINLGKTWDKLLLAARVIVA  73

Query  323  IQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTDP  502
            I+NPQDI+VQSARPYGQRAVLKFAQ TGA+AIAGRHTPGTFTNQLQTS+ EPRLL+LTDP
Sbjct  74   IENPQDIIVQSARPYGQRAVLKFAQCTGANAIAGRHTPGTFTNQLQTSFCEPRLLVLTDP  133

Query  503  RTDHQPIKEAALGNIPTIAFC  565
            RTDHQPIKEAALGNIPTIAFC
Sbjct  134  RTDHQPIKEAALGNIPTIAFC  154



>ref|XP_002966682.1| hypothetical protein SELMODRAFT_36118, partial [Selaginella moellendorffii]
 ref|XP_002978055.1| hypothetical protein SELMODRAFT_36138, partial [Selaginella moellendorffii]
 gb|EFJ20712.1| hypothetical protein SELMODRAFT_36138, partial [Selaginella moellendorffii]
 gb|EFJ32709.1| hypothetical protein SELMODRAFT_36118, partial [Selaginella moellendorffii]
Length=213

 Score =   269 bits (687),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 124/142 (87%), Positives = 135/142 (95%), Gaps = 0/142 (0%)
 Frame = +2

Query  140  ALSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIV  319
            ALS KE+DIQMMLA+ VHLGTKNCDFQMERYV+KRR+DGI+IIN+GKTWEKLQ+AARVIV
Sbjct  1    ALSPKEADIQMMLASAVHLGTKNCDFQMERYVWKRRSDGIFIINVGKTWEKLQLAARVIV  60

Query  320  AIQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTD  499
             I+NP DI+VQSARPYGQRAVLKFAQYTGA AIAGRHTPGTFTNQLQ S++EPRLLILTD
Sbjct  61   GIENPHDIIVQSARPYGQRAVLKFAQYTGAQAIAGRHTPGTFTNQLQNSFSEPRLLILTD  120

Query  500  PRTDHQPIKEAALGNIPTIAFC  565
            PRTDHQPIKEAALGNIP IAFC
Sbjct  121  PRTDHQPIKEAALGNIPVIAFC  142



>emb|CDX72910.1| BnaC06g33580D [Brassica napus]
Length=292

 Score =   271 bits (694),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 125/141 (89%), Positives = 135/141 (96%), Gaps = 0/141 (0%)
 Frame = +2

Query  143  LSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIVA  322
            LS KE+DI+MM AAEVHLGTKNC++QMERYVFKRRNDGIYI NLGKTWEKL MAARVIVA
Sbjct  9    LSQKEADIKMMCAAEVHLGTKNCNYQMERYVFKRRNDGIYIFNLGKTWEKLMMAARVIVA  68

Query  323  IQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTDP  502
            I+NPQDI+VQSARPYGQRAVLKFAQYTGA+AIAGRHTPGTFTNQ+QTS++EPRLLILTDP
Sbjct  69   IENPQDIIVQSARPYGQRAVLKFAQYTGANAIAGRHTPGTFTNQMQTSFSEPRLLILTDP  128

Query  503  RTDHQPIKEAALGNIPTIAFC  565
            RTDHQPIKE ALGNIP IAFC
Sbjct  129  RTDHQPIKEGALGNIPIIAFC  149



>sp|Q9ZSR8.1|RSSA_BRANA RecName: Full=40S ribosomal protein SA; AltName: Full=Laminin 
receptor-like protein; AltName: Full=p40 [Brassica napus]
 gb|AAC97937.1| laminin receptor-like protein [Brassica napus]
 emb|CDX96403.1| BnaA07g30140D [Brassica napus]
Length=292

 Score =   271 bits (694),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 125/141 (89%), Positives = 135/141 (96%), Gaps = 0/141 (0%)
 Frame = +2

Query  143  LSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIVA  322
            LS KE+DI+MM AAEVHLGTKNC++QMERYVFKRRNDGIYI NLGKTWEKL MAARVIVA
Sbjct  9    LSQKEADIKMMCAAEVHLGTKNCNYQMERYVFKRRNDGIYIFNLGKTWEKLMMAARVIVA  68

Query  323  IQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTDP  502
            I+NPQDI+VQSARPYGQRAVLKFAQYTGA+AIAGRHTPGTFTNQ+QTS++EPRLLILTDP
Sbjct  69   IENPQDIIVQSARPYGQRAVLKFAQYTGANAIAGRHTPGTFTNQMQTSFSEPRLLILTDP  128

Query  503  RTDHQPIKEAALGNIPTIAFC  565
            RTDHQPIKE ALGNIP IAFC
Sbjct  129  RTDHQPIKEGALGNIPIIAFC  149



>ref|XP_010415982.1| PREDICTED: 40S ribosomal protein Sa-1-like [Camelina sativa]
Length=297

 Score =   271 bits (693),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 125/150 (83%), Positives = 139/150 (93%), Gaps = 0/150 (0%)
 Frame = +2

Query  116  TTMALSTMALSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKL  295
            T  + S+  LS +E+DI+MM AAEVHLGTKNC++QMERYVFKRRNDGIYI NLGKTW+KL
Sbjct  3    TNGSASSAQLSQREADIRMMCAAEVHLGTKNCNYQMERYVFKRRNDGIYIFNLGKTWDKL  62

Query  296  QMAARVIVAIQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNE  475
             MAARVIVAI+NPQDI+VQSARPYGQRAVLKFAQYTGA+AIAGRHTPGTFTNQ+QTS++E
Sbjct  63   MMAARVIVAIENPQDIIVQSARPYGQRAVLKFAQYTGANAIAGRHTPGTFTNQMQTSFSE  122

Query  476  PRLLILTDPRTDHQPIKEAALGNIPTIAFC  565
            PRLLILTDPRTDHQPIKE ALGNIP IAFC
Sbjct  123  PRLLILTDPRTDHQPIKEGALGNIPIIAFC  152



>ref|XP_006376986.1| hypothetical protein POPTR_0012s11830g [Populus trichocarpa]
 gb|ERP54783.1| hypothetical protein POPTR_0012s11830g [Populus trichocarpa]
Length=306

 Score =   271 bits (694),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 127/141 (90%), Positives = 137/141 (97%), Gaps = 0/141 (0%)
 Frame = +2

Query  143  LSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIVA  322
            LS KE+DIQMMLAAEVHLGTKNC+FQMERYVFKRRNDGIYIINLGKTW+KL +AARVIVA
Sbjct  14   LSQKEADIQMMLAAEVHLGTKNCNFQMERYVFKRRNDGIYIINLGKTWDKLLLAARVIVA  73

Query  323  IQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTDP  502
            I+NPQDI+VQSARPYGQRAVLKFAQ TGA+AIAGRHTPGTFTNQLQT++ EPRLL+LTDP
Sbjct  74   IENPQDIIVQSARPYGQRAVLKFAQCTGANAIAGRHTPGTFTNQLQTTFCEPRLLVLTDP  133

Query  503  RTDHQPIKEAALGNIPTIAFC  565
            RTDHQPIKEAALGNIPTIAFC
Sbjct  134  RTDHQPIKEAALGNIPTIAFC  154



>ref|XP_010471264.1| PREDICTED: 40S ribosomal protein Sa-1 [Camelina sativa]
Length=298

 Score =   271 bits (692),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 125/150 (83%), Positives = 139/150 (93%), Gaps = 0/150 (0%)
 Frame = +2

Query  116  TTMALSTMALSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKL  295
            T  + S+  LS +E+DI+MM AAEVHLGTKNC++QMERYVFKRRNDGIYI NLGKTW+KL
Sbjct  3    TNGSASSAQLSQREADIRMMCAAEVHLGTKNCNYQMERYVFKRRNDGIYIFNLGKTWDKL  62

Query  296  QMAARVIVAIQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNE  475
             MAARVIVAI+NPQDI+VQSARPYGQRAVLKFAQYTGA+AIAGRHTPGTFTNQ+QTS++E
Sbjct  63   MMAARVIVAIENPQDIIVQSARPYGQRAVLKFAQYTGANAIAGRHTPGTFTNQMQTSFSE  122

Query  476  PRLLILTDPRTDHQPIKEAALGNIPTIAFC  565
            PRLLILTDPRTDHQPIKE ALGNIP IAFC
Sbjct  123  PRLLILTDPRTDHQPIKEGALGNIPIIAFC  152



>ref|XP_009104860.1| PREDICTED: 40S ribosomal protein SA-like [Brassica rapa]
Length=288

 Score =   270 bits (691),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 124/146 (85%), Positives = 137/146 (94%), Gaps = 0/146 (0%)
 Frame = +2

Query  128  LSTMALSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAA  307
            ++T   + KE+DI+MM AAEVHLGT NC++QMERYVFKRRNDGIYI NLGKTWEKLQMAA
Sbjct  1    MATQGSAQKEADIKMMCAAEVHLGTTNCNYQMERYVFKRRNDGIYIFNLGKTWEKLQMAA  60

Query  308  RVIVAIQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLL  487
            RVIVAI+NPQDI+VQSARPYGQRAVLKFAQYTGA+AIAGRHTPGTFTNQ+QTS++EPRLL
Sbjct  61   RVIVAIENPQDIIVQSARPYGQRAVLKFAQYTGANAIAGRHTPGTFTNQMQTSFSEPRLL  120

Query  488  ILTDPRTDHQPIKEAALGNIPTIAFC  565
            ILTDPRTDHQPIKE ALGNIP IAFC
Sbjct  121  ILTDPRTDHQPIKEGALGNIPIIAFC  146



>gb|AAN18120.1| At3g04770/F7O18_26 [Arabidopsis thaliana]
Length=332

 Score =   271 bits (694),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 122/141 (87%), Positives = 138/141 (98%), Gaps = 0/141 (0%)
 Frame = +2

