BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001P07

Length=632
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004251586.1|  PREDICTED: probable histone H2A variant 3          224   3e-71   Solanum lycopersicum
ref|XP_009804709.1|  PREDICTED: probable histone H2A variant 3          221   7e-70   Nicotiana sylvestris
emb|CDP03397.1|  unnamed protein product                                221   1e-69   Coffea canephora [robusta coffee]
ref|XP_007013328.1|  Histone H2A protein 9                              218   8e-69   Theobroma cacao [chocolate]
ref|NP_001235400.1|  uncharacterized protein LOC100499998               217   2e-68   Glycine max [soybeans]
ref|XP_004287377.1|  PREDICTED: probable histone H2A variant 3          217   3e-68   Fragaria vesca subsp. vesca
ref|XP_007202745.1|  hypothetical protein PRUPE_ppa013206mg             216   5e-68   Prunus persica
ref|XP_008385940.1|  PREDICTED: probable histone H2A variant 3          216   8e-68   Malus domestica [apple tree]
gb|AFK36004.1|  unknown                                                 215   1e-67   Lotus japonicus
ref|NP_001237008.1|  uncharacterized protein LOC100306322               215   1e-67   Glycine max [soybeans]
ref|NP_001237291.1|  uncharacterized protein LOC100500133               215   1e-67   Glycine max [soybeans]
gb|KHG11664.1|  hypothetical protein F383_10131                         215   1e-67   Gossypium arboreum [tree cotton]
ref|XP_002529367.1|  histone h2a, putative                              215   2e-67   Ricinus communis
gb|KJB83165.1|  hypothetical protein B456_013G232500                    214   4e-67   Gossypium raimondii
ref|XP_007138323.1|  hypothetical protein PHAVU_009G199100g             214   4e-67   Phaseolus vulgaris [French bean]
ref|XP_002285266.1|  PREDICTED: probable histone H2A variant 3          214   4e-67   Vitis vinifera
ref|XP_006475775.1|  PREDICTED: probable histone H2A variant 3-like     214   4e-67   Citrus sinensis [apfelsine]
gb|EYU21942.1|  hypothetical protein MIMGU_mgv1a016058mg                214   5e-67   Erythranthe guttata [common monkey flower]
ref|XP_010102813.1|  putative histone H2A variant 3                     214   6e-67   Morus notabilis
ref|XP_002324843.1|  hypothetical protein POPTR_0018s01310g             213   1e-66   Populus trichocarpa [western balsam poplar]
ref|XP_006371730.1|  histone H2A family protein                         213   1e-66   Populus trichocarpa [western balsam poplar]
ref|XP_011026504.1|  PREDICTED: probable histone H2A variant 3          213   1e-66   Populus euphratica
ref|XP_001777344.1|  histone H2A variant                                213   1e-66   
ref|XP_002284738.1|  PREDICTED: probable histone H2A variant 3          213   1e-66   Vitis vinifera
gb|KDP32348.1|  hypothetical protein JCGZ_13273                         213   1e-66   Jatropha curcas
ref|XP_004508547.1|  PREDICTED: probable histone H2A variant 3-like     213   1e-66   Cicer arietinum [garbanzo]
ref|XP_007223796.1|  hypothetical protein PRUPE_ppa013175mg             213   1e-66   
ref|XP_002309600.1|  histone H2A family protein                         213   1e-66   Populus trichocarpa [western balsam poplar]
ref|XP_006451012.1|  hypothetical protein CICLE_v10010700mg             214   2e-66   
gb|AFK48552.1|  unknown                                                 213   2e-66   Medicago truncatula
ref|XP_010249965.1|  PREDICTED: probable histone H2A variant 3          213   2e-66   Nelumbo nucifera [Indian lotus]
gb|KDO80364.1|  hypothetical protein CISIN_1g046088mg                   214   2e-66   Citrus sinensis [apfelsine]
ref|XP_008352047.1|  PREDICTED: probable histone H2A variant 3          213   2e-66   
ref|XP_004498649.1|  PREDICTED: probable histone H2A variant 3-like     212   2e-66   Cicer arietinum [garbanzo]
gb|AFK43217.1|  unknown                                                 212   2e-66   Lotus japonicus
ref|XP_011086217.1|  PREDICTED: probable histone H2A variant 3          212   3e-66   Sesamum indicum [beniseed]
ref|XP_010254303.1|  PREDICTED: probable histone H2A variant 3          211   4e-66   Nelumbo nucifera [Indian lotus]
ref|XP_010533391.1|  PREDICTED: probable histone H2A variant 3          211   4e-66   Tarenaya hassleriana [spider flower]
ref|XP_003559820.1|  PREDICTED: probable histone H2A variant 3          211   5e-66   Brachypodium distachyon [annual false brome]
ref|NP_001051232.1|  Os03g0743400                                       211   6e-66   
gb|ABK22002.1|  unknown                                                 211   8e-66   Picea sitchensis
ref|NP_001237054.1|  uncharacterized protein LOC100500629               211   8e-66   Glycine max [soybeans]
ref|NP_001136523.1|  uncharacterized protein LOC100216638               211   8e-66   Zea mays [maize]
gb|EPS64047.1|  hypothetical protein M569_10734                         211   1e-65   Genlisea aurea
ref|XP_001761113.1|  histone H2A variant                                211   1e-65   
ref|XP_006427173.1|  hypothetical protein CICLE_v10026746mg             210   1e-65   Citrus clementina [clementine]
ref|XP_010691223.1|  PREDICTED: probable histone H2A variant 3          210   1e-65   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010033915.1|  PREDICTED: probable histone H2A variant 3          210   1e-65   Eucalyptus grandis [rose gum]
ref|XP_002517561.1|  histone h2a, putative                              210   1e-65   Ricinus communis
gb|KHG18378.1|  hypothetical protein F383_01388                         210   2e-65   Gossypium arboreum [tree cotton]
gb|KDP33632.1|  hypothetical protein JCGZ_07203                         210   2e-65   Jatropha curcas
gb|KHG04727.1|  hypothetical protein F383_29095                         210   2e-65   Gossypium arboreum [tree cotton]
gb|KJB13095.1|  hypothetical protein B456_002G056500                    210   2e-65   Gossypium raimondii
gb|KDP37151.1|  hypothetical protein JCGZ_06207                         210   2e-65   Jatropha curcas
gb|KHN06662.1|  Putative histone H2A variant 3                          210   2e-65   Glycine soja [wild soybean]
ref|XP_001783756.1|  histone 2A variant                                 209   2e-65   
ref|XP_010691224.1|  PREDICTED: probable histone H2A variant 3          209   3e-65   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_001141633.1|  uncharacterized protein LOC100273753               209   3e-65   Zea mays [maize]
ref|XP_007023964.1|  Histone H2A protein 9                              209   3e-65   Theobroma cacao [chocolate]
ref|XP_009405812.1|  PREDICTED: histone H2A variant 1-like              209   3e-65   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY62197.1|  BnaA06g01520D                                          209   4e-65   Brassica napus [oilseed rape]
gb|ACG25502.1|  histone H2A variant 3                                   209   5e-65   Zea mays [maize]
ref|XP_009115398.1|  PREDICTED: probable histone H2A variant 3          208   6e-65   Brassica rapa
ref|XP_008775234.1|  PREDICTED: probable histone H2A variant 3          208   6e-65   Phoenix dactylifera
ref|XP_010932842.1|  PREDICTED: probable histone H2A variant 3 is...    209   8e-65   
ref|XP_004985604.1|  PREDICTED: probable histone H2A variant 1-like     208   8e-65   Setaria italica
ref|XP_010914941.1|  PREDICTED: probable histone H2A variant 3          208   8e-65   Elaeis guineensis
ref|NP_001237346.1|  uncharacterized protein LOC100499881               208   9e-65   Glycine max [soybeans]
ref|XP_010917635.1|  PREDICTED: probable histone H2A variant 3          208   1e-64   Elaeis guineensis
ref|XP_006298794.1|  hypothetical protein CARUB_v10014898mg             208   1e-64   Capsella rubella
ref|XP_004135834.1|  PREDICTED: probable histone H2A variant 3-like     208   1e-64   Cucumis sativus [cucumbers]
ref|XP_008802548.1|  PREDICTED: probable histone H2A variant 3          208   1e-64   
ref|XP_009388461.1|  PREDICTED: histone H2A variant 1                   207   1e-64   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010679145.1|  PREDICTED: probable histone H2A variant 3          207   1e-64   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009392397.1|  PREDICTED: probable histone H2A variant 3          207   2e-64   Musa acuminata subsp. malaccensis [pisang utan]
gb|KFK38906.1|  hypothetical protein AALP_AA3G176300                    207   2e-64   Arabis alpina [alpine rockcress]
ref|XP_003521264.1|  PREDICTED: histone H2A variant 1-like              207   2e-64   Glycine max [soybeans]
ref|XP_009419817.1|  PREDICTED: histone H2A variant 1-like              207   2e-64   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003573931.1|  PREDICTED: probable histone H2A variant 2          207   2e-64   Brachypodium distachyon [annual false brome]
dbj|BAJ87489.1|  predicted protein                                      207   2e-64   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDO98103.1|  unnamed protein product                                207   2e-64   Coffea canephora [robusta coffee]
ref|XP_007162479.1|  hypothetical protein PHAVU_001G155700g             207   2e-64   Phaseolus vulgaris [French bean]
ref|XP_008775343.1|  PREDICTED: probable histone H2A variant 3          207   3e-64   Phoenix dactylifera
ref|XP_009415279.1|  PREDICTED: probable histone H2A variant 3          207   3e-64   
ref|XP_009144817.1|  PREDICTED: probable histone H2A variant 3          207   3e-64   Brassica rapa
emb|CDP03683.1|  unnamed protein product                                207   3e-64   Coffea canephora [robusta coffee]
ref|XP_009601152.1|  PREDICTED: probable histone H2A variant 1          207   3e-64   Nicotiana tomentosiformis
ref|XP_010274247.1|  PREDICTED: probable histone H2A variant 3          206   4e-64   Nelumbo nucifera [Indian lotus]
gb|KHG30412.1|  hypothetical protein F383_04720                         206   4e-64   Gossypium arboreum [tree cotton]
ref|XP_011079932.1|  PREDICTED: probable histone H2A variant 3          206   4e-64   Sesamum indicum [beniseed]
ref|XP_003588715.1|  Histone H2A                                        213   4e-64   
ref|XP_008792114.1|  PREDICTED: probable histone H2A variant 3          206   4e-64   Phoenix dactylifera
ref|XP_009412349.1|  PREDICTED: probable histone H2A variant 3          206   5e-64   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011082593.1|  PREDICTED: probable histone H2A variant 3          206   5e-64   Sesamum indicum [beniseed]
ref|XP_010503198.1|  PREDICTED: probable histone H2A variant 3 is...    206   5e-64   Camelina sativa [gold-of-pleasure]
ref|XP_003577410.1|  PREDICTED: probable histone H2A variant 3          206   6e-64   Brachypodium distachyon [annual false brome]
gb|KJB56647.1|  hypothetical protein B456_009G129400                    206   6e-64   Gossypium raimondii
ref|XP_004247205.1|  PREDICTED: probable histone H2A variant 1          206   6e-64   Solanum lycopersicum
ref|XP_010465530.1|  PREDICTED: probable histone H2A variant 3          206   7e-64   Camelina sativa [gold-of-pleasure]
ref|XP_008461070.1|  PREDICTED: probable histone H2A variant 3          208   8e-64   
gb|ACU15057.1|  unknown                                                 206   8e-64   Glycine max [soybeans]
ref|XP_004495152.1|  PREDICTED: histone H2A variant 1-like              206   8e-64   Cicer arietinum [garbanzo]
ref|NP_175683.1|  histone H2A protein 9                                 206   8e-64   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006304271.1|  hypothetical protein CARUB_v10010503mg             206   9e-64   
ref|XP_002885097.1|  hypothetical protein ARALYDRAFT_341690             205   1e-63   Arabidopsis lyrata subsp. lyrata
ref|XP_009612819.1|  PREDICTED: probable histone H2A variant 1          205   1e-63   Nicotiana tomentosiformis
ref|XP_002970134.1|  hypothetical protein SELMODRAFT_227953             206   1e-63   Selaginella moellendorffii
ref|XP_004242347.1|  PREDICTED: probable histone H2A variant 1          205   1e-63   Solanum lycopersicum
ref|XP_010503207.1|  PREDICTED: probable histone H2A variant 3 is...    205   1e-63   Camelina sativa [gold-of-pleasure]
ref|XP_002985322.1|  hypothetical protein SELMODRAFT_49537              205   1e-63   
ref|NP_001049049.1|  Os03g0162200                                       205   1e-63   
ref|XP_010545785.1|  PREDICTED: probable histone H2A variant 3          205   2e-63   Tarenaya hassleriana [spider flower]
ref|XP_003590550.1|  Histone H2A                                        204   2e-63   Medicago truncatula
ref|XP_006392875.1|  hypothetical protein EUTSA_v10011855mg             204   2e-63   Eutrema salsugineum [saltwater cress]
ref|XP_004979589.1|  PREDICTED: probable histone H2A variant 3-like     204   2e-63   Setaria italica
gb|ACA58362.1|  histone H2A                                             204   2e-63   Arachis diogoi
gb|KDP21384.1|  hypothetical protein JCGZ_21855                         204   3e-63   Jatropha curcas
ref|XP_008368628.1|  PREDICTED: histone H2A variant 1                   204   3e-63   Malus domestica [apple tree]
emb|CDY62164.1|  BnaA05g35660D                                          204   3e-63   Brassica napus [oilseed rape]
gb|ACG31635.1|  histone H2A variant 3                                   204   3e-63   Zea mays [maize]
ref|XP_006662358.1|  PREDICTED: probable histone H2A variant 2-like     204   3e-63   Oryza brachyantha
ref|XP_007050449.1|  Histone H2A 11                                     204   4e-63   Theobroma cacao [chocolate]
ref|XP_005644573.1|  histone 2A variant                                 204   4e-63   Coccomyxa subellipsoidea C-169
ref|XP_007144679.1|  hypothetical protein PHAVU_007G176000g             204   4e-63   Phaseolus vulgaris [French bean]
gb|KJB40397.1|  hypothetical protein B456_007G141000                    204   4e-63   Gossypium raimondii
ref|XP_011026076.1|  PREDICTED: histone H2A variant 1                   204   5e-63   Populus euphratica
gb|AFK43322.1|  unknown                                                 204   5e-63   Lotus japonicus
ref|XP_008386405.1|  PREDICTED: histone H2A variant 1-like              204   5e-63   Malus domestica [apple tree]
emb|CAC84677.1|  putative histone H2A                                   203   7e-63   Pinus pinaster [cluster pine]
ref|NP_001064611.1|  Os10g0418000                                       203   7e-63   
gb|KHG22538.1|  Histone H2A variant 1 -like protein                     203   8e-63   Gossypium arboreum [tree cotton]
gb|EMT03513.1|  Putative histone H2A variant 3                          203   1e-62   
ref|NP_001237025.1|  uncharacterized protein LOC100306323               203   1e-62   Glycine max [soybeans]
gb|EYU46538.1|  hypothetical protein MIMGU_mgv1a016029mg                203   1e-62   Erythranthe guttata [common monkey flower]
gb|AFK49165.1|  unknown                                                 203   1e-62   Medicago truncatula
ref|XP_004290644.1|  PREDICTED: histone H2A variant 1                   202   1e-62   Fragaria vesca subsp. vesca
ref|XP_010087116.1|  Histone H2A variant 1                              202   1e-62   Morus notabilis
ref|XP_002985509.1|  hypothetical protein SELMODRAFT_122533             202   2e-62   Selaginella moellendorffii
ref|XP_010098975.1|  putative histone H2A variant 3                     211   2e-62   
ref|XP_006386250.1|  hypothetical protein POPTR_0002s04720g             204   3e-62   
ref|NP_191019.1|  histone H2A 11                                        202   3e-62   Arabidopsis thaliana [mouse-ear cress]
gb|KHG06453.1|  Histone H2A variant 1 -like protein                     201   4e-62   Gossypium arboreum [tree cotton]
ref|XP_004145372.1|  PREDICTED: histone H2A variant 1-like isoform 1    201   5e-62   Cucumis sativus [cucumbers]
ref|XP_002504544.1|  predicted protein                                  201   6e-62   Micromonas commoda
ref|XP_002956228.1|  hypothetical protein VOLCADRAFT_109344             201   6e-62   Volvox carteri f. nagariensis
emb|CDY57201.1|  BnaA04g27780D                                          200   7e-62   Brassica napus [oilseed rape]
ref|XP_009380411.1|  PREDICTED: histone H2A variant 1-like              201   7e-62   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_005851876.1|  hypothetical protein CHLNCDRAFT_133450             201   7e-62   Chlorella variabilis
ref|XP_007509240.1|  unknown                                            201   7e-62   Bathycoccus prasinos
ref|XP_009139231.1|  PREDICTED: histone H2A variant 1                   201   7e-62   Brassica rapa
ref|XP_001693700.1|  histone H2A variant                                201   9e-62   Chlamydomonas reinhardtii
ref|XP_003059832.1|  histone H2A                                        201   9e-62   Micromonas pusilla CCMP1545
gb|EPS72017.1|  hypothetical protein M569_02741                         199   9e-62   Genlisea aurea
ref|XP_004336226.1|  Histone H2A variant, putative                      200   1e-61   Acanthamoeba castellanii str. Neff
ref|XP_006403558.1|  hypothetical protein EUTSA_v10010813mg             200   1e-61   Eutrema salsugineum [saltwater cress]
ref|XP_003074738.1|  H2a Histone H2A, probable (IC)                     200   1e-61   Ostreococcus tauri
ref|XP_010427164.1|  PREDICTED: histone H2A variant 1-like              200   1e-61   Camelina sativa [gold-of-pleasure]
ref|XP_002307619.1|  hypothetical protein POPTR_0005s23810g             200   2e-61   
ref|XP_010504270.1|  PREDICTED: histone H2A variant 1                   200   2e-61   Camelina sativa [gold-of-pleasure]
ref|XP_010525349.1|  PREDICTED: histone H2A variant 1                   200   2e-61   Tarenaya hassleriana [spider flower]
ref|XP_009601396.1|  PREDICTED: probable histone H2A variant 3          199   2e-61   Nicotiana tomentosiformis
ref|XP_009103924.1|  PREDICTED: histone H2A variant 1-like              199   2e-61   Brassica rapa
ref|XP_007200594.1|  hypothetical protein PRUPE_ppa013146mg             199   2e-61   Prunus persica
ref|XP_010554466.1|  PREDICTED: histone H2A variant 1-like              199   3e-61   Tarenaya hassleriana [spider flower]
ref|XP_010517203.1|  PREDICTED: probable histone H2A variant 2          199   3e-61   Camelina sativa [gold-of-pleasure]
gb|AFK41330.1|  unknown                                                 199   3e-61   Lotus japonicus
ref|XP_010038048.1|  PREDICTED: histone H2A variant 1                   199   5e-61   Eucalyptus grandis [rose gum]
emb|CDY13216.1|  BnaC04g26190D                                          200   5e-61   Brassica napus [oilseed rape]
ref|XP_009116136.1|  PREDICTED: histone H2A variant 1-like              198   6e-61   Brassica rapa
ref|XP_002281266.1|  PREDICTED: histone H2A variant 1                   198   7e-61   Vitis vinifera
ref|XP_006291960.1|  hypothetical protein CARUB_v10018149mg             199   7e-61   
ref|XP_010505538.1|  PREDICTED: probable histone H2A variant 2          198   7e-61   Camelina sativa [gold-of-pleasure]
emb|CDX73471.1|  BnaC08g25320D                                          200   1e-60   
ref|NP_181415.1|  histone H2A 8                                         197   2e-60   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006443946.1|  hypothetical protein CICLE_v10022798mg             197   2e-60   
gb|KFK36782.1|  histone h2a                                             197   2e-60   Arabis alpina [alpine rockcress]
ref|XP_002881618.1|  hypothetical protein ARALYDRAFT_482894             197   2e-60   
ref|XP_001416208.1|  predicted protein                                  197   3e-60   Ostreococcus lucimarinus CCE9901
ref|XP_006295217.1|  hypothetical protein CARUB_v10024299mg             196   4e-60   Capsella rubella
emb|CDY14429.1|  BnaC03g21660D                                          196   4e-60   Brassica napus [oilseed rape]
ref|XP_005000165.1|  PREDICTED: histone H2A.Z-like isoform X1           196   5e-60   
ref|XP_003588709.1|  Histone H2A                                        194   1e-59   
ref|XP_006411105.1|  hypothetical protein EUTSA_v10017405mg             195   1e-59   Eutrema salsugineum [saltwater cress]
emb|CCA18155.1|  histone H2A variant 1 putative                         195   1e-59   Albugo laibachii Nc14
ref|XP_009133299.1|  PREDICTED: probable histone H2A variant 2          194   3e-59   Brassica rapa
ref|XP_006595522.1|  PREDICTED: uncharacterized protein LOC100500...    194   3e-59   Glycine max [soybeans]
gb|AAF07182.1|  H2A protein                                             194   3e-59   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003592696.1|  Histone H2A                                        193   5e-59   Medicago truncatula
emb|CDQ62413.1|  unnamed protein product                                194   5e-59   Oncorhynchus mykiss
ref|XP_006770462.1|  PREDICTED: histone H2A.V-like                      193   5e-59   Myotis davidii
ref|XP_005396709.1|  PREDICTED: histone H2A.V-like                      193   5e-59   Chinchilla lanigera
ref|XP_007255793.1|  PREDICTED: histone H2A.Z-like isoform X1           193   5e-59   Astyanax mexicanus [blind cave fish]
emb|CDW88346.1|  UNKNOWN                                                194   5e-59   Stylonychia lemnae
ref|NP_002097.1|  histone H2A.Z                                         193   6e-59   Homo sapiens [man]
gb|ABS85188.1|  putative histone 2A                                     192   6e-59   Hypericum perforatum
ref|XP_008705427.1|  PREDICTED: histone H2A.Z                           193   6e-59   Ursus maritimus [white bear]
ref|NP_001026545.1|  histone H2A.Z                                      193   6e-59   Gallus gallus [bantam]
gb|EFB21083.1|  hypothetical protein PANDA_017927                       193   6e-59   Ailuropoda melanoleuca
ref|XP_003966802.1|  PREDICTED: histone H2A.Z-like                      193   6e-59   Takifugu rubripes [tiger puffer]
gb|AFV36373.1|  histone H2A.Z.3.2                                       193   6e-59   Cyprinus carpio [carp]
gb|EMC77020.1|  Histone H2A.Z                                           193   6e-59   
ref|XP_004602082.1|  PREDICTED: histone H2A.V-like                      193   6e-59   Sorex araneus [Eurasian shrew]
ref|XP_009883835.1|  PREDICTED: histone H2A.Z                           193   6e-59   Charadrius vociferus
ref|XP_005950649.1|  PREDICTED: histone H2A.V-like isoform X2           193   6e-59   
ref|XP_006166090.1|  PREDICTED: histone H2A.V-like isoform X2           193   6e-59   Tupaia chinensis
gb|ACQ58234.1|  Histone H2A.Z                                           193   6e-59   Anoplopoma fimbria
ref|XP_006023756.1|  PREDICTED: histone H2A.Z-like                      193   7e-59   
gb|ELK13041.1|  Histone H2A.V                                           193   7e-59   Pteropus alecto
ref|XP_009935347.1|  PREDICTED: histone H2A.Z                           193   7e-59   Opisthocomus hoazin [hoatzin]
emb|CAG08182.1|  unnamed protein product                                193   7e-59   Tetraodon nigroviridis
ref|XP_003225775.1|  PREDICTED: histone H2A.Z                           193   7e-59   Anolis carolinensis [Carolina anole]
gb|ELK23257.1|  Histone H2A.Z                                           193   7e-59   Myotis davidii
ref|XP_008701702.1|  PREDICTED: histone H2A.V                           193   7e-59   Ursus maritimus [white bear]
ref|XP_004708238.1|  PREDICTED: histone H2A.V-like                      193   7e-59   
ref|NP_036544.1|  histone H2A.V isoform 1                               193   7e-59   Homo sapiens [man]
gb|EOA95897.1|  Histone H2A.Z                                           193   7e-59   Anas platyrhynchos [duck]
ref|XP_003458968.1|  PREDICTED: histone H2A.Z-like isoform X1           193   7e-59   Oreochromis niloticus
gb|ACO13560.1|  Histone H2AV                                            193   7e-59   Esox lucius
ref|XP_009076453.1|  PREDICTED: histone H2A.Z                           193   7e-59   Acanthisitta chloris
emb|CDQ68676.1|  unnamed protein product                                193   7e-59   Oncorhynchus mykiss
ref|XP_007250324.1|  PREDICTED: histone H2A.V-like                      193   7e-59   Astyanax mexicanus [blind cave fish]
ref|XP_008931529.1|  PREDICTED: histone H2A.Z                           193   7e-59   
ref|XP_002428173.1|  histone H2AV, putative                             194   7e-59   Pediculus humanus corporis [human body lice]
pdb|3WA9|C  Chain C, The Nucleosome Containing Human H2a.z.1            193   7e-59   Homo sapiens [man]
ref|XP_007613537.1|  PREDICTED: histone H2A.V isoform X2                193   7e-59   
gb|KFV85097.1|  Histone H2A.V                                           192   7e-59   Struthio camelus australis
gb|ACO11883.1|  Histone H2A.Z                                           192   7e-59   Lepeophtheirus salmonis
pdb|3WAA|C  Chain C, The Nucleosome Containing Human H2a.z.2            193   7e-59   Homo sapiens [man]
ref|XP_007081020.1|  PREDICTED: histone H2A.Z-like                      192   8e-59   Panthera tigris altaica
dbj|BAE30460.1|  unnamed protein product                                192   8e-59   Mus musculus [mouse]
ref|XP_004894331.1|  PREDICTED: histone H2A.V-like                      193   8e-59   
ref|XP_009694151.1|  PREDICTED: histone H2A.Z                           192   8e-59   Cariama cristata
ref|XP_009563646.1|  PREDICTED: histone H2A.V                           192   8e-59   Cuculus canorus
pdb|4CAY|A  Chain A, Crystal Structure Of A Human Anp32e-h2a.z-h2...    192   8e-59   Homo sapiens [man]
gb|ACO10600.1|  Histone H2A.Z                                           192   8e-59   Caligus rogercresseyi
ref|NP_001116980.1|  histone H2 A.F/Z                                   192   8e-59   Strongylocentrotus purpuratus [purple urchin]
gb|ACJ12611.1|  histone H2A isoform 2                                   192   8e-59   Haliotis discus discus
ref|XP_008633818.1|  PREDICTED: histone H2A.Z                           193   8e-59   Corvus brachyrhynchos
ref|XP_001364046.1|  PREDICTED: histone H2A.Z-like                      192   8e-59   Monodelphis domestica
emb|CDQ92154.1|  unnamed protein product                                192   8e-59   Oncorhynchus mykiss
ref|NP_001036788.1|  histone 2A family member ZA                        192   9e-59   Danio rerio [leopard danio]
ref|XP_010623224.1|  PREDICTED: histone H2A.V isoform X1                193   9e-59   Fukomys damarensis [Damara mole rat]
ref|XP_009633050.1|  PREDICTED: histone H2A.Z                           193   9e-59   Egretta garzetta
ref|XP_008524485.1|  PREDICTED: histone H2A.V                           192   9e-59   Equus przewalskii [Przewalski horse]
ref|XP_006736504.1|  PREDICTED: histone H2A.V-like                      193   9e-59   Leptonychotes weddellii
ref|XP_007979605.1|  PREDICTED: histone H2A.V isoform X1                193   9e-59   Chlorocebus sabaeus
ref|XP_010623226.1|  PREDICTED: histone H2A.V isoform X3                192   1e-58   Fukomys damarensis [Damara mole rat]
sp|P08991.1|H2AV_STRPU  RecName: Full=Histone H2A.V; AltName: Ful...    192   1e-58   Strongylocentrotus purpuratus [purple urchin]
ref|XP_005235794.1|  PREDICTED: histone H2A.V-like                      193   1e-58   
ref|XP_002610336.1|  hypothetical protein BRAFLDRAFT_72473              192   1e-58   Branchiostoma floridae
ref|XP_008158813.1|  PREDICTED: histone H2A.V                           192   1e-58   
ref|XP_009095970.1|  PREDICTED: histone H2A.V                           192   1e-58   
ref|XP_004008310.1|  PREDICTED: histone H2A.V-like                      192   1e-58   
ref|XP_006629811.1|  PREDICTED: histone H2A.Z-like                      192   1e-58   
ref|XP_005443895.1|  PREDICTED: histone H2A.Z-like                      193   1e-58   
ref|XP_010212103.1|  PREDICTED: histone H2A.Z                           193   1e-58   Tinamus guttatus
ref|XP_008939402.1|  PREDICTED: histone H2A.Z                           192   1e-58   Merops nubicus
ref|XP_005484770.1|  PREDICTED: histone H2A.Z-like isoform X1           192   1e-58   Zonotrichia albicollis
ref|XP_005044905.1|  PREDICTED: histone H2A.Z-like isoform X2           192   1e-58   Ficedula albicollis
ref|XP_006031283.1|  PREDICTED: histone H2A.V-like                      193   1e-58   
ref|XP_009701467.1|  PREDICTED: histone H2A.V                           193   1e-58   Cariama cristata
gb|AEH58058.1|  histone variant H2A.Z                                   192   1e-58   Mytilus galloprovincialis
ref|XP_010007995.1|  PREDICTED: histone H2A.Z                           192   1e-58   Nestor notabilis
ref|XP_006251449.1|  PREDICTED: H2A histone family, member V isof...    192   1e-58   Rattus norvegicus [brown rat]
ref|XP_005517542.1|  PREDICTED: histone H2A.Z-like isoform X1           192   1e-58   Pseudopodoces humilis [Tibetan ground-jay]
ref|XP_005418240.1|  PREDICTED: histone H2A.Z-like                      192   1e-58   Geospiza fortis
gb|ELU00382.1|  hypothetical protein CAPTEDRAFT_170341                  192   1e-58   Capitella teleta
ref|XP_003403261.1|  PREDICTED: histone H2A.V-like                      192   1e-58   
gb|EFN67484.1|  Histone H2A.V                                           192   2e-58   Camponotus floridanus
gb|AGM32409.1|  histone H2A.V-like protein                              192   2e-58   Coptotermes formosanus
ref|XP_009868545.1|  PREDICTED: histone H2A.Z                           192   2e-58   Apaloderma vittatum
ref|XP_004205771.1|  PREDICTED: histone H2A.Z-like                      192   2e-58   
ref|XP_009033301.1|  hypothetical protein AURANDRAFT_59843              192   2e-58   Aureococcus anophagefferens
ref|XP_008561034.1|  PREDICTED: histone H2A.V                           192   2e-58   Microplitis demolitor
gb|KFO33053.1|  Histone H2A.V                                           193   2e-58   Fukomys damarensis [Damara mole rat]
ref|XP_002129155.1|  PREDICTED: histone H2A.V                           192   2e-58   
ref|NP_001156187.1|  Histone H2AV (H2A.F/Z)-like                        192   2e-58   Acyrthosiphon pisum
gb|ACY66386.2|  histone H2AV                                            192   2e-58   Scylla paramamosain
gb|AFJ91768.1|  histone h2a                                             191   2e-58   Ostrea edulis [Colchester native oyster]
gb|EZA61420.1|  Histone H2A.V                                           192   2e-58   
gb|EJY87399.1|  Histone H2A                                             192   2e-58   
gb|AAH49523.1|  H2afvl protein                                          192   2e-58   
ref|XP_007905594.1|  PREDICTED: histone H2A.V                           192   2e-58   
ref|NP_001267767.1|  uncharacterized protein LOC101854106               192   2e-58   
dbj|BAD92238.1|  H2A histone family, member V isoform 1 variant         192   2e-58   
ref|XP_009556851.1|  PREDICTED: histone H2A.Z                           192   2e-58   
emb|CBJ32072.1|  conserved unknown protein                              192   2e-58   
gb|EFN84489.1|  Histone H2A.V                                           192   2e-58   
ref|XP_010967844.1|  PREDICTED: histone H2A.V                           193   2e-58   
ref|XP_005532971.1|  PREDICTED: histone H2A.V-like isoform X1           192   2e-58   
ref|XP_008487247.1|  PREDICTED: histone H2A.V                           192   2e-58   
gb|AAM76154.1|AF483074_1  histone 2A Z variant                          192   2e-58   
ref|XP_009904805.1|  PREDICTED: histone H2A.V                           192   2e-58   
ref|XP_010137880.1|  PREDICTED: histone H2A.Z                           192   2e-58   
ref|XP_011407383.1|  PREDICTED: histone H2A.v                           191   2e-58   
ref|XP_010339713.1|  PREDICTED: histone H2A.V                           192   2e-58   
ref|NP_524519.1|  histone H2A variant, isoform A                        192   2e-58   
gb|AEM36062.1|  putative histone h2a                                    191   2e-58   
ref|XP_009687707.1|  PREDICTED: histone H2A.Z                           192   2e-58   
ref|XP_010388179.1|  PREDICTED: histone H2A.V                           191   3e-58   
emb|CDQ79743.1|  unnamed protein product                                194   3e-58   
ref|XP_002111498.1|  conserved hypothetical protein                     191   3e-58   
ref|XP_005464230.1|  PREDICTED: histone H2A.Z-like isoform X2           192   3e-58   
ref|NP_001005097.1|  histone H2A.Z-like                                 191   3e-58   
gb|AEE61581.1|  unknown                                                 191   3e-58   
ref|XP_002060505.1|  GJ15170                                            192   3e-58   
ref|XP_001638352.1|  predicted protein                                  191   3e-58   
dbj|BAE40081.1|  unnamed protein product                                191   3e-58   
sp|O62695.3|H2AV_RABIT  RecName: Full=Histone H2A.V; AltName: Ful...    191   3e-58   
ref|XP_010561198.1|  PREDICTED: histone H2A.V isoform X1                192   3e-58   
gb|EPQ18078.1|  Histone H2A.V                                           191   3e-58   
ref|XP_975468.1|  PREDICTED: histone H2A.V                              191   3e-58   
gb|KFM69505.1|  Histone H2A.Z                                           191   3e-58   
ref|XP_001981633.1|  GG11506                                            191   3e-58   
ref|XP_007187848.1|  PREDICTED: histone H2A.V-like                      192   4e-58   
ref|XP_003693090.1|  PREDICTED: histone H2A.V-like                      192   4e-58   
ref|XP_001507614.2|  PREDICTED: histone H2A.V                           192   4e-58   
gb|KFP02168.1|  Histone H2A.V                                           191   4e-58   
ref|XP_005189127.1|  PREDICTED: histone H2A.v                           191   4e-58   
ref|XP_005395285.1|  PREDICTED: histone H2A.Z-like isoform X1           191   4e-58   
ref|XP_004524171.1|  PREDICTED: histone H2A.v-like                      191   4e-58   
ref|XP_006220121.1|  PREDICTED: histone H2A.V-like                      191   4e-58   
ref|XP_008352272.1|  PREDICTED: probable histone H2A variant 3          190   4e-58   
ref|XP_010864534.1|  PREDICTED: histone H2A.V                           193   4e-58   
ref|XP_005754222.1|  PREDICTED: histone H2A.Z-like                      192   4e-58   
ref|XP_310818.3|  AGAP000306-PA                                         191   4e-58   
gb|ETE59971.1|  Histone H2A.V                                           192   4e-58   
ref|XP_006970723.1|  PREDICTED: histone H2A.Z-like                      191   4e-58   
ref|XP_005438223.1|  PREDICTED: histone H2A.V-like                      192   4e-58   
gb|AFK10829.1|  H2afvl protein                                          191   4e-58   
ref|XP_009021431.1|  hypothetical protein HELRODRAFT_157365             191   5e-58   
ref|XP_006166089.1|  PREDICTED: histone H2A.V-like isoform X1           192   5e-58   
dbj|BAE26959.1|  unnamed protein product                                191   6e-58   
ref|XP_008493769.1|  PREDICTED: histone H2A.V                           191   6e-58   
ref|XP_005515322.1|  PREDICTED: histone H2A.Z-like                      192   6e-58   
ref|XP_006264571.1|  PREDICTED: histone H2A.Z-like                      194   6e-58   
ref|XP_009325353.1|  PREDICTED: histone H2A.Z                           193   6e-58   
ref|XP_001999466.1|  GI23052                                            191   6e-58   
gb|AAW25937.1|  SJCHGC05820 protein                                     191   6e-58   
ref|XP_008500627.1|  PREDICTED: histone H2A.Z                           192   6e-58   
ref|NP_001040529.1|  H2A histone family member V                        190   7e-58   
emb|CDJ04329.1|  histone H2A                                            190   7e-58   
emb|CCD80664.1|  putative histone H2A                                   191   7e-58   
ref|XP_006625595.1|  PREDICTED: histone H2A.V-like                      191   7e-58   
ref|XP_001994269.1|  GH10352                                            191   7e-58   
ref|XP_011345477.1|  PREDICTED: histone H2A.V isoform X2                192   7e-58   
ref|XP_005057985.1|  PREDICTED: histone H2A.V-like                      192   7e-58   
gb|ACO52023.1|  Histone H2A.Z-like                                      190   7e-58   
ref|XP_006843618.1|  hypothetical protein AMTR_s00007p00145770          189   7e-58   
ref|XP_010001484.1|  PREDICTED: histone H2A.Z                           192   7e-58   
gb|ACM09697.1|  Histone H2A.Z                                           190   8e-58   
gb|EYC33757.1|  hypothetical protein Y032_0002g969                      190   8e-58   
gb|AFK10707.1|  histone H2A.V isoform 1                                 190   9e-58   
gb|EGT43434.1|  hypothetical protein CAEBREN_05524                      191   9e-58   
gb|ACF35543.1|  histone H2                                              190   9e-58   
ref|XP_003753122.1|  PREDICTED: histone H2A.V-like                      190   9e-58   
ref|XP_002634132.1|  C. briggsae CBR-HTZ-1 protein                      190   9e-58   
emb|CDJ89859.1|  Histone core domain containing protein                 190   1e-57   
ref|XP_002072700.1|  GK13546                                            191   1e-57   
ref|XP_009680572.1|  PREDICTED: histone H2A.V                           191   1e-57   
gb|ETN84224.1|  core histone H2A/H2B/H3/H4                              190   1e-57   
ref|NP_001280079.1|  histone H2A.Z                                      190   1e-57   
gb|EFX70199.1|  hypothetical protein DAPPUDRAFT_300571                  190   1e-57   
ref|XP_006133846.1|  PREDICTED: histone H2A.Z-like isoform X1           192   1e-57   
emb|CAL26296.1|  CG5499                                                 190   1e-57   
ref|XP_001658510.1|  AAEL007609-PA                                      189   1e-57   
gb|KHJ45576.1|  putative histone H2A.V                                  190   1e-57   
emb|CAL26298.1|  CG5499                                                 190   1e-57   
ref|XP_004641110.1|  PREDICTED: histone H2A.Z-like                      190   1e-57   
gb|EMC89233.1|  Histone H2A.V                                           189   1e-57   
ref|XP_003108111.1|  CRE-HTZ-1 protein                                  190   1e-57   
gb|ADO27735.1|  histone h2a.z                                           189   1e-57   
ref|XP_008862634.1|  histone H2A.Z                                      190   1e-57   
emb|CAF90447.1|  unnamed protein product                                192   1e-57   
emb|CDQ70359.1|  unnamed protein product                                191   1e-57   
ref|XP_003797644.1|  PREDICTED: histone H2A.V-like                      192   1e-57   
ref|XP_001610164.1|  histone H2A.F/Z                                    191   2e-57   
ref|XP_006066107.1|  PREDICTED: histone H2A.Z-like isoform X1           189   2e-57   
ref|XP_004829234.1|  histone H2a, putative                              190   2e-57   
ref|NP_500569.1|  Protein HTZ-1                                         190   2e-57   
ref|XP_724268.1|  histone H2A variant                                   190   2e-57   
emb|CDW53224.1|  Histone H2A                                            190   2e-57   
ref|NP_001164412.1|  histone H2A.V                                      189   2e-57   
gb|KFD54257.1|  hypothetical protein M513_04799                         191   2e-57   
emb|CEF66425.1|  Histone H2A.v                                          189   2e-57   
ref|XP_765177.1|  histone H2A                                           190   2e-57   
ref|XP_006175203.1|  PREDICTED: histone H2A.V-like                      192   2e-57   
ref|XP_952101.1|  histone H2A variant                                   190   2e-57   
ref|XP_001351279.1|  histone H2A variant, putative                      190   2e-57   
gb|EHJ63407.1|  H2A histone family member V                             190   2e-57   
ref|XP_003738177.1|  PREDICTED: histone H2A.Z-like                      189   2e-57   
ref|XP_002286413.1|  histone H2A                                        189   2e-57   
emb|CAL26301.1|  CG5499                                                 189   3e-57   
gb|AFK37612.1|  unknown                                                 189   3e-57   
gb|EUB58322.1|  Histone H2A.V                                           191   3e-57   
ref|XP_005681448.1|  PREDICTED: histone H2A.Z-like                      192   3e-57   
ref|XP_679419.1|  histone H2A variant                                   190   3e-57   
gb|ACI69610.1|  Histone H2A.Z                                           189   3e-57   
ref|XP_001614504.1|  histone H2A                                        189   3e-57   
gb|KFM73933.1|  Histone H2A.v                                           189   3e-57   
gb|EWM21492.1|  histone 2                                               189   3e-57   
ref|XP_008658929.1|  PREDICTED: probable histone H2A variant 3 is...    188   3e-57   
ref|XP_008623417.1|  histone H2A                                        189   4e-57   
ref|XP_006091615.1|  PREDICTED: histone H2A.Z-like                      188   4e-57   
ref|XP_005882980.1|  PREDICTED: histone H2A.V-like                      192   4e-57   
ref|XP_010123551.1|  PREDICTED: histone H2A.V-like                      189   5e-57   
gb|ELK25174.1|  Histone H2A.V                                           192   5e-57   
ref|XP_006406947.1|  hypothetical protein EUTSA_v10021747mg             188   5e-57   
ref|XP_005877352.1|  PREDICTED: histone H2A.Z-like isoform X1           188   6e-57   
gb|EHB09125.1|  Histone H2A.V                                           192   6e-57   
ref|XP_003410508.1|  PREDICTED: uncharacterized protein LOC100660481    193   6e-57   
gb|ACM09081.1|  Histone H2A.Z                                           188   6e-57   
gb|ETN58627.1|  histone h2a                                             187   6e-57   
ref|XP_001899190.1|  Histone H2A variant                                187   9e-57   
gb|EJW85265.1|  histone H2A.V                                           187   9e-57   
ref|XP_008605715.1|  histone H2A                                        188   1e-56   
ref|XP_008662589.1|  PREDICTED: histone H2A.V-like isoform X4           190   1e-56   
ref|XP_004641501.1|  PREDICTED: histone H2A.Z-like                      187   1e-56   
gb|KHN88967.1|  Histone H2A.V                                           187   1e-56   
gb|KJB72942.1|  hypothetical protein B456_011G205500                    186   1e-56   
ref|XP_008662587.1|  PREDICTED: histone H2A.V-like isoform X2           190   1e-56   
ref|XP_008662588.1|  PREDICTED: histone H2A.V-like isoform X3           190   1e-56   
dbj|GAA36695.2|  histone H2A.V                                          192   1e-56   
ref|XP_005891939.1|  PREDICTED: uncharacterized protein LOC102267674    191   2e-56   
gb|KFM59779.1|  Histone H2A.V                                           191   2e-56   
gb|EWC90657.1|  histone H2A                                             191   2e-56   
gb|AFV36374.1|  histone H2A.Z.7                                         187   2e-56   
ref|XP_008658915.1|  PREDICTED: histone H2A.V-like isoform X5           189   2e-56   
ref|XP_009174184.1|  hypothetical protein T265_09750                    189   2e-56   
ref|XP_008662580.1|  PREDICTED: histone H2A.Y-like isoform X1           191   2e-56   
ref|XP_005027317.1|  PREDICTED: histone H2A.v2-like isoform X1          194   3e-56   
emb|CDR94056.1|  41-2 protein antigen precursor, putative               194   3e-56   
ref|XP_008658927.1|  PREDICTED: histone H2A.V-like isoform X6           189   3e-56   
ref|XP_002371743.1|  histone H2A                                        187   3e-56   
ref|XP_006082875.1|  PREDICTED: histone H2A.Z-like                      186   3e-56   
ref|XP_006995034.1|  PREDICTED: histone H2A.V-like                      186   3e-56   
emb|CCF74287.1|  unnamed protein product                                187   3e-56   
ref|XP_008658910.1|  PREDICTED: histone H2A.V-like isoform X4           189   3e-56   
ref|XP_004709219.1|  PREDICTED: histone H2A.V-like isoform X1           186   3e-56   
ref|XP_009940513.1|  PREDICTED: histone H2A.V-like                      188   3e-56   
gb|ABE77334.1|  histone variant H2A.Z                                   186   3e-56   
ref|XP_008658906.1|  PREDICTED: histone H2A.V-like isoform X3           189   4e-56   
ref|XP_004365639.2|  H2A histone family protein                         186   4e-56   
ref|XP_002468462.1|  hypothetical protein SORBIDRAFT_01g046310          186   4e-56   
ref|XP_006911556.1|  PREDICTED: uncharacterized protein LOC102889986    191   4e-56   
ref|XP_009271897.1|  PREDICTED: uncharacterized protein LOC103894275    192   5e-56   
ref|XP_003754259.2|  PREDICTED: histone H2A.V-like                      186   5e-56   
emb|CCI42588.1|  unnamed protein product                                198   6e-56   
gb|KFD48967.1|  hypothetical protein M513_10119                         190   6e-56   
ref|XP_008664946.1|  PREDICTED: probable histone H2A variant 3          184   7e-56   
ref|XP_008658895.1|  PREDICTED: histone H2A.V-like isoform X1           188   7e-56   
ref|XP_008658903.1|  PREDICTED: histone H2A.V-like isoform X2           188   8e-56   
emb|CDW56048.1|  Histone H2A                                            190   9e-56   
gb|EJK72006.1|  hypothetical protein THAOC_06502                        187   1e-55   
ref|XP_003380884.1|  histone H2AV                                       194   1e-55   
ref|XP_005673392.1|  PREDICTED: transcriptional activator protein...    192   1e-55   
gb|ACC68868.1|  H2A histone family, member Z (predicted)                184   1e-55   
ref|XP_004645295.1|  PREDICTED: histone H2A.V-like                      185   1e-55   
gb|KFB39676.1|  AGAP000306-PA-like protein                              186   1e-55   
ref|XP_004638797.1|  PREDICTED: histone H2A.V-like isoform X1           184   1e-55   
ref|XP_005614904.1|  PREDICTED: LOW QUALITY PROTEIN: purine-rich ...    192   1e-55   
tpg|DAA43508.1|  TPA: hypothetical protein ZEAMMB73_625434              184   1e-55   
ref|XP_008656543.1|  PREDICTED: probable histone H2A variant 3          183   1e-55   
ref|XP_005679430.1|  PREDICTED: transcriptional activator protein...    192   2e-55   
emb|CDJ54049.1|  histone H2A, putative                                  185   2e-55   
emb|CDI82313.1|  histone H2A, putative                                  185   2e-55   
ref|XP_005995243.1|  PREDICTED: transcriptional activator protein...    192   2e-55   
ref|XP_010554767.1|  PREDICTED: histone H2A variant 1-like              183   2e-55   
ref|XP_005027321.1|  PREDICTED: histone H2A.v2-like isoform X5          186   2e-55   
emb|CDJ36967.1|  histone H2A, putative                                  185   2e-55   
ref|XP_002181345.1|  histone H2A isoform 1                              184   3e-55   
ref|XP_005826577.1|  hypothetical protein GUITHDRAFT_96636              184   3e-55   
ref|XP_008651308.1|  PREDICTED: probable histone H2A variant 3          182   3e-55   
ref|XP_006051371.1|  PREDICTED: transcriptional activator protein...    192   3e-55   
ref|XP_008679438.1|  PREDICTED: probable histone H2A variant 3          182   4e-55   
ref|XP_005818380.1|  hypothetical protein GUITHDRAFT_98800              184   4e-55   
ref|XP_005642237.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    192   5e-55   
ref|XP_005451499.1|  PREDICTED: histone H2A.V-like                      183   5e-55   
ref|XP_005950648.1|  PREDICTED: histone H2A.V-like isoform X1           183   5e-55   
ref|XP_010307675.1|  PREDICTED: histone H2A.V-like                      183   6e-55   
ref|XP_007524533.1|  PREDICTED: uncharacterized protein LOC103114743    192   7e-55   
ref|XP_009475454.1|  PREDICTED: uncharacterized protein LOC104023371    187   1e-54   
ref|XP_008656120.1|  PREDICTED: probable histone H2A variant 3          181   1e-54   
gb|KFH64076.1|  histone H2A.V                                           182   1e-54   
ref|XP_005766436.1|  hypothetical protein EMIHUDRAFT_445748             182   1e-54   
ref|XP_003784203.1|  PREDICTED: histone H2A.Z-like isoform 1            181   2e-54   
ref|XP_007069918.1|  PREDICTED: histone H2A.V-like isoform X1           181   2e-54   
ref|XP_005340627.1|  PREDICTED: histone H2A.V-like isoform X2           181   3e-54   
gb|KFO14285.1|  Histone H2A.V                                           181   4e-54   
ref|XP_002680414.1|  histone H2A                                        182   4e-54   
gb|AFJ24840.1|  histone h2a.z-1                                         180   5e-54   
ref|XP_007633962.1|  PREDICTED: histone H2A.V-like                      180   6e-54   
ref|XP_005957744.1|  PREDICTED: histone H2A.V-like isoform X1           180   6e-54   
ref|XP_002139374.1|  histone H2A                                        181   6e-54   
gb|AFK11380.1|  histone H2A.V-like protein                              179   8e-54   
gb|ACI69015.1|  Histone H2AV                                            180   8e-54   
ref|XP_005857307.1|  PREDICTED: histone H2A.Z-like                      180   9e-54   
ref|XP_005027322.1|  PREDICTED: histone H2A.v2-like isoform X6          179   9e-54   
ref|XP_009968971.1|  PREDICTED: histone H2A.Z-like                      179   9e-54   
ref|XP_008361251.1|  PREDICTED: TMV resistance protein N-like           183   9e-54   