Query  143  LSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIVA  322
            +S KE+DIQ+ML+A+VHLGTKNC++QMERYVFKRR+DGIYIINLGKTW+KLQMAARVIVA
Sbjct  13   VSEKEADIQIMLSADVHLGTKNCNYQMERYVFKRRDDGIYIINLGKTWDKLQMAARVIVA  72

Query  323  IQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTDP  502
            I+NP+DI+VQSARPYGQRAVLKFAQYTG +AIAGRHTPGTFTNQ+QTS++EPRLLILTDP
Sbjct  73   IENPKDIIVQSARPYGQRAVLKFAQYTGVNAIAGRHTPGTFTNQMQTSFSEPRLLILTDP  132

Query  503  RTDHQPIKEAALGNIPTIAFC  565
            RTDHQPIKE ALGNIPTIAFC
Sbjct  133  RTDHQPIKEGALGNIPTIAFC  153



>ref|XP_009387628.1| PREDICTED: 40S ribosomal protein Sa-2-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=295

 Score =   270 bits (691),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 123/146 (84%), Positives = 138/146 (95%), Gaps = 0/146 (0%)
 Frame = +2

Query  128  LSTMALSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAA  307
            ++T  LS KE DIQMML+A VHLG +NCDFQMERYV+KRR+DG++IINLGKTWEKL++AA
Sbjct  1    MATRVLSQKEEDIQMMLSAAVHLGARNCDFQMERYVYKRRSDGVHIINLGKTWEKLRLAA  60

Query  308  RVIVAIQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLL  487
            RVIVAI+NPQDI+VQSARPYGQRAVLKFAQYTGA  IAGRHTPGTFTNQLQTS++EPRLL
Sbjct  61   RVIVAIENPQDIIVQSARPYGQRAVLKFAQYTGASPIAGRHTPGTFTNQLQTSFSEPRLL  120

Query  488  ILTDPRTDHQPIKEAALGNIPTIAFC  565
            ILTDPRTDHQPIKE+ALGNIPTIAFC
Sbjct  121  ILTDPRTDHQPIKESALGNIPTIAFC  146



>gb|AAL77699.1| AT3g04770/F7O18_26 [Arabidopsis thaliana]
Length=332

 Score =   271 bits (694),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 122/141 (87%), Positives = 138/141 (98%), Gaps = 0/141 (0%)
 Frame = +2

Query  143  LSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIVA  322
            +S KE+DIQ+ML+A+VHLGTKNC++QMERYVFKRR+DGIYIINLGKTW+KLQMAARVIVA
Sbjct  13   VSEKEADIQIMLSADVHLGTKNCNYQMERYVFKRRDDGIYIINLGKTWDKLQMAARVIVA  72

Query  323  IQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTDP  502
            I+NP+DI+VQSARPYGQRAVLKFAQYTG +AIAGRHTPGTFTNQ+QTS++EPRLLILTDP
Sbjct  73   IENPKDIIVQSARPYGQRAVLKFAQYTGVNAIAGRHTPGTFTNQMQTSFSEPRLLILTDP  132

Query  503  RTDHQPIKEAALGNIPTIAFC  565
            RTDHQPIKE ALGNIPTIAFC
Sbjct  133  RTDHQPIKEGALGNIPTIAFC  153



>ref|XP_009387629.1| PREDICTED: 40S ribosomal protein Sa-2-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=294

 Score =   270 bits (690),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 123/146 (84%), Positives = 138/146 (95%), Gaps = 0/146 (0%)
 Frame = +2

Query  128  LSTMALSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAA  307
            ++T  LS KE DIQMML+A VHLG +NCDFQMERYV+KRR+DG++IINLGKTWEKL++AA
Sbjct  1    MATRVLSQKEEDIQMMLSAAVHLGARNCDFQMERYVYKRRSDGVHIINLGKTWEKLRLAA  60

Query  308  RVIVAIQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLL  487
            RVIVAI+NPQDI+VQSARPYGQRAVLKFAQYTGA  IAGRHTPGTFTNQLQTS++EPRLL
Sbjct  61   RVIVAIENPQDIIVQSARPYGQRAVLKFAQYTGASPIAGRHTPGTFTNQLQTSFSEPRLL  120

Query  488  ILTDPRTDHQPIKEAALGNIPTIAFC  565
            ILTDPRTDHQPIKE+ALGNIPTIAFC
Sbjct  121  ILTDPRTDHQPIKESALGNIPTIAFC  146



>gb|ABA81872.1| ribosome-associated protein p40-like [Solanum tuberosum]
Length=278

 Score =   268 bits (685),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 124/131 (95%), Positives = 129/131 (98%), Gaps = 0/131 (0%)
 Frame = +2

Query  173  MLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIVAIQNPQDIVVQ  352
            MLAAEVHLGTKNCDFQMERYVFKRRNDGIYIIN GKTW+KL MAARVIV+I+NPQDI+VQ
Sbjct  1    MLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINAGKTWDKLHMAARVIVSIENPQDIIVQ  60

Query  353  SARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTDPRTDHQPIKEA  532
            SARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSY+EPRLLILTDPRTDHQPIKEA
Sbjct  61   SARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYSEPRLLILTDPRTDHQPIKEA  120

Query  533  ALGNIPTIAFC  565
            ALGNIPTIAFC
Sbjct  121  ALGNIPTIAFC  131



>ref|XP_010939863.1| PREDICTED: 40S ribosomal protein SA-like [Elaeis guineensis]
Length=289

 Score =   268 bits (685),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 123/132 (93%), Positives = 132/132 (100%), Gaps = 0/132 (0%)
 Frame = +2

Query  170  MMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIVAIQNPQDIVV  349
            MMLAA+VHLGTKNCDFQMERYVFKRR+DGI+IINLGKTWEKLQ+AARVIVAI+NPQDI+V
Sbjct  1    MMLAADVHLGTKNCDFQMERYVFKRRSDGIFIINLGKTWEKLQLAARVIVAIENPQDIIV  60

Query  350  QSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTDPRTDHQPIKE  529
            QSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTS++EPRLLILTDPRTDHQPIKE
Sbjct  61   QSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSFSEPRLLILTDPRTDHQPIKE  120

Query  530  AALGNIPTIAFC  565
            +ALGNIPTIAFC
Sbjct  121  SALGNIPTIAFC  132



>gb|KHN49065.1| 40S ribosomal protein SA [Glycine soja]
Length=289

 Score =   267 bits (683),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 123/132 (93%), Positives = 129/132 (98%), Gaps = 0/132 (0%)
 Frame = +2

Query  170  MMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIVAIQNPQDIVV  349
            MMLAA+VHLGTKNCDFQMERYVFKRR DGIYIINLGKTWEKLQ+AAR+IVAI+NPQDI+V
Sbjct  1    MMLAADVHLGTKNCDFQMERYVFKRRTDGIYIINLGKTWEKLQLAARIIVAIENPQDIIV  60

Query  350  QSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTDPRTDHQPIKE  529
            QSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQ+Q SYNEPRLLILTDPRTDHQPIKE
Sbjct  61   QSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQMQQSYNEPRLLILTDPRTDHQPIKE  120

Query  530  AALGNIPTIAFC  565
             ALGNIPTIAFC
Sbjct  121  GALGNIPTIAFC  132



>gb|KFK37891.1| hypothetical protein AALP_AA3G042600 [Arabis alpina]
Length=282

 Score =   267 bits (682),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 122/141 (87%), Positives = 136/141 (96%), Gaps = 0/141 (0%)
 Frame = +2

Query  143  LSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIVA  322
            LS KE DI+M+LAA+ HLGTKNC++QMERYVFKRRNDGIYIINLGKTW+KL +AARVIVA
Sbjct  9    LSQKEGDIKMLLAADGHLGTKNCNYQMERYVFKRRNDGIYIINLGKTWDKLMLAARVIVA  68

Query  323  IQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTDP  502
            I+NP+DI+VQSARPYGQRAVLKFAQYTGA+AIAGRHTPGTFTNQ+QTS++EPRLLILTDP
Sbjct  69   IENPKDIIVQSARPYGQRAVLKFAQYTGANAIAGRHTPGTFTNQMQTSFSEPRLLILTDP  128

Query  503  RTDHQPIKEAALGNIPTIAFC  565
            RTDHQPIKE ALGNIPTIAFC
Sbjct  129  RTDHQPIKEGALGNIPTIAFC  149



>ref|XP_006408150.1| hypothetical protein EUTSA_v10022011mg [Eutrema salsugineum]
 gb|ESQ49603.1| hypothetical protein EUTSA_v10022011mg [Eutrema salsugineum]
Length=261

 Score =   264 bits (674),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 121/141 (86%), Positives = 134/141 (95%), Gaps = 0/141 (0%)
 Frame = +2

Query  143  LSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIVA  322
            LS KE+DIQMML+A VHLGTKNCD+QMERYVFKRRNDGIYIINLGKTWEKL++AARVIVA
Sbjct  13   LSQKEADIQMMLSANVHLGTKNCDYQMERYVFKRRNDGIYIINLGKTWEKLELAARVIVA  72

Query  323  IQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTDP  502
            I+NP+DI+VQSARPYGQRAVLKFAQYTGA+AIAGRHTPGTFTNQ QT ++EPRLLI+TDP
Sbjct  73   IENPKDIIVQSARPYGQRAVLKFAQYTGANAIAGRHTPGTFTNQKQTCFSEPRLLIVTDP  132

Query  503  RTDHQPIKEAALGNIPTIAFC  565
            RTDHQPIKE+ LG IPTIA C
Sbjct  133  RTDHQPIKESGLGRIPTIALC  153



>ref|XP_009117134.1| PREDICTED: 40S ribosomal protein SA-like [Brassica rapa]
Length=275

 Score =   260 bits (664),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 121/141 (86%), Positives = 135/141 (96%), Gaps = 0/141 (0%)
 Frame = +2

Query  143  LSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIVA  322
            LS KESDI+MM+A+EVHLGTKNC++QMERYV+KRRNDGIYI++LGKT EKL MAARVIVA
Sbjct  7    LSQKESDIRMMIASEVHLGTKNCNYQMERYVYKRRNDGIYILDLGKTLEKLYMAARVIVA  66

Query  323  IQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTDP  502
            I+NPQ I+VQSARPYGQRAVLKFAQYTGA+AIAGRHTPGTFTNQ+QTS++EPRLLILTDP
Sbjct  67   IENPQHIIVQSARPYGQRAVLKFAQYTGANAIAGRHTPGTFTNQMQTSFSEPRLLILTDP  126

Query  503  RTDHQPIKEAALGNIPTIAFC  565
            RTDHQPIKE ALGNIP IAFC
Sbjct  127  RTDHQPIKEGALGNIPIIAFC  147



>ref|XP_001763188.1| predicted protein [Physcomitrella patens]
 gb|EDQ72065.1| predicted protein, partial [Physcomitrella patens]
Length=305

 Score =   259 bits (663),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 118/140 (84%), Positives = 133/140 (95%), Gaps = 0/140 (0%)
 Frame = +2

Query  146  STKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIVAI  325
            + KESD+QMMLAA+VHLGTKNCDFQMERYV+KRR+DGI+IIN+GKT+EKL++AARVI AI
Sbjct  1    TMKESDVQMMLAADVHLGTKNCDFQMERYVWKRRSDGIFIINVGKTYEKLELAARVIAAI  60

Query  326  QNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTDPR  505
            +NPQDI+VQSARPYGQRAVLKFAQYTG  AIAGRHTPGTFTNQLQ +++EPRLLILTDPR
Sbjct  61   ENPQDIIVQSARPYGQRAVLKFAQYTGCQAIAGRHTPGTFTNQLQNTFSEPRLLILTDPR  120

Query  506  TDHQPIKEAALGNIPTIAFC  565
            TDHQPI EAALGNIP IAFC
Sbjct  121  TDHQPIMEAALGNIPVIAFC  140



>ref|XP_001761349.1| predicted protein [Physcomitrella patens]
 gb|EDQ73738.1| predicted protein [Physcomitrella patens]
Length=292

 Score =   258 bits (659),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 118/138 (86%), Positives = 132/138 (96%), Gaps = 0/138 (0%)
 Frame = +2

Query  152  KESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIVAIQN  331
            KESD+QMMLAA+VHLGTKNCDFQMERYV+KRR+DGI+IIN+GKT+EKL++AARVI AI+N
Sbjct  2    KESDVQMMLAADVHLGTKNCDFQMERYVWKRRSDGIFIINVGKTYEKLELAARVIAAIEN  61

Query  332  PQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTDPRTD  511
            PQDI+VQSARPYGQRAVLKFAQYTG  AIAGRHTPGTFTNQLQ +++EPRLLILTDPRTD
Sbjct  62   PQDIIVQSARPYGQRAVLKFAQYTGCQAIAGRHTPGTFTNQLQNTFSEPRLLILTDPRTD  121

Query  512  HQPIKEAALGNIPTIAFC  565
            HQPI EAALGNIP IAFC
Sbjct  122  HQPIMEAALGNIPVIAFC  139



>ref|XP_001776650.1| predicted protein [Physcomitrella patens]
 ref|XP_001776687.1| predicted protein [Physcomitrella patens]
 gb|EDQ58486.1| predicted protein [Physcomitrella patens]
 gb|EDQ58523.1| predicted protein [Physcomitrella patens]
Length=292

 Score =   258 bits (659),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 118/138 (86%), Positives = 132/138 (96%), Gaps = 0/138 (0%)
 Frame = +2

Query  152  KESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIVAIQN  331
            KESD+QMMLAA+VHLGTKNCDFQMERYV+KRR+DGI+IIN+GKT+EKL++AARVI AI+N
Sbjct  2    KESDVQMMLAADVHLGTKNCDFQMERYVWKRRSDGIFIINVGKTYEKLELAARVIAAIEN  61

Query  332  PQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTDPRTD  511
            PQDI+VQSARPYGQRAVLKFAQYTG  AIAGRHTPGTFTNQLQ +++EPRLLILTDPRTD
Sbjct  62   PQDIIVQSARPYGQRAVLKFAQYTGCQAIAGRHTPGTFTNQLQNTFSEPRLLILTDPRTD  121

Query  512  HQPIKEAALGNIPTIAFC  565
            HQPI EAALGNIP IAFC
Sbjct  122  HQPIMEAALGNIPVIAFC  139



>ref|XP_001774174.1| predicted protein [Physcomitrella patens]
 gb|EDQ60950.1| predicted protein, partial [Physcomitrella patens]
Length=278

 Score =   256 bits (655),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 117/137 (85%), Positives = 131/137 (96%), Gaps = 0/137 (0%)
 Frame = +2

Query  155  ESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIVAIQNP  334
            ESD+QMMLAA+VHLGTKNCDFQMERYV+KRR+DGI+IIN+GKT+EKL++AARVI AI+NP
Sbjct  1    ESDVQMMLAADVHLGTKNCDFQMERYVWKRRSDGIFIINVGKTYEKLELAARVIAAIENP  60

Query  335  QDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTDPRTDH  514
            QDI+VQSARPYGQRAVLKFAQYTG  AIAGRHTPGTFTNQLQ +++EPRLLILTDPRTDH
Sbjct  61   QDIIVQSARPYGQRAVLKFAQYTGCQAIAGRHTPGTFTNQLQNTFSEPRLLILTDPRTDH  120

Query  515  QPIKEAALGNIPTIAFC  565
            QPI EAALGNIP IAFC
Sbjct  121  QPIMEAALGNIPVIAFC  137



>ref|XP_005645300.1| ribosomal protein S2 [Coccomyxa subellipsoidea C-169]
 gb|EIE20756.1| ribosomal protein S2 [Coccomyxa subellipsoidea C-169]
Length=295

 Score =   255 bits (651),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 115/143 (80%), Positives = 131/143 (92%), Gaps = 0/143 (0%)
 Frame = +2

Query  137  MALSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVI  316
            MALS +E DIQ+MLAA VHLGTK CDFQMERY+++RR DGIY+INLGKTW+KLQ+AARVI
Sbjct  1    MALSQREQDIQLMLAANVHLGTKQCDFQMERYIYRRRQDGIYVINLGKTWDKLQLAARVI  60

Query  317  VAIQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILT  496
            VAI+NPQD+VVQSARPY QRAVLKFAQYTGA A+AGR+TPGTFTNQ+Q  + EPRLLI+T
Sbjct  61   VAIENPQDVVVQSARPYAQRAVLKFAQYTGAKALAGRYTPGTFTNQIQKDFEEPRLLIVT  120

Query  497  DPRTDHQPIKEAALGNIPTIAFC  565
            DPRTDHQPIKE+A  NIPTIAFC
Sbjct  121  DPRTDHQPIKESAYMNIPTIAFC  143



>ref|XP_010485861.1| PREDICTED: 40S ribosomal protein Sa-2-like [Camelina sativa]
Length=274

 Score =   254 bits (649),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 120/141 (85%), Positives = 135/141 (96%), Gaps = 1/141 (1%)
 Frame = +2

Query  143  LSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIVA  322
            LS KE+DIQ+ML+A+VHLGTKNC++QM+RYVF RRNDGIYIINLGKT +KLQMAARVIVA
Sbjct  18   LSEKEADIQIMLSADVHLGTKNCNYQMDRYVFNRRNDGIYIINLGKTRDKLQMAARVIVA  77

Query  323  IQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTDP  502
            I+NP+DI+VQSARPYGQRAVLKFAQYTGA AIAGRHTPGTFTNQ+QTS++EPRLLILTDP
Sbjct  78   IENPKDIIVQSARPYGQRAVLKFAQYTGATAIAGRHTPGTFTNQMQTSFSEPRLLILTDP  137

Query  503  RTDHQPIKEAALGNIPTIAFC  565
            RTDHQ +KE ALGNIPTIAFC
Sbjct  138  RTDHQ-LKEGALGNIPTIAFC  157



>emb|CDY34776.1| BnaA09g41430D [Brassica napus]
Length=823

 Score =   265 bits (677),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 121/141 (86%), Positives = 135/141 (96%), Gaps = 0/141 (0%)
 Frame = +2

Query  143  LSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIVA  322
            LS KESDI+MM+A+EVHLGTKNC++QMERYV+KRRNDGIYI++LGKT EKL MAARVIVA
Sbjct  551  LSQKESDIRMMIASEVHLGTKNCNYQMERYVYKRRNDGIYILDLGKTLEKLYMAARVIVA  610

Query  323  IQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTDP  502
            I+NPQ I+VQSARPYGQRAVLKFAQYTGA+AIAGRHTPGTFTNQ+QTS++EPRLLILTDP
Sbjct  611  IENPQHIIVQSARPYGQRAVLKFAQYTGANAIAGRHTPGTFTNQMQTSFSEPRLLILTDP  670

Query  503  RTDHQPIKEAALGNIPTIAFC  565
            RTDHQPIKE ALGNIP IAFC
Sbjct  671  RTDHQPIKEGALGNIPIIAFC  691



>ref|XP_002499912.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO61170.1| predicted protein [Micromonas sp. RCC299]
Length=296

 Score =   248 bits (634),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 111/141 (79%), Positives = 128/141 (91%), Gaps = 0/141 (0%)
 Frame = +2

Query  143  LSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIVA  322
            LS KE+DIQMMLAA  HLGTKNCDFQMERYV+KRR DGIYIINLGKTW+KL +AAR++VA
Sbjct  5    LSQKEADIQMMLAAGCHLGTKNCDFQMERYVWKRRQDGIYIINLGKTWDKLMLAARILVA  64

Query  323  IQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTDP  502
            I+NP D+VVQS+RPYGQRAVLK+AQYTGA AIAGRHTPGT+TNQ+Q  ++EPR+L+LTDP
Sbjct  65   IENPSDVVVQSSRPYGQRAVLKYAQYTGAKAIAGRHTPGTYTNQIQEGFHEPRVLVLTDP  124