>ref|XP_004251586.1| PREDICTED: probable histone H2A variant 3 [Solanum lycopersicum]
 ref|XP_006366860.1| PREDICTED: probable histone H2A variant 3-like [Solanum tuberosum]
Length=135

 Score =   224 bits (572),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 124/130 (95%), Positives = 126/130 (97%), Gaps = 3/130 (2%)
 Frame = +1

Query  163  LIMGKTSVAAANkdkdkdkkkPTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYS  342
            LIMGKT   AANKDK+K+KKKPTSRSSRAGLQFPVGRIHRLLKERT ANGRVGATAAVYS
Sbjct  9    LIMGKT---AANKDKEKEKKKPTSRSSRAGLQFPVGRIHRLLKERTNANGRVGATAAVYS  65

Query  343  AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH  522
            AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH
Sbjct  66   AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH  125

Query  523  KSLINKSSKE  552
            KSLINKSSKE
Sbjct  126  KSLINKSSKE  135



>ref|XP_009804709.1| PREDICTED: probable histone H2A variant 3 [Nicotiana sylvestris]
Length=133

 Score =   221 bits (563),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 123/130 (95%), Positives = 123/130 (95%), Gaps = 5/130 (4%)
 Frame = +1

Query  163  LIMGKTSVAAANkdkdkdkkkPTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYS  342
            LI GKTS   ANKDKDK K  PTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYS
Sbjct  9    LITGKTS---ANKDKDKKK--PTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYS  63

Query  343  AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH  522
            AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH
Sbjct  64   AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH  123

Query  523  KSLINKSSKE  552
            KSLINKSSKE
Sbjct  124  KSLINKSSKE  133



>emb|CDP03397.1| unnamed protein product [Coffea canephora]
Length=140

 Score =   221 bits (562),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 124/132 (94%), Positives = 127/132 (96%), Gaps = 2/132 (2%)
 Frame = +1

Query  163  LIMGKTSVA--AANkdkdkdkkkPTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAV  336
            LI GK S A  AANKDKDKDKKKPTSRSSRAGLQFPVGRIHRLLK+RTTA+GRVGATAAV
Sbjct  9    LITGKNSSASAAANKDKDKDKKKPTSRSSRAGLQFPVGRIHRLLKQRTTAHGRVGATAAV  68

Query  337  YSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPH  516
            YSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPH
Sbjct  69   YSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPH  128

Query  517  IHKSLINKSSKE  552
            IHKSLINKSSK+
Sbjct  129  IHKSLINKSSKD  140



>ref|XP_007013328.1| Histone H2A protein 9 [Theobroma cacao]
 gb|EOY30947.1| Histone H2A protein 9 [Theobroma cacao]
Length=135

 Score =   218 bits (556),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 122/130 (94%), Positives = 124/130 (95%), Gaps = 3/130 (2%)
 Frame = +1

Query  163  LIMGKTSVAAANkdkdkdkkkPTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYS  342
            LIMGKTS AAANKDKDK K  P SRSSRAGLQFPVGRIHRLLK RTTA+GRVGATAAVYS
Sbjct  9    LIMGKTS-AAANKDKDKKK--PISRSSRAGLQFPVGRIHRLLKSRTTAHGRVGATAAVYS  65

Query  343  AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH  522
            AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH
Sbjct  66   AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH  125

Query  523  KSLINKSSKE  552
            KSLINKSSK+
Sbjct  126  KSLINKSSKD  135



>ref|NP_001235400.1| uncharacterized protein LOC100499998 [Glycine max]
 gb|ACU14550.1| unknown [Glycine max]
 gb|KHN46009.1| Putative histone H2A variant 3 [Glycine soja]
Length=134

 Score =   217 bits (553),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 122/130 (94%), Positives = 122/130 (94%), Gaps = 4/130 (3%)
 Frame = +1

Query  163  LIMGKTSVAAANkdkdkdkkkPTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYS  342
            LI GKTS  AANKDKDK K  P SRSSRAGLQFPVGRIHRLLK RTTANGRVGATAAVYS
Sbjct  9    LITGKTS--AANKDKDKKK--PISRSSRAGLQFPVGRIHRLLKSRTTANGRVGATAAVYS  64

Query  343  AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH  522
            AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH
Sbjct  65   AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH  124

Query  523  KSLINKSSKE  552
            KSLINKSSKE
Sbjct  125  KSLINKSSKE  134



>ref|XP_004287377.1| PREDICTED: probable histone H2A variant 3 [Fragaria vesca subsp. 
vesca]
Length=134

 Score =   217 bits (552),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 107/109 (98%), Positives = 109/109 (100%), Gaps = 0/109 (0%)
 Frame = +1

Query  226  PTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKD  405
            PTSRSSRAGLQFPVGRIHRLLK+RTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKD
Sbjct  26   PTSRSSRAGLQFPVGRIHRLLKQRTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKD  85

Query  406  LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKS+KE
Sbjct  86   LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSTKE  134



>ref|XP_007202745.1| hypothetical protein PRUPE_ppa013206mg [Prunus persica]
 ref|XP_008242708.1| PREDICTED: probable histone H2A variant 3 [Prunus mume]
 gb|EMJ03944.1| hypothetical protein PRUPE_ppa013206mg [Prunus persica]
Length=135

 Score =   216 bits (551),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 120/130 (92%), Positives = 125/130 (96%), Gaps = 3/130 (2%)
 Frame = +1

Query  163  LIMGKTSVAAANkdkdkdkkkPTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYS  342
            LIMGK+   A+N +KDKDKKKP SRSSRAGLQFPVGRIHRLLK+RTTANGRVGATAAVYS
Sbjct  9    LIMGKS---ASNSNKDKDKKKPISRSSRAGLQFPVGRIHRLLKQRTTANGRVGATAAVYS  65

Query  343  AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH  522
            AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH
Sbjct  66   AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH  125

Query  523  KSLINKSSKE  552
            KSLINKS+KE
Sbjct  126  KSLINKSTKE  135



>ref|XP_008385940.1| PREDICTED: probable histone H2A variant 3 [Malus domestica]
 ref|XP_009347465.1| PREDICTED: probable histone H2A variant 3 [Pyrus x bretschneideri]
 ref|XP_009348197.1| PREDICTED: probable histone H2A variant 3 [Pyrus x bretschneideri]
Length=136

 Score =   216 bits (550),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 120/130 (92%), Positives = 122/130 (94%), Gaps = 2/130 (2%)
 Frame = +1

Query  163  LIMGKTSVAAANkdkdkdkkkPTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYS  342
            LIMGKT  A  +  KDKDKKKP SRSSRAGLQFPVGRIHRLLK RTTANGRVGATAAVYS
Sbjct  9    LIMGKT--ATNSGGKDKDKKKPISRSSRAGLQFPVGRIHRLLKLRTTANGRVGATAAVYS  66

Query  343  AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH  522
            AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH
Sbjct  67   AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH  126

Query  523  KSLINKSSKE  552
            KSLINKS+KE
Sbjct  127  KSLINKSTKE  136



>gb|AFK36004.1| unknown [Lotus japonicus]
Length=133

 Score =   215 bits (548),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 117/122 (96%), Positives = 119/122 (98%), Gaps = 0/122 (0%)
 Frame = +1

Query  187  AAANkdkdkdkkkPTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLT  366
            +A NK KDKDKKKPTSRSSRAGLQFPVGRIHRLLK RTTA+GRVGATAAVYSAAILEYLT
Sbjct  12   SANNKGKDKDKKKPTSRSSRAGLQFPVGRIHRLLKSRTTAHGRVGATAAVYSAAILEYLT  71

Query  367  AEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSS  546
            AEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSS
Sbjct  72   AEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSS  131

Query  547  KE  552
            KE
Sbjct  132  KE  133



>ref|NP_001237008.1| uncharacterized protein LOC100306322 [Glycine max]
 gb|ACU14444.1| unknown [Glycine max]
 gb|KHN07104.1| Putative histone H2A variant 3 [Glycine soja]
Length=136

 Score =   215 bits (548),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 118/130 (91%), Positives = 121/130 (93%), Gaps = 2/130 (2%)
 Frame = +1

Query  163  LIMGKTSVAAANkdkdkdkkkPTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYS  342
            LI GKTS +A +KDKDK K  P SRSSRAGLQFPVGRIHRLLK R +ANGRVGATAAVYS
Sbjct  9    LITGKTSASAKDKDKDKKK--PVSRSSRAGLQFPVGRIHRLLKSRVSANGRVGATAAVYS  66

Query  343  AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH  522
            AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH
Sbjct  67   AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH  126

Query  523  KSLINKSSKE  552
            KSLINKSSKE
Sbjct  127  KSLINKSSKE  136



>ref|NP_001237291.1| uncharacterized protein LOC100500133 [Glycine max]
 gb|ACU15054.1| unknown [Glycine max]
 gb|KHN13762.1| Putative histone H2A variant 3 [Glycine soja]
Length=135

 Score =   215 bits (548),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 115/130 (88%), Positives = 115/130 (88%), Gaps = 3/130 (2%)
 Frame = +1

Query  163  LIMGKTSVAAANkdkdkdkkkPTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYS  342
            LI GKTS A       K    P SRSSRAGLQFPVGRIHRLLK RTTANGRVGATAAVYS
Sbjct  9    LITGKTSAANNKDKDKKK---PISRSSRAGLQFPVGRIHRLLKSRTTANGRVGATAAVYS  65

Query  343  AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH  522
            AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH
Sbjct  66   AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH  125

Query  523  KSLINKSSKE  552
            KSLINKSSKE
Sbjct  126  KSLINKSSKE  135



>gb|KHG11664.1| hypothetical protein F383_10131 [Gossypium arboreum]
Length=134

 Score =   215 bits (548),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 116/130 (89%), Positives = 119/130 (92%), Gaps = 4/130 (3%)
 Frame = +1

Query  163  LIMGKTSVAAANkdkdkdkkkPTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYS  342
            LIMGK S +  +KDK K    P SRSSRAGLQFPVGRIHRLLK RTTA+GRVGATAAVYS
Sbjct  9    LIMGKNSASNKDKDKKK----PISRSSRAGLQFPVGRIHRLLKLRTTAHGRVGATAAVYS  64

Query  343  AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH  522
            AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH
Sbjct  65   AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH  124

Query  523  KSLINKSSKE  552
            KSLINKSSKE
Sbjct  125  KSLINKSSKE  134



>ref|XP_002529367.1| histone h2a, putative [Ricinus communis]
 gb|EEF33034.1| histone h2a, putative [Ricinus communis]
Length=134

 Score =   215 bits (548),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 121/130 (93%), Positives = 122/130 (94%), Gaps = 4/130 (3%)
 Frame = +1

Query  163  LIMGKTSVAAANkdkdkdkkkPTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYS  342
            LI GKTS  AANKDKDK K  P SRSSRAGLQFPVGRIHRLLK RTTA+GRVGATAAVYS
Sbjct  9    LITGKTS--AANKDKDKKK--PISRSSRAGLQFPVGRIHRLLKSRTTAHGRVGATAAVYS  64

Query  343  AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH  522
            AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH
Sbjct  65   AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH  124

Query  523  KSLINKSSKE  552
            KSLINKSSKE
Sbjct  125  KSLINKSSKE  134



>gb|KJB83165.1| hypothetical protein B456_013G232500 [Gossypium raimondii]
Length=134

 Score =   214 bits (545),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 115/130 (88%), Positives = 119/130 (92%), Gaps = 4/130 (3%)
 Frame = +1

Query  163  LIMGKTSVAAANkdkdkdkkkPTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYS  342
            LIMGK S +  +KDK K    P SRSSRAGLQFPVGRIHRLLK RTTA+GRVGATAAVYS
Sbjct  9    LIMGKNSASNKDKDKKK----PISRSSRAGLQFPVGRIHRLLKLRTTAHGRVGATAAVYS  64

Query  343  AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH  522
            AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH
Sbjct  65   AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH  124

Query  523  KSLINKSSKE  552
            KSLINK+SKE
Sbjct  125  KSLINKTSKE  134



>ref|XP_007138323.1| hypothetical protein PHAVU_009G199100g [Phaseolus vulgaris]
 gb|ESW10317.1| hypothetical protein PHAVU_009G199100g [Phaseolus vulgaris]
Length=134

 Score =   214 bits (545),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 107/109 (98%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  226  PTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKD  405
            P SRSSRAGLQFPVGRIHRLLK RTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKD
Sbjct  26   PISRSSRAGLQFPVGRIHRLLKSRTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKD  85

Query  406  LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE
Sbjct  86   LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  134



>ref|XP_002285266.1| PREDICTED: probable histone H2A variant 3 [Vitis vinifera]
 emb|CAN64650.1| hypothetical protein VITISV_002812 [Vitis vinifera]
 emb|CBI36242.3| unnamed protein product [Vitis vinifera]
Length=136

 Score =   214 bits (545),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 116/130 (89%), Positives = 120/130 (92%), Gaps = 2/130 (2%)
 Frame = +1

Query  163  LIMGKTSVAAANkdkdkdkkkPTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYS  342
            LIMGK+S    NKDKDK K  P SRSSRAGLQFPVGR+HRLLK R +ANGRVGATAAVY+
Sbjct  9    LIMGKSSTLNGNKDKDKKK--PISRSSRAGLQFPVGRVHRLLKTRVSANGRVGATAAVYT  66

Query  343  AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH  522
            AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH
Sbjct  67   AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH  126

Query  523  KSLINKSSKE  552
            KSLINKSSKE
Sbjct  127  KSLINKSSKE  136



>ref|XP_006475775.1| PREDICTED: probable histone H2A variant 3-like [Citrus sinensis]
Length=134

 Score =   214 bits (545),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 114/130 (88%), Positives = 119/130 (92%), Gaps = 4/130 (3%)
 Frame = +1

Query  163  LIMGKTSVAAANkdkdkdkkkPTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYS  342
            LIMGK S +  +KDK K    P SRSSRAGLQFPVGRIHRLLK RTTA+GRVGATAAVYS
Sbjct  9    LIMGKASASNKDKDKKK----PISRSSRAGLQFPVGRIHRLLKSRTTAHGRVGATAAVYS  64

Query  343  AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH  522
            AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH
Sbjct  65   AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH  124

Query  523  KSLINKSSKE  552
            KSLINKS+K+
Sbjct  125  KSLINKSTKD  134



>gb|EYU21942.1| hypothetical protein MIMGU_mgv1a016058mg [Erythranthe guttata]
Length=136

 Score =   214 bits (545),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 107/109 (98%), Positives = 108/109 (99%), Gaps = 0/109 (0%)
 Frame = +1

Query  226  PTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKD  405
            PTSRSSRAGLQFPVGRIHRLLKER TA+GRVGATAAVYSAAILEYLTAEVLELAGNASKD
Sbjct  28   PTSRSSRAGLQFPVGRIHRLLKERATAHGRVGATAAVYSAAILEYLTAEVLELAGNASKD  87

Query  406  LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE
Sbjct  88   LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  136



>ref|XP_010102813.1| putative histone H2A variant 3 [Morus notabilis]
 gb|EXB94141.1| putative histone H2A variant 3 [Morus notabilis]
Length=138

 Score =   214 bits (544),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 119/130 (92%), Positives = 121/130 (93%), Gaps = 0/130 (0%)
 Frame = +1

Query  163  LIMGKTSVAAANkdkdkdkkkPTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYS  342
            LI GK+     +KDKDKDKKKP SRSSRAGLQFPVGRIHRLLK R TANGRVGATAAVYS
Sbjct  9    LITGKSPALGKDKDKDKDKKKPVSRSSRAGLQFPVGRIHRLLKSRVTANGRVGATAAVYS  68

Query  343  AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH  522
            AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH
Sbjct  69   AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH  128

Query  523  KSLINKSSKE  552
            KSLINKSSKE
Sbjct  129  KSLINKSSKE  138



>ref|XP_002324843.1| hypothetical protein POPTR_0018s01310g [Populus trichocarpa]
 ref|XP_011019753.1| PREDICTED: probable histone H2A variant 3 [Populus euphratica]
 ref|XP_011019754.1| PREDICTED: probable histone H2A variant 3 [Populus euphratica]
 ref|XP_011026503.1| PREDICTED: probable histone H2A variant 3 [Populus euphratica]
 ref|XP_011015109.1| PREDICTED: probable histone H2A variant 3 [Populus euphratica]
 gb|EEF03408.1| hypothetical protein POPTR_0018s01310g [Populus trichocarpa]
Length=134

 Score =   213 bits (542),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 106/109 (97%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  226  PTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKD  405
            PTSRSSRAGLQFPVGRIHRLLK R TA+GRVGATAAVYSAAILEYLTAEVLELAGNASKD
Sbjct  26   PTSRSSRAGLQFPVGRIHRLLKSRATAHGRVGATAAVYSAAILEYLTAEVLELAGNASKD  85

Query  406  LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE
Sbjct  86   LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  134



>ref|XP_006371730.1| histone H2A family protein [Populus trichocarpa]
 gb|ERP49527.1| histone H2A family protein [Populus trichocarpa]
Length=134

 Score =   213 bits (542),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 106/109 (97%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  226  PTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKD  405
            PTSRSSRAGLQFPVGRIHRLLK R TA+GRVGATAAVYSAAILEYLTAEVLELAGNASKD
Sbjct  26   PTSRSSRAGLQFPVGRIHRLLKSRATAHGRVGATAAVYSAAILEYLTAEVLELAGNASKD  85

Query  406  LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE
Sbjct  86   LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  134



>ref|XP_011026504.1| PREDICTED: probable histone H2A variant 3 [Populus euphratica]
Length=134

 Score =   213 bits (542),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 106/109 (97%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  226  PTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKD  405
            PTSRSSRAGLQFPVGRIHRLLK R TA+GRVGATAAVYSAAILEYLTAEVLELAGNASKD
Sbjct  26   PTSRSSRAGLQFPVGRIHRLLKSRATAHGRVGATAAVYSAAILEYLTAEVLELAGNASKD  85

Query  406  LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE
Sbjct  86   LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  134



>ref|XP_001777344.1| histone H2A variant [Physcomitrella patens]
 gb|EDQ57874.1| histone H2A variant [Physcomitrella patens]
Length=143

 Score =   213 bits (543),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 115/130 (88%), Positives = 120/130 (92%), Gaps = 0/130 (0%)
 Frame = +1

Query  163  LIMGKTSVAAANkdkdkdkkkPTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYS  342
            L+MGK + +A   DK KDKKKPTSRSSRAGLQFPVGRIHRLLK R  ANGRVGATAAVYS
Sbjct  13   LLMGKAAASAVVDDKSKDKKKPTSRSSRAGLQFPVGRIHRLLKSRVAANGRVGATAAVYS  72

Query  343  AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH  522
            AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH
Sbjct  73   AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH  132

Query  523  KSLINKSSKE  552
            KSLINK+ K+
Sbjct  133  KSLINKTPKK  142



>ref|XP_002284738.1| PREDICTED: probable histone H2A variant 3 [Vitis vinifera]
 emb|CBI20969.3| unnamed protein product [Vitis vinifera]
Length=134

 Score =   213 bits (542),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 114/130 (88%), Positives = 117/130 (90%), Gaps = 4/130 (3%)
 Frame = +1

Query  163  LIMGKTSVAAANkdkdkdkkkPTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYS  342
            LIMGK+     +KDK K    P SRSSRAGLQFPVGRIHRLLK R TANGRVGATAAVYS
Sbjct  9    LIMGKSPALNKDKDKKK----PVSRSSRAGLQFPVGRIHRLLKSRVTANGRVGATAAVYS  64

Query  343  AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH  522
            AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH
Sbjct  65   AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH  124

Query  523  KSLINKSSKE  552
            KSLINKSSK+
Sbjct  125  KSLINKSSKD  134



>gb|KDP32348.1| hypothetical protein JCGZ_13273 [Jatropha curcas]
Length=137

 Score =   213 bits (542),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 121/130 (93%), Positives = 123/130 (95%), Gaps = 1/130 (1%)
 Frame = +1

Query  163  LIMGKTSVAAANkdkdkdkkkPTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYS  342
            LI G TS A  +KDKDKDKKKP SRSSRAGLQFPVGRIHRLLK RTTA+GRVGATAAVYS
Sbjct  9    LITG-TSAATRSKDKDKDKKKPISRSSRAGLQFPVGRIHRLLKSRTTAHGRVGATAAVYS  67

Query  343  AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH  522
            AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH
Sbjct  68   AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH  127

Query  523  KSLINKSSKE  552
            KSLINKSSKE
Sbjct  128  KSLINKSSKE  137



>ref|XP_004508547.1| PREDICTED: probable histone H2A variant 3-like [Cicer arietinum]
Length=131

 Score =   213 bits (541),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 118/127 (93%), Positives = 120/127 (94%), Gaps = 0/127 (0%)
 Frame = +1

Query  172  GKTSVAAANkdkdkdkkkPTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAI  351
            G   +  ANKDKDKDKKKP SRSSRAGLQFPVGRIHRLLK RTTA+GRVGATAAVYSAAI
Sbjct  5    GAKGLITANKDKDKDKKKPISRSSRAGLQFPVGRIHRLLKSRTTAHGRVGATAAVYSAAI  64

Query  352  LEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSL  531
            LEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSL
Sbjct  65   LEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSL  124

Query  532  INKSSKE  552
            INKSSKE
Sbjct  125  INKSSKE  131



>ref|XP_007223796.1| hypothetical protein PRUPE_ppa013175mg [Prunus persica]
 ref|XP_008219889.1| PREDICTED: histone H2A variant 1-like [Prunus mume]
 gb|EMJ24995.1| hypothetical protein PRUPE_ppa013175mg [Prunus persica]
Length=136

 Score =   213 bits (541),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 119/130 (92%), Positives = 123/130 (95%), Gaps = 2/130 (2%)
 Frame = +1

Query  163  LIMGKTSVAAANkdkdkdkkkPTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYS  342
            LIMGK+   A NKDKDKDKKKP SRSSRAGLQFPVGRIHRLLK R +ANGRVGATAAVYS
Sbjct  9    LIMGKSP--AINKDKDKDKKKPISRSSRAGLQFPVGRIHRLLKSRVSANGRVGATAAVYS  66

Query  343  AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH  522
            AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH
Sbjct  67   AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH  126

Query  523  KSLINKSSKE  552
            KSLINKS+K+
Sbjct  127  KSLINKSTKD  136



>ref|XP_002309600.1| histone H2A family protein [Populus trichocarpa]
 ref|XP_002309601.1| histone H2A family protein [Populus trichocarpa]
 gb|ABK96206.1| unknown [Populus trichocarpa]
 gb|EEE93123.1| histone H2A family protein [Populus trichocarpa]
 gb|EEE93124.1| histone H2A family protein [Populus trichocarpa]
Length=134

 Score =   213 bits (541),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 106/109 (97%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  226  PTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKD  405
            PTSRSSRAGLQFPVGRIHRLLK R TA+GRVGATAAVYSAAILEYLTAEVLELAGNASKD
Sbjct  26   PTSRSSRAGLQFPVGRIHRLLKTRATAHGRVGATAAVYSAAILEYLTAEVLELAGNASKD  85

Query  406  LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE
Sbjct  86   LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  134



>ref|XP_006451012.1| hypothetical protein CICLE_v10010700mg, partial [Citrus clementina]
 gb|ESR64252.1| hypothetical protein CICLE_v10010700mg, partial [Citrus clementina]
Length=193

 Score =   214 bits (546),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 114/130 (88%), Positives = 119/130 (92%), Gaps = 4/130 (3%)
 Frame = +1

Query  163  LIMGKTSVAAANkdkdkdkkkPTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYS  342
            LIMGK S +  +KDK K    P SRSSRAGLQFPVGRIHRLLK RTTA+GRVGATAAVYS
Sbjct  68   LIMGKASASNKDKDKKK----PISRSSRAGLQFPVGRIHRLLKSRTTAHGRVGATAAVYS  123

Query  343  AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH  522
            AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH
Sbjct  124  AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH  183

Query  523  KSLINKSSKE  552
            KSLINKS+K+
Sbjct  184  KSLINKSTKD  193



>gb|AFK48552.1| unknown [Medicago truncatula]
 gb|AES58960.2| core histone H2A/H2B/H3/H4 [Medicago truncatula]
 gb|AES58966.2| core histone H2A/H2B/H3/H4 [Medicago truncatula]
Length=134

 Score =   213 bits (541),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 106/109 (97%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  226  PTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKD  405
            PTSRSSRAGLQFPVGRIHRLLK RT A+GRVGATAAVYSAAILEYLTAEVLELAGNASKD
Sbjct  26   PTSRSSRAGLQFPVGRIHRLLKSRTMAHGRVGATAAVYSAAILEYLTAEVLELAGNASKD  85

Query  406  LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE
Sbjct  86   LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  134



>ref|XP_010249965.1| PREDICTED: probable histone H2A variant 3 [Nelumbo nucifera]
Length=136

 Score =   213 bits (541),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 117/130 (90%), Positives = 120/130 (92%), Gaps = 2/130 (2%)
 Frame = +1

Query  163  LIMGKTSVAAANkdkdkdkkkPTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYS  342
            LI GK+S  A N +KDKDKKKP SRSSRAGLQFPVGRIHRLLK R  ANGRVGATAAVY 
Sbjct  9    LITGKSS--AMNANKDKDKKKPVSRSSRAGLQFPVGRIHRLLKSRIAANGRVGATAAVYC  66

Query  343  AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH  522
            AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH
Sbjct  67   AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH  126

Query  523  KSLINKSSKE  552
            KSLINKSSK+
Sbjct  127  KSLINKSSKD  136



>gb|KDO80364.1| hypothetical protein CISIN_1g046088mg, partial [Citrus sinensis]
Length=193

 Score =   214 bits (546),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 114/130 (88%), Positives = 119/130 (92%), Gaps = 4/130 (3%)
 Frame = +1

Query  163  LIMGKTSVAAANkdkdkdkkkPTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYS  342
            LIMGK S +  +KDK K    P SRSSRAGLQFPVGRIHRLLK RTTA+GRVGATAAVYS
Sbjct  68   LIMGKASASNKDKDKKK----PISRSSRAGLQFPVGRIHRLLKSRTTAHGRVGATAAVYS  123

Query  343  AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH  522
            AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH
Sbjct  124  AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH  183

Query  523  KSLINKSSKE  552
            KSLINKS+K+
Sbjct  184  KSLINKSTKD  193



>ref|XP_008352047.1| PREDICTED: probable histone H2A variant 3 [Malus domestica]
 ref|XP_009334787.1| PREDICTED: probable histone H2A variant 3 [Pyrus x bretschneideri]
Length=137

 Score =   213 bits (541),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 120/130 (92%), Positives = 122/130 (94%), Gaps = 1/130 (1%)
 Frame = +1

Query  163  LIMGKTSVAAANkdkdkdkkkPTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYS  342
            LIMGK   AA NKDKDKDKKKP SRSSRAGLQFPVGRIHRLLK R  ANGRVGATAAVYS
Sbjct  9    LIMGKGP-AAINKDKDKDKKKPISRSSRAGLQFPVGRIHRLLKTRVQANGRVGATAAVYS  67

Query  343  AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH  522
            AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH
Sbjct  68   AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH  127

Query  523  KSLINKSSKE  552
            KSLINKS+K+
Sbjct  128  KSLINKSTKD  137



>ref|XP_004498649.1| PREDICTED: probable histone H2A variant 3-like [Cicer arietinum]
Length=134

 Score =   212 bits (540),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 106/109 (97%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  226  PTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKD  405
            PTSRSSRAGLQFPVGRIHRLLK RT A+GRVGATAAVYSAAILEYLTAEVLELAGNASKD
Sbjct  26   PTSRSSRAGLQFPVGRIHRLLKSRTMAHGRVGATAAVYSAAILEYLTAEVLELAGNASKD  85

Query  406  LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE
Sbjct  86   LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  134



>gb|AFK43217.1| unknown [Lotus japonicus]
Length=137

 Score =   212 bits (540),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 105/109 (96%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  226  PTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKD  405
            PTSRSSRAGLQFPVGRIHRLLK R +ANGRVGATAAVY+AAILEYLTAEVLELAGNASKD
Sbjct  29   PTSRSSRAGLQFPVGRIHRLLKTRVSANGRVGATAAVYTAAILEYLTAEVLELAGNASKD  88

Query  406  LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE
Sbjct  89   LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  137



>ref|XP_011086217.1| PREDICTED: probable histone H2A variant 3 [Sesamum indicum]
 ref|XP_011081915.1| PREDICTED: probable histone H2A variant 3 [Sesamum indicum]
Length=135

 Score =   212 bits (539),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 106/109 (97%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  226  PTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKD  405
            P SRSSRAGLQFPVGRIHRLLKER TA+GRVGATAAVYSAAILEYLTAEVLELAGNASKD
Sbjct  27   PISRSSRAGLQFPVGRIHRLLKERVTAHGRVGATAAVYSAAILEYLTAEVLELAGNASKD  86

Query  406  LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE
Sbjct  87   LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  135



>ref|XP_010254303.1| PREDICTED: probable histone H2A variant 3 [Nelumbo nucifera]
Length=136

 Score =   211 bits (538),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 115/130 (88%), Positives = 117/130 (90%), Gaps = 2/130 (2%)
 Frame = +1

Query  163  LIMGKTSVAAANkdkdkdkkkPTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYS  342
             I GK+S    NKDKDK K  P SRSSRAGLQFPVGRIHRLLK R TANGRVGATAAVY 
Sbjct  9    FITGKSSALGENKDKDKKK--PVSRSSRAGLQFPVGRIHRLLKSRITANGRVGATAAVYC  66

Query  343  AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH  522
            AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH
Sbjct  67   AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH  126

Query  523  KSLINKSSKE  552
            KSLINKSSK+
Sbjct  127  KSLINKSSKD  136



>ref|XP_010533391.1| PREDICTED: probable histone H2A variant 3 [Tarenaya hassleriana]
 ref|XP_010519385.1| PREDICTED: probable histone H2A variant 3 [Tarenaya hassleriana]
Length=136

 Score =   211 bits (538),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 118/130 (91%), Positives = 123/130 (95%), Gaps = 2/130 (2%)
 Frame = +1

Query  163  LIMGKTSVAAANkdkdkdkkkPTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYS  342
            LIMGK+   A +KDKDKDKKKP SRSSRAGLQFPVGR+HRLLK R +ANGRVGATAAVY+
Sbjct  9    LIMGKSP--AGSKDKDKDKKKPISRSSRAGLQFPVGRVHRLLKTRVSANGRVGATAAVYT  66

Query  343  AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH  522
            AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH
Sbjct  67   AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH  126

Query  523  KSLINKSSKE  552
            KSLINKSSKE
Sbjct  127  KSLINKSSKE  136



>ref|XP_003559820.1| PREDICTED: probable histone H2A variant 3 [Brachypodium distachyon]
Length=137

 Score =   211 bits (538),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 105/109 (96%), Positives = 106/109 (97%), Gaps = 0/109 (0%)
 Frame = +1

Query  226  PTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKD  405
            P SRSSRAGLQFPVGRIHR LK+RT ANGRVGATAAVYSAAILEYLTAEVLELAGNASKD
Sbjct  29   PVSRSSRAGLQFPVGRIHRQLKQRTQANGRVGATAAVYSAAILEYLTAEVLELAGNASKD  88

Query  406  LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE
Sbjct  89   LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  137



>ref|NP_001051232.1| Os03g0743400 [Oryza sativa Japonica Group]
 ref|XP_004981815.1| PREDICTED: probable histone H2A variant 3-like [Setaria italica]
 ref|XP_006650568.1| PREDICTED: probable histone H2A variant 3-like [Oryza brachyantha]
 sp|Q84MP7.1|H2AV3_ORYSJ RecName: Full=Probable histone H2A variant 3 [Oryza sativa Japonica 
Group]
 gb|AAP12995.1| putative histone H2 protein [Oryza sativa Japonica Group]
 gb|AAR87284.1| putative histone H2A protein [Oryza sativa Japonica Group]
 gb|ABF98814.1| Histone H2A.Z, putative, expressed [Oryza sativa Japonica Group]
 gb|ABF98815.1| Histone H2A.Z, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF13146.1| Os03g0743400 [Oryza sativa Japonica Group]
 dbj|BAG99958.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE59908.1| hypothetical protein OsJ_12526 [Oryza sativa Japonica Group]
 gb|AFC88827.1| histone H2-like protein [Miscanthus sinensis]
Length=137

 Score =   211 bits (538),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 105/109 (96%), Positives = 106/109 (97%), Gaps = 0/109 (0%)
 Frame = +1

Query  226  PTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKD  405
            P SRSSRAGLQFPVGRIHR LK+RT ANGRVGATAAVYSAAILEYLTAEVLELAGNASKD
Sbjct  29   PVSRSSRAGLQFPVGRIHRQLKQRTQANGRVGATAAVYSAAILEYLTAEVLELAGNASKD  88

Query  406  LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE
Sbjct  89   LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  137



>gb|ABK22002.1| unknown [Picea sitchensis]
Length=145

 Score =   211 bits (537),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 117/131 (89%), Positives = 121/131 (92%), Gaps = 1/131 (1%)
 Frame = +1

Query  163  LIMGKTSV-AAANkdkdkdkkkPTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVY  339
            L+MGK+S     N  KDKDKKKP SRSSRAGLQFPVGRIHRLLK R +ANGRVGATAAVY
Sbjct  15   LLMGKSSAPVNNNNSKDKDKKKPVSRSSRAGLQFPVGRIHRLLKSRISANGRVGATAAVY  74

Query  340  SAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHI  519
            SAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHI
Sbjct  75   SAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHI  134

Query  520  HKSLINKSSKE  552
            HKSLINKSSK+
Sbjct  135  HKSLINKSSKD  145



>ref|NP_001237054.1| uncharacterized protein LOC100500629 [Glycine max]
 ref|XP_006595521.1| PREDICTED: uncharacterized protein LOC100500629 isoform X1 [Glycine 
max]
 gb|ACU15754.1| unknown [Glycine max]
 gb|KHN32492.1| Putative histone H2A variant 3 [Glycine soja]
Length=128

 Score =   211 bits (536),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 105/109 (96%), Positives = 106/109 (97%), Gaps = 0/109 (0%)
 Frame = +1

Query  226  PTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKD  405
            P SRSSRAGLQFPVGRIHRLLK R TA+GRVGATAAVYSAAILEYLTAEVLELAGNASKD
Sbjct  20   PISRSSRAGLQFPVGRIHRLLKSRVTAHGRVGATAAVYSAAILEYLTAEVLELAGNASKD  79

Query  406  LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE
Sbjct  80   LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  128



>ref|NP_001136523.1| uncharacterized protein LOC100216638 [Zea mays]
 ref|NP_001136445.1| uncharacterized protein LOC100216551 [Zea mays]
 gb|ACF81448.1| unknown [Zea mays]
 gb|ACF82098.1| unknown [Zea mays]
 gb|ACG31394.1| histone H2A variant 3 [Zea mays]
 gb|ACN26481.1| unknown [Zea mays]
 gb|AFW67660.1| histone H2A isoform 1 [Zea mays]
 gb|AFW67661.1| histone H2A isoform 2 [Zea mays]
 tpg|DAA51279.1| TPA: histone H2A isoform 1 [Zea mays]
 tpg|DAA51280.1| TPA: histone H2A isoform 2 [Zea mays]
Length=137

 Score =   211 bits (536),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 105/109 (96%), Positives = 106/109 (97%), Gaps = 0/109 (0%)
 Frame = +1

Query  226  PTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKD  405
            P SRSSRAGLQFPVGRIHR LK+RT ANGRVGATAAVYSAAILEYLTAEVLELAGNASKD
Sbjct  29   PISRSSRAGLQFPVGRIHRQLKQRTQANGRVGATAAVYSAAILEYLTAEVLELAGNASKD  88

Query  406  LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE
Sbjct  89   LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  137



>gb|EPS64047.1| hypothetical protein M569_10734 [Genlisea aurea]
Length=137

 Score =   211 bits (536),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 105/109 (96%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  226  PTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKD  405
            P SRS+RAGLQFPVGRIHRLLKER TA+GRVGATAAVYSAAILEYLTAEVLELAGNASKD
Sbjct  29   PISRSARAGLQFPVGRIHRLLKERATAHGRVGATAAVYSAAILEYLTAEVLELAGNASKD  88

Query  406  LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE
Sbjct  89   LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  137



>ref|XP_001761113.1| histone H2A variant [Physcomitrella patens]
 gb|EDQ74180.1| histone H2A variant [Physcomitrella patens]
Length=145

 Score =   211 bits (536),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 117/130 (90%), Positives = 121/130 (93%), Gaps = 0/130 (0%)
 Frame = +1

Query  163  LIMGKTSVAAANkdkdkdkkkPTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYS  342
            L+MGK + AA   DK KDKKKPTSRSSRAGLQFPVGRIHRLLK R  ANGRVGATAAVYS
Sbjct  15   LLMGKAAAAAVVDDKLKDKKKPTSRSSRAGLQFPVGRIHRLLKSRVAANGRVGATAAVYS  74

Query  343  AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH  522
            AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH
Sbjct  75   AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH  134

Query  523  KSLINKSSKE  552
            KSLINK+SK+
Sbjct  135  KSLINKTSKK  144



>ref|XP_006427173.1| hypothetical protein CICLE_v10026746mg [Citrus clementina]
 ref|XP_006465399.1| PREDICTED: probable histone H2A variant 3-like [Citrus sinensis]
 gb|ESR40413.1| hypothetical protein CICLE_v10026746mg [Citrus clementina]
 gb|KDO52918.1| hypothetical protein CISIN_1g032701mg [Citrus sinensis]
Length=135

 Score =   210 bits (535),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 109/130 (84%), Positives = 114/130 (88%), Gaps = 3/130 (2%)
 Frame = +1

Query  163  LIMGKTSVAAANkdkdkdkkkPTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYS  342
            LI GKT++        K    P SRSSRAGLQFPVGR+HRLLKER  A+GRVGATAAVY+
Sbjct  9    LITGKTTINNNKDKDKKK---PVSRSSRAGLQFPVGRVHRLLKERAAAHGRVGATAAVYT  65

Query  343  AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH  522
            AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH
Sbjct  66   AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH  125

Query  523  KSLINKSSKE  552
            KSLINKSSKE
Sbjct  126  KSLINKSSKE  135



>ref|XP_010691223.1| PREDICTED: probable histone H2A variant 3 [Beta vulgaris subsp. 
vulgaris]
Length=134

 Score =   210 bits (535),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 103/109 (94%), Positives = 106/109 (97%), Gaps = 0/109 (0%)
 Frame = +1

Query  226  PTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKD  405
            P SRSSRAGLQFPVGR+HRLLK R TANGRVGATAAVY+AAILEYLTAEVLELAGNASKD
Sbjct  26   PVSRSSRAGLQFPVGRVHRLLKTRVTANGRVGATAAVYTAAILEYLTAEVLELAGNASKD  85

Query  406  LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSK+
Sbjct  86   LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKD  134



>ref|XP_010033915.1| PREDICTED: probable histone H2A variant 3 [Eucalyptus grandis]
 gb|KCW53786.1| hypothetical protein EUGRSUZ_J03033 [Eucalyptus grandis]
Length=134

 Score =   210 bits (535),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 115/130 (88%), Positives = 119/130 (92%), Gaps = 4/130 (3%)
 Frame = +1

Query  163  LIMGKTSVAAANkdkdkdkkkPTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYS  342
            LIMGK+    A+  KDKDKKKP SRSSRAGLQFPVGR+HR LK R  ANGRVGATAAVY+
Sbjct  9    LIMGKS----ASNSKDKDKKKPVSRSSRAGLQFPVGRVHRQLKSRVAANGRVGATAAVYT  64

Query  343  AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH  522
            AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH
Sbjct  65   AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH  124

Query  523  KSLINKSSKE  552
            KSLINKSSKE
Sbjct  125  KSLINKSSKE  134



>ref|XP_002517561.1| histone h2a, putative [Ricinus communis]
 gb|EEF44725.1| histone h2a, putative [Ricinus communis]
Length=135

 Score =   210 bits (535),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 103/109 (94%), Positives = 106/109 (97%), Gaps = 0/109 (0%)
 Frame = +1

Query  226  PTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKD  405
            P SRSSRAGLQFPVGR+HRLLK R +ANGRVGATAAVY+AAILEYLTAEVLELAGNASKD
Sbjct  27   PVSRSSRAGLQFPVGRVHRLLKTRVSANGRVGATAAVYTAAILEYLTAEVLELAGNASKD  86

Query  406  LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE
Sbjct  87   LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  135



>gb|KHG18378.1| hypothetical protein F383_01388 [Gossypium arboreum]
 gb|KJB35108.1| hypothetical protein B456_006G100600 [Gossypium raimondii]
 gb|KJB35109.1| hypothetical protein B456_006G100600 [Gossypium raimondii]
Length=134

 Score =   210 bits (534),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 103/109 (94%), Positives = 106/109 (97%), Gaps = 0/109 (0%)
 Frame = +1

Query  226  PTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKD  405
            P SRSSRAGLQFPVGR+HRLLK R +ANGRVGATAAVY+AAILEYLTAEVLELAGNASKD
Sbjct  26   PVSRSSRAGLQFPVGRVHRLLKTRVSANGRVGATAAVYTAAILEYLTAEVLELAGNASKD  85

Query  406  LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE
Sbjct  86   LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  134



>gb|KDP33632.1| hypothetical protein JCGZ_07203 [Jatropha curcas]
Length=134

 Score =   210 bits (534),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 105/109 (96%), Positives = 106/109 (97%), Gaps = 0/109 (0%)
 Frame = +1

Query  226  PTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKD  405
            P SRSSRAGLQFPVGRIHRLLK R TA+GRVGATAAVYSAAILEYLTAEVLELAGNASKD
Sbjct  26   PISRSSRAGLQFPVGRIHRLLKSRVTAHGRVGATAAVYSAAILEYLTAEVLELAGNASKD  85

Query  406  LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE
Sbjct  86   LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  134



>gb|KHG04727.1| hypothetical protein F383_29095 [Gossypium arboreum]
Length=134

 Score =   210 bits (534),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 103/109 (94%), Positives = 106/109 (97%), Gaps = 0/109 (0%)
 Frame = +1

Query  226  PTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKD  405
            P SRSSRAGLQFPVGR+HRLLK R +ANGRVGATAAVY+AAILEYLTAEVLELAGNASKD
Sbjct  26   PVSRSSRAGLQFPVGRVHRLLKARVSANGRVGATAAVYTAAILEYLTAEVLELAGNASKD  85

Query  406  LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE
Sbjct  86   LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  134



>gb|KJB13095.1| hypothetical protein B456_002G056500 [Gossypium raimondii]
Length=134

 Score =   210 bits (534),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 103/109 (94%), Positives = 106/109 (97%), Gaps = 0/109 (0%)
 Frame = +1

Query  226  PTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKD  405
            P SRSSRAGLQFPVGR+HRLLK R +ANGRVGATAAVY+AAILEYLTAEVLELAGNASKD
Sbjct  26   PVSRSSRAGLQFPVGRVHRLLKTRVSANGRVGATAAVYTAAILEYLTAEVLELAGNASKD  85

Query  406  LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE
Sbjct  86   LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  134



>gb|KDP37151.1| hypothetical protein JCGZ_06207 [Jatropha curcas]
Length=134

 Score =   210 bits (534),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 103/109 (94%), Positives = 106/109 (97%), Gaps = 0/109 (0%)
 Frame = +1

Query  226  PTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKD  405
            P SRSSRAGLQFPVGR+HRLLK R +ANGRVGATAAVY+AAILEYLTAEVLELAGNASKD
Sbjct  26   PVSRSSRAGLQFPVGRVHRLLKTRVSANGRVGATAAVYTAAILEYLTAEVLELAGNASKD  85

Query  406  LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE
Sbjct  86   LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  134



>gb|KHN06662.1| Putative histone H2A variant 3 [Glycine soja]
Length=134

 Score =   210 bits (534),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 105/109 (96%), Positives = 106/109 (97%), Gaps = 0/109 (0%)
 Frame = +1

Query  226  PTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKD  405
            P SRSSRAGLQFPVGRIHRLLK R TA+GRVGATAAVYSAAILEYLTAEVLELAGNASKD
Sbjct  26   PISRSSRAGLQFPVGRIHRLLKSRVTAHGRVGATAAVYSAAILEYLTAEVLELAGNASKD  85

Query  406  LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE
Sbjct  86   LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  134



>ref|XP_001783756.1| histone 2A variant [Physcomitrella patens]
 gb|EDQ51408.1| histone 2A variant [Physcomitrella patens]
Length=128

 Score =   209 bits (532),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 104/109 (95%), Positives = 106/109 (97%), Gaps = 0/109 (0%)
 Frame = +1

Query  226  PTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKD  405
            PTSRSSRAGLQFPVGRIHRLLK R  ANGRVGATAAVYSAAILEYLTAEVLELAGNASKD
Sbjct  19   PTSRSSRAGLQFPVGRIHRLLKSRVAANGRVGATAAVYSAAILEYLTAEVLELAGNASKD  78

Query  406  LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINK+SK+
Sbjct  79   LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKTSKK  127



>ref|XP_010691224.1| PREDICTED: probable histone H2A variant 3 [Beta vulgaris subsp. 
vulgaris]
Length=134

 Score =   209 bits (532),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 113/130 (87%), Positives = 119/130 (92%), Gaps = 4/130 (3%)
 Frame = +1

Query  163  LIMGKTSVAAANkdkdkdkkkPTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYS  342
            LI GK+S      +KDKDKK P SRSSRAGLQFPVGR+HRLLK R +ANGRVGATAAVY+
Sbjct  9    LITGKSS----GMNKDKDKKAPVSRSSRAGLQFPVGRVHRLLKTRVSANGRVGATAAVYT  64

Query  343  AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH  522
            AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH
Sbjct  65   AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH  124

Query  523  KSLINKSSKE  552
            KSLINKSSK+
Sbjct  125  KSLINKSSKD  134



>ref|NP_001141633.1| uncharacterized protein LOC100273753 [Zea mays]
 ref|XP_002454131.1| hypothetical protein SORBIDRAFT_04g025140 [Sorghum bicolor]
 gb|ACF86755.1| unknown [Zea mays]
 gb|ACG24497.1| histone H2A variant 1 [Zea mays]
 gb|ACG24631.1| histone H2A variant 1 [Zea mays]
 gb|ACG34111.1| histone H2A variant 1 [Zea mays]
 gb|EES07107.1| hypothetical protein SORBIDRAFT_04g025140 [Sorghum bicolor]
 tpg|DAA43492.1| TPA: histone H2A [Zea mays]
Length=138

 Score =   209 bits (533),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 107/130 (82%), Positives = 114/130 (88%), Gaps = 0/130 (0%)
 Frame = +1

Query  163  LIMGKTSVAAANkdkdkdkkkPTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYS  342
            L+  KT+ A +       KK P SRSSRAGLQFPVGRIHR LK R +A+GRVGATAAVYS
Sbjct  9    LLAAKTTAAKSTDKDKDRKKAPVSRSSRAGLQFPVGRIHRQLKSRASAHGRVGATAAVYS  68

Query  343  AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH  522
            AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH
Sbjct  69   AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH  128

Query  523  KSLINKSSKE  552
            KSLINK++KE
Sbjct  129  KSLINKTAKE  138



>ref|XP_007023964.1| Histone H2A protein 9 [Theobroma cacao]
 gb|EOY26586.1| Histone H2A protein 9 [Theobroma cacao]
Length=134

 Score =   209 bits (532),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 103/109 (94%), Positives = 105/109 (96%), Gaps = 0/109 (0%)
 Frame = +1

Query  226  PTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKD  405
            P SRSSRAGLQFPVGR+HRLLK R  ANGRVGATAAVY+AAILEYLTAEVLELAGNASKD
Sbjct  26   PVSRSSRAGLQFPVGRVHRLLKTRVNANGRVGATAAVYTAAILEYLTAEVLELAGNASKD  85

Query  406  LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE
Sbjct  86   LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  134



>ref|XP_009405812.1| PREDICTED: histone H2A variant 1-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009405813.1| PREDICTED: histone H2A variant 1-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009405814.1| PREDICTED: histone H2A variant 1-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009405815.1| PREDICTED: histone H2A variant 1-like [Musa acuminata subsp. 
malaccensis]
Length=134

 Score =   209 bits (532),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 103/109 (94%), Positives = 106/109 (97%), Gaps = 0/109 (0%)
 Frame = +1

Query  226  PTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKD  405
            P SRSSR+GLQFPVGRIHRLLK R +ANGRVGATAAVYSAAILEYLTAEVLELAGNASKD
Sbjct  26   PVSRSSRSGLQFPVGRIHRLLKSRISANGRVGATAAVYSAAILEYLTAEVLELAGNASKD  85

Query  406  LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKS+KE
Sbjct  86   LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSTKE  134



>emb|CDY62197.1| BnaA06g01520D [Brassica napus]
 emb|CDY47568.1| BnaC03g69110D [Brassica napus]
Length=135

 Score =   209 bits (532),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 108/130 (83%), Positives = 118/130 (91%), Gaps = 3/130 (2%)
 Frame = +1

Query  163  LIMGKTSVAAANkdkdkdkkkPTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYS  342
            LIMGK S    N+     KK+P +RS+RAGLQFPVGR+HRLLK R+TA+GRVGATAAVY+
Sbjct  9    LIMGKPS---GNEKDKDKKKQPITRSARAGLQFPVGRVHRLLKTRSTAHGRVGATAAVYT  65

Query  343  AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH  522
            AAILEYLTAEVLELAGNASKDLKVKRI+PRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH
Sbjct  66   AAILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH  125

Query  523  KSLINKSSKE  552
            KSLINKS+KE
Sbjct  126  KSLINKSAKE  135



>gb|ACG25502.1| histone H2A variant 3 [Zea mays]
Length=137

 Score =   209 bits (531),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 104/109 (95%), Positives = 105/109 (96%), Gaps = 0/109 (0%)
 Frame = +1

Query  226  PTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKD  405
            P SRSSRAGLQFP GRIHR LK+RT ANGRVGATAAVYSAAILEYLTAEVLELAGNASKD
Sbjct  29   PISRSSRAGLQFPFGRIHRQLKQRTQANGRVGATAAVYSAAILEYLTAEVLELAGNASKD  88

Query  406  LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE
Sbjct  89   LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  137



>ref|XP_009115398.1| PREDICTED: probable histone H2A variant 3 [Brassica rapa]
 emb|CDY21851.1| BnaC01g35970D [Brassica napus]
Length=134

 Score =   208 bits (530),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 115/130 (88%), Positives = 122/130 (94%), Gaps = 4/130 (3%)
 Frame = +1

Query  163  LIMGKTSVAAANkdkdkdkkkPTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYS  342
            LIMGK+S      DKDKDKKKPT+RSSRAGLQFPVGR+HRLLK R+TA+GRVGATAAVY+
Sbjct  9    LIMGKSS----GNDKDKDKKKPTTRSSRAGLQFPVGRVHRLLKGRSTAHGRVGATAAVYT  64

Query  343  AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH  522
            AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH
Sbjct  65   AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH  124

Query  523  KSLINKSSKE  552
            KSLINKS +E
Sbjct  125  KSLINKSGQE  134



>ref|XP_008775234.1| PREDICTED: probable histone H2A variant 3 [Phoenix dactylifera]
 ref|XP_010932843.1| PREDICTED: probable histone H2A variant 3 isoform X2 [Elaeis 
guineensis]
 ref|XP_010932845.1| PREDICTED: probable histone H2A variant 3 isoform X2 [Elaeis 
guineensis]
 ref|XP_010932846.1| PREDICTED: probable histone H2A variant 3 isoform X2 [Elaeis 
guineensis]
Length=134

 Score =   208 bits (530),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 104/109 (95%), Positives = 104/109 (95%), Gaps = 0/109 (0%)
 Frame = +1

Query  226  PTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKD  405
            P SRSSRAGLQFPVGRIHR LK R  ANGRVGATAAVYSAAILEYLTAEVLELAGNASKD
Sbjct  26   PVSRSSRAGLQFPVGRIHRQLKSRIAANGRVGATAAVYSAAILEYLTAEVLELAGNASKD  85

Query  406  LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE
Sbjct  86   LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  134



>ref|XP_010932842.1| PREDICTED: probable histone H2A variant 3 isoform X1 [Elaeis 
guineensis]
Length=148

 Score =   209 bits (531),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 104/109 (95%), Positives = 104/109 (95%), Gaps = 0/109 (0%)
 Frame = +1

Query  226  PTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKD  405
            P SRSSRAGLQFPVGRIHR LK R  ANGRVGATAAVYSAAILEYLTAEVLELAGNASKD
Sbjct  40   PVSRSSRAGLQFPVGRIHRQLKSRIAANGRVGATAAVYSAAILEYLTAEVLELAGNASKD  99

Query  406  LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE
Sbjct  100  LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  148



>ref|XP_004985604.1| PREDICTED: probable histone H2A variant 1-like [Setaria italica]
Length=138

 Score =   208 bits (530),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 107/130 (82%), Positives = 114/130 (88%), Gaps = 0/130 (0%)
 Frame = +1

Query  163  LIMGKTSVAAANkdkdkdkkkPTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYS  342
            L+  KT+ A +       KK P SRSSRAGLQFPVGRIHR LK R +A+GRVGATAAVYS
Sbjct  9    LLAAKTTAAKSTDKDKDKKKAPVSRSSRAGLQFPVGRIHRQLKSRASAHGRVGATAAVYS  68

Query  343  AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH  522
            AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH
Sbjct  69   AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH  128

Query  523  KSLINKSSKE  552
            KSLINK++KE
Sbjct  129  KSLINKTAKE  138



>ref|XP_010914941.1| PREDICTED: probable histone H2A variant 3 [Elaeis guineensis]
Length=133