Query  503  RTDHQPIKEAALGNIPTIAFC  565
            RTDHQPI E A  N+PTIAFC
Sbjct  125  RTDHQPISETAYVNLPTIAFC  145



>gb|EMS60591.1| 40S ribosomal protein SA [Triticum urartu]
Length=252

 Score =   246 bits (629),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 114/126 (90%), Positives = 123/126 (98%), Gaps = 0/126 (0%)
 Frame = +2

Query  140  ALSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIV  319
            ALS +E DIQMMLAA+VHLGTKNCDFQMERYV+KRR DGIYIINLGKTWEKLQMAARVIV
Sbjct  10   ALSQREQDIQMMLAADVHLGTKNCDFQMERYVYKRRTDGIYIINLGKTWEKLQMAARVIV  69

Query  320  AIQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTD  499
            AI+NPQDI+VQSARPYGQRAVLKFAQYTGA+AIAGRHTPGTFTNQ+QTS++EPRLLILTD
Sbjct  70   AIENPQDIIVQSARPYGQRAVLKFAQYTGANAIAGRHTPGTFTNQMQTSFSEPRLLILTD  129

Query  500  PRTDHQ  517
            PRTDHQ
Sbjct  130  PRTDHQ  135



>ref|XP_003055242.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH60494.1| predicted protein [Micromonas pusilla CCMP1545]
Length=266

 Score =   243 bits (621),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 110/141 (78%), Positives = 127/141 (90%), Gaps = 0/141 (0%)
 Frame = +2

Query  143  LSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIVA  322
            LS KE+DIQMMLAA  HLGTKNCDFQMERYV+KRR+DGIYIINLGKTW+KL +AAR++VA
Sbjct  4    LSQKEADIQMMLAAGCHLGTKNCDFQMERYVWKRRSDGIYIINLGKTWDKLMLAARILVA  63

Query  323  IQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTDP  502
            I+NP D+V QSARPYGQRAVLK+AQYTGA AIAGRHTPGT+TNQ+Q  ++EPR+L+LTDP
Sbjct  64   IENPADVVCQSARPYGQRAVLKYAQYTGAKAIAGRHTPGTYTNQIQEGFHEPRVLVLTDP  123

Query  503  RTDHQPIKEAALGNIPTIAFC  565
            RTD QPI E A  N+PTIAFC
Sbjct  124  RTDQQPISETAYVNLPTIAFC  144



>ref|XP_002947037.1| component of cytosolic 80S ribosome and 40S small subunit [Volvox 
carteri f. nagariensis]
 gb|EFJ51627.1| component of cytosolic 80S ribosome and 40S small subunit [Volvox 
carteri f. nagariensis]
Length=280

 Score =   244 bits (622),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 112/143 (78%), Positives = 127/143 (89%), Gaps = 0/143 (0%)
 Frame = +2

Query  137  MALSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVI  316
            MALS KE DIQMMLAA+ HLGTKNC +QMERY+++RR DGIYIINL KT+EKLQMAARVI
Sbjct  1    MALSQKEQDIQMMLAAQCHLGTKNCHYQMERYMYRRRQDGIYIINLEKTYEKLQMAARVI  60

Query  317  VAIQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILT  496
            VAI+NPQDI V SARPYGQRAV KFAQY G  ++AGRHTPGTFTNQ+Q ++ EPRLLILT
Sbjct  61   VAIENPQDICVLSARPYGQRAVFKFAQYLGCKSMAGRHTPGTFTNQIQKAFEEPRLLILT  120

Query  497  DPRTDHQPIKEAALGNIPTIAFC  565
            DPRTDHQP+KE++  NIPTIAFC
Sbjct  121  DPRTDHQPVKESSYMNIPTIAFC  143



>ref|XP_001702485.1| ribosomal protein Sa, component of cytosolic 80S ribosome and 
40S small subunit [Chlamydomonas reinhardtii]
 sp|A8IB25.1|RSSA_CHLRE RecName: Full=40S ribosomal protein SA [Chlamydomonas reinhardtii]
 gb|EDP06264.1| ribosomal protein Sa [Chlamydomonas reinhardtii]
Length=279

 Score =   243 bits (620),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 111/143 (78%), Positives = 127/143 (89%), Gaps = 0/143 (0%)
 Frame = +2

Query  137  MALSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVI  316
            MALS KE DIQMMLAA+ HLGTKNC +QMERY+++RR DGIYIINL KT+EKLQMAAR+I
Sbjct  1    MALSQKEQDIQMMLAAQCHLGTKNCHYQMERYMYRRRQDGIYIINLEKTYEKLQMAARII  60

Query  317  VAIQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILT  496
            VAI+NPQDI V SARPYGQRAV KFAQY G  ++AGRHTPGTFTNQ+Q ++ EPRLLILT
Sbjct  61   VAIENPQDICVLSARPYGQRAVFKFAQYLGCKSMAGRHTPGTFTNQIQKAFEEPRLLILT  120

Query  497  DPRTDHQPIKEAALGNIPTIAFC  565
            DPRTDHQP+KE++  NIPTIAFC
Sbjct  121  DPRTDHQPVKESSYMNIPTIAFC  143



>ref|XP_009105896.1| PREDICTED: LOW QUALITY PROTEIN: 40S ribosomal protein SA [Brassica 
rapa]
Length=282

 Score =   243 bits (620),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 115/141 (82%), Positives = 124/141 (88%), Gaps = 10/141 (7%)
 Frame = +2

Query  143  LSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIVA  322
            LS KE+DI+MM AAEVHLGTKNC++QMERYVFKRRNDGIYI NLGKTWEKL MAARVIVA
Sbjct  9    LSQKEADIKMMCAAEVHLGTKNCNYQMERYVFKRRNDGIYIFNLGKTWEKLMMAARVIVA  68

Query  323  IQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTDP  502
            I+NPQDI+VQSARPYGQRA           AIAGRHTPGTFTNQ+QTS++EPRLLILTDP
Sbjct  69   IENPQDIIVQSARPYGQRAX----------AIAGRHTPGTFTNQMQTSFSEPRLLILTDP  118

Query  503  RTDHQPIKEAALGNIPTIAFC  565
            RTDHQPIKE ALGNIP IAFC
Sbjct  119  RTDHQPIKEGALGNIPIIAFC  139



>gb|KIZ04526.1| small subunit ribosomal protein SAe [Monoraphidium neglectum]
Length=282

 Score =   241 bits (615),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 110/143 (77%), Positives = 127/143 (89%), Gaps = 0/143 (0%)
 Frame = +2

Query  137  MALSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVI  316
            MALS KE+DIQ++LAA  HLGTKNC FQMERYV++RRNDGIY+INL KT+EKLQ+AARVI
Sbjct  1    MALSQKEADIQLLLAAGCHLGTKNCSFQMERYVYRRRNDGIYVINLEKTYEKLQLAARVI  60

Query  317  VAIQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILT  496
            VAI+NPQD+VV SARPYGQRAV KFAQY  A  +AGRHTPGTFTNQ+Q  + EPRLLI+T
Sbjct  61   VAIENPQDVVVLSARPYGQRAVFKFAQYLQAKCMAGRHTPGTFTNQIQKQFEEPRLLIVT  120

Query  497  DPRTDHQPIKEAALGNIPTIAFC  565
            DPRTDHQP+KE++  NIPTIAFC
Sbjct  121  DPRTDHQPVKESSYMNIPTIAFC  143



>ref|XP_001776686.1| predicted protein [Physcomitrella patens]
 gb|EDQ58522.1| predicted protein [Physcomitrella patens]
Length=126

 Score =   229 bits (584),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 104/122 (85%), Positives = 118/122 (97%), Gaps = 0/122 (0%)
 Frame = +2

Query  152  KESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIVAIQN  331
            KESD+QMMLAA+VHLGTKNCDFQMERYV+KRR+DGI+IIN+GKT+EKL++AARVI AI+N
Sbjct  2    KESDVQMMLAADVHLGTKNCDFQMERYVWKRRSDGIFIINVGKTYEKLELAARVIAAIEN  61

Query  332  PQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTDPRTD  511
            PQDI+VQSARPYGQRAVLKFAQYTG  AIAGRHTPGTFTNQLQ +++EPRLLILTDPRTD
Sbjct  62   PQDIIVQSARPYGQRAVLKFAQYTGCQAIAGRHTPGTFTNQLQNTFSEPRLLILTDPRTD  121

Query  512  HQ  517
            HQ
Sbjct  122  HQ  123



>emb|CBI35816.3| unnamed protein product [Vitis vinifera]
Length=279

 Score =   234 bits (597),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 109/115 (95%), Positives = 115/115 (100%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MERYVFKRRNDGIYIINLGKTWEKLQMAARVIVAIQNPQDIVVQSARPYGQRAVLKFAQY  400
            MERYVFKRRNDGIYIINLGKTWEKLQ+AARVIVAI+NP+DI+VQSARPYGQRAVLKFAQY
Sbjct  1    MERYVFKRRNDGIYIINLGKTWEKLQLAARVIVAIENPKDIIVQSARPYGQRAVLKFAQY  60

Query  401  TGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTDPRTDHQPIKEAALGNIPTIAFC  565
            TGAHAIAGRHTPGTFTNQLQTS++EPRLLILTDPRTDHQPIKEAALGNIPTIAFC
Sbjct  61   TGAHAIAGRHTPGTFTNQLQTSFSEPRLLILTDPRTDHQPIKEAALGNIPTIAFC  115



>ref|XP_003078238.1| B1056G08.113 gene product (ISS) [Ostreococcus tauri]
Length=313

 Score =   233 bits (594),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 107/149 (72%), Positives = 125/149 (84%), Gaps = 0/149 (0%)
 Frame = +2