 Score =   208 bits (529),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 103/109 (94%), Positives = 105/109 (96%), Gaps = 0/109 (0%)
 Frame = +1

Query  226  PTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKD  405
            P SRSSRAGLQFPVGRIHRLLK R  ANGRVGATAAVY+AAILEYLTAEVLELAGNASKD
Sbjct  25   PVSRSSRAGLQFPVGRIHRLLKSRIAANGRVGATAAVYTAAILEYLTAEVLELAGNASKD  84

Query  406  LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSK+
Sbjct  85   LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKD  133



>ref|NP_001237346.1| uncharacterized protein LOC100499881 [Glycine max]
 gb|ACU14025.1| unknown [Glycine max]
Length=134

 Score =   208 bits (529),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 104/109 (95%), Positives = 105/109 (96%), Gaps = 0/109 (0%)
 Frame = +1

Query  226  PTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKD  405
            P SRSSRAGLQFPVGRIHRLLK R TA+GRVGATAAVYSAAILEYLTAEVLELAGNASKD
Sbjct  26   PISRSSRAGLQFPVGRIHRLLKSRVTAHGRVGATAAVYSAAILEYLTAEVLELAGNASKD  85

Query  406  LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            LKVKRITPRHLQL IRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE
Sbjct  86   LKVKRITPRHLQLVIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  134



>ref|XP_010917635.1| PREDICTED: probable histone H2A variant 3 [Elaeis guineensis]
 ref|XP_010917636.1| PREDICTED: probable histone H2A variant 3 [Elaeis guineensis]
 ref|XP_010932840.1| PREDICTED: probable histone H2A variant 3 [Elaeis guineensis]
 ref|XP_010932841.1| PREDICTED: probable histone H2A variant 3 [Elaeis guineensis]
Length=134

 Score =   208 bits (529),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 104/109 (95%), Positives = 104/109 (95%), Gaps = 0/109 (0%)
 Frame = +1

Query  226  PTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKD  405
            P SRSSRAGLQFPVGRIHR LK R  ANGRVGATAAVYSAAILEYLTAEVLELAGNASKD
Sbjct  26   PVSRSSRAGLQFPVGRIHRHLKSRIAANGRVGATAAVYSAAILEYLTAEVLELAGNASKD  85

Query  406  LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE
Sbjct  86   LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  134



>ref|XP_006298794.1| hypothetical protein CARUB_v10014898mg [Capsella rubella]
 gb|EOA31692.1| hypothetical protein CARUB_v10014898mg [Capsella rubella]
Length=134

 Score =   208 bits (529),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 116/130 (89%), Positives = 121/130 (93%), Gaps = 4/130 (3%)
 Frame = +1

Query  163  LIMGKTSVAAANkdkdkdkkkPTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYS  342
            LIMGK S      DKDKDKKKPT+RSSRAGLQFPVGR+HRLLK R+TA+GRVGATAAVY+
Sbjct  9    LIMGKPS----GNDKDKDKKKPTTRSSRAGLQFPVGRVHRLLKGRSTAHGRVGATAAVYT  64

Query  343  AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH  522
            AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH
Sbjct  65   AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH  124

Query  523  KSLINKSSKE  552
            KSLINKS KE
Sbjct  125  KSLINKSGKE  134



>ref|XP_004135834.1| PREDICTED: probable histone H2A variant 3-like [Cucumis sativus]
 ref|XP_004166619.1| PREDICTED: probable histone H2A variant 3-like [Cucumis sativus]
 gb|KGN45310.1| hypothetical protein Csa_7G433390 [Cucumis sativus]
Length=134

 Score =   208 bits (529),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 111/130 (85%), Positives = 116/130 (89%), Gaps = 4/130 (3%)
 Frame = +1

Query  163  LIMGKTSVAAANkdkdkdkkkPTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYS  342
            LIMGK++    +KDK K    P SRSSRAGLQFPVGR+HR LK R  ANGRVGATAAVY+
Sbjct  9    LIMGKSAANNKDKDKKK----PVSRSSRAGLQFPVGRVHRQLKSRVAANGRVGATAAVYT  64

Query  343  AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH  522
            AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH
Sbjct  65   AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH  124

Query  523  KSLINKSSKE  552
            KSLINKSSKE
Sbjct  125  KSLINKSSKE  134



>ref|XP_008802548.1| PREDICTED: probable histone H2A variant 3 [Phoenix dactylifera]
 ref|XP_008802549.1| PREDICTED: probable histone H2A variant 3 [Phoenix dactylifera]
 ref|XP_008802550.1| PREDICTED: probable histone H2A variant 3 [Phoenix dactylifera]
Length=134

 Score =   208 bits (529),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 104/109 (95%), Positives = 104/109 (95%), Gaps = 0/109 (0%)
 Frame = +1

Query  226  PTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKD  405
            P SRSSRAGLQFPVGRIHR LK R  ANGRVGATAAVYSAAILEYLTAEVLELAGNASKD
Sbjct  26   PVSRSSRAGLQFPVGRIHRHLKSRIAANGRVGATAAVYSAAILEYLTAEVLELAGNASKD  85

Query  406  LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE
Sbjct  86   LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  134



>ref|XP_009388461.1| PREDICTED: histone H2A variant 1 [Musa acuminata subsp. malaccensis]
 ref|XP_009388469.1| PREDICTED: histone H2A variant 1 [Musa acuminata subsp. malaccensis]
 ref|XP_009388476.1| PREDICTED: histone H2A variant 1 [Musa acuminata subsp. malaccensis]
Length=134

 Score =   207 bits (528),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 103/109 (94%), Positives = 105/109 (96%), Gaps = 0/109 (0%)
 Frame = +1

Query  226  PTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKD  405
            P SRSSRAGLQFPVGRIHR LK R +ANGRVGATAAVYSAAILEYLTAEVLELAGNASKD
Sbjct  26   PVSRSSRAGLQFPVGRIHRQLKTRISANGRVGATAAVYSAAILEYLTAEVLELAGNASKD  85

Query  406  LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKS+KE
Sbjct  86   LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSTKE  134



>ref|XP_010679145.1| PREDICTED: probable histone H2A variant 3 [Beta vulgaris subsp. 
vulgaris]
Length=134

 Score =   207 bits (528),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 103/109 (94%), Positives = 106/109 (97%), Gaps = 0/109 (0%)
 Frame = +1

Query  226  PTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKD  405
            PTSRSSRAGLQFPVGRIHR LK R +ANGRVGATAAVYSAAILEYLTAEVLELAGNASKD
Sbjct  26   PTSRSSRAGLQFPVGRIHRHLKTRVSANGRVGATAAVYSAAILEYLTAEVLELAGNASKD  85

Query  406  LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKS+K+
Sbjct  86   LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSAKD  134



>ref|XP_009392397.1| PREDICTED: probable histone H2A variant 3 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009392398.1| PREDICTED: probable histone H2A variant 3 [Musa acuminata subsp. 
malaccensis]
Length=134

 Score =   207 bits (528),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 103/109 (94%), Positives = 104/109 (95%), Gaps = 0/109 (0%)
 Frame = +1

Query  226  PTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKD  405
            P SRS+RAGLQFPVGRIHR LK R  ANGRVGATAAVYSAAILEYLTAEVLELAGNASKD
Sbjct  26   PVSRSARAGLQFPVGRIHRQLKSRIQANGRVGATAAVYSAAILEYLTAEVLELAGNASKD  85

Query  406  LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE
Sbjct  86   LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  134



>gb|KFK38906.1| hypothetical protein AALP_AA3G176300 [Arabis alpina]
Length=134

 Score =   207 bits (528),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 115/130 (88%), Positives = 121/130 (93%), Gaps = 4/130 (3%)
 Frame = +1

Query  163  LIMGKTSVAAANkdkdkdkkkPTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYS  342
            LIMGK+S      +KDKDKKKPT+RS RAGLQFPVGRIHRLLK R+TA+GRVGATAAVY+
Sbjct  9    LIMGKSS----GNEKDKDKKKPTTRSFRAGLQFPVGRIHRLLKGRSTAHGRVGATAAVYT  64

Query  343  AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH  522
            AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH
Sbjct  65   AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH  124

Query  523  KSLINKSSKE  552
            KSLINKS KE
Sbjct  125  KSLINKSGKE  134



>ref|XP_003521264.1| PREDICTED: histone H2A variant 1-like [Glycine max]
 ref|XP_003554274.1| PREDICTED: histone H2A variant 1-like [Glycine max]
 gb|KHN02543.1| Histone H2A variant 1 [Glycine soja]
 gb|KHN10699.1| Histone H2A variant 1 [Glycine soja]
Length=136

 Score =   207 bits (528),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 114/130 (88%), Positives = 122/130 (94%), Gaps = 2/130 (2%)
 Frame = +1

Query  163  LIMGKTSVAAANkdkdkdkkkPTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYS  342
            L+ GKT+  AANKDKDKDKK+P SRSSRAG+QFPVGRIHR LK+R  ANGRVGATAAVY 
Sbjct  9    LVAGKTT--AANKDKDKDKKRPVSRSSRAGIQFPVGRIHRQLKQRVQANGRVGATAAVYL  66

Query  343  AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH  522
            A+ILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH
Sbjct  67   ASILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH  126

Query  523  KSLINKSSKE  552
            KSLINK++KE
Sbjct  127  KSLINKAAKE  136



>ref|XP_009419817.1| PREDICTED: histone H2A variant 1-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009419825.1| PREDICTED: histone H2A variant 1-like [Musa acuminata subsp. 
malaccensis]
Length=134

 Score =   207 bits (528),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 103/109 (94%), Positives = 105/109 (96%), Gaps = 0/109 (0%)
 Frame = +1

Query  226  PTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKD  405
            P SRSSRAGLQFPVGRIHR LK R +ANGRVGATAAVYSAAILEYLTAEVLELAGNASKD
Sbjct  26   PVSRSSRAGLQFPVGRIHRHLKSRISANGRVGATAAVYSAAILEYLTAEVLELAGNASKD  85

Query  406  LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKS+KE
Sbjct  86   LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSTKE  134



>ref|XP_003573931.1| PREDICTED: probable histone H2A variant 2 [Brachypodium distachyon]
Length=139

 Score =   207 bits (528),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 102/109 (94%), Positives = 106/109 (97%), Gaps = 0/109 (0%)
 Frame = +1

Query  226  PTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKD  405
            P SRSSRAG+QFPVGRIHR LK+R +ANGRVGATAAVYSAAILEYLTAEVLELAGNASKD
Sbjct  31   PVSRSSRAGIQFPVGRIHRQLKQRVSANGRVGATAAVYSAAILEYLTAEVLELAGNASKD  90

Query  406  LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINK+SKE
Sbjct  91   LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKTSKE  139



>dbj|BAJ87489.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gb|EMS56553.1| putative histone H2A variant 3 [Triticum urartu]
 gb|EMT13271.1| Putative histone H2A variant 3 [Aegilops tauschii]
Length=139

 Score =   207 bits (528),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 102/109 (94%), Positives = 106/109 (97%), Gaps = 0/109 (0%)
 Frame = +1

Query  226  PTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKD  405
            P SRSSRAG+QFPVGRIHR LK+R +ANGRVGATAAVYSAAILEYLTAEVLELAGNASKD
Sbjct  31   PVSRSSRAGIQFPVGRIHRQLKQRVSANGRVGATAAVYSAAILEYLTAEVLELAGNASKD  90

Query  406  LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINK+SKE
Sbjct  91   LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKTSKE  139



>emb|CDO98103.1| unnamed protein product [Coffea canephora]
Length=131

 Score =   207 bits (527),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 102/109 (94%), Positives = 105/109 (96%), Gaps = 0/109 (0%)
 Frame = +1

Query  226  PTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKD  405
            P SRSSRAGLQFPVGR+HR LK R +ANGRVGATAAVY+AAILEYLTAEVLELAGNASKD
Sbjct  23   PVSRSSRAGLQFPVGRVHRQLKTRVSANGRVGATAAVYTAAILEYLTAEVLELAGNASKD  82

Query  406  LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE
Sbjct  83   LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  131



>ref|XP_007162479.1| hypothetical protein PHAVU_001G155700g [Phaseolus vulgaris]
 gb|ESW34473.1| hypothetical protein PHAVU_001G155700g [Phaseolus vulgaris]
Length=136

 Score =   207 bits (527),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 114/130 (88%), Positives = 122/130 (94%), Gaps = 2/130 (2%)
 Frame = +1

Query  163  LIMGKTSVAAANkdkdkdkkkPTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYS  342
            L+ GKT+  AANKDKDKDKK+P SRSSRAG+QFPVGRIHR LK+R  ANGRVGATAAVY 
Sbjct  9    LVAGKTT--AANKDKDKDKKRPVSRSSRAGIQFPVGRIHRQLKQRVQANGRVGATAAVYL  66

Query  343  AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH  522
            A+ILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH
Sbjct  67   ASILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH  126

Query  523  KSLINKSSKE  552
            KSLINK++KE
Sbjct  127  KSLINKAAKE  136



>ref|XP_008775343.1| PREDICTED: probable histone H2A variant 3 [Phoenix dactylifera]
Length=135

 Score =   207 bits (526),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 104/109 (95%), Positives = 104/109 (95%), Gaps = 0/109 (0%)
 Frame = +1

Query  226  PTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKD  405
            P SRSSRAGLQFPVGRIHR LK R  ANGRVGATAAVYSAAILEYLTAEVLELAGNASKD
Sbjct  27   PVSRSSRAGLQFPVGRIHRHLKSRIAANGRVGATAAVYSAAILEYLTAEVLELAGNASKD  86

Query  406  LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE
Sbjct  87   LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  135



>ref|XP_009415279.1| PREDICTED: probable histone H2A variant 3 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009415281.1| PREDICTED: probable histone H2A variant 3 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009415282.1| PREDICTED: probable histone H2A variant 3 [Musa acuminata subsp. 
malaccensis]
Length=134

 Score =   207 bits (526),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 103/109 (94%), Positives = 104/109 (95%), Gaps = 0/109 (0%)
 Frame = +1

Query  226  PTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKD  405
            P SRS+RAGLQFPVGRIHR LK R  ANGRVGATAAVYSAAILEYLTAEVLELAGNASKD
Sbjct  26   PISRSARAGLQFPVGRIHRQLKSRIQANGRVGATAAVYSAAILEYLTAEVLELAGNASKD  85

Query  406  LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE
Sbjct  86   LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  134



>ref|XP_009144817.1| PREDICTED: probable histone H2A variant 3 [Brassica rapa]
 ref|XP_009147667.1| PREDICTED: probable histone H2A variant 3 [Brassica rapa]
 emb|CDY61820.1| BnaC06g41850D [Brassica napus]
 emb|CDY40131.1| BnaC06g05580D [Brassica napus]
Length=135

 Score =   207 bits (526),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 107/130 (82%), Positives = 118/130 (91%), Gaps = 3/130 (2%)
 Frame = +1

Query  163  LIMGKTSVAAANkdkdkdkkkPTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYS  342
            LIMGK S    ++     KK+P +RS+RAGLQFPVGR+HRLLK R+TA+GRVGATAAVY+
Sbjct  9    LIMGKPS---GSEKDKDKKKQPITRSARAGLQFPVGRVHRLLKTRSTAHGRVGATAAVYT  65

Query  343  AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH  522
            AAILEYLTAEVLELAGNASKDLKVKRI+PRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH
Sbjct  66   AAILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH  125

Query  523  KSLINKSSKE  552
            KSLINKS+KE
Sbjct  126  KSLINKSAKE  135



>emb|CDP03683.1| unnamed protein product [Coffea canephora]
Length=141

 Score =   207 bits (526),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 102/109 (94%), Positives = 106/109 (97%), Gaps = 0/109 (0%)
 Frame = +1

Query  226  PTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKD  405
            P SRSSRAGLQFPVGRIHR LK RT+A+GRVGATAAVYSAAILEYLTAEVLELAGNASKD
Sbjct  33   PVSRSSRAGLQFPVGRIHRQLKSRTSAHGRVGATAAVYSAAILEYLTAEVLELAGNASKD  92

Query  406  LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINK++KE
Sbjct  93   LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKTTKE  141



>ref|XP_009601152.1| PREDICTED: probable histone H2A variant 1 [Nicotiana tomentosiformis]
 ref|XP_009601153.1| PREDICTED: probable histone H2A variant 1 [Nicotiana tomentosiformis]
 ref|XP_009765811.1| PREDICTED: probable histone H2A variant 1 [Nicotiana sylvestris]
 ref|XP_009765812.1| PREDICTED: probable histone H2A variant 1 [Nicotiana sylvestris]
 ref|XP_009765813.1| PREDICTED: probable histone H2A variant 1 [Nicotiana sylvestris]
Length=140

 Score =   207 bits (526),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 102/109 (94%), Positives = 106/109 (97%), Gaps = 0/109 (0%)
 Frame = +1

Query  226  PTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKD  405
            P SRSSRAGLQFPVGRIHR LK RT+A+GRVGATAAVYSAAILEYLTAEVLELAGNASKD
Sbjct  32   PVSRSSRAGLQFPVGRIHRQLKSRTSAHGRVGATAAVYSAAILEYLTAEVLELAGNASKD  91

Query  406  LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINK++KE
Sbjct  92   LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKTTKE  140



>ref|XP_010274247.1| PREDICTED: probable histone H2A variant 3 [Nelumbo nucifera]
 ref|XP_010279306.1| PREDICTED: probable histone H2A variant 3 [Nelumbo nucifera]
Length=134

 Score =   206 bits (525),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 103/109 (94%), Positives = 104/109 (95%), Gaps = 0/109 (0%)
 Frame = +1

Query  226  PTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKD  405
            P SRSSRAGLQFPVGRIHR LK R  ANGRVGATAAVYSAAILEYLTAEVLELAGNASKD
Sbjct  26   PVSRSSRAGLQFPVGRIHRHLKSRIAANGRVGATAAVYSAAILEYLTAEVLELAGNASKD  85

Query  406  LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSK+
Sbjct  86   LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKD  134



>gb|KHG30412.1| hypothetical protein F383_04720 [Gossypium arboreum]
Length=134

 Score =   206 bits (525),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 102/109 (94%), Positives = 105/109 (96%), Gaps = 0/109 (0%)
 Frame = +1

Query  226  PTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKD  405
            P SRSSRAGLQFPVGR+HRLLK R  A+GRVGATAAVY+AAILEYLTAEVLELAGNASKD
Sbjct  26   PISRSSRAGLQFPVGRVHRLLKTRVNAHGRVGATAAVYTAAILEYLTAEVLELAGNASKD  85

Query  406  LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE
Sbjct  86   LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  134



>ref|XP_011079932.1| PREDICTED: probable histone H2A variant 3 [Sesamum indicum]
Length=137

 Score =   206 bits (525),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 102/109 (94%), Positives = 105/109 (96%), Gaps = 0/109 (0%)
 Frame = +1

Query  226  PTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKD  405
            P SRS+RAGLQFPVGRIHR LK RT ANGRVGATAAVYSAAILEYLTAEVLELAGNASKD
Sbjct  29   PVSRSARAGLQFPVGRIHRHLKSRTNANGRVGATAAVYSAAILEYLTAEVLELAGNASKD  88

Query  406  LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINK++KE
Sbjct  89   LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKTTKE  137



>ref|XP_003588715.1| Histone H2A [Medicago truncatula]
Length=345

 Score =   213 bits (543),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 106/109 (97%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  226  PTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKD  405
            PTSRSSRAGLQFPVGRIHRLLK RT A+GRVGATAAVYSAAILEYLTAEVLELAGNASKD
Sbjct  237  PTSRSSRAGLQFPVGRIHRLLKSRTMAHGRVGATAAVYSAAILEYLTAEVLELAGNASKD  296

Query  406  LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE
Sbjct  297  LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  345



>ref|XP_008792114.1| PREDICTED: probable histone H2A variant 3 [Phoenix dactylifera]
Length=133

 Score =   206 bits (525),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 102/109 (94%), Positives = 104/109 (95%), Gaps = 0/109 (0%)
 Frame = +1

Query  226  PTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKD  405
            P SRSSRAGLQFPVGRIHRLLK R  ANGRVG TAAVY+AAILEYLTAEVLELAGNASKD
Sbjct  25   PVSRSSRAGLQFPVGRIHRLLKSRIAANGRVGGTAAVYTAAILEYLTAEVLELAGNASKD  84

Query  406  LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSK+
Sbjct  85   LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKD  133



>ref|XP_009412349.1| PREDICTED: probable histone H2A variant 3 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009412351.1| PREDICTED: probable histone H2A variant 3 [Musa acuminata subsp. 
malaccensis]
Length=134

 Score =   206 bits (524),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 103/109 (94%), Positives = 104/109 (95%), Gaps = 0/109 (0%)
 Frame = +1

Query  226  PTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKD  405
            P SRS+RAGLQFPVGRIHR LK R  ANGRVGATAAVYSAAILEYLTAEVLELAGNASKD
Sbjct  26   PVSRSARAGLQFPVGRIHRQLKLRIQANGRVGATAAVYSAAILEYLTAEVLELAGNASKD  85

Query  406  LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE
Sbjct  86   LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  134



>ref|XP_011082593.1| PREDICTED: probable histone H2A variant 3 [Sesamum indicum]
Length=137

 Score =   206 bits (524),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 102/109 (94%), Positives = 105/109 (96%), Gaps = 0/109 (0%)
 Frame = +1

Query  226  PTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKD  405
            P SRS+RAGLQFPVGRIHR LK RT ANGRVGATAAVYSAAILEYLTAEVLELAGNASKD
Sbjct  29   PVSRSARAGLQFPVGRIHRHLKSRTNANGRVGATAAVYSAAILEYLTAEVLELAGNASKD  88

Query  406  LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINK++KE
Sbjct  89   LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKTTKE  137



>ref|XP_010503198.1| PREDICTED: probable histone H2A variant 3 isoform X1 [Camelina 
sativa]
 ref|XP_010487385.1| PREDICTED: probable histone H2A variant 3 isoform X1 [Camelina 
sativa]
Length=134

 Score =   206 bits (524),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 116/130 (89%), Positives = 120/130 (92%), Gaps = 4/130 (3%)
 Frame = +1

Query  163  LIMGKTSVAAANkdkdkdkkkPTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYS  342
            LIMGK S      DKDKDKKKP +RSSRAGLQFPVGRIHRLLK R+TA+GRVGATAAVY+
Sbjct  9    LIMGKPS----GNDKDKDKKKPITRSSRAGLQFPVGRIHRLLKGRSTAHGRVGATAAVYT  64

Query  343  AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH  522
            AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH
Sbjct  65   AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH  124

Query  523  KSLINKSSKE  552
            KSLINKS KE
Sbjct  125  KSLINKSGKE  134



>ref|XP_003577410.1| PREDICTED: probable histone H2A variant 3 [Brachypodium distachyon]
Length=133

 Score =   206 bits (524),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 113/130 (87%), Positives = 117/130 (90%), Gaps = 5/130 (4%)
 Frame = +1

Query  163  LIMGKTSVAAANkdkdkdkkkPTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYS  342
            LI  KT+VA     KDKDKK P SRSSRAGLQFPVGRIHR LK+R  A+GRVGATAAVYS
Sbjct  9    LIAAKTAVA-----KDKDKKLPVSRSSRAGLQFPVGRIHRQLKQRAQASGRVGATAAVYS  63

Query  343  AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH  522
            AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAG GVIPHIH
Sbjct  64   AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGAGVIPHIH  123

Query  523  KSLINKSSKE  552
            KSLINKSSK+
Sbjct  124  KSLINKSSKD  133



>gb|KJB56647.1| hypothetical protein B456_009G129400 [Gossypium raimondii]
Length=134

 Score =   206 bits (524),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 102/109 (94%), Positives = 105/109 (96%), Gaps = 0/109 (0%)
 Frame = +1

Query  226  PTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKD  405
            P SRSSRAGLQFPVGR+HRLLK R  A+GRVGATAAVY+AAILEYLTAEVLELAGNASKD
Sbjct  26   PISRSSRAGLQFPVGRVHRLLKTRVNAHGRVGATAAVYTAAILEYLTAEVLELAGNASKD  85

Query  406  LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE
Sbjct  86   LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  134



>ref|XP_004247205.1| PREDICTED: probable histone H2A variant 1 [Solanum lycopersicum]
 ref|XP_006349733.1| PREDICTED: probable histone H2A variant 1-like [Solanum tuberosum]
Length=139

 Score =   206 bits (524),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 102/109 (94%), Positives = 105/109 (96%), Gaps = 0/109 (0%)
 Frame = +1

Query  226  PTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKD  405
            P SRSSRAGLQFPVGRIHR LK RT A+GRVGATAAVYSAAILEYLTAEVLELAGNASKD
Sbjct  31   PVSRSSRAGLQFPVGRIHRQLKSRTAAHGRVGATAAVYSAAILEYLTAEVLELAGNASKD  90

Query  406  LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINK++KE
Sbjct  91   LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKTTKE  139



>ref|XP_010465530.1| PREDICTED: probable histone H2A variant 3 [Camelina sativa]
Length=136

 Score =   206 bits (524),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 117/130 (90%), Positives = 122/130 (94%), Gaps = 2/130 (2%)
 Frame = +1

Query  163  LIMGKTSVAAANkdkdkdkkkPTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYS  342
            LIMGK S    +KDKDKDKKKP +RSSRAGLQFPVGRIHRLLK R+TA+GRVGATAAVY+
Sbjct  9    LIMGKPS--GNDKDKDKDKKKPITRSSRAGLQFPVGRIHRLLKGRSTAHGRVGATAAVYT  66

Query  343  AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH  522
            AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH
Sbjct  67   AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH  126

Query  523  KSLINKSSKE  552
            KSLINKS KE
Sbjct  127  KSLINKSGKE  136



>ref|XP_008461070.1| PREDICTED: probable histone H2A variant 3 [Cucumis melo]
Length=209

 Score =   208 bits (530),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 111/130 (85%), Positives = 116/130 (89%), Gaps = 4/130 (3%)
 Frame = +1

Query  163  LIMGKTSVAAANkdkdkdkkkPTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYS  342
            LIMGK++    +KDK K    P SRSSRAGLQFPVGR+HR LK R  ANGRVGATAAVY+
Sbjct  84   LIMGKSAANNKDKDKKK----PVSRSSRAGLQFPVGRVHRQLKSRVAANGRVGATAAVYT  139

Query  343  AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH  522
            AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH
Sbjct  140  AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH  199

Query  523  KSLINKSSKE  552
            KSLINKSSKE
Sbjct  200  KSLINKSSKE  209



>gb|ACU15057.1| unknown [Glycine max]
Length=136

 Score =   206 bits (523),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 113/130 (87%), Positives = 122/130 (94%), Gaps = 2/130 (2%)
 Frame = +1

Query  163  LIMGKTSVAAANkdkdkdkkkPTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYS  342
            L+ GKT+  AANKDKDKDKK+P SRSSRAG+QFPVGRIHR LK+R  ANGRVGATAAVY 
Sbjct  9    LVAGKTT--AANKDKDKDKKRPASRSSRAGIQFPVGRIHRQLKQRVQANGRVGATAAVYL  66

Query  343  AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH  522
            A+ILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDE+LDTLIKGTIAGGGVIPHIH
Sbjct  67   ASILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEKLDTLIKGTIAGGGVIPHIH  126

Query  523  KSLINKSSKE  552
            KSLINK++KE
Sbjct  127  KSLINKAAKE  136



>ref|XP_004495152.1| PREDICTED: histone H2A variant 1-like [Cicer arietinum]
Length=134

 Score =   206 bits (523),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 101/109 (93%), Positives = 105/109 (96%), Gaps = 0/109 (0%)
 Frame = +1

Query  226  PTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKD  405
            PTSRSSRAG+QFPVGRIHR LK+R  ANGRVGATAAVY A+ILEYLTAEVLELAGNASKD
Sbjct  26   PTSRSSRAGIQFPVGRIHRQLKQRVQANGRVGATAAVYLASILEYLTAEVLELAGNASKD  85

Query  406  LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINK+SKE
Sbjct  86   LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKTSKE  134



>ref|NP_175683.1| histone H2A protein 9 [Arabidopsis thaliana]
 ref|XP_002891713.1| hypothetical protein ARALYDRAFT_474400 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_010500891.1| PREDICTED: probable histone H2A variant 3 [Camelina sativa]
 ref|XP_010462129.1| PREDICTED: probable histone H2A variant 3 [Camelina sativa]
 ref|XP_010479795.1| PREDICTED: probable histone H2A variant 3 [Camelina sativa]
 sp|Q9C944.1|H2AV3_ARATH RecName: Full=Probable histone H2A variant 3; AltName: Full=H2A.F/Z 
3; AltName: Full=HTA9 [Arabidopsis thaliana]
 gb|AAG52265.1|AC019018_2 putative histone H2A; 14481-15293 [Arabidopsis thaliana]
 gb|AAK96748.1| putative histone H2A [Arabidopsis thaliana]
 gb|AAL25563.1| At1g52740/F14G24_1 [Arabidopsis thaliana]
 gb|AAL47344.1| putative histone H2A [Arabidopsis thaliana]
 gb|AAM60967.1| putative histone H2A [Arabidopsis thaliana]
 gb|EFH67972.1| hypothetical protein ARALYDRAFT_474400 [Arabidopsis lyrata subsp. 
lyrata]
 gb|AEE32847.1| histone H2A protein 9 [Arabidopsis thaliana]
 gb|KFK35773.1| hypothetical protein AALP_AA4G034200 [Arabis alpina]
Length=134

 Score =   206 bits (523),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 114/130 (88%), Positives = 121/130 (93%), Gaps = 4/130 (3%)
 Frame = +1

Query  163  LIMGKTSVAAANkdkdkdkkkPTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYS  342
            LIMGK S      DKDKDKKKP +RSSRAGLQFPVGR+HRLLK R+TA+GRVGATAAVY+
Sbjct  9    LIMGKPS----GSDKDKDKKKPITRSSRAGLQFPVGRVHRLLKTRSTAHGRVGATAAVYT  64

Query  343  AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH  522
            AAILEYLTAEVLELAGNASKDLKVKRI+PRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH
Sbjct  65   AAILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH  124

Query  523  KSLINKSSKE  552
            KSLINKS+KE
Sbjct  125  KSLINKSAKE  134



>ref|XP_006304271.1| hypothetical protein CARUB_v10010503mg, partial [Capsella rubella]
 gb|EOA37169.1| hypothetical protein CARUB_v10010503mg, partial [Capsella rubella]
Length=163

 Score =   206 bits (525),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 114/130 (88%), Positives = 121/130 (93%), Gaps = 4/130 (3%)
 Frame = +1

Query  163  LIMGKTSVAAANkdkdkdkkkPTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYS  342
            LIMGK S      DKDKDKKKP +RSSRAGLQFPVGR+HRLLK R+TA+GRVGATAAVY+
Sbjct  38   LIMGKPS----GSDKDKDKKKPITRSSRAGLQFPVGRVHRLLKTRSTAHGRVGATAAVYT  93

Query  343  AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH  522
            AAILEYLTAEVLELAGNASKDLKVKRI+PRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH
Sbjct  94   AAILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH  153

Query  523  KSLINKSSKE  552
            KSLINKS+KE
Sbjct  154  KSLINKSAKE  163



>ref|XP_002885097.1| hypothetical protein ARALYDRAFT_341690 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61356.1| hypothetical protein ARALYDRAFT_341690 [Arabidopsis lyrata subsp. 
lyrata]
Length=134

 Score =   205 bits (522),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 102/108 (94%), Positives = 106/108 (98%), Gaps = 0/108 (0%)
 Frame = +1

Query  229  TSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKDL  408
            T+RSSRAGLQFPVGRIHRLLK R+TA+GRVGATAAVY+AAILEYLTAEVLELAGNASKDL
Sbjct  27   TTRSSRAGLQFPVGRIHRLLKGRSTAHGRVGATAAVYTAAILEYLTAEVLELAGNASKDL  86

Query  409  KVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            KVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKS KE
Sbjct  87   KVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSGKE  134



>ref|XP_009612819.1| PREDICTED: probable histone H2A variant 1 [Nicotiana tomentosiformis]
 ref|XP_009786588.1| PREDICTED: probable histone H2A variant 1 [Nicotiana sylvestris]
Length=138

 Score =   205 bits (522),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 102/109 (94%), Positives = 106/109 (97%), Gaps = 0/109 (0%)
 Frame = +1

Query  226  PTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKD  405
            P SRSSRAGLQFPVGRIHR LK RT+A+GRVGATAAVYSAAILEYLTAEVLELAGNASKD
Sbjct  30   PISRSSRAGLQFPVGRIHRQLKTRTSAHGRVGATAAVYSAAILEYLTAEVLELAGNASKD  89

Query  406  LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINK++KE
Sbjct  90   LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKTTKE  138



>ref|XP_002970134.1| hypothetical protein SELMODRAFT_227953 [Selaginella moellendorffii]
 gb|EFJ29258.1| hypothetical protein SELMODRAFT_227953 [Selaginella moellendorffii]
Length=141

 Score =   206 bits (523),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 101/109 (93%), Positives = 104/109 (95%), Gaps = 0/109 (0%)
 Frame = +1

Query  226  PTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKD  405
            P S+SSRAGLQFPVGRIHRLLK R TANGRVG TAAVYSAAILEYLTAEVLELAGNASKD
Sbjct  32   PLSKSSRAGLQFPVGRIHRLLKSRVTANGRVGGTAAVYSAAILEYLTAEVLELAGNASKD  91

Query  406  LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINK +K+
Sbjct  92   LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKQAKK  140



>ref|XP_004242347.1| PREDICTED: probable histone H2A variant 1 [Solanum lycopersicum]
 ref|XP_006352756.1| PREDICTED: probable histone H2A variant 1-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006352757.1| PREDICTED: probable histone H2A variant 1-like isoform X2 [Solanum 
tuberosum]
 ref|XP_006352758.1| PREDICTED: probable histone H2A variant 1-like isoform X3 [Solanum 
tuberosum]
 ref|XP_010323053.1| PREDICTED: probable histone H2A variant 1 [Solanum lycopersicum]
Length=137

 Score =   205 bits (522),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 102/109 (94%), Positives = 106/109 (97%), Gaps = 0/109 (0%)
 Frame = +1

Query  226  PTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKD  405
            P SRSSRAGLQFPVGRIHR LK RT+A+GRVGATAAVYSAAILEYLTAEVLELAGNASKD
Sbjct  29   PISRSSRAGLQFPVGRIHRQLKTRTSAHGRVGATAAVYSAAILEYLTAEVLELAGNASKD  88

Query  406  LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINK++KE
Sbjct  89   LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKTTKE  137



>ref|XP_010503207.1| PREDICTED: probable histone H2A variant 3 isoform X2 [Camelina 
sativa]
 ref|XP_010487386.1| PREDICTED: probable histone H2A variant 3 isoform X2 [Camelina 
sativa]
Length=124

 Score =   205 bits (521),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 102/109 (94%), Positives = 106/109 (97%), Gaps = 0/109 (0%)
 Frame = +1

Query  226  PTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKD  405
            P +RSSRAGLQFPVGRIHRLLK R+TA+GRVGATAAVY+AAILEYLTAEVLELAGNASKD
Sbjct  16   PITRSSRAGLQFPVGRIHRLLKGRSTAHGRVGATAAVYTAAILEYLTAEVLELAGNASKD  75

Query  406  LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKS KE
Sbjct  76   LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSGKE  124



>ref|XP_002985322.1| hypothetical protein SELMODRAFT_49537, partial [Selaginella moellendorffii]
 gb|EFJ13816.1| hypothetical protein SELMODRAFT_49537, partial [Selaginella moellendorffii]
Length=134

 Score =   205 bits (521),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 101/109 (93%), Positives = 104/109 (95%), Gaps = 0/109 (0%)
 Frame = +1

Query  226  PTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKD  405
            P S+SSRAGLQFPVGRIHRLLK R TANGRVG TAAVYSAAILEYLTAEVLELAGNASKD
Sbjct  26   PLSKSSRAGLQFPVGRIHRLLKSRVTANGRVGGTAAVYSAAILEYLTAEVLELAGNASKD  85

Query  406  LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINK +K+
Sbjct  86   LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKQAKK  134



>ref|NP_001049049.1| Os03g0162200 [Oryza sativa Japonica Group]
 sp|Q8H7Y8.1|H2AV1_ORYSJ RecName: Full=Probable histone H2A variant 1 [Oryza sativa Japonica 
Group]
 gb|AAN06860.1| Putative histone H2A [Oryza sativa Japonica Group]
 gb|ABF94121.1| Histone H2A.Z, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF10963.1| Os03g0162200 [Oryza sativa Japonica Group]
 gb|EAY88652.1| hypothetical protein OsI_10126 [Oryza sativa Indica Group]
 gb|EAZ25680.1| hypothetical protein OsJ_09510 [Oryza sativa Japonica Group]
 dbj|BAG88035.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH00539.1| unnamed protein product [Oryza sativa Japonica Group]
Length=138

 Score =   205 bits (522),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 102/109 (94%), Positives = 105/109 (96%), Gaps = 0/109 (0%)
 Frame = +1

Query  226  PTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKD  405
            P SRSSRAGLQFPVGRIHR LK R +A+GRVGATAAVYSAAILEYLTAEVLELAGNASKD
Sbjct  30   PVSRSSRAGLQFPVGRIHRQLKSRASAHGRVGATAAVYSAAILEYLTAEVLELAGNASKD  89

Query  406  LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINK+SKE
Sbjct  90   LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKTSKE  138



>ref|XP_010545785.1| PREDICTED: probable histone H2A variant 3 [Tarenaya hassleriana]
Length=134

 Score =   205 bits (521),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 101/109 (93%), Positives = 106/109 (97%), Gaps = 0/109 (0%)
 Frame = +1

Query  226  PTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKD  405
            P +RSSRAGLQFPVGR+HRLLK R+TA+GRVGATAAVY+AAILEYLTAEVLELAGNASKD
Sbjct  26   PITRSSRAGLQFPVGRVHRLLKTRSTAHGRVGATAAVYTAAILEYLTAEVLELAGNASKD  85

Query  406  LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKS KE
Sbjct  86   LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSVKE  134



>ref|XP_003590550.1| Histone H2A [Medicago truncatula]
 gb|AES60801.1| core histone H2A/H2B/H3/H4 [Medicago truncatula]
 gb|AFK35139.1| unknown [Medicago truncatula]
Length=134

 Score =   204 bits (520),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 100/109 (92%), Positives = 105/109 (96%), Gaps = 0/109 (0%)
 Frame = +1

Query  226  PTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKD  405
            PTSRSSRAG+QFPVGRIHR LK+R  ANGRVGATAAVY A+ILEYLTAEVLELAGNASKD
Sbjct  26   PTSRSSRAGIQFPVGRIHRQLKQRVQANGRVGATAAVYLASILEYLTAEVLELAGNASKD  85

Query  406  LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINK++KE
Sbjct  86   LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKTAKE  134



>ref|XP_006392875.1| hypothetical protein EUTSA_v10011855mg [Eutrema salsugineum]
 gb|ESQ30161.1| hypothetical protein EUTSA_v10011855mg [Eutrema salsugineum]
Length=134

 Score =   204 bits (520),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 100/109 (92%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  226  PTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKD  405
            P +RSSRAGLQFPVGR+HRLLK R+TA+GRVGATAAVY+AAILEYLTAEVLELAGNASKD
Sbjct  26   PITRSSRAGLQFPVGRVHRLLKTRSTAHGRVGATAAVYTAAILEYLTAEVLELAGNASKD  85

Query  406  LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            LKVKRI+PRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKS+KE
Sbjct  86   LKVKRISPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSAKE  134



>ref|XP_004979589.1| PREDICTED: probable histone H2A variant 3-like [Setaria italica]
Length=133

 Score =   204 bits (520),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 101/109 (93%), Positives = 104/109 (95%), Gaps = 0/109 (0%)
 Frame = +1

Query  226  PTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKD  405
            P +RSSRAGLQFPVGRIHR LKER  A+GRVGATAAVYSAAILEYLTAEVLELAGNASKD
Sbjct  25   PVTRSSRAGLQFPVGRIHRQLKERAQASGRVGATAAVYSAAILEYLTAEVLELAGNASKD  84

Query  406  LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINK+ KE
Sbjct  85   LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKTVKE  133



>gb|ACA58362.1| histone H2A [Arachis diogoi]
Length=137

 Score =   204 bits (520),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 103/109 (94%), Positives = 105/109 (96%), Gaps = 0/109 (0%)
 Frame = +1

Query  226  PTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKD  405
            P  RSSRAGLQFPVGRIHRLLK RTTA+GRVGATAAVYSAAILEYLTAEVLELAGNA+K 
Sbjct  29   PIFRSSRAGLQFPVGRIHRLLKSRTTAHGRVGATAAVYSAAILEYLTAEVLELAGNANKG  88

Query  406  LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE
Sbjct  89   LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  137



>gb|KDP21384.1| hypothetical protein JCGZ_21855 [Jatropha curcas]
Length=138

 Score =   204 bits (520),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 110/130 (85%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = +1

Query  163  LIMGKTSVAAANkdkdkdkkkPTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYS  342
            L+  KT+ A  +K+KDKDKK+P SRSSRAG+QFPVGRIHR LK+RT+ANGRVGATAAVY 
Sbjct  9    LLAAKTTAANKDKEKDKDKKRPISRSSRAGIQFPVGRIHRHLKQRTSANGRVGATAAVYL  68

Query  343  AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH  522
            A+ILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH
Sbjct  69   ASILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH  128

Query  523  KSLINKSSKE  552
            KSLINK++K+
Sbjct  129  KSLINKTTKD  138



>ref|XP_008368628.1| PREDICTED: histone H2A variant 1 [Malus domestica]
 ref|XP_008368634.1| PREDICTED: histone H2A variant 1 [Malus domestica]
 ref|XP_009370741.1| PREDICTED: histone H2A variant 1 [Pyrus x bretschneideri]
 ref|XP_009370742.1| PREDICTED: histone H2A variant 1 [Pyrus x bretschneideri]
Length=136

 Score =   204 bits (520),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 114/130 (88%), Positives = 121/130 (93%), Gaps = 2/130 (2%)
 Frame = +1

Query  163  LIMGKTSVAAANkdkdkdkkkPTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYS  342
            LI  KT+  AANKDKDKDKK+P SRSSRAG+QFPVGRIHR LK+R  A+GRVGATAAVY 
Sbjct  9    LIAAKTT--AANKDKDKDKKRPVSRSSRAGIQFPVGRIHRQLKQRIAAHGRVGATAAVYL  66

Query  343  AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH  522
            A+ILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH
Sbjct  67   ASILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH  126

Query  523  KSLINKSSKE  552
            KSLINK+SKE
Sbjct  127  KSLINKTSKE  136



>emb|CDY62164.1| BnaA05g35660D [Brassica napus]
Length=125

 Score =   204 bits (518),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 99/109 (91%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  226  PTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKD  405
            P +RS+RAGLQFPVGR+HRLLK R+TA+GRVGATAAVY+AAILEYLTAEVLELAGNASKD
Sbjct  17   PITRSARAGLQFPVGRVHRLLKTRSTAHGRVGATAAVYTAAILEYLTAEVLELAGNASKD  76

Query  406  LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            LKVKRI+PRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKS+KE
Sbjct  77   LKVKRISPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSAKE  125



>gb|ACG31635.1| histone H2A variant 3 [Zea mays]
Length=136

 Score =   204 bits (519),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 104/109 (95%), Positives = 105/109 (96%), Gaps = 1/109 (1%)
 Frame = +1

Query  226  PTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKD  405
            P SRSSRAGLQFPVGRIHR LK+RT ANGRVGATAAVYSAAILEYLTAEVLELA NASKD
Sbjct  29   PISRSSRAGLQFPVGRIHRQLKQRTQANGRVGATAAVYSAAILEYLTAEVLELA-NASKD  87

Query  406  LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE
Sbjct  88   LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  136



>ref|XP_006662358.1| PREDICTED: probable histone H2A variant 2-like, partial [Oryza 
brachyantha]
Length=128

 Score =   204 bits (518),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 100/109 (92%), Positives = 105/109 (96%), Gaps = 0/109 (0%)
 Frame = +1

Query  226  PTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKD  405
            P SRSSRAG+QFPVGRIHR LK R +ANGRVGATAAVY+AAILEYLTAEVLELAGNASKD
Sbjct  20   PVSRSSRAGIQFPVGRIHRQLKGRVSANGRVGATAAVYTAAILEYLTAEVLELAGNASKD  79

Query  406  LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINK++KE
Sbjct  80   LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKTAKE  128



>ref|XP_007050449.1| Histone H2A 11 [Theobroma cacao]
 gb|EOX94606.1| Histone H2A 11 [Theobroma cacao]
Length=138

 Score =   204 bits (519),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 111/130 (85%), Positives = 121/130 (93%), Gaps = 0/130 (0%)
 Frame = +1

Query  163  LIMGKTSVAAANkdkdkdkkkPTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYS  342
            L+  KT+ A  +KDKDKDKK+P SRSSRAG+QFPVGRIHR LK RT+ANGRVGATAAVY 
Sbjct  9    LLAAKTTAANKDKDKDKDKKRPVSRSSRAGIQFPVGRIHRHLKSRTSANGRVGATAAVYL  68

Query  343  AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH  522
            A+ILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH
Sbjct  69   ASILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH  128

Query  523  KSLINKSSKE  552
            KSLINK++K+
Sbjct  129  KSLINKTTKD  138



>ref|XP_005644573.1| histone 2A variant [Coccomyxa subellipsoidea C-169]
 gb|EIE20029.1| histone 2A variant [Coccomyxa subellipsoidea C-169]
Length=137

 Score =   204 bits (519),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 100/109 (92%), Positives = 105/109 (96%), Gaps = 0/109 (0%)
 Frame = +1

Query  226  PTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKD  405
            P SRS+RAGLQFPVGRIHRLLK R TANGRVGATAAVY+AAILEYLTAEVLELAGNASKD
Sbjct  28   PVSRSARAGLQFPVGRIHRLLKGRVTANGRVGATAAVYTAAILEYLTAEVLELAGNASKD  87

Query  406  LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            LKVKRITPRHLQLAIRGDEELDTLIK TIAGGGVIPHIHKSLINK++K+
Sbjct  88   LKVKRITPRHLQLAIRGDEELDTLIKATIAGGGVIPHIHKSLINKATKK  136



>ref|XP_007144679.1| hypothetical protein PHAVU_007G176000g [Phaseolus vulgaris]
 gb|ESW16673.1| hypothetical protein PHAVU_007G176000g [Phaseolus vulgaris]
Length=136

 Score =   204 bits (518),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 111/130 (85%), Positives = 120/130 (92%), Gaps = 2/130 (2%)
 Frame = +1

Query  163  LIMGKTSVAAANkdkdkdkkkPTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYS  342
            L+  KT+  AANK+KDKDKK+P SRSSRAG+QFPVGRIHR LK+R  ANGRVGATAAVY 
Sbjct  9    LLAAKTT--AANKEKDKDKKRPISRSSRAGIQFPVGRIHRQLKQRVQANGRVGATAAVYL  66

Query  343  AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH  522
            A+ILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH
Sbjct  67   ASILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH  126

Query  523  KSLINKSSKE  552
            KSLINK+ K+
Sbjct  127  KSLINKTVKD  136



>gb|KJB40397.1| hypothetical protein B456_007G141000 [Gossypium raimondii]
 gb|KJB40398.1| hypothetical protein B456_007G141000 [Gossypium raimondii]
Length=138

 Score =   204 bits (518),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 111/130 (85%), Positives = 121/130 (93%), Gaps = 0/130 (0%)
 Frame = +1

Query  163  LIMGKTSVAAANkdkdkdkkkPTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYS  342
            L+  KT+ A  +KDKDKDKK+P SRSSRAG+QFPVGRIHR LK RT+ANGRVGATAAVY 
Sbjct  9    LLAAKTTAANKDKDKDKDKKRPVSRSSRAGIQFPVGRIHRHLKTRTSANGRVGATAAVYL  68

Query  343  AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH  522
            A+ILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH
Sbjct  69   ASILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH  128

Query  523  KSLINKSSKE  552
            KSLINK++K+
Sbjct  129  KSLINKTTKD  138



>ref|XP_011026076.1| PREDICTED: histone H2A variant 1 [Populus euphratica]
 ref|XP_011026077.1| PREDICTED: histone H2A variant 1 [Populus euphratica]
 gb|ABK92943.1| unknown [Populus trichocarpa]
Length=137

 Score =   204 bits (518),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 110/129 (85%), Positives = 121/129 (94%), Gaps = 0/129 (0%)
 Frame = +1

Query  166  IMGKTSVAAANkdkdkdkkkPTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSA  345
            ++   + AAANKDKDKDKK+P SRSSRAG+QFPVGRIHR LK+R +A+GRVGATAAVY A
Sbjct  9    LLATKTTAAANKDKDKDKKRPVSRSSRAGIQFPVGRIHRHLKQRISAHGRVGATAAVYLA  68

Query  346  AILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHK  525
            +ILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHK
Sbjct  69   SILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHK  128

Query  526  SLINKSSKE  552
            SLINK++KE
Sbjct  129  SLINKTTKE  137



>gb|AFK43322.1| unknown [Lotus japonicus]
Length=135

 Score =   204 bits (518),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 100/109 (92%), Positives = 105/109 (96%), Gaps = 0/109 (0%)
 Frame = +1

Query  226  PTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKD  405
            PTSRSSRAG+QFPVGRIHR LK+R  ANGRVGATAAVY A+ILEYLTAEVLELAGNASKD
Sbjct  27   PTSRSSRAGIQFPVGRIHRQLKQRVQANGRVGATAAVYLASILEYLTAEVLELAGNASKD  86

Query  406  LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINK++KE
Sbjct  87   LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKTAKE  135



>ref|XP_008386405.1| PREDICTED: histone H2A variant 1-like [Malus domestica]
Length=138

 Score =   204 bits (518),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 110/130 (85%), Positives = 120/130 (92%), Gaps = 0/130 (0%)
 Frame = +1

Query  163  LIMGKTSVAAANkdkdkdkkkPTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYS  342
            LI  KT+ A  +K+K+KDKK+P SRSSRAG+QFPVGRIHR LK+R  A+GRVGATAAVY 
Sbjct  9    LIAAKTTAANKDKEKEKDKKRPVSRSSRAGIQFPVGRIHRQLKQRIAAHGRVGATAAVYL  68

Query  343  AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH  522
            A+ILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH
Sbjct  69   ASILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH  128

Query  523  KSLINKSSKE  552
            KSLINK+SKE
Sbjct  129  KSLINKTSKE  138



>emb|CAC84677.1| putative histone H2A [Pinus pinaster]
Length=139

 Score =   203 bits (517),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 114/131 (87%), Positives = 120/131 (92%), Gaps = 1/131 (1%)
 Frame = +1

Query  163  LIMGKTSV-AAANkdkdkdkkkPTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVY  339
            L+MGK+S     N +KDKDKKKP SRSSRAGLQFPVGRIHRLLK R +ANGRVGATAAVY
Sbjct  9    LLMGKSSAPVNNNNNKDKDKKKPVSRSSRAGLQFPVGRIHRLLKSRISANGRVGATAAVY  68

Query  340  SAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHI  519
            SAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIA GGV+ HI
Sbjct  69   SAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAVGGVVFHI  128

Query  520  HKSLINKSSKE  552
            HKSLINKSSK+
Sbjct  129  HKSLINKSSKD  139



>ref|NP_001064611.1| Os10g0418000 [Oryza sativa Japonica Group]
 sp|Q8S857.1|H2AV2_ORYSJ RecName: Full=Probable histone H2A variant 2 [Oryza sativa Japonica 
Group]
 gb|AAM08789.1|AC016780_19 Putative histone H2A [Oryza sativa]
 gb|AAP53784.1| Histone H2A variant, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF26525.1| Os10g0418000 [Oryza sativa Japonica Group]
 gb|EAY78499.1| hypothetical protein OsI_33592 [Oryza sativa Indica Group]
 gb|EAZ16090.1| hypothetical protein OsJ_31536 [Oryza sativa Japonica Group]
 dbj|BAH00529.1| unnamed protein product [Oryza sativa Japonica Group]
Length=139

 Score =   203 bits (517),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 100/109 (92%), Positives = 105/109 (96%), Gaps = 0/109 (0%)
 Frame = +1

Query  226  PTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKD  405
            P SRSSRAG+QFPVGRIHR LK R +ANGRVGATAAVY+AAILEYLTAEVLELAGNASKD
Sbjct  31   PVSRSSRAGIQFPVGRIHRQLKGRVSANGRVGATAAVYTAAILEYLTAEVLELAGNASKD  90

Query  406  LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINK++KE
Sbjct  91   LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKTAKE  139



>gb|KHG22538.1| Histone H2A variant 1 -like protein [Gossypium arboreum]
 gb|KJB09694.1| hypothetical protein B456_001G242100 [Gossypium raimondii]
Length=138

 Score =   203 bits (517),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 111/130 (85%), Positives = 120/130 (92%), Gaps = 0/130 (0%)
 Frame = +1

Query  163  LIMGKTSVAAANkdkdkdkkkPTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYS  342
            L+  KT+ A  +KDKDKDKK+P SRSSRAG+QFPVGRIHR LK R +ANGRVGATAAVY 
Sbjct  9    LLAAKTTAANKDKDKDKDKKRPVSRSSRAGIQFPVGRIHRHLKSRASANGRVGATAAVYL  68

Query  343  AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH  522
            A+ILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH
Sbjct  69   ASILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH  128

Query  523  KSLINKSSKE  552
            KSLINK++KE
Sbjct  129  KSLINKTTKE  138



>gb|EMT03513.1| Putative histone H2A variant 3 [Aegilops tauschii]
Length=145

 Score =   203 bits (517),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 105/117 (90%), Positives = 106/117 (91%), Gaps = 8/117 (7%)
 Frame = +1

Query  226  PTSRSSRAGLQ--------FPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLE  381
            P SRSSRAGLQ        FPVGRIHR LK+RT ANGRVGATAAVYSAAILEYLTAEVLE
Sbjct  29   PISRSSRAGLQVGLGFRDSFPVGRIHRQLKQRTQANGRVGATAAVYSAAILEYLTAEVLE  88

Query  382  LAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            LAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE
Sbjct  89   LAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  145



>ref|NP_001237025.1| uncharacterized protein LOC100306323 [Glycine max]
 ref|XP_003518898.1| PREDICTED: histone H2A variant 1-like [Glycine max]
 gb|ACU14445.1| unknown [Glycine max]
 gb|KHN03833.1| Histone H2A variant 1 [Glycine soja]
 gb|KHN18845.1| Histone H2A variant 1 [Glycine soja]
Length=136

 Score =   203 bits (516),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 112/130 (86%), Positives = 121/130 (93%), Gaps = 2/130 (2%)
 Frame = +1

Query  163  LIMGKTSVAAANkdkdkdkkkPTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYS  342
            L+  KT+  AANKDKDKDKK+P SRSSRAG+QFPVGRIHR LK+R  ANGRVGATAAVY 
Sbjct  9    LLAAKTT--AANKDKDKDKKRPISRSSRAGIQFPVGRIHRQLKQRVQANGRVGATAAVYL  66

Query  343  AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH  522
            A+ILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH
Sbjct  67   ASILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH  126

Query  523  KSLINKSSKE  552
            KSLINK++K+
Sbjct  127  KSLINKTAKD  136



>gb|EYU46538.1| hypothetical protein MIMGU_mgv1a016029mg [Erythranthe guttata]
 gb|EYU46539.1| hypothetical protein MIMGU_mgv1a016029mg [Erythranthe guttata]
 gb|EYU46540.1| hypothetical protein MIMGU_mgv1a016029mg [Erythranthe guttata]
Length=137

 Score =   203 bits (516),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 101/109 (93%), Positives = 105/109 (96%), Gaps = 0/109 (0%)
 Frame = +1

Query  226  PTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKD  405
            P SRS+RAGLQFPVGRIHR LK RT A+GRVGATAAVYSAAILEYLTAEVLELAGNASKD
Sbjct  29   PISRSARAGLQFPVGRIHRHLKTRTNAHGRVGATAAVYSAAILEYLTAEVLELAGNASKD  88

Query  406  LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINK++KE
Sbjct  89   LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKTTKE  137



>gb|AFK49165.1| unknown [Medicago truncatula]
Length=134

 Score =   203 bits (516),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 99/109 (91%), Positives = 104/109 (95%), Gaps = 0/109 (0%)
 Frame = +1

Query  226  PTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKD  405
            PTSRSSRAG+QFPVGRIHR LK+R  ANGRVGATAAVY A+ILEYLTAEVLELAGNASKD
Sbjct  26   PTSRSSRAGIQFPVGRIHRQLKQRVQANGRVGATAAVYLASILEYLTAEVLELAGNASKD  85

Query  406  LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            LKVKRITPRHLQLAIRGDEELDTL KGTIAGGGVIPHIHKSLINK++KE
Sbjct  86   LKVKRITPRHLQLAIRGDEELDTLTKGTIAGGGVIPHIHKSLINKTAKE  134



>ref|XP_004290644.1| PREDICTED: histone H2A variant 1 [Fragaria vesca subsp. vesca]
Length=136

 Score =   202 bits (515),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 113/130 (87%), Positives = 121/130 (93%), Gaps = 2/130 (2%)
 Frame = +1

Query  163  LIMGKTSVAAANkdkdkdkkkPTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYS  342
            L+  KT+  AANKDKDKDKK+P SRSSRAG+QFPVGRIHR LK+R  A+GRVGATAAVY 
Sbjct  9    LLAQKTT--AANKDKDKDKKRPVSRSSRAGIQFPVGRIHRQLKQRIAAHGRVGATAAVYL  66

Query  343  AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH  522
            A+ILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH
Sbjct  67   ASILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH  126

Query  523  KSLINKSSKE  552
            KSLINK+SKE
Sbjct  127  KSLINKTSKE  136



>ref|XP_010087116.1| Histone H2A variant 1 [Morus notabilis]
 gb|EXB26556.1| Histone H2A variant 1 [Morus notabilis]
Length=138

 Score =   202 bits (515),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 111/130 (85%), Positives = 120/130 (92%), Gaps = 0/130 (0%)
 Frame = +1

Query  163  LIMGKTSVAAANkdkdkdkkkPTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYS  342
            L+  KT+ A  +KDKDKDKK+P SRSSRAG+QFPVGRIHR LK R +ANGRVGATAAVY 
Sbjct  9    LLAAKTTAANKDKDKDKDKKRPVSRSSRAGIQFPVGRIHRHLKTRISANGRVGATAAVYL  68

Query  343  AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH  522
            A+ILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH
Sbjct  69   ASILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH  128

Query  523  KSLINKSSKE  552
            KSLINK+SK+
Sbjct  129  KSLINKTSKD  138



>ref|XP_002985509.1| hypothetical protein SELMODRAFT_122533 [Selaginella moellendorffii]
 ref|XP_002987056.1| hypothetical protein SELMODRAFT_125194 [Selaginella moellendorffii]
 gb|EFJ11899.1| hypothetical protein SELMODRAFT_125194 [Selaginella moellendorffii]
 gb|EFJ13383.1| hypothetical protein SELMODRAFT_122533 [Selaginella moellendorffii]
Length=135

 Score =   202 bits (514),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 99/109 (91%), Positives = 103/109 (94%), Gaps = 0/109 (0%)
 Frame = +1

Query  226  PTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKD  405
            P SRSS+AGLQFPVGRIHR+LK R  ANGRVGATAAVYSAAILEYLTAEVLELAGNASKD
Sbjct  26   PMSRSSKAGLQFPVGRIHRMLKTRVAANGRVGATAAVYSAAILEYLTAEVLELAGNASKD  85

Query  406  LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            LKVKRITPRHLQLAIRGDEELD LIKGTIAGGGVIPHIHKSLINK+ K+
Sbjct  86   LKVKRITPRHLQLAIRGDEELDALIKGTIAGGGVIPHIHKSLINKTPKK  134



>ref|XP_010098975.1| putative histone H2A variant 3 [Morus notabilis]
 gb|EXB76277.1| putative histone H2A variant 3 [Morus notabilis]
Length=425

 Score =   211 bits (537),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 114/130 (88%), Positives = 116/130 (89%), Gaps = 1/130 (1%)
 Frame = +1

Query  163  LIMGKTSVAAANkdkdkdkkkPTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYS  342
            LI GKTS A         KK P SRSSRAGLQFPVGRIHRLLK RTT+NGRVGATAAVYS
Sbjct  9    LITGKTSAANNANKDKDKKK-PISRSSRAGLQFPVGRIHRLLKLRTTSNGRVGATAAVYS  67

Query  343  AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH  522
            AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH
Sbjct  68   AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH  127

Query  523  KSLINKSSKE  552
            KSLINKSSK+
Sbjct  128  KSLINKSSKD  137



>ref|XP_006386250.1| hypothetical protein POPTR_0002s04720g, partial [Populus trichocarpa]
 gb|ERP64047.1| hypothetical protein POPTR_0002s04720g, partial [Populus trichocarpa]
Length=202

 Score =   204 bits (519),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 110/129 (85%), Positives = 121/129 (94%), Gaps = 0/129 (0%)
 Frame = +1

Query  166  IMGKTSVAAANkdkdkdkkkPTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSA  345
            ++   + AAANKDKDKDKK+P SRSSRAG+QFPVGRIHR LK+R +A+GRVGATAAVY A
Sbjct  74   LLATKTTAAANKDKDKDKKRPVSRSSRAGIQFPVGRIHRHLKQRISAHGRVGATAAVYLA  133

Query  346  AILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHK  525
            +ILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHK
Sbjct  134  SILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHK  193

Query  526  SLINKSSKE  552
            SLINK++KE
Sbjct  194  SLINKTTKE  202



>ref|NP_191019.1| histone H2A 11 [Arabidopsis thaliana]
 ref|XP_002876259.1| histone H2A.F/Z [Arabidopsis lyrata subsp. lyrata]
 sp|O23628.1|H2AV1_ARATH RecName: Full=Histone H2A variant 1; AltName: Full=H2A.F/Z 1; 
AltName: Full=H2AvAt; AltName: Full=HTA11 [Arabidopsis thaliana]
 emb|CAA73155.1| histone H2A.F/Z [Arabidopsis thaliana]
 emb|CAB77576.1| histone H2A.F/Z [Arabidopsis thaliana]
 gb|AAM64788.1| histone H2A.F/Z [Arabidopsis thaliana]
 gb|AAO63269.1| At3g54560 [Arabidopsis thaliana]
 dbj|BAF00012.1| histone H2A.F/Z [Arabidopsis thaliana]
 gb|EFH52518.1| histone H2A.F/Z [Arabidopsis lyrata subsp. lyrata]
 gb|AEE79250.1| histone H2A 11 [Arabidopsis thaliana]
Length=136

 Score =   202 bits (513),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 112/130 (86%), Positives = 121/130 (93%), Gaps = 2/130 (2%)
 Frame = +1

Query  163  LIMGKTSVAAANkdkdkdkkkPTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYS  342
            L+  KT   AANKDKDKDKKKP SRS+RAG+QFPVGRIHR LK R +A+GRVGATAAVY+
Sbjct  9    LVAAKT--MAANKDKDKDKKKPISRSARAGIQFPVGRIHRQLKTRVSAHGRVGATAAVYT  66

Query  343  AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH  522
            A+ILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH
Sbjct  67   ASILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH  126

Query  523  KSLINKSSKE  552
            KSLINK++KE
Sbjct  127  KSLINKTTKE  136



>gb|KHG06453.1| Histone H2A variant 1 -like protein [Gossypium arboreum]
 gb|KJB25954.1| hypothetical protein B456_004G217900 [Gossypium raimondii]
 gb|KJB25955.1| hypothetical protein B456_004G217900 [Gossypium raimondii]
Length=136

 Score =   201 bits (512),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 109/125 (87%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = +1

Query  178  TSVAAANkdkdkdkkkPTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILE  357
            T   AANKDKDKDKK+P SRSSRAG+QFPVGRIHR LK R +A+GRVGATAAVY A+ILE
Sbjct  12   TKTTAANKDKDKDKKRPVSRSSRAGIQFPVGRIHRQLKSRASAHGRVGATAAVYLASILE  71

Query  358  YLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLIN  537
            YLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLIN
Sbjct  72   YLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLIN  131

Query  538  KSSKE  552
            K++K+
Sbjct  132  KTTKD  136



>ref|XP_004145372.1| PREDICTED: histone H2A variant 1-like isoform 1 [Cucumis sativus]
 ref|XP_004145373.1| PREDICTED: histone H2A variant 1-like isoform 2 [Cucumis sativus]
 ref|XP_004152957.1| PREDICTED: histone H2A variant 1-like isoform 1 [Cucumis sativus]
 ref|XP_004152958.1| PREDICTED: histone H2A variant 1-like isoform 2 [Cucumis sativus]
 ref|XP_004163562.1| PREDICTED: histone H2A variant 1-like isoform 1 [Cucumis sativus]
 ref|XP_004163563.1| PREDICTED: histone H2A variant 1-like isoform 2 [Cucumis sativus]
 ref|XP_008449356.1| PREDICTED: histone H2A variant 1 [Cucumis melo]
 ref|XP_008449357.1| PREDICTED: histone H2A variant 1 [Cucumis melo]
 ref|XP_008449358.1| PREDICTED: histone H2A variant 1 [Cucumis melo]
 gb|KGN61697.1| Histone H2A [Cucumis sativus]
Length=136

 Score =   201 bits (512),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 111/121 (92%), Positives = 116/121 (96%), Gaps = 0/121 (0%)
 Frame = +1

Query  190  AANkdkdkdkkkPTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTA  369
            AANKDKDKDKKKP SRSSRAG+QFPVGRIHR LK R +ANGRVGATAAVY A+ILEYLTA
Sbjct  16   AANKDKDKDKKKPISRSSRAGIQFPVGRIHRHLKTRISANGRVGATAAVYLASILEYLTA  75

Query  370  EVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSK  549
            EVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINK+SK
Sbjct  76   EVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKASK  135

Query  550  E  552
            +
Sbjct  136  D  136



>ref|XP_002504544.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO65802.1| predicted protein [Micromonas sp. RCC299]
Length=141

 Score =   201 bits (511),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 99/109 (91%), Positives = 102/109 (94%), Gaps = 0/109 (0%)
 Frame = +1

Query  226  PTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKD  405
            PTSRS +AGLQFPVGRIHR LK R  + GRVGATAAVYSAAILEYLTAEVLELAGNASKD
Sbjct  31   PTSRSVKAGLQFPVGRIHRFLKNRAASGGRVGATAAVYSAAILEYLTAEVLELAGNASKD  90

Query  406  LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            LKVKRITPRHLQLAIRGDEELDTLIK TIAGGGVIPHIHKSLINKSSK+
Sbjct  91   LKVKRITPRHLQLAIRGDEELDTLIKATIAGGGVIPHIHKSLINKSSKK  139



>ref|XP_002956228.1| hypothetical protein VOLCADRAFT_109344 [Volvox carteri f. nagariensis]
 gb|EFJ42767.1| hypothetical protein VOLCADRAFT_109344 [Volvox carteri f. nagariensis]
Length=144

 Score =   201 bits (511),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 98/109 (90%), Positives = 104/109 (95%), Gaps = 0/109 (0%)
 Frame = +1

Query  226  PTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKD  405
            PTSRS++AGLQFPVGRIHRLLK R TANGRVGAT+AVY+AAILEYLTAEVLELAGNASKD
Sbjct  29   PTSRSAKAGLQFPVGRIHRLLKSRVTANGRVGATSAVYAAAILEYLTAEVLELAGNASKD  88

Query  406  LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            LKVKRITPRHLQLAIRGDEELDTLIK TIAGGGVIPHIHKSLI+K  K+
Sbjct  89   LKVKRITPRHLQLAIRGDEELDTLIKATIAGGGVIPHIHKSLISKQQKK  137



>emb|CDY57201.1| BnaA04g27780D [Brassica napus]
Length=122

 Score =   200 bits (509),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 106/121 (88%), Positives = 114/121 (94%), Gaps = 0/121 (0%)
 Frame = +1

Query  190  AANkdkdkdkkkPTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTA  369
            AANKDKDK K KP SRS+RAG+QFPVGRIHR LK R +A+GRVGATAAVY+A+ILEYLTA
Sbjct  2    AANKDKDKGKMKPISRSARAGIQFPVGRIHRQLKTRVSAHGRVGATAAVYTASILEYLTA  61

Query  370  EVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSK  549
            EVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINK++ 
Sbjct  62   EVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKTTN  121

Query  550  E  552
            E
Sbjct  122  E  122



>ref|XP_009380411.1| PREDICTED: histone H2A variant 1-like [Musa acuminata subsp. 
malaccensis]
Length=136

 Score =   201 bits (510),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 111/130 (85%), Positives = 116/130 (89%), Gaps = 2/130 (2%)
 Frame = +1

Query  163  LIMGKTSVAAANkdkdkdkkkPTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYS  342
            LI  +TSV  +NKDKDK K    SRS RAGLQFPVGR+HRLLK R  A+GRVGATAAVY 
Sbjct  9    LITARTSVPNSNKDKDKKKA--ISRSHRAGLQFPVGRVHRLLKSRVAAHGRVGATAAVYL  66

Query  343  AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH  522
            AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH
Sbjct  67   AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH  126