Query  119  TMALSTMALSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQ  298
            T+A     +S KE+DI MMLAA  HLGTKN DFQMERYV+KRR DGI+IINLGKTW+KL 
Sbjct  23   TIAQMAPQMSQKEADIAMMLAAGCHLGTKNVDFQMERYVWKRRADGIHIINLGKTWDKLM  82

Query  299  MAARVIVAIQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEP  478
            +AARVIVA++NPQD++ Q+ARPYGQRAVLKFAQYTGA A+AGRHTPGT+TNQ    + EP
Sbjct  83   LAARVIVAVENPQDVIAQAARPYGQRAVLKFAQYTGAKALAGRHTPGTYTNQKDAVFAEP  142

Query  479  RLLILTDPRTDHQPIKEAALGNIPTIAFC  565
            R+L++TDPRTD QPI E A  NIPTIAFC
Sbjct  143  RVLVVTDPRTDAQPISETAFVNIPTIAFC  171



>sp|Q01CH5.2|RSSA_OSTTA RecName: Full=40S ribosomal protein SA [Ostreococcus tauri]
 emb|CEF97172.1| Ribosomal protein S2, eukaryotic/archaeal [Ostreococcus tauri]
Length=287

 Score =   231 bits (590),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 105/141 (74%), Positives = 122/141 (87%), Gaps = 0/141 (0%)
 Frame = +2

Query  143  LSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIVA  322
            +S KE+DI MMLAA  HLGTKN DFQMERYV+KRR DGI+IINLGKTW+KL +AARVIVA
Sbjct  5    MSQKEADIAMMLAAGCHLGTKNVDFQMERYVWKRRADGIHIINLGKTWDKLMLAARVIVA  64

Query  323  IQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTDP  502
            ++NPQD++ Q+ARPYGQRAVLKFAQYTGA A+AGRHTPGT+TNQ    + EPR+L++TDP
Sbjct  65   VENPQDVIAQAARPYGQRAVLKFAQYTGAKALAGRHTPGTYTNQKDAVFAEPRVLVVTDP  124

Query  503  RTDHQPIKEAALGNIPTIAFC  565
            RTD QPI E A  NIPTIAFC
Sbjct  125  RTDAQPISETAFVNIPTIAFC  145



>emb|CBX25070.1| 40S ribosomal protein SA [Polytomella sp. Pringsheim 198.80]
Length=269

 Score =   231 bits (588),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 107/143 (75%), Positives = 125/143 (87%), Gaps = 0/143 (0%)
 Frame = +2

Query  137  MALSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVI  316
            M+L+ KE DIQM+LAA+ HLGTKNC +QMERYV++RR DGI IINL KT+EKLQMAARVI
Sbjct  1    MSLTQKEQDIQMLLAAQCHLGTKNCHYQMERYVYRRRQDGINIINLEKTYEKLQMAARVI  60

Query  317  VAIQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILT  496
            VAI+NPQDI V SARPYGQRAV KFAQ  G  ++AGR+TPGTFTNQ+Q ++ EPRL+ILT
Sbjct  61   VAIENPQDICVLSARPYGQRAVFKFAQALGCKSMAGRYTPGTFTNQIQKAFEEPRLVILT  120

Query  497  DPRTDHQPIKEAALGNIPTIAFC  565
            DPRTDHQPIKE++  NIPTIAFC
Sbjct  121  DPRTDHQPIKESSYVNIPTIAFC  143



>ref|XP_006649508.1| PREDICTED: 40S ribosomal protein SA-like [Oryza brachyantha]
Length=301

 Score =   231 bits (589),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 112/141 (79%), Positives = 122/141 (87%), Gaps = 11/141 (8%)
 Frame = +2

Query  143  LSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIVA  322
            LS +E DIQMMLAA+VHL    C+F            GIYIINLGKTWEKLQ+AARVIVA
Sbjct  16   LSQREQDIQMMLAADVHLXXXXCNFI-----------GIYIINLGKTWEKLQLAARVIVA  64

Query  323  IQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTDP  502
            I+NPQDI+VQSARPYGQRAVLKFA +TGAHAIAGRHTPGTFTNQLQTS++EPRLLILTDP
Sbjct  65   IENPQDIIVQSARPYGQRAVLKFAHHTGAHAIAGRHTPGTFTNQLQTSFSEPRLLILTDP  124

Query  503  RTDHQPIKEAALGNIPTIAFC  565
            RTDHQPIKE+ALGNIPTIAFC
Sbjct  125  RTDHQPIKESALGNIPTIAFC  145



>ref|XP_007511079.1| predicted protein [Bathycoccus prasinos]
 emb|CCO66639.1| predicted protein [Bathycoccus prasinos]
Length=285

 Score =   230 bits (586),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 103/141 (73%), Positives = 121/141 (86%), Gaps = 0/141 (0%)
 Frame = +2

Query  143  LSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIVA  322
            +S KE DIQMMLAA  HLGTKN +FQMERYV+KRRNDGI++INLGKTW+KL MAAR+IVA
Sbjct  4    MSQKEQDIQMMLAAGCHLGTKNVNFQMERYVYKRRNDGIHVINLGKTWDKLMMAARIIVA  63

Query  323  IQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTDP  502
             +NP D++ QSARPYGQRAVLKFAQYTGA AIAGRH PGT+TNQ+ + + EPR++I+TDP
Sbjct  64   TENPADVICQSARPYGQRAVLKFAQYTGAKAIAGRHMPGTYTNQIDSEFREPRVVIMTDP  123

Query  503  RTDHQPIKEAALGNIPTIAFC  565
            RTD QPI E A  N+P IAFC
Sbjct  124  RTDSQPISETAYVNLPVIAFC  144



>ref|XP_006657956.1| PREDICTED: 40S ribosomal protein SA-like [Oryza brachyantha]
Length=271

 Score =   228 bits (582),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 106/115 (92%), Positives = 113/115 (98%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MERYVFKRRNDGIYIINLGKTWEKLQMAARVIVAIQNPQDIVVQSARPYGQRAVLKFAQY  400
            MERYV+KRR DGIYIINLGKTWEKLQ+AARVIVAI+NP DI+VQSARPYGQRAVLKFAQY
Sbjct  1    MERYVYKRRTDGIYIINLGKTWEKLQLAARVIVAIENPHDIIVQSARPYGQRAVLKFAQY  60

Query  401  TGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTDPRTDHQPIKEAALGNIPTIAFC  565
            TGAHAIAGRHTPGTFTNQLQTS++EPRLLILTDPRTDHQPIKE+ALGNIPTIAFC
Sbjct  61   TGAHAIAGRHTPGTFTNQLQTSFSEPRLLILTDPRTDHQPIKESALGNIPTIAFC  115



>ref|XP_005847675.1| hypothetical protein CHLNCDRAFT_134066 [Chlorella variabilis]
 gb|EFN55573.1| hypothetical protein CHLNCDRAFT_134066 [Chlorella variabilis]
Length=288

 Score =   228 bits (581),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 102/141 (72%), Positives = 120/141 (85%), Gaps = 0/141 (0%)
 Frame = +2

Query  143  LSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIVA  322
            L+ +E+D+QM+LA++ HLGTKNC   MERYV++RRNDGI++ NL KTWEKLQ+AAR+IVA
Sbjct  4    LNQRENDVQMLLASQAHLGTKNCTAAMERYVYRRRNDGIFVFNLAKTWEKLQLAARIIVA  63

Query  323  IQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTDP  502
            I+NPQDIV  SARPYGQRAVLKFA Y+GA A  GRHTPG FTNQ+Q  + EPRLLI+TDP
Sbjct  64   IENPQDIVAISARPYGQRAVLKFAHYSGAKATVGRHTPGAFTNQIQKGFEEPRLLIVTDP  123

Query  503  RTDHQPIKEAALGNIPTIAFC  565
            RTDHQ IKEAA  NIP IAFC
Sbjct  124  RTDHQSIKEAAYMNIPVIAFC  144



>ref|XP_001416686.1| Ribosomal protein Sa, component of cytosolic 80S ribosome and 
40S small subunit [Ostreococcus lucimarinus CCE9901]
 sp|A4RUK2.1|RSSA_OSTLU RecName: Full=40S ribosomal protein SA [Ostreococcus lucimarinus 
CCE9901]
 gb|ABO94979.1| Ribosomal protein Sa, component of cytosolic 80S ribosome and 
40S small subunit [Ostreococcus lucimarinus CCE9901]
Length=290

 Score =   227 bits (579),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 104/141 (74%), Positives = 121/141 (86%), Gaps = 0/141 (0%)
 Frame = +2

Query  143  LSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIVA  322
            +S KE+DI MMLAA  HLGTKN DFQMERYV+KRR DGI+IINLG+TW+KL +AAR+IVA
Sbjct  5    MSQKEADIAMMLAAGCHLGTKNVDFQMERYVWKRRADGIHIINLGRTWDKLMLAARIIVA  64

Query  323  IQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTDP  502
             +NPQD++ Q+ARPYGQRAVLKFAQYTGA AIAGRHTPGT+TNQ    + EPR+LI+TDP
Sbjct  65   CENPQDVICQAARPYGQRAVLKFAQYTGAKAIAGRHTPGTYTNQKDAIFAEPRVLIVTDP  124

Query  503  RTDHQPIKEAALGNIPTIAFC  565
            RTD QPI E A  N+PTIAFC
Sbjct  125  RTDAQPISETAYVNLPTIAFC  145



>emb|CBN08645.1| small nucleolar RNA, H/ACA box 62 [Microcosmus squamiger]
Length=277

 Score =   217 bits (553),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 98/141 (70%), Positives = 117/141 (83%), Gaps = 0/141 (0%)
 Frame = +2

Query  143  LSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIVA  322
            LS KE D+  MLAA  H+G+ NCDFQME+Y++K R+DG+YIINL KTWEKLQ+AAR IVA
Sbjct  8    LSLKEEDVSKMLAATTHIGSTNCDFQMEQYIYKTRSDGVYIINLKKTWEKLQLAARAIVA  67