Query  523  KSLINKSSKE  552
            KSLINKSSK+
Sbjct  127  KSLINKSSKD  136



>ref|XP_005851876.1| hypothetical protein CHLNCDRAFT_133450 [Chlorella variabilis]
 gb|EFN59774.1| hypothetical protein CHLNCDRAFT_133450 [Chlorella variabilis]
Length=147

 Score =   201 bits (511),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 100/109 (92%), Positives = 103/109 (94%), Gaps = 0/109 (0%)
 Frame = +1

Query  226  PTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKD  405
            P SRS+RAGLQFPVGRIHRLLK R TANGRVGATAAVY+AAILEYLTAEVLELAGNASKD
Sbjct  30   PISRSARAGLQFPVGRIHRLLKGRATANGRVGATAAVYTAAILEYLTAEVLELAGNASKD  89

Query  406  LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            LKVKRITPRHLQLAIRGDEELDTLIK TIAGGGVIPHIHKSLINK  K+
Sbjct  90   LKVKRITPRHLQLAIRGDEELDTLIKATIAGGGVIPHIHKSLINKQGKK  138



>ref|XP_007509240.1| unknown [Bathycoccus prasinos]
 emb|CCO19697.1| unknown [Bathycoccus prasinos]
Length=143

 Score =   201 bits (511),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 99/109 (91%), Positives = 102/109 (94%), Gaps = 0/109 (0%)
 Frame = +1

Query  226  PTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKD  405
            PTSRS +AGLQFPVGRIHR LK R  + GRVGATAAVYSAAILEYLTAEVLELAGNASKD
Sbjct  33   PTSRSVKAGLQFPVGRIHRFLKNRAASGGRVGATAAVYSAAILEYLTAEVLELAGNASKD  92

Query  406  LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            LKVKRITPRHLQLAIRGDEELDTLIK TIAGGGVIPHIHKSLINKSSK+
Sbjct  93   LKVKRITPRHLQLAIRGDEELDTLIKATIAGGGVIPHIHKSLINKSSKK  141



>ref|XP_009139231.1| PREDICTED: histone H2A variant 1 [Brassica rapa]
Length=136

 Score =   201 bits (510),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 109/130 (84%), Positives = 118/130 (91%), Gaps = 2/130 (2%)
 Frame = +1

Query  163  LIMGKTSVAAANkdkdkdkkkPTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYS  342
            L+  KT   AANKDKDK K KP SRS+RAG+QFPVGRIHR LK R +A+GRVGATAAVY+
Sbjct  9    LVAAKT--MAANKDKDKGKMKPISRSARAGIQFPVGRIHRQLKTRVSAHGRVGATAAVYT  66

Query  343  AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH  522
            A+ILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH
Sbjct  67   ASILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH  126

Query  523  KSLINKSSKE  552
            KSLINK++ E
Sbjct  127  KSLINKTTNE  136



>ref|XP_001693700.1| histone H2A variant [Chlamydomonas reinhardtii]
 gb|EDP08954.1| histone H2A variant [Chlamydomonas reinhardtii]
Length=144

 Score =   201 bits (510),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 98/109 (90%), Positives = 103/109 (94%), Gaps = 0/109 (0%)
 Frame = +1

Query  226  PTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKD  405
            PTSRS +AGLQFPVGRIHRLLK R TANGRVGAT+AVY+AAILEYLTAEVLELAGNASKD
Sbjct  29   PTSRSQKAGLQFPVGRIHRLLKSRVTANGRVGATSAVYAAAILEYLTAEVLELAGNASKD  88

Query  406  LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            LKVKRITPRHLQLAIRGDEELDTLIK TIAGGGVIPHIHKSLI+K  K+
Sbjct  89   LKVKRITPRHLQLAIRGDEELDTLIKATIAGGGVIPHIHKSLISKQQKK  137



>ref|XP_003059832.1| histone H2A [Micromonas pusilla CCMP1545]
 gb|EEH55784.1| histone H2A [Micromonas pusilla CCMP1545]
Length=140

 Score =   201 bits (510),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 99/109 (91%), Positives = 102/109 (94%), Gaps = 0/109 (0%)
 Frame = +1

Query  226  PTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKD  405
            PTSRS +AGLQFPVGRIHR LK R  + GRVGATAAVYSAAILEYLTAEVLELAGNASKD
Sbjct  30   PTSRSVKAGLQFPVGRIHRFLKNRAASGGRVGATAAVYSAAILEYLTAEVLELAGNASKD  89

Query  406  LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            LKVKRITPRHLQLAIRGDEELDTLIK TIAGGGVIPHIHKSLINKSSK+
Sbjct  90   LKVKRITPRHLQLAIRGDEELDTLIKATIAGGGVIPHIHKSLINKSSKK  138



>gb|EPS72017.1| hypothetical protein M569_02741, partial [Genlisea aurea]
Length=106

 Score =   199 bits (507),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 99/106 (93%), Positives = 103/106 (97%), Gaps = 0/106 (0%)
 Frame = +1

Query  235  RSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKV  414
            RS+RAGLQFPVGRIHR LK RTTA+GRVGATAAVYSAAILEYLTAEVLELAGNASKDLKV
Sbjct  1    RSARAGLQFPVGRIHRHLKSRTTAHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKV  60

Query  415  KRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            KRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINK++ E
Sbjct  61   KRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKTTSE  106



>ref|XP_004336226.1| Histone H2A variant, putative [Acanthamoeba castellanii str. 
Neff]
 gb|ELR14213.1| Histone H2A variant, putative [Acanthamoeba castellanii str. 
Neff]
Length=131

 Score =   200 bits (508),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 98/109 (90%), Positives = 102/109 (94%), Gaps = 0/109 (0%)
 Frame = +1

Query  226  PTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKD  405
            P SRS+RAGLQFPVGRIHR LK+R T NGRVGATAAVYSAAILEYLTAEVLELAGNASKD
Sbjct  18   PISRSARAGLQFPVGRIHRFLKQRATNNGRVGATAAVYSAAILEYLTAEVLELAGNASKD  77

Query  406  LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
             KVKRITPRHLQLAIRGDEELDTLIK TIAGGGVIPHIHKSLI KS+K+
Sbjct  78   YKVKRITPRHLQLAIRGDEELDTLIKATIAGGGVIPHIHKSLIKKSNKK  126



>ref|XP_006403558.1| hypothetical protein EUTSA_v10010813mg [Eutrema salsugineum]
 gb|ESQ45011.1| hypothetical protein EUTSA_v10010813mg [Eutrema salsugineum]
Length=136

 Score =   200 bits (509),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 111/130 (85%), Positives = 120/130 (92%), Gaps = 2/130 (2%)
 Frame = +1

Query  163  LIMGKTSVAAANkdkdkdkkkPTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYS  342
            L+  KT   A NKDKDKDKKKP SRS+RAG+QFPVGRIHR LK R +A+GRVGATAAVY+
Sbjct  9    LVAAKT--MAGNKDKDKDKKKPISRSARAGIQFPVGRIHRQLKTRVSAHGRVGATAAVYT  66

Query  343  AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH  522
            A+ILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH
Sbjct  67   ASILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH  126

Query  523  KSLINKSSKE  552
            KSLINK++KE
Sbjct  127  KSLINKTTKE  136



>ref|XP_003074738.1| H2a Histone H2A, probable (IC) [Ostreococcus tauri]
 emb|CAL51996.2| Histone core [Ostreococcus tauri]
Length=143

 Score =   200 bits (509),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 98/109 (90%), Positives = 102/109 (94%), Gaps = 0/109 (0%)
 Frame = +1

Query  226  PTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKD  405
            PTSRS +AGLQFPVGRIHR LK R  + GRVGATAAVYSAAILEYLTAEVLELAGNASKD
Sbjct  33   PTSRSVKAGLQFPVGRIHRFLKNRAASGGRVGATAAVYSAAILEYLTAEVLELAGNASKD  92

Query  406  LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            LKVKRITPRHLQLAIRGDEELDTLIK TIAGGGVIPHIHKSL+NKSSK+
Sbjct  93   LKVKRITPRHLQLAIRGDEELDTLIKATIAGGGVIPHIHKSLMNKSSKK  141



>ref|XP_010427164.1| PREDICTED: histone H2A variant 1-like [Camelina sativa]
 ref|XP_010427165.1| PREDICTED: histone H2A variant 1-like [Camelina sativa]
 ref|XP_010427166.1| PREDICTED: histone H2A variant 1-like [Camelina sativa]
Length=137

 Score =   200 bits (508),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 97/109 (89%), Positives = 105/109 (96%), Gaps = 0/109 (0%)
 Frame = +1

Query  226  PTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKD  405
            P SRS+RAG+QFPVGRIHR LK R +A+GRVGATAAVY+A+ILEYLTAEVLELAGNASKD
Sbjct  29   PISRSARAGIQFPVGRIHRQLKNRVSAHGRVGATAAVYTASILEYLTAEVLELAGNASKD  88

Query  406  LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINK++KE
Sbjct  89   LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKTTKE  137



>ref|XP_002307619.1| hypothetical protein POPTR_0005s23810g [Populus trichocarpa]
 ref|XP_006383681.1| hypothetical protein POPTR_0005s23810g [Populus trichocarpa]
 ref|XP_006383682.1| hypothetical protein POPTR_0005s23810g [Populus trichocarpa]
 ref|XP_006383683.1| histone H2A family protein [Populus trichocarpa]
 ref|XP_011042445.1| PREDICTED: histone H2A variant 1-like [Populus euphratica]
 ref|XP_011042446.1| PREDICTED: histone H2A variant 1-like [Populus euphratica]
 gb|ABK95317.1| unknown [Populus trichocarpa]
 gb|EEE94615.1| hypothetical protein POPTR_0005s23810g [Populus trichocarpa]
 gb|ERP61478.1| hypothetical protein POPTR_0005s23810g [Populus trichocarpa]
 gb|ERP61479.1| hypothetical protein POPTR_0005s23810g [Populus trichocarpa]
 gb|ERP61480.1| histone H2A family protein [Populus trichocarpa]
Length=139

 Score =   200 bits (508),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 98/109 (90%), Positives = 105/109 (96%), Gaps = 0/109 (0%)
 Frame = +1

Query  226  PTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKD  405
            P SRSSRAG+QFPVGRIHR LK+R +A+GRVGATAAVY A+ILEYLTAEVLELAGNASKD
Sbjct  31   PVSRSSRAGIQFPVGRIHRHLKQRISAHGRVGATAAVYLASILEYLTAEVLELAGNASKD  90

Query  406  LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINK++KE
Sbjct  91   LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKTTKE  139



>ref|XP_010504270.1| PREDICTED: histone H2A variant 1 [Camelina sativa]
 ref|XP_010515991.1| PREDICTED: histone H2A variant 1 [Camelina sativa]
 ref|XP_010515992.1| PREDICTED: histone H2A variant 1 [Camelina sativa]
 ref|XP_010515993.1| PREDICTED: histone H2A variant 1 [Camelina sativa]
 ref|XP_010515994.1| PREDICTED: histone H2A variant 1 [Camelina sativa]
Length=136

 Score =   200 bits (508),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 111/130 (85%), Positives = 120/130 (92%), Gaps = 2/130 (2%)
 Frame = +1

Query  163  LIMGKTSVAAANkdkdkdkkkPTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYS  342
            L+  KT   A NKDKDKDKKKP SRS+RAG+QFPVGRIHR LK R +A+GRVGATAAVY+
Sbjct  9    LVAAKT--MAGNKDKDKDKKKPISRSARAGIQFPVGRIHRQLKNRVSAHGRVGATAAVYT  66

Query  343  AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH  522
            A+ILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH
Sbjct  67   ASILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH  126

Query  523  KSLINKSSKE  552
            KSLINK++KE
Sbjct  127  KSLINKTNKE  136



>ref|XP_010525349.1| PREDICTED: histone H2A variant 1 [Tarenaya hassleriana]
 ref|XP_010525350.1| PREDICTED: histone H2A variant 1 [Tarenaya hassleriana]
Length=136

 Score =   200 bits (508),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 110/130 (85%), Positives = 121/130 (93%), Gaps = 2/130 (2%)
 Frame = +1

Query  163  LIMGKTSVAAANkdkdkdkkkPTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYS  342
            L+  KT+  A NKDKDKDKKKP SRS+RAG+QFPVGRIHR LK R +A+GRVGATAAVY+
Sbjct  9    LVAAKTT--ATNKDKDKDKKKPISRSARAGIQFPVGRIHRQLKTRVSAHGRVGATAAVYT  66

Query  343  AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH  522
            A+ILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH
Sbjct  67   ASILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH  126

Query  523  KSLINKSSKE  552
            KSLINK++K+
Sbjct  127  KSLINKTTKD  136



>ref|XP_009601396.1| PREDICTED: probable histone H2A variant 3, partial [Nicotiana 
tomentosiformis]
Length=106

 Score =   199 bits (505),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 98/100 (98%), Positives = 99/100 (99%), Gaps = 0/100 (0%)
 Frame = +1

Query  253  LQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPR  432
             QFPVGRIHRLLKERTTANGRVGATAAVYSAAI+EYLTAEVLELAGNASKDLKVKRITPR
Sbjct  7    FQFPVGRIHRLLKERTTANGRVGATAAVYSAAIMEYLTAEVLELAGNASKDLKVKRITPR  66

Query  433  HLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            HLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE
Sbjct  67   HLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  106



>ref|XP_009103924.1| PREDICTED: histone H2A variant 1-like [Brassica rapa]
 emb|CDY07535.1| BnaC06g15290D [Brassica napus]
 emb|CDX67603.1| BnaA07g16430D [Brassica napus]
Length=138

 Score =   199 bits (507),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 109/130 (84%), Positives = 119/130 (92%), Gaps = 0/130 (0%)
 Frame = +1

Query  163  LIMGKTSVAAANkdkdkdkkkPTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYS  342
            L+  KT  A  +KDKDKDKKKP SRS+RAG+QFPVGRIHR LK R +A+GRVGATAAVY+
Sbjct  9    LVAAKTMAANKDKDKDKDKKKPMSRSARAGIQFPVGRIHRQLKTRVSAHGRVGATAAVYT  68

Query  343  AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH  522
            A+ILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH
Sbjct  69   ASILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH  128

Query  523  KSLINKSSKE  552
            KSLINK++ E
Sbjct  129  KSLINKTTNE  138



>ref|XP_007200594.1| hypothetical protein PRUPE_ppa013146mg [Prunus persica]
 ref|XP_007200595.1| hypothetical protein PRUPE_ppa013146mg [Prunus persica]
 ref|XP_008235340.1| PREDICTED: histone H2A variant 1 [Prunus mume]
 gb|EMJ01793.1| hypothetical protein PRUPE_ppa013146mg [Prunus persica]
 gb|EMJ01794.1| hypothetical protein PRUPE_ppa013146mg [Prunus persica]
Length=138

 Score =   199 bits (507),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 108/130 (83%), Positives = 118/130 (91%), Gaps = 0/130 (0%)
 Frame = +1

Query  163  LIMGKTSVAAANkdkdkdkkkPTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYS  342
            L+  KT+ A  +K+K+KDKK+P SRSSRAG+QFPVGRIHR LK R  A+GRVGA AAVY 
Sbjct  9    LLAAKTTAANKDKEKEKDKKRPVSRSSRAGIQFPVGRIHRQLKSRIAAHGRVGANAAVYL  68

Query  343  AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH  522
            A+ILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH
Sbjct  69   ASILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH  128

Query  523  KSLINKSSKE  552
            KSLINK+SKE
Sbjct  129  KSLINKTSKE  138



>ref|XP_010554466.1| PREDICTED: histone H2A variant 1-like [Tarenaya hassleriana]
 ref|XP_010554467.1| PREDICTED: histone H2A variant 1-like [Tarenaya hassleriana]
 ref|XP_010554468.1| PREDICTED: histone H2A variant 1-like [Tarenaya hassleriana]
Length=136

 Score =   199 bits (507),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 109/130 (84%), Positives = 121/130 (93%), Gaps = 2/130 (2%)
 Frame = +1

Query  163  LIMGKTSVAAANkdkdkdkkkPTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYS  342
            L+  KT+  AANKDKDKDKK+P SRS+RAG+QFPVGR+HR LK R +A+GRVGATAAVY 
Sbjct  9    LVAAKTT--AANKDKDKDKKRPISRSARAGIQFPVGRLHRQLKTRVSAHGRVGATAAVYM  66

Query  343  AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH  522
            A+ILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH
Sbjct  67   ASILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH  126

Query  523  KSLINKSSKE  552
            KSLINK++K+
Sbjct  127  KSLINKTTKD  136



>ref|XP_010517203.1| PREDICTED: probable histone H2A variant 2 [Camelina sativa]
 ref|XP_010517204.1| PREDICTED: probable histone H2A variant 2 [Camelina sativa]
Length=135

 Score =   199 bits (506),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 107/130 (82%), Positives = 116/130 (89%), Gaps = 3/130 (2%)
 Frame = +1

Query  163  LIMGKTSVAAANkdkdkdkkkPTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYS  342
            LI GKT   AANKD    KK   SRSSRAG+QFPVGRIHR LK+R +A+GRVGATAAVY+
Sbjct  9    LIAGKT--VAANKDSSVKKK-SISRSSRAGIQFPVGRIHRQLKQRVSAHGRVGATAAVYA  65

Query  343  AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH  522
            A+ILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH
Sbjct  66   ASILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH  125

Query  523  KSLINKSSKE  552
            KSL+NK +K+
Sbjct  126  KSLVNKVTKD  135



>gb|AFK41330.1| unknown [Lotus japonicus]
Length=135

 Score =   199 bits (506),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 98/109 (90%), Positives = 103/109 (94%), Gaps = 0/109 (0%)
 Frame = +1

Query  226  PTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKD  405
            P SRSSRAG+QFPVGRIHR LK+R  A+GRVG TAAVY A+ILEYLTAEVLELAGNASKD
Sbjct  27   PVSRSSRAGIQFPVGRIHRQLKQRAHAHGRVGGTAAVYLASILEYLTAEVLELAGNASKD  86

Query  406  LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINK+SKE
Sbjct  87   LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKTSKE  135



>ref|XP_010038048.1| PREDICTED: histone H2A variant 1 [Eucalyptus grandis]
 gb|KCW49846.1| hypothetical protein EUGRSUZ_K03318 [Eucalyptus grandis]
Length=137

 Score =   199 bits (505),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 98/109 (90%), Positives = 104/109 (95%), Gaps = 0/109 (0%)
 Frame = +1

Query  226  PTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKD  405
            P SRSSRAG+QFPVGRIHR LK R +ANGRVGATAAVY A+ILEYLTAEVLELAGNASKD
Sbjct  29   PISRSSRAGIQFPVGRIHRHLKTRISANGRVGATAAVYLASILEYLTAEVLELAGNASKD  88

Query  406  LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINK++K+
Sbjct  89   LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKTTKD  137



>emb|CDY13216.1| BnaC04g26190D [Brassica napus]
Length=187

 Score =   200 bits (509),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 109/130 (84%), Positives = 118/130 (91%), Gaps = 2/130 (2%)
 Frame = +1

Query  163  LIMGKTSVAAANkdkdkdkkkPTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYS  342
            L+  KT   AANKDKDK K KP SRS+RAG+QFPVGRIHR LK R +A+GRVGATAAVY+
Sbjct  60   LVAAKT--MAANKDKDKGKMKPISRSARAGIQFPVGRIHRQLKTRVSAHGRVGATAAVYT  117

Query  343  AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH  522
            A+ILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH
Sbjct  118  ASILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH  177

Query  523  KSLINKSSKE  552
            KSLINK++ E
Sbjct  178  KSLINKTTNE  187



>ref|XP_009116136.1| PREDICTED: histone H2A variant 1-like [Brassica rapa]
 emb|CDX78246.1| BnaA09g34410D [Brassica napus]
Length=136

 Score =   198 bits (504),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 108/125 (86%), Positives = 116/125 (93%), Gaps = 0/125 (0%)
 Frame = +1

Query  178  TSVAAANkdkdkdkkkPTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILE  357
            T   A NKDKDKDKKKP +RS+RAG+QFPVGRIHR LK R +A+GRVGATAAVY+A+ILE
Sbjct  12   TKTMAGNKDKDKDKKKPITRSARAGIQFPVGRIHRQLKTRVSAHGRVGATAAVYTASILE  71

Query  358  YLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLIN  537
            YLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLIN
Sbjct  72   YLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLIN  131

Query  538  KSSKE  552
            K+ KE
Sbjct  132  KAIKE  136



>ref|XP_002281266.1| PREDICTED: histone H2A variant 1 [Vitis vinifera]
 emb|CBI25061.3| unnamed protein product [Vitis vinifera]
Length=133

 Score =   198 bits (504),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 97/106 (92%), Positives = 102/106 (96%), Gaps = 0/106 (0%)
 Frame = +1

Query  226  PTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKD  405
            P SRSSRAG+QFPVGRIHR LK R +A+GRVGATAAVY+A+ILEYLTAEVLELAGNASKD
Sbjct  26   PVSRSSRAGIQFPVGRIHRQLKSRISAHGRVGATAAVYTASILEYLTAEVLELAGNASKD  85

Query  406  LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKS  543
            LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKS
Sbjct  86   LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKS  131



>ref|XP_006291960.1| hypothetical protein CARUB_v10018149mg, partial [Capsella rubella]
 gb|EOA24858.1| hypothetical protein CARUB_v10018149mg, partial [Capsella rubella]
Length=163

 Score =   199 bits (506),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 110/130 (85%), Positives = 120/130 (92%), Gaps = 2/130 (2%)
 Frame = +1

Query  163  LIMGKTSVAAANkdkdkdkkkPTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYS  342
            L+  KT   A NKDKDKDKKKP SRS+RAG+QFPVGRIHR LK R +A+GRVGATAAVY+
Sbjct  36   LVAAKT--MAGNKDKDKDKKKPISRSARAGIQFPVGRIHRQLKTRVSAHGRVGATAAVYT  93

Query  343  AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH  522
            A+ILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH
Sbjct  94   ASILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH  153

Query  523  KSLINKSSKE  552
            KSLINK+++E
Sbjct  154  KSLINKTTRE  163



>ref|XP_010505538.1| PREDICTED: probable histone H2A variant 2 [Camelina sativa]
Length=135

 Score =   198 bits (503),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 95/107 (89%), Positives = 104/107 (97%), Gaps = 0/107 (0%)
 Frame = +1

Query  232  SRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKDLK  411
            SRSSRAG+QFPVGRIHR LK+R +A+GRVGATAAVY+A+ILEYLTAEVLELAGNASKDLK
Sbjct  29   SRSSRAGIQFPVGRIHRQLKQRVSAHGRVGATAAVYTASILEYLTAEVLELAGNASKDLK  88

Query  412  VKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            VKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSL+NK +K+
Sbjct  89   VKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLVNKVTKD  135



>emb|CDX73471.1| BnaC08g25320D [Brassica napus]
Length=208

 Score =   200 bits (508),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 108/125 (86%), Positives = 116/125 (93%), Gaps = 0/125 (0%)
 Frame = +1

Query  178  TSVAAANkdkdkdkkkPTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILE  357
            T   A NKDKDKDKKKP +RS+RAG+QFPVGRIHR LK R +A+GRVGATAAVY+A+ILE
Sbjct  84   TKTMAGNKDKDKDKKKPITRSARAGIQFPVGRIHRQLKTRVSAHGRVGATAAVYTASILE  143

Query  358  YLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLIN  537
            YLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLIN
Sbjct  144  YLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLIN  203

Query  538  KSSKE  552
            K+ KE
Sbjct  204  KAIKE  208



>ref|NP_181415.1| histone H2A 8 [Arabidopsis thaliana]
 ref|NP_850298.1| histone H2A 8 [Arabidopsis thaliana]
 ref|NP_850299.1| histone H2A 8 [Arabidopsis thaliana]
 sp|Q9SII0.1|H2AV2_ARATH RecName: Full=Probable histone H2A variant 2; AltName: Full=H2A.F/Z 
2; AltName: Full=HTA8 [Arabidopsis thaliana]
 gb|AAD25562.1| histone H2A [Arabidopsis thaliana]
 gb|AAM66104.1| histone H2A [Arabidopsis thaliana]
 dbj|BAD94243.1| histone H2A [Arabidopsis thaliana]
 dbj|BAF00219.1| histone H2A [Arabidopsis thaliana]
 gb|ABH04530.1| At2g38810 [Arabidopsis thaliana]
 gb|AEC09586.1| histone H2A 8 [Arabidopsis thaliana]
 gb|AEC09587.1| histone H2A 8 [Arabidopsis thaliana]
 gb|AEC09588.1| histone H2A 8 [Arabidopsis thaliana]
Length=136

 Score =   197 bits (501),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 95/107 (89%), Positives = 104/107 (97%), Gaps = 0/107 (0%)
 Frame = +1

Query  232  SRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKDLK  411
            SRSSRAG+QFPVGRIHR LK+R +A+GRVGATAAVY+A+ILEYLTAEVLELAGNASKDLK
Sbjct  30   SRSSRAGIQFPVGRIHRQLKQRVSAHGRVGATAAVYTASILEYLTAEVLELAGNASKDLK  89

Query  412  VKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            VKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSL+NK +K+
Sbjct  90   VKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLVNKVTKD  136



>ref|XP_006443946.1| hypothetical protein CICLE_v10022798mg [Citrus clementina]
 ref|XP_006443947.1| hypothetical protein CICLE_v10022798mg [Citrus clementina]
 ref|XP_006479618.1| PREDICTED: histone H2A variant 1-like [Citrus sinensis]
 gb|ESR57186.1| hypothetical protein CICLE_v10022798mg [Citrus clementina]
 gb|ESR57187.1| hypothetical protein CICLE_v10022798mg [Citrus clementina]
 gb|KDO68591.1| hypothetical protein CISIN_1g032658mg [Citrus sinensis]
 gb|KDO68592.1| hypothetical protein CISIN_1g032658mg [Citrus sinensis]
 gb|KDO68593.1| hypothetical protein CISIN_1g032658mg [Citrus sinensis]
Length=136

 Score =   197 bits (501),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 110/130 (85%), Positives = 119/130 (92%), Gaps = 2/130 (2%)
 Frame = +1

Query  163  LIMGKTSVAAANkdkdkdkkkPTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYS  342
            L+  KT+  A NKDKDKDKK+P SRSSRAG+QFPVGRIHR LK R  A+GRVGATAAVY 
Sbjct  9    LLAAKTT--AGNKDKDKDKKRPISRSSRAGIQFPVGRIHRHLKSRIAAHGRVGATAAVYL  66

Query  343  AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH  522
            A+ILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH
Sbjct  67   ASILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH  126

Query  523  KSLINKSSKE  552
            KSLINK++K+
Sbjct  127  KSLINKTTKD  136



>gb|KFK36782.1| histone h2a [Arabis alpina]
Length=133

 Score =   197 bits (500),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 107/130 (82%), Positives = 116/130 (89%), Gaps = 5/130 (4%)
 Frame = +1

Query  163  LIMGKTSVAAANkdkdkdkkkPTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYS  342
            LI  KT+ AAANKDK K      SRS+RAG+QFPVGRIHR LK R +A+GRVGATAAVY+
Sbjct  9    LIATKTT-AAANKDKKK----SISRSARAGIQFPVGRIHRQLKNRVSAHGRVGATAAVYT  63

Query  343  AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH  522
            A+ILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH
Sbjct  64   ASILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH  123

Query  523  KSLINKSSKE  552
            KSL+NK +KE
Sbjct  124  KSLVNKVTKE  133



>ref|XP_002881618.1| hypothetical protein ARALYDRAFT_482894 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57877.1| hypothetical protein ARALYDRAFT_482894 [Arabidopsis lyrata subsp. 
lyrata]
Length=135

 Score =   197 bits (501),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 95/107 (89%), Positives = 104/107 (97%), Gaps = 0/107 (0%)
 Frame = +1

Query  232  SRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKDLK  411
            SRSSRAG+QFPVGRIHR LK+R +A+GRVGATAAVY+A+ILEYLTAEVLELAGNASKDLK
Sbjct  29   SRSSRAGIQFPVGRIHRQLKQRVSAHGRVGATAAVYTASILEYLTAEVLELAGNASKDLK  88

Query  412  VKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            VKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSL+NK +K+
Sbjct  89   VKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLVNKVTKD  135



>ref|XP_001416208.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO94501.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=143

 Score =   197 bits (501),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 96/109 (88%), Positives = 101/109 (93%), Gaps = 0/109 (0%)
 Frame = +1

Query  226  PTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKD  405
            PTSRS +AGLQFPVGRIHR LK R  + GRVGATAAVYSAAILEYLTAEVLELAGNASKD
Sbjct  33   PTSRSVKAGLQFPVGRIHRFLKNRAASGGRVGATAAVYSAAILEYLTAEVLELAGNASKD  92

Query  406  LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            LKVKRITPRHLQLAIRGDEELD LIK TIAGGGVIPHIHKSL+NKS+K+
Sbjct  93   LKVKRITPRHLQLAIRGDEELDMLIKATIAGGGVIPHIHKSLMNKSAKK  141



>ref|XP_006295217.1| hypothetical protein CARUB_v10024299mg [Capsella rubella]
 gb|EOA28115.1| hypothetical protein CARUB_v10024299mg [Capsella rubella]
Length=134

 Score =   196 bits (499),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 94/107 (88%), Positives = 104/107 (97%), Gaps = 0/107 (0%)
 Frame = +1

Query  232  SRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKDLK  411
            SRSSRAG+QFPVGRIHR LK+R +++GRVGATAAVY+A+ILEYLTAEVLELAGNASKDLK
Sbjct  28   SRSSRAGIQFPVGRIHRQLKQRVSSHGRVGATAAVYTASILEYLTAEVLELAGNASKDLK  87

Query  412  VKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            VKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSL+NK +K+
Sbjct  88   VKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLVNKVTKD  134



>emb|CDY14429.1| BnaC03g21660D [Brassica napus]
Length=134

 Score =   196 bits (498),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 112/126 (89%), Gaps = 4/126 (3%)
 Frame = +1

Query  163  LIMGKTSVAAANkdkdkdkkkPTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYS  342
            LI  KT+  +ANKDK K      SRSSRAG+QFPVGRIHR LK R +A+GRVGATAAVY+
Sbjct  9    LIATKTTTTSANKDKKK----SISRSSRAGIQFPVGRIHRQLKTRVSAHGRVGATAAVYT  64

Query  343  AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH  522
            A+ILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH
Sbjct  65   ASILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH  124

Query  523  KSLINK  540
            KSL+NK
Sbjct  125  KSLVNK  130



>ref|XP_005000165.1| PREDICTED: histone H2A.Z-like isoform X1 [Cavia porcellus]
Length=128

 Score =   196 bits (497),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 96/107 (90%), Positives = 101/107 (94%), Gaps = 0/107 (0%)
 Frame = +1

Query  232  SRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKDLK  411
            SRS RAGLQFPVGRIHRLLK RTT++GRVGATAAVYSAAILEYLTAEVLELAGNASKDLK
Sbjct  19   SRSQRAGLQFPVGRIHRLLKSRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLK  78

Query  412  VKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            VKRITPRHLQLAIRGDEELD+LIK TIAGGGVIPHIHKSLI K  ++
Sbjct  79   VKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQQ  125



>ref|XP_003588709.1| Histone H2A [Medicago truncatula]
Length=102

 Score =   194 bits (493),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 96/100 (96%), Positives = 98/100 (98%), Gaps = 0/100 (0%)
 Frame = +1

Query  253  LQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPR  432
            +QFPVGRIHRLLK RT A+GRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPR
Sbjct  3    IQFPVGRIHRLLKSRTMAHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPR  62

Query  433  HLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            HLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE
Sbjct  63   HLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  102



>ref|XP_006411105.1| hypothetical protein EUTSA_v10017405mg [Eutrema salsugineum]
 gb|ESQ52558.1| hypothetical protein EUTSA_v10017405mg [Eutrema salsugineum]
Length=136

 Score =   195 bits (496),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 107/130 (82%), Positives = 118/130 (91%), Gaps = 2/130 (2%)
 Frame = +1

Query  163  LIMGKTSVAAANkdkdkdkkkPTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYS  342
            LI  KT+  A+NKDKD  KKK  SRSSRAG+QFPVGRIHR LK R +A+GRVGATAAVY+
Sbjct  9    LIAAKTT--ASNKDKDSVKKKSISRSSRAGIQFPVGRIHRQLKSRVSAHGRVGATAAVYT  66

Query  343  AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH  522
            A+ILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH
Sbjct  67   ASILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIH  126

Query  523  KSLINKSSKE  552
            KSL++K +K+
Sbjct  127  KSLVSKITKD  136



>emb|CCA18155.1| histone H2A variant 1 putative [Albugo laibachii Nc14]
Length=138

 Score =   195 bits (496),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 95/109 (87%), Positives = 100/109 (92%), Gaps = 0/109 (0%)
 Frame = +1

Query  226  PTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKD  405
            P SRS RAGLQFPVGRIHR LK+R   N RVGATAAVY+AAI+EYLTAEVLELAGNASKD
Sbjct  26   PQSRSQRAGLQFPVGRIHRFLKKRVANNQRVGATAAVYTAAIMEYLTAEVLELAGNASKD  85

Query  406  LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            LKVKRITPRHLQLAIRGDEELDTLIK TIAGGGVIP+IHKSLINK SK+
Sbjct  86   LKVKRITPRHLQLAIRGDEELDTLIKATIAGGGVIPYIHKSLINKQSKK  134



>ref|XP_009133299.1| PREDICTED: probable histone H2A variant 2 [Brassica rapa]
 emb|CDY07697.1| BnaA03g18140D [Brassica napus]
Length=134

 Score =   194 bits (493),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 95/107 (89%), Positives = 102/107 (95%), Gaps = 0/107 (0%)
 Frame = +1

Query  232  SRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKDLK  411
            SRSSRAG+QFPVGRIHR LK R +A+GRVGATAAVY+A+ILEYLTAEVLELAGNASKDLK
Sbjct  28   SRSSRAGIQFPVGRIHRQLKTRVSAHGRVGATAAVYTASILEYLTAEVLELAGNASKDLK  87

Query  412  VKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            VKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSL+NK + E
Sbjct  88   VKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLVNKIANE  134



>ref|XP_006595522.1| PREDICTED: uncharacterized protein LOC100500629 isoform X2 [Glycine 
max]
Length=119

 Score =   194 bits (492),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 95/98 (97%), Positives = 96/98 (98%), Gaps = 0/98 (0%)
 Frame = +1

Query  259  FPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHL  438
            FPVGRIHRLLK R TA+GRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHL
Sbjct  22   FPVGRIHRLLKSRVTAHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHL  81

Query  439  QLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            QLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE
Sbjct  82   QLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  119



>gb|AAF07182.1| H2A protein [Oryza sativa Japonica Group]
Length=139

 Score =   194 bits (493),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 97/109 (89%), Positives = 102/109 (94%), Gaps = 0/109 (0%)
 Frame = +1

Query  226  PTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKD  405
            P S SSRAG+QFPVGRIHR LK R +ANG VGATAAVY+AAILEYLT EVLELAGNASKD
Sbjct  31   PLSPSSRAGIQFPVGRIHRQLKGRVSANGPVGATAAVYTAAILEYLTGEVLELAGNASKD  90

Query  406  LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINK++KE
Sbjct  91   LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKTAKE  139



>ref|XP_003592696.1| Histone H2A [Medicago truncatula]
 ref|XP_003636723.1| Histone H2A [Medicago truncatula]
 gb|AES62947.1| core histone H2A/H2B/H3/H4 [Medicago truncatula]
Length=131

 Score =   193 bits (491),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 95/109 (87%), Positives = 101/109 (93%), Gaps = 0/109 (0%)
 Frame = +1

Query  226  PTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKD  405
            P SRSSRAG+QFPVGRIHR LK R  ANGRVGATAAVY A+ILEYLT EVLELAGNAS+D
Sbjct  23   PISRSSRAGIQFPVGRIHRQLKHRVQANGRVGATAAVYLASILEYLTTEVLELAGNASRD  82

Query  406  LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            L VKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIP+IHKSLINK++KE
Sbjct  83   LNVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPNIHKSLINKTAKE  131



>emb|CDQ62413.1| unnamed protein product [Oncorhynchus mykiss]
Length=148

 Score =   194 bits (492),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 95/107 (89%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +1

Query  232  SRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKDLK  411
            SRS RAGLQFPVGRIHR LK RTT++GRVGATAAVYSAAILEYLTAEVLELAGNASKDLK
Sbjct  39   SRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLK  98

Query  412  VKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            VKRITPRHLQLAIRGDEELD+LIK TIAGGGVIPHIHKSLI K  ++
Sbjct  99   VKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQQ  145



>ref|XP_006770462.1| PREDICTED: histone H2A.V-like [Myotis davidii]
Length=130

 Score =   193 bits (491),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 95/107 (89%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +1

Query  232  SRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKDLK  411
            SRS RAGLQFPVGRIHR LK RTT++GRVGATAAVYSAAILEYLTAEVLELAGNASKDLK
Sbjct  21   SRSQRAGLQFPVGRIHRHLKTRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLK  80

Query  412  VKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            VKRITPRHLQLAIRGDEELD+LIK TIAGGGVIPHIHKSLI K  ++
Sbjct  81   VKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQQ  127



>ref|XP_005396709.1| PREDICTED: histone H2A.V-like [Chinchilla lanigera]
 ref|XP_010623225.1| PREDICTED: histone H2A.V isoform X2 [Fukomys damarensis]
Length=133

 Score =   193 bits (491),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 95/107 (89%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +1

Query  232  SRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKDLK  411
            SRS RAGLQFPVGRIHR LK RTT++GRVGATAAVYSAAILEYLTAEVLELAGNASKDLK
Sbjct  24   SRSQRAGLQFPVGRIHRHLKTRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLK  83

Query  412  VKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            VKRITPRHLQLAIRGDEELD+LIK TIAGGGVIPHIHKSLI K  ++
Sbjct  84   VKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQQ  130



>ref|XP_007255793.1| PREDICTED: histone H2A.Z-like isoform X1 [Astyanax mexicanus]
 ref|XP_007255794.1| PREDICTED: histone H2A.Z-like isoform X2 [Astyanax mexicanus]
Length=128

 Score =   193 bits (490),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 95/108 (88%), Positives = 100/108 (93%), Gaps = 0/108 (0%)
 Frame = +1

Query  229  TSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKDL  408
             SRS RAGLQFPVGRIHR LK RTT++GRVGATAAVYSAAILEYLTAEVLELAGNASKDL
Sbjct  18   VSRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDL  77

Query  409  KVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            KVKRITPRHLQLAIRGDEELD+LIK TIAGGGVIPHIHKSLI K  ++
Sbjct  78   KVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQQ  125



>emb|CDW88346.1| UNKNOWN [Stylonychia lemnae]
Length=149

 Score =   194 bits (492),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 93/109 (85%), Positives = 101/109 (93%), Gaps = 0/109 (0%)
 Frame = +1

Query  226  PTSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKD  405
            P SRS++AGLQFPVGRIHR LK R +AN RVGAT+AVY+AAILEYLTAEVLELAGNASKD
Sbjct  39   PQSRSAKAGLQFPVGRIHRFLKSRVSANSRVGATSAVYTAAILEYLTAEVLELAGNASKD  98

Query  406  LKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            LKVKRITPRHLQLAIRGDEELDTLIK TIAGGGVIPHIHK+LI K +K+
Sbjct  99   LKVKRITPRHLQLAIRGDEELDTLIKATIAGGGVIPHIHKALILKQTKK  147



>ref|NP_002097.1| histone H2A.Z [Homo sapiens]
 ref|NP_058030.1| histone H2A.Z [Mus musculus]
 ref|NP_073165.1| histone H2A.Z [Rattus norvegicus]
 ref|NP_777234.1| histone H2A.Z [Bos taurus]
 ref|NP_001009270.1| histone H2A.Z [Ovis aries]
 ref|NP_001116594.1| histone H2A.Z [Sus scrofa]
 ref|NP_001127318.1| histone H2A.Z [Pongo abelii]
 ref|NP_001180479.1| H2A histone family, member Z [Macaca mulatta]
 ref|NP_001274021.1| H2A histone family, member Z [Canis lupus familiaris]
 ref|XP_002743705.1| PREDICTED: histone H2A.Z [Callithrix jacchus]
 ref|XP_002928044.1| PREDICTED: histone H2A.Z [Ailuropoda melanoleuca]
 ref|XP_003257543.1| PREDICTED: histone H2A.Z-like isoform 1 [Nomascus leucogenys]
 ref|XP_517363.3| PREDICTED: histone H2A.Z [Pan troglodytes]
 ref|XP_003798557.1| PREDICTED: histone H2A.Z-like [Otolemur garnettii]
 ref|XP_003798558.1| PREDICTED: histone H2A.Z-like [Otolemur garnettii]
 ref|XP_003798559.1| PREDICTED: histone H2A.Z-like [Otolemur garnettii]
 ref|XP_003798560.1| PREDICTED: histone H2A.Z-like [Otolemur garnettii]
 ref|XP_003798561.1| PREDICTED: histone H2A.Z-like [Otolemur garnettii]
 ref|XP_003798562.1| PREDICTED: histone H2A.Z-like [Otolemur garnettii]
 ref|XP_003798563.1| PREDICTED: histone H2A.Z-like [Otolemur garnettii]
 ref|XP_003798564.1| PREDICTED: histone H2A.Z-like [Otolemur garnettii]
 ref|XP_003829988.1| PREDICTED: histone H2A.Z [Pan paniscus]
 ref|XP_004040232.1| PREDICTED: histone H2A.Z-like isoform 1 [Gorilla gorilla gorilla]
 ref|XP_004040233.1| PREDICTED: histone H2A.Z-like isoform 2 [Gorilla gorilla gorilla]
 ref|XP_004040234.1| PREDICTED: histone H2A.Z-like isoform 3 [Gorilla gorilla gorilla]
 ref|XP_004089074.1| PREDICTED: histone H2A.Z-like [Nomascus leucogenys]
 ref|XP_004089075.1| PREDICTED: histone H2A.Z-like [Nomascus leucogenys]
 ref|XP_004089076.1| PREDICTED: histone H2A.Z-like [Nomascus leucogenys]
 ref|XP_004263611.1| PREDICTED: histone H2A.Z-like [Orcinus orca]
 ref|XP_004380242.1| PREDICTED: histone H2A.Z-like [Trichechus manatus latirostris]
 ref|XP_004391529.1| PREDICTED: histone H2A.Z-like isoform 2 [Odobenus rosmarus divergens]
 ref|XP_004431055.1| PREDICTED: histone H2A.Z-like [Ceratotherium simum simum]
 ref|XP_004462010.1| PREDICTED: histone H2A.Z-like isoform 2 [Dasypus novemcinctus]
 ref|XP_004661700.1| PREDICTED: histone H2A.Z-like [Jaculus jaculus]
 ref|XP_004788698.1| PREDICTED: histone H2A.Z-like [Mustela putorius furo]
 ref|XP_004866335.1| PREDICTED: histone H2A.Z-like [Heterocephalus glaber]
 ref|XP_005325808.1| PREDICTED: histone H2A.Z-like [Ictidomys tridecemlineatus]
 ref|XP_005406318.1| PREDICTED: histone H2A.Z-like isoform X1 [Chinchilla lanigera]
 ref|XP_005555595.1| PREDICTED: histone H2A.Z-like [Macaca fascicularis]
 ref|XP_005910369.1| PREDICTED: histone H2A.Z-like [Bos mutus]
 ref|XP_006208989.1| PREDICTED: histone H2A.Z-like [Vicugna pacos]
 ref|XP_006152220.1| PREDICTED: histone H2A.Z-like [Tupaia chinensis]
 ref|XP_006773066.1| PREDICTED: histone H2A.Z-like [Myotis davidii]
 ref|XP_006876436.1| PREDICTED: histone H2A.Z-like [Chrysochloris asiatica]
 ref|XP_006918930.1| PREDICTED: histone H2A.Z-like isoform X1 [Pteropus alecto]
 ref|XP_006918931.1| PREDICTED: histone H2A.Z-like isoform X2 [Pteropus alecto]
 ref|XP_007172968.1| PREDICTED: histone H2A.Z-like isoform X1 [Balaenoptera acutorostrata 
scammoni]
 ref|XP_007463865.1| PREDICTED: histone H2A.Z-like [Lipotes vexillifer]
 ref|XP_007605775.1| PREDICTED: histone H2A.Z [Cricetulus griseus]
 ref|XP_007628993.1| PREDICTED: histone H2A.Z [Cricetulus griseus]
 ref|XP_007947050.1| PREDICTED: histone H2A.Z [Orycteropus afer afer]
 ref|XP_007997575.1| PREDICTED: histone H2A.Z [Chlorocebus sabaeus]
 ref|XP_007997839.1| PREDICTED: histone H2A.Z [Chlorocebus sabaeus]
 ref|XP_008052112.1| PREDICTED: histone H2A.Z [Tarsius syrichta]
 ref|XP_008154876.1| PREDICTED: histone H2A.Z [Eptesicus fuscus]
 ref|XP_008532962.1| PREDICTED: histone H2A.Z [Equus przewalskii]
 ref|XP_008583237.1| PREDICTED: histone H2A.Z [Galeopterus variegatus]
 ref|XP_008824387.1| PREDICTED: histone H2A.Z [Nannospalax galili]
 ref|XP_008991175.1| PREDICTED: histone H2A.Z isoform X2 [Callithrix jacchus]
 ref|XP_009205515.1| PREDICTED: histone H2A.Z [Papio anubis]
 ref|XP_010366876.1| PREDICTED: histone H2A.Z [Rhinopithecus roxellana]
 ref|XP_010369946.1| PREDICTED: histone H2A.Z isoform X2 [Rhinopithecus roxellana]
 ref|XP_010372444.1| PREDICTED: histone H2A.Z [Rhinopithecus roxellana]
 ref|XP_010804249.1| PREDICTED: histone H2A.Z isoform X1 [Bos taurus]
 ref|XP_010848781.1| PREDICTED: histone H2A.Z [Bison bison bison]
 ref|XP_010951878.1| PREDICTED: histone H2A.Z [Camelus bactrianus]
 ref|XP_010978927.1| PREDICTED: histone H2A.Z [Camelus dromedarius]
 sp|Q5RC42.3|H2AZ_PONAB RecName: Full=Histone H2A.Z; Short=H2A/z [Pongo abelii]
 sp|Q6YNC8.3|H2AZ_SHEEP RecName: Full=Histone H2A.Z; Short=H2A/z [Ovis aries]
 sp|P0C0S4.2|H2AZ_BOVIN RecName: Full=Histone H2A.Z; Short=H2A/z [Bos taurus]
 sp|P0C0S5.2|H2AZ_HUMAN RecName: Full=Histone H2A.Z; Short=H2A/z [Homo sapiens]
 sp|P0C0S6.2|H2AZ_MOUSE RecName: Full=Histone H2A.Z; Short=H2A/z [Mus musculus]
 sp|P0C0S7.2|H2AZ_RAT RecName: Full=Histone H2A.Z; Short=H2A/z [Rattus norvegicus]
 sp|P22647.4|H2AZ_ONCMY RecName: Full=Histone H2A.Z; Short=H2A/z [Oncorhynchus mykiss]
 pdb|1F66|C Chain C, 2.6 A Crystal Structure Of A Nucleosome Core Particle 
Containing The Variant Histone H2a.Z
 pdb|1F66|G Chain G, 2.6 A Crystal Structure Of A Nucleosome Core Particle 
Containing The Variant Histone H2a.Z
 emb|CAA36554.1| unnamed protein product [Bos taurus]
 emb|CAA36553.1| unnamed protein product [Homo sapiens]
 emb|CAA36552.1| unnamed protein product [Rattus sp.]
 gb|AAA30566.1| histone (H2A.Z) [Bos taurus]
 gb|AAA35984.1| histone (H2A.Z) [Homo sapiens]
 gb|AAA41329.1| histone (H2A.Z) [Rattus norvegicus]
 gb|AAB09578.1| histone H2A.Z [Mus musculus]
 gb|AAC61625.1| histone [Homo sapiens]
 gb|AAH18002.1| H2A histone family, member Z [Homo sapiens]
 gb|AAH20936.1| H2A histone family, member Z [Homo sapiens]
 gb|AAL71863.1| histone H2A.Z [Ovis aries]
 gb|AAL71864.1| histone H2A.Z [Mus musculus]
 dbj|BAC40515.1| unnamed protein product [Mus musculus]
 dbj|BAC25791.1| unnamed protein product [Mus musculus]
 gb|AAH60564.1| H2A histone family, member Z [Rattus norvegicus]
 emb|CAG33696.1| H2AFZ [Homo sapiens]
 gb|AAH79903.1| H2A histone family, member Z [Mus musculus]
 gb|AAH86348.1| H2A histone family, member Z [Rattus norvegicus]
 emb|CAH90668.1| hypothetical protein [Pongo abelii]
 gb|AAY41013.1| unknown [Homo sapiens]
 dbj|BAE25443.1| unnamed protein product [Mus musculus]
 dbj|BAE30069.1| unnamed protein product [Mus musculus]
 dbj|BAE30756.1| unnamed protein product [Mus musculus]
 dbj|BAE40138.1| unnamed protein product [Mus musculus]
 dbj|BAE31186.1| unnamed protein product [Mus musculus]
 dbj|BAE29574.1| unnamed protein product [Mus musculus]
 dbj|BAE31541.1| unnamed protein product [Mus musculus]
 gb|AAI03744.1| H2A histone family, member Z [Homo sapiens]
 gb|AAI09744.1| H2A histone family, member Z [Bos taurus]
 gb|EAX06118.1| H2A histone family, member Z [Homo sapiens]
 gb|ABM84142.1| H2A histone family, member Z [synthetic construct]
 gb|ABM87544.1| H2A histone family, member Z [synthetic construct]
 gb|EDL82293.1| rCG28894, isoform CRA_a [Rattus norvegicus]
 gb|ABY87518.1| H2A histone family member Z [Sus scrofa]
 gb|AAI58036.1| H2A histone family, member Z [Mus musculus]
 dbj|BAG37803.1| unnamed protein product [Homo sapiens]
 gb|AAI71999.1| H2A histone family, member Z [Mus musculus]
 gb|AAI47479.1| H2A histone family, member Z [Mus musculus]
 gb|EHH53865.1| hypothetical protein EGM_14573 [Macaca fascicularis]
 gb|AFM88225.1| H2A histone family, member Z [Callorhinchus milii]
 gb|AFM88584.1| H2A histone family, member Z [Callorhinchus milii]
 gb|AFM88971.1| H2A histone family, member Z [Callorhinchus milii]
 gb|AFM89179.1| H2A histone family, member Z [Callorhinchus milii]
 gb|AFM90960.1| histone 2A family member ZA [Callorhinchus milii]
 gb|AIC48911.1| H2AFZ, partial [synthetic construct]
Length=128

 Score =   193 bits (490),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 95/107 (89%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +1

Query  232  SRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKDLK  411
            SRS RAGLQFPVGRIHR LK RTT++GRVGATAAVYSAAILEYLTAEVLELAGNASKDLK
Sbjct  19   SRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLK  78

Query  412  VKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            VKRITPRHLQLAIRGDEELD+LIK TIAGGGVIPHIHKSLI K  ++
Sbjct  79   VKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQQ  125



>gb|ABS85188.1| putative histone 2A, partial [Hypericum perforatum]
Length=99

 Score =   192 bits (488),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 94/99 (95%), Positives = 97/99 (98%), Gaps = 0/99 (0%)
 Frame = +1

Query  256  QFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRH  435
            QFPVGR+HRLLK R +ANGRVGATAAVY+AAILEYLTAEVLELAGNASKDLKVKRITPRH
Sbjct  1    QFPVGRVHRLLKTRVSANGRVGATAAVYTAAILEYLTAEVLELAGNASKDLKVKRITPRH  60

Query  436  LQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            LQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE
Sbjct  61   LQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  99



>ref|XP_008705427.1| PREDICTED: histone H2A.Z [Ursus maritimus]
Length=128

 Score =   193 bits (490),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 95/107 (89%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +1

Query  232  SRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKDLK  411
            SRS RAGLQFPVGRIHR LK RTT++GRVGATAAVYSAAILEYLTAEVLELAGNASKDLK
Sbjct  19   SRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLK  78

Query  412  VKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            VKRITPRHLQLAIRGDEELD+LIK TIAGGGVIPHIHKSLI K  ++
Sbjct  79   VKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQQ  125



>ref|NP_001026545.1| histone H2A.Z [Gallus gallus]
 ref|NP_001232784.1| H2A histone family, member V [Taeniopygia guttata]
 ref|XP_003205800.1| PREDICTED: histone H2A.Z [Meleagris gallopavo]
 ref|XP_005148709.1| PREDICTED: histone H2A.Z-like [Melopsittacus undulatus]
 ref|XP_005238118.1| PREDICTED: histone H2A.Z-like [Falco peregrinus]
 ref|XP_005278560.1| PREDICTED: histone H2A.Z [Chrysemys picta bellii]
 ref|XP_005484771.1| PREDICTED: histone H2A.Z-like isoform X2 [Zonotrichia albicollis]
 ref|XP_005517543.1| PREDICTED: histone H2A.Z-like isoform X2 [Pseudopodoces humilis]
 ref|XP_006133847.1| PREDICTED: histone H2A.Z-like isoform X2 [Pelodiscus sinensis]
 ref|XP_007063086.1| PREDICTED: histone H2A.Z-like [Chelonia mydas]
 ref|XP_009472961.1| PREDICTED: histone H2A.Z [Nipponia nippon]
 ref|XP_009904373.1| PREDICTED: histone H2A.Z [Picoides pubescens]
 ref|XP_010584498.1| PREDICTED: histone H2A.Z [Haliaeetus leucocephalus]
 sp|Q5ZMD6.3|H2AZ_CHICK RecName: Full=Histone H2A.Z; Short=H2A/z [Gallus gallus]
 emb|CAG31107.1| hypothetical protein RCJMB04_2h11 [Gallus gallus]
 gb|ACH45280.1| putative histone H2A.Z [Taeniopygia guttata]
 gb|ACH45281.1| putative histone H2A.Z [Taeniopygia guttata]
 gb|ACH45282.1| putative histone H2A.Z [Taeniopygia guttata]
 gb|ACH45283.1| putative histone H2A.Z [Taeniopygia guttata]
 gb|ACH45284.1| putative histone H2A.Z [Taeniopygia guttata]
 gb|ACH45285.1| putative histone H2A.Z [Taeniopygia guttata]
 gb|ACH45286.1| putative histone H2A.Z [Taeniopygia guttata]
 gb|ACH45287.1| putative histone H2A.Z [Taeniopygia guttata]
 gb|ACH45288.1| putative histone H2A.Z [Taeniopygia guttata]
Length=128

 Score =   193 bits (490),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 95/107 (89%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +1

Query  232  SRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKDLK  411
            SRS RAGLQFPVGRIHR LK RTT++GRVGATAAVYSAAILEYLTAEVLELAGNASKDLK
Sbjct  19   SRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLK  78

Query  412  VKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            VKRITPRHLQLAIRGDEELD+LIK TIAGGGVIPHIHKSLI K  ++
Sbjct  79   VKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQQ  125



>gb|EFB21083.1| hypothetical protein PANDA_017927 [Ailuropoda melanoleuca]
 gb|EHH26079.1| hypothetical protein EGK_15964, partial [Macaca mulatta]
 gb|ELR45666.1| Histone H2A.Z, partial [Bos mutus]
Length=128

 Score =   193 bits (490),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 95/107 (89%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +1

Query  232  SRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKDLK  411
            SRS RAGLQFPVGRIHR LK RTT++GRVGATAAVYSAAILEYLTAEVLELAGNASKDLK
Sbjct  19   SRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLK  78

Query  412  VKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            VKRITPRHLQLAIRGDEELD+LIK TIAGGGVIPHIHKSLI K  ++
Sbjct  79   VKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQQ  125



>ref|XP_003966802.1| PREDICTED: histone H2A.Z-like [Takifugu rubripes]
Length=128

 Score =   193 bits (490),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 95/107 (89%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +1

Query  232  SRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKDLK  411
            SRS RAGLQFPVGRIHR LK RTT++GRVGATAAVYSAAILEYLTAEVLELAGNASKDLK
Sbjct  19   SRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLK  78

Query  412  VKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            VKRITPRHLQLAIRGDEELD+LIK TIAGGGVIPHIHKSLI K  ++
Sbjct  79   VKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQQ  125



>gb|AFV36373.1| histone H2A.Z.3.2 [Cyprinus carpio]
Length=128

 Score =   193 bits (490),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 95/107 (89%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +1

Query  232  SRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKDLK  411
            SRS RAGLQFPVGRIHR LK RTT++GRVGATAAVYSAAILEYLTAEVLELAGNASKDLK
Sbjct  19   SRSQRAGLQFPVGRIHRHLKTRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLK  78

Query  412  VKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            VKRITPRHLQLAIRGDEELD+LIK TIAGGGVIPHIHKSLI K  ++
Sbjct  79   VKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQQ  125



>gb|EMC77020.1| Histone H2A.Z, partial [Columba livia]
 gb|KFO96424.1| Histone H2A.Z, partial [Calypte anna]
 gb|KFQ30505.1| Histone H2A.Z, partial [Merops nubicus]
 gb|KFU93780.1| Histone H2A.Z, partial [Chaetura pelagica]
 gb|KFV02264.1| Histone H2A.Z, partial [Tauraco erythrolophus]
 gb|KFV71545.1| Histone H2A.Z, partial [Picoides pubescens]
 gb|KFW75738.1| Histone H2A.Z, partial [Manacus vitellinus]
Length=128

 Score =   193 bits (490),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 95/107 (89%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +1

Query  232  SRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKDLK  411
            SRS RAGLQFPVGRIHR LK RTT++GRVGATAAVYSAAILEYLTAEVLELAGNASKDLK
Sbjct  19   SRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLK  78

Query  412  VKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            VKRITPRHLQLAIRGDEELD+LIK TIAGGGVIPHIHKSLI K  ++
Sbjct  79   VKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQQ  125



>ref|XP_004602082.1| PREDICTED: histone H2A.V-like [Sorex araneus]
Length=135

 Score =   193 bits (491),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 95/107 (89%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +1

Query  232  SRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKDLK  411
            SRS RAGLQFPVGRIHR LK RTT++GRVGATAAVYSAAILEYLTAEVLELAGNASKDLK
Sbjct  26   SRSQRAGLQFPVGRIHRHLKTRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLK  85

Query  412  VKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            VKRITPRHLQLAIRGDEELD+LIK TIAGGGVIPHIHKSLI K  ++
Sbjct  86   VKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQQ  132



>ref|XP_009883835.1| PREDICTED: histone H2A.Z [Charadrius vociferus]
Length=129

 Score =   193 bits (490),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 95/107 (89%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +1

Query  232  SRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKDLK  411
            SRS RAGLQFPVGRIHR LK RTT++GRVGATAAVYSAAILEYLTAEVLELAGNASKDLK
Sbjct  20   SRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLK  79

Query  412  VKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            VKRITPRHLQLAIRGDEELD+LIK TIAGGGVIPHIHKSLI K  ++
Sbjct  80   VKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQQ  126



>ref|XP_005950649.1| PREDICTED: histone H2A.V-like isoform X2 [Haplochromis burtoni]
Length=129

 Score =   193 bits (490),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 95/107 (89%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +1

Query  232  SRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKDLK  411
            SRS RAGLQFPVGRIHR LK RTT++GRVGATAAVYSAAILEYLTAEVLELAGNASKDLK
Sbjct  20   SRSQRAGLQFPVGRIHRHLKTRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLK  79

Query  412  VKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            VKRITPRHLQLAIRGDEELD+LIK TIAGGGVIPHIHKSLI K  ++
Sbjct  80   VKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQQ  126



>ref|XP_006166090.1| PREDICTED: histone H2A.V-like isoform X2 [Tupaia chinensis]
Length=129

 Score =   193 bits (490),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 95/107 (89%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +1

Query  232  SRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKDLK  411
            SRS RAGLQFPVGRIHR LK RTT++GRVGATAAVYSAAILEYLTAEVLELAGNASKDLK
Sbjct  20   SRSQRAGLQFPVGRIHRHLKTRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLK  79

Query  412  VKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            VKRITPRHLQLAIRGDEELD+LIK TIAGGGVIPHIHKSLI K  ++
Sbjct  80   VKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQQ  126



>gb|ACQ58234.1| Histone H2A.Z [Anoplopoma fimbria]
Length=128

 Score =   193 bits (490),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 95/107 (89%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +1

Query  232  SRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKDLK  411
            SRS RAGLQFPVGRIHR LK RTT++GRVGATAAVYSAAILEYLTAEVLELAGNASKDLK
Sbjct  19   SRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLK  78

Query  412  VKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            VKRITPRHLQLAIRGDEELD+LIK TIAGGGVIPHIHKSLI K  ++
Sbjct  79   VKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQQ  125



>ref|XP_006023756.1| PREDICTED: histone H2A.Z-like [Alligator sinensis]
Length=132

 Score =   193 bits (490),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 95/107 (89%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +1

Query  232  SRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKDLK  411
            SRS RAGLQFPVGRIHR LK RTT++GRVGATAAVYSAAILEYLTAEVLELAGNASKDLK
Sbjct  23   SRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLK  82

Query  412  VKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            VKRITPRHLQLAIRGDEELD+LIK TIAGGGVIPHIHKSLI K  ++
Sbjct  83   VKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQQ  129



>gb|ELK13041.1| Histone H2A.V [Pteropus alecto]
Length=131

 Score =   193 bits (490),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 95/107 (89%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +1

Query  232  SRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKDLK  411
            SRS RAGLQFPVGRIHR LK RTT++GRVGATAAVYSAAILEYLTAEVLELAGNASKDLK
Sbjct  22   SRSQRAGLQFPVGRIHRHLKTRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLK  81

Query  412  VKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            VKRITPRHLQLAIRGDEELD+LIK TIAGGGVIPHIHKSLI K  ++
Sbjct  82   VKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQQ  128



>ref|XP_009935347.1| PREDICTED: histone H2A.Z [Opisthocomus hoazin]
Length=133

 Score =   193 bits (490),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 95/107 (89%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +1

Query  232  SRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKDLK  411
            SRS RAGLQFPVGRIHR LK RTT++GRVGATAAVYSAAILEYLTAEVLELAGNASKDLK
Sbjct  24   SRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLK  83

Query  412  VKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            VKRITPRHLQLAIRGDEELD+LIK TIAGGGVIPHIHKSLI K  ++
Sbjct  84   VKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQQ  130



>emb|CAG08182.1| unnamed protein product, partial [Tetraodon nigroviridis]
Length=128

 Score =   193 bits (490),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 95/107 (89%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +1

Query  232  SRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKDLK  411
            SRS RAGLQFPVGRIHR LK RTT++GRVGATAAVYSAAILEYLTAEVLELAGNASKDLK
Sbjct  19   SRSQRAGLQFPVGRIHRHLKTRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLK  78

Query  412  VKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            VKRITPRHLQLAIRGDEELD+LIK TIAGGGVIPHIHKSLI K  ++
Sbjct  79   VKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQQ  125



>ref|XP_003225775.1| PREDICTED: histone H2A.Z [Anolis carolinensis]
 ref|XP_007435067.1| PREDICTED: histone H2A.Z-like [Python bivittatus]
Length=128

 Score =   193 bits (490),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 95/107 (89%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +1

Query  232  SRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKDLK  411
            SRS RAGLQFPVGRIHR LK RTT++GRVGATAAVYSAAILEYLTAEVLELAGNASKDLK
Sbjct  19   SRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLK  78

Query  412  VKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            VKRITPRHLQLAIRGDEELD+LIK TIAGGGVIPHIHKSLI K  ++
Sbjct  79   VKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQQ  125



>gb|ELK23257.1| Histone H2A.Z, partial [Myotis davidii]
Length=127

 Score =   193 bits (490),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 95/107 (89%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +1

Query  232  SRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKDLK  411
            SRS RAGLQFPVGRIHR LK RTT++GRVGATAAVYSAAILEYLTAEVLELAGNASKDLK
Sbjct  18   SRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLK  77

Query  412  VKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            VKRITPRHLQLAIRGDEELD+LIK TIAGGGVIPHIHKSLI K  ++
Sbjct  78   VKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQQ  124



>ref|XP_008701702.1| PREDICTED: histone H2A.V [Ursus maritimus]
 ref|XP_011229090.1| PREDICTED: histone H2A.V isoform X1 [Ailuropoda melanoleuca]
Length=131

 Score =   193 bits (490),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 95/107 (89%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +1

Query  232  SRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKDLK  411
            SRS RAGLQFPVGRIHR LK RTT++GRVGATAAVYSAAILEYLTAEVLELAGNASKDLK
Sbjct  22   SRSQRAGLQFPVGRIHRHLKTRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLK  81

Query  412  VKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            VKRITPRHLQLAIRGDEELD+LIK TIAGGGVIPHIHKSLI K  ++
Sbjct  82   VKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQQ  128



>ref|XP_004708238.1| PREDICTED: histone H2A.V-like [Echinops telfairi]
Length=138

 Score =   193 bits (491),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 95/107 (89%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +1

Query  232  SRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKDLK  411
            SRS RAGLQFPVGRIHR LK RTT++GRVGATAAVYSAAILEYLTAEVLELAGNASKDLK
Sbjct  29   SRSQRAGLQFPVGRIHRHLKTRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLK  88

Query  412  VKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            VKRITPRHLQLAIRGDEELD+LIK TIAGGGVIPHIHKSLI K  ++
Sbjct  89   VKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQQ  135