Query  323  IQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTDP  502
            I+NP DI V S++ YGQRAVLKFA  TGA AIAGR+TPG FTNQ+Q ++ EPRLLI+TDP
Sbjct  68   IENPADICVISSKQYGQRAVLKFASATGATAIAGRYTPGAFTNQIQAAFREPRLLIVTDP  127

Query  503  RTDHQPIKEAALGNIPTIAFC  565
            RTDHQPI+E+A  NIP IA C
Sbjct  128  RTDHQPIRESAYVNIPVIALC  148



>ref|XP_008868945.1| ribosomal protein S2 [Aphanomyces invadans]
 gb|ETW02340.1| ribosomal protein S2 [Aphanomyces invadans]
Length=277

 Score =   216 bits (549),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 95/143 (66%), Positives = 119/143 (83%), Gaps = 0/143 (0%)
 Frame = +2

Query  137  MALSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVI  316
            M L+ +E DIQ MLAA VH+GT+N D QM  Y+++RRNDG++IIN+G+TWEKL +AA+VI
Sbjct  1    MVLTQREEDIQKMLAAMVHIGTRNADSQMADYIWRRRNDGVHIINVGQTWEKLMLAAKVI  60

Query  317  VAIQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILT  496
            VA++NP D++  SARPYGQRAVLKFAQYTGA AIAGR TPGTFTNQ+   + EPRLLI+T
Sbjct  61   VAVENPADVIAISARPYGQRAVLKFAQYTGAQAIAGRFTPGTFTNQITKQFREPRLLIIT  120

Query  497  DPRTDHQPIKEAALGNIPTIAFC  565
            DPRTD QP++E+A  N+P IAF 
Sbjct  121  DPRTDSQPVRESAYVNVPVIAFV  143



>gb|AGH70213.1| 40S ribosomal protein SA, partial [Placozoa sp. H4]
Length=216

 Score =   214 bits (544),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 98/141 (70%), Positives = 114/141 (81%), Gaps = 0/141 (0%)
 Frame = +2

Query  143  LSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIVA  322
            L     D+  MLAA  HLGT N DFQME+YVF+RRNDG++II+L KTWEKL MAAR+I A
Sbjct  8    LRLNADDVSKMLAASAHLGTTNVDFQMEQYVFRRRNDGVHIIDLRKTWEKLLMAARIIAA  67

Query  323  IQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTDP  502
            I+NP D+ V SARPYGQRAVLKFA++TGA  IAGR TPGTFTNQ+Q ++ EPRLLI+TDP
Sbjct  68   IENPADVCVLSARPYGQRAVLKFAKFTGASPIAGRFTPGTFTNQIQKAFREPRLLIVTDP  127

Query  503  RTDHQPIKEAALGNIPTIAFC  565
            R DHQPI EA+  NIP IAFC
Sbjct  128  RVDHQPITEASYVNIPVIAFC  148



>emb|CDY55242.1| BnaC02g44920D [Brassica napus]
Length=247

 Score =   215 bits (547),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 101/115 (88%), Positives = 110/115 (96%), Gaps = 0/115 (0%)
 Frame = +2

Query  221  MERYVFKRRNDGIYIINLGKTWEKLQMAARVIVAIQNPQDIVVQSARPYGQRAVLKFAQY  400
            MERYV+KRRNDGI I++LGKT EKL MAARVIVAI+NPQDI+VQSARPYGQRAVLKFAQY
Sbjct  1    MERYVYKRRNDGINILDLGKTLEKLYMAARVIVAIENPQDIIVQSARPYGQRAVLKFAQY  60

Query  401  TGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTDPRTDHQPIKEAALGNIPTIAFC  565
            TGA+AIAGRHTPGTFTNQ+QTS++EPRLLILTDPRTDHQPIKE ALGNIP IAFC
Sbjct  61   TGANAIAGRHTPGTFTNQMQTSFSEPRLLILTDPRTDHQPIKEGALGNIPIIAFC  115



>ref|XP_002181180.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC47103.1| predicted protein, partial [Phaeodactylum tricornutum CCAP 1055/1]
Length=220

 Score =   214 bits (544),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 95/141 (67%), Positives = 116/141 (82%), Gaps = 0/141 (0%)
 Frame = +2

Query  143  LSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIVA  322
            L  KE DIQMML+A VH GT+N D  M+ Y+++RRNDG++I+N+GKTWEKL +AARVIVA
Sbjct  11   LQPKEEDIQMMLSAGVHTGTRNSDSNMQEYIWRRRNDGVHILNIGKTWEKLVLAARVIVA  70

Query  323  IQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTDP  502
            I+NP+D++  SARPYG RAVLKFA YTGA A+AGR TPGTFTNQ+   + EPRLLI+TDP
Sbjct  71   IENPEDVIAISARPYGMRAVLKFANYTGAQAVAGRWTPGTFTNQITKQFKEPRLLIITDP  130

Query  503  RTDHQPIKEAALGNIPTIAFC  565
            RTD Q +KEA+  NIP IAFC
Sbjct  131  RTDSQAVKEASYVNIPVIAFC  151



>ref|XP_009037182.1| hypothetical protein AURANDRAFT_4875, partial [Aureococcus anophagefferens]
 gb|EGB07823.1| hypothetical protein AURANDRAFT_4875 [Aureococcus anophagefferens]
Length=219

 Score =   211 bits (538),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 94/141 (67%), Positives = 117/141 (83%), Gaps = 0/141 (0%)
 Frame = +2

Query  143  LSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIVA  322
            L+ KE DIQ ML+A+ H+GT+N D  ME Y+++RR DGI+IIN+GKTWEKL +AARV+ A
Sbjct  2    LAPKEEDIQKMLSAQCHIGTRNSDHMMEEYIWRRRQDGIHIINVGKTWEKLMLAARVLTA  61

Query  323  IQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTDP  502
            I+NPQDI+  SARPYGQRAVLKFAQYTGA +IAGR TPGTFTNQ+   + EPR+L++TDP
Sbjct  62   IENPQDIIAISARPYGQRAVLKFAQYTGAASIAGRFTPGTFTNQITKQFKEPRILVITDP  121

Query  503  RTDHQPIKEAALGNIPTIAFC  565
            RTD Q +KEA+  N+P IAFC
Sbjct  122  RTDSQAVKEASYVNLPVIAFC  142



>ref|XP_005767823.1| hypothetical protein EMIHUDRAFT_356503 [Emiliania huxleyi CCMP1516]
 gb|EOD15394.1| hypothetical protein EMIHUDRAFT_356503 [Emiliania huxleyi CCMP1516]
Length=283

 Score =   213 bits (543),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 97/148 (66%), Positives = 121/148 (82%), Gaps = 0/148 (0%)
 Frame = +2

Query  122  MALSTMALSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQM  301
            M+++ ++   K+ D QMMLA   HLGTKN D+QM RYV+KR+ DGI+IINLG+T++KLQ+
Sbjct  1    MSMNYISEEQKKKDFQMMLACSTHLGTKNLDYQMTRYVWKRKPDGIHIINLGRTYDKLQL  60

Query  302  AARVIVAIQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPR  481
            AAR+IVAI+NP D+ V SARPYGQR++LK+ QYTGA  IAGR TPGTFTNQ+   + EPR
Sbjct  61   AARIIVAIENPADVCVISARPYGQRSILKYCQYTGATPIAGRFTPGTFTNQITNKFMEPR  120

Query  482  LLILTDPRTDHQPIKEAALGNIPTIAFC  565
            LL+LTDPRTDHQ I E+A  NIPTIAFC
Sbjct  121  LLLLTDPRTDHQAIAESAYANIPTIAFC  148



>ref|XP_008619402.1| 30S ribosomal protein SAe [Saprolegnia diclina VS20]
 gb|EQC27215.1| 30S ribosomal protein SAe [Saprolegnia diclina VS20]
 gb|KDO20919.1| hypothetical protein SPRG_14150 [Saprolegnia parasitica CBS 223.65]
Length=279

 Score =   213 bits (543),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 94/141 (67%), Positives = 117/141 (83%), Gaps = 0/141 (0%)
 Frame = +2

Query  143  LSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIVA  322
            L+ +E DI  MLAA VH+GT+N D QM  Y+++RRNDGI+IIN+GKTWEKL +AA++IVA
Sbjct  2    LTQREEDISKMLAAMVHIGTRNADAQMGDYIWRRRNDGIHIINVGKTWEKLMLAAKIIVA  61

Query  323  IQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTDP  502
            ++NP D++  SARPYGQRAVLKFAQYTG  AIAGR TPGTFTNQ+   + EPRLLI+TDP
Sbjct  62   VENPADVIAISARPYGQRAVLKFAQYTGCQAIAGRFTPGTFTNQITKQFREPRLLIITDP  121

Query  503  RTDHQPIKEAALGNIPTIAFC  565
            RTD QP++E+A  N+P IAFC
Sbjct  122  RTDAQPVRESAYVNVPVIAFC  142



>ref|XP_011399769.1| 40S ribosomal protein Sa-2 [Auxenochlorella protothecoides]
 gb|KFM26821.1| 40S ribosomal protein Sa-2 [Auxenochlorella protothecoides]
Length=282

 Score =   213 bits (543),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 98/138 (71%), Positives = 114/138 (83%), Gaps = 0/138 (0%)
 Frame = +2

Query  152  KESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIVAIQN  331
            + +D+ ++LAA+ HLGTKNC   MERYV KRR+DGI++ NLG+T+EKLQ+AARVIVAI+N
Sbjct  5    RGNDVALLLAAQSHLGTKNCTAHMERYVHKRRSDGIFVFNLGRTYEKLQLAARVIVAIEN  64

Query  332  PQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTDPRTD  511
            PQD+V  SARPYGQR VLKFA YTGA A  GRHTPG FTNQLQ  + EPRLLI+TDPRTD
Sbjct  65   PQDVVAISARPYGQRGVLKFATYTGARATVGRHTPGAFTNQLQKGFEEPRLLIVTDPRTD  124