>ref|NP_036544.1| histone H2A.V isoform 1 [Homo sapiens]
 ref|NP_705930.1| histone H2A.V [Danio rerio]
 ref|NP_001016178.1| histone H2A.V [Xenopus (Silurana) tropicalis]
 ref|NP_001033286.1| histone H2A.V [Bos taurus]
 ref|NP_001087351.1| MGC85536 protein [Xenopus laevis]
 ref|NP_001086112.1| histone H2A.V [Xenopus laevis]
 ref|NP_001099489.1| H2A histone family, member V [Rattus norvegicus]
 ref|NP_084214.1| histone H2A.V [Mus musculus]
 ref|NP_001184228.1| histone H2A.V [Taeniopygia guttata]
 ref|NP_001188492.1| H2A histone family, member Z [Danio rerio]
 ref|XP_003227465.1| PREDICTED: histone H2A.V [Anolis carolinensis]
 ref|XP_003268919.1| PREDICTED: histone H2A.V-like isoform 1 [Nomascus leucogenys]
 ref|XP_003465852.1| PREDICTED: histone H2A.V-like [Cavia porcellus]
 ref|XP_003504811.1| PREDICTED: histone H2A.V isoform X1 [Cricetulus griseus]
 ref|XP_003757790.1| PREDICTED: histone H2A.V-like [Sarcophilus harrisii]
 ref|XP_003805268.1| PREDICTED: histone H2A.V isoform X1 [Pan paniscus]
 ref|XP_003975126.1| PREDICTED: histone H2A.V-like [Takifugu rubripes]
 ref|XP_004283037.1| PREDICTED: histone H2A.V-like isoform 1 [Orcinus orca]
 ref|XP_004386157.1| PREDICTED: histone H2A.V-like [Trichechus manatus latirostris]
 ref|XP_004414116.1| PREDICTED: histone H2A.V-like isoform 1 [Odobenus rosmarus divergens]
 ref|XP_004438396.1| PREDICTED: histone H2A.V-like isoform 1 [Ceratotherium simum 
simum]
 ref|XP_004457527.1| PREDICTED: histone H2A.V-like [Dasypus novemcinctus]
 ref|XP_004555835.1| PREDICTED: histone H2A.V-like [Maylandia zebra]
 ref|XP_004582293.1| PREDICTED: histone H2A.V-like [Ochotona princeps]
 ref|XP_004652975.1| PREDICTED: histone H2A.V-like [Jaculus jaculus]
 ref|XP_004630416.1| PREDICTED: histone H2A.V-like [Octodon degus]
 ref|XP_004676014.1| PREDICTED: histone H2A.V-like [Condylura cristata]
 ref|XP_004839953.1| PREDICTED: histone H2A.V-like isoform X1 [Heterocephalus glaber]
 ref|XP_005086833.1| PREDICTED: histone H2A.V-like [Mesocricetus auratus]
 ref|XP_005366260.1| PREDICTED: histone H2A.V-like [Microtus ochrogaster]
 ref|XP_005319307.1| PREDICTED: histone H2A.V-like [Ictidomys tridecemlineatus]
 ref|XP_005532972.1| PREDICTED: histone H2A.V-like isoform X2 [Pseudopodoces humilis]
 ref|XP_005549717.1| PREDICTED: histone H2A.V-like isoform X1 [Macaca fascicularis]
 ref|XP_005730683.1| PREDICTED: histone H2A.V-like [Pundamilia nyererei]
 ref|XP_005812570.1| PREDICTED: histone H2A.V-like [Xiphophorus maculatus]
 ref|XP_005950650.1| PREDICTED: histone H2A.V-like isoform X3 [Haplochromis burtoni]
 ref|XP_005995244.1| PREDICTED: transcriptional activator protein Pur-beta-like isoform 
X2 [Latimeria chalumnae]
 ref|XP_006106769.1| PREDICTED: histone H2A.V-like [Myotis lucifugus]
 ref|XP_006134605.1| PREDICTED: histone H2A.V-like [Pelodiscus sinensis]
 ref|XP_006217196.1| PREDICTED: histone H2A.V-like [Vicugna pacos]
 ref|XP_006275074.1| PREDICTED: histone H2A.V-like [Alligator mississippiensis]
 ref|XP_006797729.1| PREDICTED: histone H2A.V-like [Neolamprologus brichardi]
 ref|XP_006832164.1| PREDICTED: histone H2A.V-like [Chrysochloris asiatica]
 ref|XP_006973069.1| PREDICTED: histone H2A.V-like [Peromyscus maniculatus bairdii]
 ref|XP_007118958.1| PREDICTED: histone H2A.V-like [Physeter catodon]
 ref|XP_007238208.1| PREDICTED: histone H2A.V-like [Astyanax mexicanus]
 ref|XP_007430054.1| PREDICTED: histone H2A.V-like [Python bivittatus]
 ref|XP_007447081.1| PREDICTED: histone H2A.V-like [Lipotes vexillifer]
 ref|XP_007475948.1| PREDICTED: histone H2A.V-like isoform X1 [Monodelphis domestica]
 ref|XP_007575759.1| PREDICTED: histone H2A.V [Poecilia formosa]
 ref|XP_007956075.1| PREDICTED: histone H2A.V [Orycteropus afer afer]
 ref|XP_007979606.1| PREDICTED: histone H2A.V isoform X2 [Chlorocebus sabaeus]
 ref|XP_008065059.1| PREDICTED: histone H2A.V [Tarsius syrichta]
 ref|XP_008172145.1| PREDICTED: histone H2A.V [Chrysemys picta bellii]
 ref|XP_008286891.1| PREDICTED: histone H2A.V [Stegastes partitus]
 ref|XP_008333357.1| PREDICTED: histone H2A.V [Cynoglossus semilaevis]
 ref|XP_008334511.1| PREDICTED: histone H2A.V isoform X1 [Cynoglossus semilaevis]
 ref|XP_008334512.1| PREDICTED: histone H2A.V isoform X2 [Cynoglossus semilaevis]
 ref|XP_008417540.1| PREDICTED: histone H2A.V [Poecilia reticulata]
 ref|XP_008832315.1| PREDICTED: histone H2A.V isoform X1 [Nannospalax galili]
 ref|XP_009000387.1| PREDICTED: histone H2A.V isoform X1 [Callithrix jacchus]
 ref|XP_009201261.1| PREDICTED: histone H2A.V isoform X1 [Papio anubis]
 ref|XP_009451295.1| PREDICTED: histone H2A.V isoform X5 [Pan troglodytes]
 ref|XP_010372882.1| PREDICTED: histone H2A.V isoform X1 [Rhinopithecus roxellana]
 ref|XP_010561199.1| PREDICTED: histone H2A.V isoform X2 [Haliaeetus leucocephalus]
 ref|XP_010596578.1| PREDICTED: histone H2A.V [Loxodonta africana]
 ref|XP_010734849.1| PREDICTED: histone H2A.V [Larimichthys crocea]
 ref|XP_010787000.1| PREDICTED: histone H2A.V [Notothenia coriiceps]
 ref|XP_010827338.1| PREDICTED: histone H2A.V [Bison bison bison]
 ref|XP_010864377.1| PREDICTED: histone H2A.V [Esox lucius]
 ref|XP_010986189.1| PREDICTED: histone H2A.V [Camelus dromedarius]
 ref|XP_011278573.1| PREDICTED: histone H2A.V [Felis catus]
 ref|XP_011383065.1| PREDICTED: histone H2A.V [Pteropus vampyrus]
 ref|XP_011491502.1| PREDICTED: histone H2A.V [Oryzias latipes]
 sp|P02272.2|H2AV_CHICK RecName: Full=Histone H2A.V; AltName: Full=H2A.F/Z [Gallus gallus]
 sp|Q71UI9.3|H2AV_HUMAN RecName: Full=Histone H2A.V; AltName: Full=H2A.F/Z [Homo sapiens]
 sp|Q5BJ65.3|H2AV_XENTR RecName: Full=Histone H2A.V; AltName: Full=H2A.F/Z [Xenopus (Silurana) 
tropicalis]
 sp|Q6GM74.3|H2AV_XENLA RecName: Full=Histone H2A.V; AltName: Full=H2A.F/Z [Xenopus laevis]
 sp|Q6Y237.3|H2AV_PAGMA RecName: Full=Histone H2A.V; AltName: Full=H2A.F/Z [Pagrus major]
 sp|Q71PD7.3|H2AV_DANRE RecName: Full=Histone H2A.V; AltName: Full=H2A.F/Z [Danio rerio]
 sp|Q3THW5.3|H2AV_MOUSE RecName: Full=Histone H2A.V; AltName: Full=H2A.F/Z [Mus musculus]
 sp|Q32LA7.3|H2AV_BOVIN RecName: Full=Histone H2A.V; AltName: Full=H2A.F/Z [Bos taurus]
 gb|AAL10395.1|AF414110_1 histone variant H2A.F/Z [Danio rerio]
 gb|AAL10396.1|AF414111_1 histone variant H2A.F/Z [Danio rerio]
 emb|CAA23705.1| unnamed protein product [Gallus gallus]
 gb|AAC31938.1| histone H2A.F/Z variant [Homo sapiens]
 gb|AAH00098.1| H2A histone family, member V [Homo sapiens]
 dbj|BAB32354.1| unnamed protein product [Mus musculus]
 gb|AAH14885.1| H2A histone family, member V [Homo sapiens]
 gb|AAH49019.1| H2A histone family, member V [Danio rerio]
 gb|AAP20175.1| histone H2A.F/Z variant, partial [Pagrus major]
 gb|AAS00365.1| unknown [Homo sapiens]
 gb|AAH70169.1| H2A histone family, member V [Homo sapiens]
 gb|AAH74203.1| MGC82121 protein [Xenopus laevis]
 gb|AAH78599.1| MGC85536 protein [Xenopus laevis]
 gb|AAH91605.1| H2A histone family, member V [Xenopus (Silurana) tropicalis]
 dbj|BAE33050.1| unnamed protein product [Mus musculus]
 gb|AAI09674.1| H2A histone family, member V [Bos taurus]
 emb|CAJ81609.1| H2A histone family, member V [Xenopus (Silurana) tropicalis]
 gb|EAW61076.1| H2A histone family, member V, isoform CRA_c [Homo sapiens]
 gb|ABM83332.1| H2A histone family, member V [synthetic construct]
 gb|ABM86544.1| H2A histone family, member V [synthetic construct]
 gb|AAH04274.3| H2A histone family, member V [Homo sapiens]
 gb|EDL40593.1| mCG121516, isoform CRA_a [Mus musculus]
 gb|EDM00357.1| rCG35761, isoform CRA_b [Rattus norvegicus]
 gb|AAI54792.1| H2afv protein [Danio rerio]
 gb|AAI47294.1| H2afv protein [Mus musculus]
 gb|AAI47295.1| H2afv protein [Mus musculus]
 gb|AAI47742.1| H2A histone family, member V [Mus musculus]
 gb|ACH44797.1| putative H2A histone family member V variant 1 [Taeniopygia guttata]
 gb|ACH44798.1| putative H2A histone family member V variant 1 [Taeniopygia guttata]
 gb|ACH44799.1| putative H2A histone family member V variant 1 [Taeniopygia guttata]
 gb|ACH44800.1| putative H2A histone family member V variant 1 [Taeniopygia guttata]
 gb|ACH44801.1| putative H2A histone family member V variant 1 [Taeniopygia guttata]
 gb|ACH70792.1| H2A histone family, member V [Salmo salar]
 gb|ACI34256.1| Histone H2AV [Salmo salar]
 gb|ACI66110.1| Histone H2AV [Salmo salar]
 gb|ACI66770.1| Histone H2AV [Salmo salar]
 gb|ACI66843.1| Histone H2AV [Salmo salar]
 gb|ACI67816.1| Histone H2AV [Salmo salar]
 gb|ACM09557.1| Histone H2AV [Salmo salar]
 gb|AAI47752.1| H2A histone family, member V [Mus musculus]
 gb|ACO07817.1| Histone H2AV [Oncorhynchus mykiss]
 gb|ACO07937.1| Histone H2AV [Oncorhynchus mykiss]
 gb|ACO09906.1| Histone H2AV [Osmerus mordax]
 gb|ACO13608.1| Histone H2AV [Esox lucius]
 gb|ACQ58127.1| Histone H2AV [Anoplopoma fimbria]
 tpg|DAA30485.1| TPA: histone H2A.V [Bos taurus]
 gb|ADM16155.1| Histone H2AV [Salmo salar]
 gb|ADO28986.1| histone h2a.v [Ictalurus punctatus]
 gb|EGW08639.1| Histone H2A.V [Cricetulus griseus]
 gb|AFV36371.1| histone H2A.Z.2.1 [Cyprinus carpio]
 gb|AHI42552.1| histone h2a, partial [Campylomormyrus compressirostris]
 gb|AIC52807.1| H2AFV, partial [synthetic construct]
Length=128

 Score =   193 bits (490),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 95/107 (89%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +1

Query  232  SRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKDLK  411
            SRS RAGLQFPVGRIHR LK RTT++GRVGATAAVYSAAILEYLTAEVLELAGNASKDLK
Sbjct  19   SRSQRAGLQFPVGRIHRHLKTRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLK  78

Query  412  VKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            VKRITPRHLQLAIRGDEELD+LIK TIAGGGVIPHIHKSLI K  ++
Sbjct  79   VKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQQ  125



>gb|EOA95897.1| Histone H2A.Z, partial [Anas platyrhynchos]
Length=133

 Score =   193 bits (490),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 95/107 (89%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +1

Query  232  SRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKDLK  411
            SRS RAGLQFPVGRIHR LK RTT++GRVGATAAVYSAAILEYLTAEVLELAGNASKDLK
Sbjct  25   SRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLK  84

Query  412  VKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            VKRITPRHLQLAIRGDEELD+LIK TIAGGGVIPHIHKSLI K  ++
Sbjct  85   VKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQQ  131



>ref|XP_003458968.1| PREDICTED: histone H2A.Z-like isoform X1 [Oreochromis niloticus]
 ref|XP_004080121.1| PREDICTED: histone H2A.Z [Oryzias latipes]
 ref|XP_004576020.1| PREDICTED: histone H2A.Z-like isoform X2 [Maylandia zebra]
 ref|XP_005807952.1| PREDICTED: histone H2A.Z-like [Xiphophorus maculatus]
 ref|XP_007567956.1| PREDICTED: histone H2A.Z [Poecilia formosa]
 ref|XP_008298729.1| PREDICTED: histone H2A.Z [Stegastes partitus]
 ref|XP_008317183.1| PREDICTED: histone H2A.Z [Cynoglossus semilaevis]
 ref|XP_008433132.1| PREDICTED: histone H2A.Z [Poecilia reticulata]
 ref|XP_010782229.1| PREDICTED: histone H2A.Z [Notothenia coriiceps]
 ref|XP_010901188.1| PREDICTED: histone H2A.Z [Esox lucius]
 gb|ACI66137.1| Histone H2A.Z [Salmo salar]
 gb|ACI68191.1| Histone H2A.Z [Salmo salar]
 gb|ACI69641.1| Histone H2A.Z [Salmo salar]
 gb|ACN10027.1| Histone H2A.Z [Salmo salar]
 gb|ACN10153.1| Histone H2A.Z [Salmo salar]
 gb|ACN12374.1| Histone H2A.Z [Salmo salar]
 gb|ACN12505.1| Histone H2A.Z [Salmo salar]
 gb|ADM16115.1| Histone H2A.Z [Salmo salar]
Length=128

 Score =   193 bits (490),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 95/107 (89%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +1

Query  232  SRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKDLK  411
            SRS RAGLQFPVGRIHR LK RTT++GRVGATAAVYSAAILEYLTAEVLELAGNASKDLK
Sbjct  19   SRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLK  78

Query  412  VKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            VKRITPRHLQLAIRGDEELD+LIK TIAGGGVIPHIHKSLI K  ++
Sbjct  79   VKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQQ  125



>gb|ACO13560.1| Histone H2AV [Esox lucius]
Length=128

 Score =   193 bits (490),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 95/107 (89%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +1

Query  232  SRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKDLK  411
            SRS RAGLQFPVGRIHR LK RTT++GRVGATAAVYSAAILEYLTAEVLELAGNASKDLK
Sbjct  19   SRSQRAGLQFPVGRIHRHLKTRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLK  78

Query  412  VKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            VKRITPRHLQLAIRGDEELD+LIK TIAGGGVIPHIHKSLI K  ++
Sbjct  79   VKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQQ  125



>ref|XP_009076453.1| PREDICTED: histone H2A.Z, partial [Acanthisitta chloris]
 ref|XP_009490010.1| PREDICTED: histone H2A.Z, partial [Pelecanus crispus]
 ref|XP_009512078.1| PREDICTED: histone H2A.Z, partial [Phalacrocorax carbo]
 ref|XP_009585588.1| PREDICTED: histone H2A.Z, partial [Fulmarus glacialis]
 ref|XP_009957946.1| PREDICTED: histone H2A.Z, partial [Leptosomus discolor]
 ref|XP_009985287.1| PREDICTED: histone H2A.Z, partial [Tauraco erythrolophus]
 ref|XP_010149377.1| PREDICTED: histone H2A.Z, partial [Eurypyga helias]
 ref|XP_010174253.1| PREDICTED: histone H2A.Z, partial [Caprimulgus carolinensis]
 ref|XP_010191572.1| PREDICTED: histone H2A.Z, partial [Mesitornis unicolor]
 ref|XP_010115915.1| PREDICTED: histone H2A.Z, partial [Chlamydotis macqueenii]
 gb|EMP32810.1| Histone H2A.Z, partial [Chelonia mydas]
 gb|KFQ48224.1| Histone H2A.Z, partial [Pelecanus crispus]
 gb|KFR12690.1| Histone H2A.Z, partial [Opisthocomus hoazin]
 gb|KFV98688.1| Histone H2A.Z, partial [Fulmarus glacialis]
 gb|KFW04745.1| Histone H2A.Z, partial [Eurypyga helias]
 gb|KFZ49019.1| Histone H2A.Z, partial [Caprimulgus carolinensis]
Length=127

 Score =   193 bits (490),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 95/107 (89%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +1

Query  232  SRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKDLK  411
            SRS RAGLQFPVGRIHR LK RTT++GRVGATAAVYSAAILEYLTAEVLELAGNASKDLK
Sbjct  18   SRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLK  77

Query  412  VKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            VKRITPRHLQLAIRGDEELD+LIK TIAGGGVIPHIHKSLI K  ++
Sbjct  78   VKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQQ  124



>emb|CDQ68676.1| unnamed protein product [Oncorhynchus mykiss]
Length=132

 Score =   193 bits (490),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 95/107 (89%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +1

Query  232  SRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKDLK  411
            SRS RAGLQFPVGRIHR LK RTT++GRVGATAAVYSAAILEYLTAEVLELAGNASKDLK
Sbjct  23   SRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLK  82

Query  412  VKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            VKRITPRHLQLAIRGDEELD+LIK TIAGGGVIPHIHKSLI K  ++
Sbjct  83   VKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQQ  129



>ref|XP_007250324.1| PREDICTED: histone H2A.V-like [Astyanax mexicanus]
 gb|AFV36372.1| histone H2A.Z.3.1 [Cyprinus carpio]
Length=128

 Score =   193 bits (490),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 95/107 (89%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +1

Query  232  SRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKDLK  411
            SRS RAGLQFPVGRIHR LK RTT++GRVGATAAVYSAAILEYLTAEVLELAGNASKDLK
Sbjct  19   SRSQRAGLQFPVGRIHRHLKTRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLK  78

Query  412  VKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            VKRITPRHLQLAIRGDEELD+LIK TIAGGGVIPHIHKSLI K  ++
Sbjct  79   VKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQQ  125



>ref|XP_008931529.1| PREDICTED: histone H2A.Z, partial [Manacus vitellinus]
Length=138

 Score =   193 bits (490),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 95/107 (89%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +1

Query  232  SRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKDLK  411
            SRS RAGLQFPVGRIHR LK RTT++GRVGATAAVYSAAILEYLTAEVLELAGNASKDLK
Sbjct  29   SRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLK  88

Query  412  VKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            VKRITPRHLQLAIRGDEELD+LIK TIAGGGVIPHIHKSLI K  ++
Sbjct  89   VKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQQ  135



>ref|XP_002428173.1| histone H2AV, putative [Pediculus humanus corporis]
 gb|EEB15435.1| histone H2AV, putative [Pediculus humanus corporis]
Length=153

 Score =   194 bits (492),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 96/108 (89%), Positives = 101/108 (94%), Gaps = 0/108 (0%)
 Frame = +1

Query  229  TSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKDL  408
             SRS+RAGLQFPVGRIHR LK RTT++GRVGATAAVYSAAILEYLTAEVLELAGNASKDL
Sbjct  45   VSRSARAGLQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDL  104

Query  409  KVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            KVKRITPRHLQLAIRGDEELD+LIK TIAGGGVIPHIHKSLI K  K+
Sbjct  105  KVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGKK  152



>pdb|3WA9|C Chain C, The Nucleosome Containing Human H2a.z.1
 pdb|3WA9|G Chain G, The Nucleosome Containing Human H2a.z.1
Length=131

 Score =   193 bits (490),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 95/107 (89%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +1

Query  232  SRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKDLK  411
            SRS RAGLQFPVGRIHR LK RTT++GRVGATAAVYSAAILEYLTAEVLELAGNASKDLK
Sbjct  22   SRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLK  81

Query  412  VKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            VKRITPRHLQLAIRGDEELD+LIK TIAGGGVIPHIHKSLI K  ++
Sbjct  82   VKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQQ  128



>ref|XP_007613537.1| PREDICTED: histone H2A.V isoform X2 [Cricetulus griseus]
 gb|ERE88393.1| histone H2A.V-like protein [Cricetulus griseus]
Length=137

 Score =   193 bits (490),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 95/107 (89%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +1

Query  232  SRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKDLK  411
            SRS RAGLQFPVGRIHR LK RTT++GRVGATAAVYSAAILEYLTAEVLELAGNASKDLK
Sbjct  28   SRSQRAGLQFPVGRIHRHLKTRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLK  87

Query  412  VKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            VKRITPRHLQLAIRGDEELD+LIK TIAGGGVIPHIHKSLI K  ++
Sbjct  88   VKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQQ  134



>gb|KFV85097.1| Histone H2A.V, partial [Struthio camelus australis]
Length=127

 Score =   192 bits (489),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 95/107 (89%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +1

Query  232  SRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKDLK  411
            SRS RAGLQFPVGRIHR LK RTT++GRVGATAAVYSAAILEYLTAEVLELAGNASKDLK
Sbjct  19   SRSQRAGLQFPVGRIHRHLKTRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLK  78

Query  412  VKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            VKRITPRHLQLAIRGDEELD+LIK TIAGGGVIPHIHKSLI K  ++
Sbjct  79   VKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQQ  125



>gb|ACO11883.1| Histone H2A.Z [Lepeophtheirus salmonis]
 gb|ACO13063.1| Histone H2A.Z [Lepeophtheirus salmonis]
 gb|ADD38645.1| Histone H2A.Z [Lepeophtheirus salmonis]
Length=128

 Score =   192 bits (489),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 96/104 (92%), Positives = 99/104 (95%), Gaps = 0/104 (0%)
 Frame = +1

Query  229  TSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKDL  408
             SRS+RAGLQFPVGRIHR LK RTT++GRVGATAAVYSAAILEYLTAEVLELAGNASKDL
Sbjct  18   VSRSARAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDL  77

Query  409  KVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINK  540
            KVKRITPRHLQLAIRGDEELDTLIK TIAGGGVIPHIHKSLI K
Sbjct  78   KVKRITPRHLQLAIRGDEELDTLIKATIAGGGVIPHIHKSLIGK  121



>pdb|3WAA|C Chain C, The Nucleosome Containing Human H2a.z.2
 pdb|3WAA|G Chain G, The Nucleosome Containing Human H2a.z.2
Length=131

 Score =   193 bits (490),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 95/107 (89%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +1

Query  232  SRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKDLK  411
            SRS RAGLQFPVGRIHR LK RTT++GRVGATAAVYSAAILEYLTAEVLELAGNASKDLK
Sbjct  22   SRSQRAGLQFPVGRIHRHLKTRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLK  81

Query  412  VKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            VKRITPRHLQLAIRGDEELD+LIK TIAGGGVIPHIHKSLI K  ++
Sbjct  82   VKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQQ  128



>ref|XP_007081020.1| PREDICTED: histone H2A.Z-like [Panthera tigris altaica]
Length=128

 Score =   192 bits (489),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 95/107 (89%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +1

Query  232  SRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKDLK  411
            SRS RAGLQFPVGRIHR LK RTT++GRVGATAAVYSAAILEYLTAEVLELAGNASKDLK
Sbjct  19   SRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLK  78

Query  412  VKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            VKRITPRHLQLAIRGDEELD+LIK TIAGGGVIPHIHKSLI K  ++
Sbjct  79   VKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQQ  125



>dbj|BAE30460.1| unnamed protein product [Mus musculus]
Length=128

 Score =   192 bits (489),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 95/107 (89%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +1

Query  232  SRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKDLK  411
            SRS RAGLQFPVGRIHR LK RTT++GRVGATAAVYSAAILEYLTAEVLELAGNASKDLK
Sbjct  19   SRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLK  78

Query  412  VKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            VKRITPRHLQLAIRGDEELD+LIK TIAGGGVIPHIHKSLI K  ++
Sbjct  79   VKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQQ  125



>ref|XP_004894331.1| PREDICTED: histone H2A.V-like [Heterocephalus glaber]
Length=142

 Score =   193 bits (491),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 95/107 (89%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +1

Query  232  SRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKDLK  411
            SRS RAGLQFPVGRIHR LK RTT++GRVGATAAVYSAAILEYLTAEVLELAGNASKDLK
Sbjct  33   SRSQRAGLQFPVGRIHRHLKTRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLK  92

Query  412  VKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            VKRITPRHLQLAIRGDEELD+LIK TIAGGGVIPHIHKSLI K  ++
Sbjct  93   VKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQQ  139



>ref|XP_009694151.1| PREDICTED: histone H2A.Z, partial [Cariama cristata]
 ref|XP_009812474.1| PREDICTED: histone H2A.Z, partial [Gavia stellata]
 ref|XP_010293918.1| PREDICTED: histone H2A.Z, partial [Phaethon lepturus]
 ref|XP_010306383.1| PREDICTED: histone H2A.Z, partial [Balearica regulorum gibbericeps]
Length=126

 Score =   192 bits (489),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 95/107 (89%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +1

Query  232  SRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKDLK  411
            SRS RAGLQFPVGRIHR LK RTT++GRVGATAAVYSAAILEYLTAEVLELAGNASKDLK
Sbjct  17   SRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLK  76

Query  412  VKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            VKRITPRHLQLAIRGDEELD+LIK TIAGGGVIPHIHKSLI K  ++
Sbjct  77   VKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQQ  123



>ref|XP_009563646.1| PREDICTED: histone H2A.V [Cuculus canorus]
Length=126

 Score =   192 bits (489),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 95/107 (89%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +1

Query  232  SRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKDLK  411
            SRS RAGLQFPVGRIHR LK RTT++GRVGATAAVYSAAILEYLTAEVLELAGNASKDLK
Sbjct  17   SRSQRAGLQFPVGRIHRHLKTRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLK  76

Query  412  VKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            VKRITPRHLQLAIRGDEELD+LIK TIAGGGVIPHIHKSLI K  ++
Sbjct  77   VKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQQ  123



>pdb|4CAY|A Chain A, Crystal Structure Of A Human Anp32e-h2a.z-h2b Complex
Length=111

 Score =   192 bits (488),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 95/107 (89%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +1

Query  232  SRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKDLK  411
            SRS RAGLQFPVGRIHR LK RTT++GRVGATAAVYSAAILEYLTAEVLELAGNASKDLK
Sbjct  2    SRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLK  61

Query  412  VKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            VKRITPRHLQLAIRGDEELD+LIK TIAGGGVIPHIHKSLI K  ++
Sbjct  62   VKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQQ  108



>gb|ACO10600.1| Histone H2A.Z [Caligus rogercresseyi]
Length=129

 Score =   192 bits (489),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 96/103 (93%), Positives = 99/103 (96%), Gaps = 0/103 (0%)
 Frame = +1

Query  232  SRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKDLK  411
            SRS+RAGLQFPVGRIHR LK RTT++GRVGATAAVYSAAILEYLTAEVLELAGNASKDLK
Sbjct  19   SRSARAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLK  78

Query  412  VKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINK  540
            VKRITPRHLQLAIRGDEELDTLIK TIAGGGVIPHIHKSLI K
Sbjct  79   VKRITPRHLQLAIRGDEELDTLIKATIAGGGVIPHIHKSLIGK  121



>ref|NP_001116980.1| histone H2 A.F/Z [Strongylocentrotus purpuratus]
 ref|XP_002739823.1| PREDICTED: histone H2A.V-like [Saccoglossus kowalevskii]
Length=128

 Score =   192 bits (489),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 95/107 (89%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +1

Query  232  SRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKDLK  411
            SRS+RAGLQFPVGRIHR LK RTT++GRVGATAAVYSAAILEYLTAEVLELAGNASKDLK
Sbjct  19   SRSARAGLQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLK  78

Query  412  VKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            VKRITPRHLQLAIRGDEELD+LIK TIAGGGVIPHIHKSLI K   +
Sbjct  79   VKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGSQ  125



>gb|ACJ12611.1| histone H2A isoform 2 [Haliotis discus discus]
Length=128

 Score =   192 bits (489),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 95/108 (88%), Positives = 100/108 (93%), Gaps = 0/108 (0%)
 Frame = +1

Query  229  TSRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKDL  408
             SRS+RAGLQFPVGRIHR LK RTT++GRVGATAAVYSAAILEYLTAEVLELAGNASKDL
Sbjct  18   VSRSARAGLQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDL  77

Query  409  KVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            KVKRITPRHLQLAIRGDEELD+LIK TIAGGGVIPHIHKSLI K   +
Sbjct  78   KVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGSQ  125



>ref|XP_008633818.1| PREDICTED: histone H2A.Z [Corvus brachyrhynchos]
 ref|XP_010409974.1| PREDICTED: histone H2A.Z [Corvus cornix cornix]
Length=143

 Score =   193 bits (491),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 95/107 (89%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +1

Query  232  SRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKDLK  411
            SRS RAGLQFPVGRIHR LK RTT++GRVGATAAVYSAAILEYLTAEVLELAGNASKDLK
Sbjct  34   SRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLK  93

Query  412  VKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            VKRITPRHLQLAIRGDEELD+LIK TIAGGGVIPHIHKSLI K  ++
Sbjct  94   VKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQQ  140



>ref|XP_001364046.1| PREDICTED: histone H2A.Z-like [Monodelphis domestica]
Length=128

 Score =   192 bits (489),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 95/107 (89%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +1

Query  232  SRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKDLK  411
            SRS RAGLQFPVGRIHR LK RTT++GRVGATAAVYSAAILEYLTAEVLELAGNASKDLK
Sbjct  19   SRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLK  78

Query  412  VKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            VKRITPRHLQLAIRGDEELD+LIK TIAGGGVIPHIHKSLI K  ++
Sbjct  79   VKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQQ  125



>emb|CDQ92154.1| unnamed protein product [Oncorhynchus mykiss]
Length=128

 Score =   192 bits (489),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 94/107 (88%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +1

Query  232  SRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKDLK  411
            SRS RAGLQFPVGRIHR LK RTT++GRVGATAAVYSAAILEYLTAEVLELAGNASKDLK
Sbjct  19   SRSQRAGLQFPVGRIHRHLKTRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLK  78

Query  412  VKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            VKRITPRHLQLAIRGDEELD+L+K TIAGGGVIPHIHKSLI K  ++
Sbjct  79   VKRITPRHLQLAIRGDEELDSLVKATIAGGGVIPHIHKSLIGKKGQQ  125



>ref|NP_001036788.1| histone 2A family member ZA [Danio rerio]
 gb|ABG46420.1| histone 2A family member ZA [Danio rerio]
Length=128

 Score =   192 bits (489),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 95/107 (89%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +1

Query  232  SRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKDLK  411
            SRS RAGLQFPVGRIHR LK RTT++GRVGATAAVYSAAILEYLTAEVLELAGNASKDLK
Sbjct  19   SRSQRAGLQFPVGRIHRHLKTRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLK  78

Query  412  VKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            VKRITPRHLQLAIRGDEELD+LIK TIAGGGVIPHIHKSLI K  ++
Sbjct  79   VKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQQ  125



>ref|XP_010623224.1| PREDICTED: histone H2A.V isoform X1 [Fukomys damarensis]
Length=134

 Score =   193 bits (490),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 95/107 (89%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +1

Query  232  SRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKDLK  411
            SRS RAGLQFPVGRIHR LK RTT++GRVGATAAVYSAAILEYLTAEVLELAGNASKDLK
Sbjct  25   SRSQRAGLQFPVGRIHRHLKTRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLK  84

Query  412  VKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            VKRITPRHLQLAIRGDEELD+LIK TIAGGGVIPHIHKSLI K  ++
Sbjct  85   VKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQQ  131



>ref|XP_009633050.1| PREDICTED: histone H2A.Z [Egretta garzetta]
Length=139

 Score =   193 bits (490),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 95/107 (89%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +1

Query  232  SRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKDLK  411
            SRS RAGLQFPVGRIHR LK RTT++GRVGATAAVYSAAILEYLTAEVLELAGNASKDLK
Sbjct  30   SRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLK  89

Query  412  VKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            VKRITPRHLQLAIRGDEELD+LIK TIAGGGVIPHIHKSLI K  ++
Sbjct  90   VKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQQ  136



>ref|XP_008524485.1| PREDICTED: histone H2A.V, partial [Equus przewalskii]
 ref|XP_009483342.1| PREDICTED: histone H2A.V, partial [Pelecanus crispus]
 ref|XP_010006523.1| PREDICTED: histone H2A.V, partial [Chaetura pelagica]
 ref|XP_010208906.1| PREDICTED: histone H2A.V, partial [Colius striatus]
 ref|XP_010284413.1| PREDICTED: histone H2A.V, partial [Phaethon lepturus]
 gb|EHH52147.1| H2A.F/Z, partial [Macaca fascicularis]
 gb|ELR59168.1| Histone H2A.V, partial [Bos mutus]
Length=127

 Score =   192 bits (489),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 95/107 (89%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +1

Query  232  SRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKDLK  411
            SRS RAGLQFPVGRIHR LK RTT++GRVGATAAVYSAAILEYLTAEVLELAGNASKDLK
Sbjct  18   SRSQRAGLQFPVGRIHRHLKTRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLK  77

Query  412  VKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            VKRITPRHLQLAIRGDEELD+LIK TIAGGGVIPHIHKSLI K  ++
Sbjct  78   VKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQQ  124



>ref|XP_006736504.1| PREDICTED: histone H2A.V-like [Leptonychotes weddellii]
Length=140

 Score =   193 bits (490),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 95/107 (89%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +1

Query  232  SRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKDLK  411
            SRS RAGLQFPVGRIHR LK RTT++GRVGATAAVYSAAILEYLTAEVLELAGNASKDLK
Sbjct  31   SRSQRAGLQFPVGRIHRHLKTRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLK  90

Query  412  VKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            VKRITPRHLQLAIRGDEELD+LIK TIAGGGVIPHIHKSLI K  ++
Sbjct  91   VKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQQ  137



>ref|XP_007979605.1| PREDICTED: histone H2A.V isoform X1 [Chlorocebus sabaeus]
Length=138

 Score =   193 bits (490),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 95/107 (89%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +1

Query  232  SRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKDLK  411
            SRS RAGLQFPVGRIHR LK RTT++GRVGATAAVYSAAILEYLTAEVLELAGNASKDLK
Sbjct  29   SRSQRAGLQFPVGRIHRHLKTRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLK  88

Query  412  VKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            VKRITPRHLQLAIRGDEELD+LIK TIAGGGVIPHIHKSLI K  ++
Sbjct  89   VKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQQ  135



>ref|XP_010623226.1| PREDICTED: histone H2A.V isoform X3 [Fukomys damarensis]
Length=130

 Score =   192 bits (489),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 95/107 (89%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +1

Query  232  SRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKDLK  411
            SRS RAGLQFPVGRIHR LK RTT++GRVGATAAVYSAAILEYLTAEVLELAGNASKDLK
Sbjct  21   SRSQRAGLQFPVGRIHRHLKTRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLK  80

Query  412  VKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            VKRITPRHLQLAIRGDEELD+LIK TIAGGGVIPHIHKSLI K  ++
Sbjct  81   VKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQQ  127



>sp|P08991.1|H2AV_STRPU RecName: Full=Histone H2A.V; AltName: Full=H2A.F/Z, partial [Strongylocentrotus 
purpuratus]
 emb|CAA29061.1| histone H2 A.F/Z [Strongylocentrotus purpuratus]
Length=125

 Score =   192 bits (488),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 95/107 (89%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +1

Query  232  SRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKDLK  411
            SRS+RAGLQFPVGRIHR LK RTT++GRVGATAAVYSAAILEYLTAEVLELAGNASKDLK
Sbjct  16   SRSARAGLQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLK  75

Query  412  VKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            VKRITPRHLQLAIRGDEELD+LIK TIAGGGVIPHIHKSLI K   +
Sbjct  76   VKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGSQ  122



>ref|XP_005235794.1| PREDICTED: histone H2A.V-like [Falco peregrinus]
Length=140

 Score =   193 bits (490),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 95/107 (89%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +1

Query  232  SRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKDLK  411
            SRS RAGLQFPVGRIHR LK RTT++GRVGATAAVYSAAILEYLTAEVLELAGNASKDLK
Sbjct  31   SRSQRAGLQFPVGRIHRHLKTRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLK  90

Query  412  VKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            VKRITPRHLQLAIRGDEELD+LIK TIAGGGVIPHIHKSLI K  ++
Sbjct  91   VKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQQ  137



>ref|XP_002610336.1| hypothetical protein BRAFLDRAFT_72473 [Branchiostoma floridae]
 gb|EEN66346.1| hypothetical protein BRAFLDRAFT_72473 [Branchiostoma floridae]
Length=128

 Score =   192 bits (489),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 95/107 (89%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +1

Query  232  SRSSRAGLQFPVGRIHRLLKERTTANGRVGATAAVYSAAILEYLTAEVLELAGNASKDLK  411
            SRS+RAGLQFPVGRIHR LK RTT++GRVGATAAVYSAAILEYLTAEVLELAGNASKDLK
Sbjct  19   SRSARAGLQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLK  78

Query  412  VKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE  552
            VKRITPRHLQLAIRGDEELD+LIK TIAGGGVIPHIHKSLI K   +
Sbjct  79   VKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGSQ  125



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 906702465875