Query  512  HQPIKEAALGNIPTIAFC  565
            HQ IKEAA  NIP IAF 
Sbjct  125  HQAIKEAAYMNIPVIAFT  142



>ref|XP_009827016.1| ribosomal protein S2 [Aphanomyces astaci]
 gb|ETV83586.1| ribosomal protein S2 [Aphanomyces astaci]
Length=277

 Score =   213 bits (542),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 95/143 (66%), Positives = 118/143 (83%), Gaps = 0/143 (0%)
 Frame = +2

Query  137  MALSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVI  316
            M L+ +E DIQ MLAA VH+GT+N D QM  Y+++RRNDGI+IIN+G+TWEKL +AA+VI
Sbjct  1    MVLTQREEDIQKMLAAMVHIGTRNADSQMGDYIWRRRNDGIHIINVGQTWEKLMLAAKVI  60

Query  317  VAIQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILT  496
            VA++NP D++  SARPYGQRAVLKFAQYTGA AIAGR TPGTFTNQ+   + EPRLLI+T
Sbjct  61   VAVENPADVIAISARPYGQRAVLKFAQYTGAQAIAGRFTPGTFTNQITKQFREPRLLIIT  120

Query  497  DPRTDHQPIKEAALGNIPTIAFC  565
            D RTD QP++E+A  N+P IAF 
Sbjct  121  DTRTDSQPVRESAYVNVPVIAFV  143



>ref|XP_006825592.1| PREDICTED: 40S ribosomal protein SA-like [Saccoglossus kowalevskii]
Length=323

 Score =   214 bits (544),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 95/142 (67%), Positives = 117/142 (82%), Gaps = 0/142 (0%)
 Frame = +2

Query  140  ALSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIV  319
            AL+ KE D+   LAA  HLG+ N DFQME+YV+KR+NDG+YI+N+ KTWEK+ +AAR IV
Sbjct  7    ALALKEEDVTKFLAAGSHLGSTNVDFQMEQYVYKRKNDGMYIMNIRKTWEKILIAARAIV  66

Query  320  AIQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTD  499
            AI+NP D+ V SARPYGQRA+LKFA +TGA  +AGR TPGTFTNQ+Q +Y EPR+L++TD
Sbjct  67   AIENPSDVCVISARPYGQRAILKFATHTGASPVAGRFTPGTFTNQIQAAYREPRILVVTD  126

Query  500  PRTDHQPIKEAALGNIPTIAFC  565
            PRTDHQPI EA+  NIP IAFC
Sbjct  127  PRTDHQPITEASYVNIPVIAFC  148



>gb|KDD76664.1| ribosomal protein S2, partial [Helicosporidium sp. ATCC 50920]
Length=212

 Score =   210 bits (534),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 96/138 (70%), Positives = 113/138 (82%), Gaps = 0/138 (0%)
 Frame = +2

Query  152  KESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIVAIQN  331
            +E+DI ++LAA+  LGTKNC  +MERYV  RR DGIY+INLGKT+EKLQ+AARVIVAI+N
Sbjct  5    RENDIALLLAAQSQLGTKNCTSKMERYVHARRPDGIYVINLGKTYEKLQLAARVIVAIEN  64

Query  332  PQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTDPRTD  511
            PQD+V  SARPYGQR VLKFA Y GA +  GRHTPG FTNQ+Q  + EPRLLI+TDPRTD
Sbjct  65   PQDVVAISARPYGQRGVLKFANYIGARSTVGRHTPGAFTNQMQKGFEEPRLLIVTDPRTD  124

Query  512  HQPIKEAALGNIPTIAFC  565
             Q I+EA+  NIP IAFC
Sbjct  125  AQAIREASYMNIPVIAFC  142



>gb|EJU04455.1| ribosomal protein S2 [Dacryopinax sp. DJM-731 SS1]
Length=295

 Score =   211 bits (537),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 97/141 (69%), Positives = 114/141 (81%), Gaps = 0/141 (0%)
 Frame = +2

Query  143  LSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIVA  322
            LS  + DIQMMLAA VH+G KNCD QME YV+KRR DG++IIN+GKTWEKL +AARV+  
Sbjct  8    LSATDEDIQMMLAAAVHIGAKNCDKQMESYVWKRRVDGVHIINIGKTWEKLVLAARVLAT  67

Query  323  IQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTDP  502
            I+NP DI V S+RPYGQRAVLKFA  TGA AIAGR TPG FTN +  S+ EPR++I+TDP
Sbjct  68   IENPNDICVISSRPYGQRAVLKFAASTGAQAIAGRFTPGNFTNYITRSFKEPRIIIVTDP  127

Query  503  RTDHQPIKEAALGNIPTIAFC  565
            RTDHQ I+EA+  NIP IAFC
Sbjct  128  RTDHQAIREASYVNIPVIAFC  148



>ref|XP_008915584.1| ribosomal protein S2 [Phytophthora parasitica INRA-310]
 gb|ETK70972.1| ribosomal protein S2 [Phytophthora parasitica]
 gb|ETL24418.1| ribosomal protein S2 [Phytophthora parasitica]
 gb|ETL77638.1| ribosomal protein S2 [Phytophthora parasitica]
 gb|ETM30893.1| ribosomal protein S2 [Phytophthora parasitica]
 gb|ETM99104.1| ribosomal protein S2 [Phytophthora parasitica INRA-310]
 gb|ETO59328.1| ribosomal protein S2 [Phytophthora parasitica P1976]
Length=282

 Score =   211 bits (536),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 91/138 (66%), Positives = 117/138 (85%), Gaps = 0/138 (0%)
 Frame = +2

Query  152  KESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIVAIQN  331
            +E DI+MMLAA+VH+GT+N D +M  Y+++RRNDGI+IIN+GKTWEKL +AARVIVA++N
Sbjct  5    REEDIKMMLAAQVHIGTRNADSKMADYIWRRRNDGIHIINVGKTWEKLMLAARVIVAVEN  64

Query  332  PQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTDPRTD  511
            P+D++  SARPYGQRAVLKFAQ+TG  AIA R TPGTFTNQ+   + EPRLLI+TDPRTD
Sbjct  65   PEDVIAISARPYGQRAVLKFAQHTGCQAIASRFTPGTFTNQITKQFREPRLLIITDPRTD  124

Query  512  HQPIKEAALGNIPTIAFC  565
             Q ++E++  N+P IAFC
Sbjct  125  SQAVRESSFVNVPVIAFC  142



>ref|XP_002288449.1| 40S ribosomal protein-like protein [Thalassiosira pseudonana 
CCMP1335]
 gb|EED93885.1| 40S ribosomal protein-like protein [Thalassiosira pseudonana 
CCMP1335]
Length=243

 Score =   209 bits (532),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 92/141 (65%), Positives = 115/141 (82%), Gaps = 0/141 (0%)
 Frame = +2

Query  143  LSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIVA  322
            L  KE DIQMML+A VH GT+N D  ME Y+++RR DG++I+N+GKTWEK+ +AARVIVA
Sbjct  11   LHPKEEDIQMMLSAGVHTGTRNSDSSMEEYIWRRRKDGLHILNIGKTWEKIMLAARVIVA  70

Query  323  IQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTDP  502
            I+NP+D+V  SARP+G RAVLKFA YTGA +IAGR TPGTFTNQ+   + EPRLLI+TDP
Sbjct  71   IENPEDVVAISARPWGMRAVLKFAHYTGAQSIAGRFTPGTFTNQITKQFREPRLLIVTDP  130

Query  503  RTDHQPIKEAALGNIPTIAFC  565
            RTD Q ++E++  NIP IAFC
Sbjct  131  RTDSQAVRESSYVNIPVIAFC  151



>gb|EUC64123.1| 40S ribosomal protein S0 [Rhizoctonia solani AG-3 Rhs1AP]
Length=286

 Score =   210 bits (535),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 96/142 (68%), Positives = 115/142 (81%), Gaps = 0/142 (0%)
 Frame = +2

Query  140  ALSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIV  319
            AL+  E DIQ++L+A+ HLGTKNCD QME YV+KRR DGI+IIN+GKTWEKL +AAR+I 
Sbjct  8    ALNPTEEDIQLLLSAQTHLGTKNCDKQMEPYVWKRRADGIHIINIGKTWEKLVLAARIIA  67

Query  320  AIQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTD  499
            A++NP D+V  SARPYGQRAVLKFA  TGA AIAGR TPG FTN +  S+ EPRL+I+TD
Sbjct  68   AVENPSDVVAISARPYGQRAVLKFAANTGAQAIAGRFTPGNFTNYITRSFKEPRLIIVTD  127

Query  500  PRTDHQPIKEAALGNIPTIAFC  565
            PR DHQ I+EA+  NIP IA C
Sbjct  128  PRVDHQAIREASYVNIPVIALC  149



>ref|XP_009523936.1| hypothetical protein PHYSODRAFT_285573 [Phytophthora sojae]
 gb|EGZ21219.1| hypothetical protein PHYSODRAFT_285573 [Phytophthora sojae]
Length=284

 Score =   210 bits (535),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 91/138 (66%), Positives = 117/138 (85%), Gaps = 0/138 (0%)
 Frame = +2

Query  152  KESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIVAIQN  331
            +E DI+MMLAA+VH+GT+N D +M  Y+++RRNDGI+IIN+GKTWEKL +AARVIVA++N
Sbjct  5    REEDIKMMLAAQVHIGTRNADSKMADYIWRRRNDGIHIINVGKTWEKLMLAARVIVAVEN  64

Query  332  PQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTDPRTD  511
            P+D++  SARPYGQRAVLKFAQ+TG  AIA R TPGTFTNQ+   + EPRLLI+TDPRTD
Sbjct  65   PEDVIAISARPYGQRAVLKFAQHTGCQAIASRFTPGTFTNQITKQFREPRLLIITDPRTD  124

Query  512  HQPIKEAALGNIPTIAFC  565
             Q ++E++  N+P IAFC
Sbjct  125  SQAVRESSFVNVPVIAFC  142



>ref|XP_008482046.1| PREDICTED: 40S ribosomal protein SA [Diaphorina citri]
Length=197

 Score =   207 bits (526),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 93/141 (66%), Positives = 115/141 (82%), Gaps = 0/141 (0%)
 Frame = +2

Query  143  LSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIVA  322
            LS KE D+  ML A+ H+G++N D+QME+YV+KRRNDG++I+NL +TWEKL +AAR IVA
Sbjct  8    LSLKEDDVTKMLGAQTHIGSENSDYQMEQYVYKRRNDGVHILNLRRTWEKLLLAARAIVA  67

Query  323  IQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTDP  502
            I++P D+ V S+RP GQRAVLKFA YTGA  IAGR TPG FTNQ+Q ++ EPRLL++TDP
Sbjct  68   IEHPADVFVISSRPIGQRAVLKFASYTGATPIAGRFTPGAFTNQIQAAFREPRLLVVTDP  127

Query  503  RTDHQPIKEAALGNIPTIAFC  565
             TDHQPI EAA  NIP IAFC
Sbjct  128  HTDHQPITEAAYVNIPVIAFC  148



>gb|KDN49777.1| hypothetical protein RSAG8_01842, partial [Rhizoctonia solani 
AG-8 WAC10335]
Length=287

 Score =   209 bits (533),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 95/142 (67%), Positives = 115/142 (81%), Gaps = 0/142 (0%)
 Frame = +2

Query  140  ALSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIV  319
            AL+  E DIQ++L+A+ H+GTKNCD QME YV+KRR DGI+IIN+GKTWEKL +AAR+I 
Sbjct  8    ALNPTEEDIQLLLSAQTHMGTKNCDKQMEPYVWKRRADGIHIINIGKTWEKLVLAARIIA  67

Query  320  AIQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTD  499
            A++NP D+V  SARPYGQRAVLKFA  TGA AIAGR TPG FTN +  S+ EPRL+I+TD
Sbjct  68   AVENPSDVVAISARPYGQRAVLKFAANTGAQAIAGRFTPGNFTNYITRSFKEPRLIIVTD  127

Query  500  PRTDHQPIKEAALGNIPTIAFC  565
            PR DHQ I+EA+  NIP IA C
Sbjct  128  PRVDHQAIREASYVNIPVIALC  149



>ref|XP_002908512.1| 40S ribosomal protein SA [Phytophthora infestans T30-4]
 gb|EEY61595.1| 40S ribosomal protein SA [Phytophthora infestans T30-4]
Length=283

 Score =   209 bits (533),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 90/138 (65%), Positives = 117/138 (85%), Gaps = 0/138 (0%)
 Frame = +2

Query  152  KESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIVAIQN  331
            +E DI+MMLAA+VH+GT+N D +M  Y+++RRNDGI+IIN+GKTWEKL +AARVIVA++N
Sbjct  5    REEDIKMMLAAQVHIGTRNADSKMADYIWRRRNDGIHIINVGKTWEKLMLAARVIVAVEN  64

Query  332  PQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTDPRTD  511
            P+D++  SARPYGQRAVLKFAQ+TG  AIA R TPGTFTNQ+   + EPRLL++TDPRTD
Sbjct  65   PEDVIAISARPYGQRAVLKFAQHTGCQAIASRFTPGTFTNQITKQFREPRLLLITDPRTD  124

Query  512  HQPIKEAALGNIPTIAFC  565
             Q ++E++  N+P IAFC
Sbjct  125  SQAVRESSFVNVPVIAFC  142



>emb|CBJ28597.1| conserved unknown protein [Ectocarpus siliculosus]
Length=350

 Score =   211 bits (537),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 98/150 (65%), Positives = 121/150 (81%), Gaps = 2/150 (1%)
 Frame = +2

Query  122  MALSTM--ALSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKL  295
            MA S++   L  KE DI  MLAA+VH+GT+N D QM+ Y+++RR DGI+I+N+GKTWEKL
Sbjct  1    MASSSLPACLHAKEEDIHKMLAAQVHIGTRNSDSQMQDYIWRRRQDGIHILNIGKTWEKL  60

Query  296  QMAARVIVAIQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNE  475
             +AAR+IVAI+NPQD+V  SARPYGQRAVLKFAQYTG  +IAGR TPGTFTNQ+   + E
Sbjct  61   VLAARIIVAIENPQDVVAISARPYGQRAVLKFAQYTGCLSIAGRFTPGTFTNQITKQFRE  120

Query  476  PRLLILTDPRTDHQPIKEAALGNIPTIAFC  565
            PRLLI+TDPR D Q +KEA+  N+P IAFC
Sbjct  121  PRLLIITDPRPDAQAVKEASYVNVPVIAFC  150



>tpg|DAA34051.1| TPA_exp: 40S ribosomal protein SA [Amblyomma variegatum]
Length=232

 Score =   207 bits (527),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 93/148 (63%), Positives = 115/148 (78%), Gaps = 0/148 (0%)
 Frame = +2

Query  122  MALSTMALSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQM  301
            M+  T  L+ KE D++ ML A+ HLGT N DFQM+ Y FKRR DGI++INL KTWEKL +
Sbjct  1    MSGGTSVLALKEDDVRRMLTAKTHLGTSNLDFQMKEYCFKRRPDGIHLINLKKTWEKLLL  60

Query  302  AARVIVAIQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPR  481
            AAR IVAI+NP ++   S+RPYGQRAVLKFA +TGA  IAGR TPGTFTNQ+Q ++ EPR
Sbjct  61   AARAIVAIENPAEVCAISSRPYGQRAVLKFASFTGATPIAGRFTPGTFTNQIQAAFREPR  120

Query  482  LLILTDPRTDHQPIKEAALGNIPTIAFC  565
            LL++ DPR DHQP+ EA+  N+P IAFC
Sbjct  121  LLVVCDPRADHQPVTEASYVNLPVIAFC  148



>ref|XP_005828150.1| small subunit ribosomal protein SAe, cytoplasmic [Guillardia 
theta CCMP2712]
 gb|EKX41170.1| small subunit ribosomal protein SAe, cytoplasmic [Guillardia 
theta CCMP2712]
Length=278

 Score =   208 bits (530),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 94/142 (66%), Positives = 115/142 (81%), Gaps = 0/142 (0%)
 Frame = +2

Query  140  ALSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIV  319
            AL   + D   MLAA VHLGTKN D +M  Y++KRR DG+YIINL KTWEKL +AAR++V
Sbjct  11   ALRATDDDWAKMLAAHVHLGTKNLDNKMMPYIWKRRADGLYIINLAKTWEKLMLAARIVV  70

Query  320  AIQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTD  499
            AI+NP D+ V SARPYGQRAVLKF QYTGA+ +AGR+TPGTFTNQ+Q  + EPRLL++TD
Sbjct  71   AIENPADVCVISARPYGQRAVLKFGQYTGANYMAGRYTPGTFTNQIQQQFQEPRLLVITD  130

Query  500  PRTDHQPIKEAALGNIPTIAFC  565
            PRTD QP+ E++  NIPT+AFC
Sbjct  131  PRTDSQPLHESSFVNIPTVAFC  152



>gb|ADV40166.1| putative ribosomal protein SA [Latrodectus hesperus]
Length=304

 Score =   209 bits (532),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 95/148 (64%), Positives = 117/148 (79%), Gaps = 0/148 (0%)
 Frame = +2

Query  122  MALSTMALSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQM  301
            M+    +L+ K+ D+   LA+  H+G +N DFQME+YVFKRR+DGIY+INL KTWEKL +
Sbjct  1    MSGGIPSLALKDEDVTKFLASSTHIGNENLDFQMEQYVFKRRSDGIYLINLKKTWEKLLL  60

Query  302  AARVIVAIQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPR  481
            AAR IVAI+NP DI V S+RP+GQRAVLKFA  TGA  IAGR TPGTFTNQ+Q ++ EPR
Sbjct  61   AARAIVAIENPADICVISSRPFGQRAVLKFASATGATPIAGRFTPGTFTNQIQAAFREPR  120

Query  482  LLILTDPRTDHQPIKEAALGNIPTIAFC  565
            LL++TDPR DHQP+ EA+  NIP IAFC
Sbjct  121  LLVVTDPRIDHQPLTEASYVNIPVIAFC  148



>ref|XP_005828149.1| hypothetical protein GUITHDRAFT_189772 [Guillardia theta CCMP2712]
 gb|EKX41169.1| hypothetical protein GUITHDRAFT_189772 [Guillardia theta CCMP2712]
Length=276

 Score =   208 bits (529),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 94/142 (66%), Positives = 115/142 (81%), Gaps = 0/142 (0%)
 Frame = +2

Query  140  ALSTKESDIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIV  319
            AL   + D   MLAA VHLGTKN D +M  Y++KRR DG+YIINL KTWEKL +AAR++V
Sbjct  9    ALRATDDDWAKMLAAHVHLGTKNLDNKMMPYIWKRRADGLYIINLAKTWEKLMLAARIVV  68

Query  320  AIQNPQDIVVQSARPYGQRAVLKFAQYTGAHAIAGRHTPGTFTNQLQTSYNEPRLLILTD  499
            AI+NP D+ V SARPYGQRAVLKF QYTGA+ +AGR+TPGTFTNQ+Q  + EPRLL++TD
Sbjct  69   AIENPADVCVISARPYGQRAVLKFGQYTGANYMAGRYTPGTFTNQIQQQFQEPRLLVITD  128

Query  500  PRTDHQPIKEAALGNIPTIAFC  565
            PRTD QP+ E++  NIPT+AFC
Sbjct  129  PRTDSQPLHESSFVNIPTVAFC  150



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 658693633920