BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001P04

Length=587
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|ABL67954.2|  1-aminocyclopropane-1-carboxylate oxidase               300   1e-98   Ipomoea nil [qian niu]
gb|AAD28196.2|AF115261_1  1-aminocyclopropane-1-carboxylate oxidase     258   7e-82   Trifolium repens [creeping white clover]
ref|XP_004486198.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    256   3e-81   Cicer arietinum [garbanzo]
ref|XP_008224728.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    255   5e-81   Prunus mume [ume]
dbj|BAF33502.1|  ACC oxidase                                            255   5e-81   Phelipanche ramosa
sp|P31239.1|ACCO_PEA  RecName: Full=1-aminocyclopropane-1-carboxy...    254   9e-81   Pisum sativum [garden pea]
emb|CAI64500.1|  1-aminocyclopropane-1-carboxylate oxidase 2            254   1e-80   Prunus domestica subsp. syriaca [Mirabelle plum]
gb|ABO32691.1|  ACC oxidase ACO3                                        254   1e-80   Nicotiana attenuata
ref|XP_007211643.1|  hypothetical protein PRUPE_ppa008813mg             254   1e-80   Prunus persica
ref|XP_009802116.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    254   2e-80   Nicotiana sylvestris
gb|AGN74918.1|  1-aminocyclopropane-1-carboxylate oxidase               254   2e-80   Morus alba
dbj|BAD06178.1|  ACC oxidase                                            254   3e-80   Pisum sativum var. macrocarpum [snow pea]
ref|XP_011096014.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    252   9e-80   Sesamum indicum [beniseed]
ref|NP_001289250.1|  1-aminocyclopropane-1-carboxylate oxidase 1        252   1e-79   Pyrus x bretschneideri [bai li]
gb|ABF61805.1|  1-aminocyclopropane-1-carboxylate oxidase               252   1e-79   Medicago sativa [alfalfa]
ref|XP_003594162.1|  1-aminocyclopropane-1-carboxylate oxidase          249   1e-79   
ref|XP_011086213.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    252   1e-79   Sesamum indicum [beniseed]
ref|XP_002273430.3|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    252   1e-79   Vitis vinifera
gb|ACU23036.1|  unknown                                                 248   1e-79   Glycine max [soybeans]
gb|AAF36484.1|AF129074_1  1-aminocyclopropane-1-carboxylate oxidase     252   1e-79   Prunus persica
ref|NP_001275208.1|  1-aminocyclopropane-1-carboxylate oxidase          252   1e-79   Solanum tuberosum [potatoes]
ref|XP_010110622.1|  1-aminocyclopropane-1-carboxylate oxidase 3        251   2e-79   Morus notabilis
ref|XP_011000640.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    251   4e-79   Populus euphratica
ref|XP_003529653.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    250   6e-79   Glycine max [soybeans]
ref|NP_001281047.1|  1-aminocyclopropane-1-carboxylate oxidase 1        250   6e-79   Malus domestica [apple tree]
emb|CAJ56065.1|  ACC oxidase                                            250   7e-79   Vigna radiata [mung bean]
ref|NP_001234638.1|  1-aminocyclopropane-1-carboxylate oxidase          250   8e-79   Solanum lycopersicum
ref|XP_003549632.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    250   8e-79   Glycine max [soybeans]
sp|Q00985.1|ACCO1_MALDO  RecName: Full=1-aminocyclopropane-1-carb...    249   9e-79   Malus domestica [apple tree]
ref|XP_009355918.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    249   1e-78   Pyrus x bretschneideri [bai li]
gb|ACU24286.1|  unknown                                                 249   1e-78   Glycine max [soybeans]
gb|KJB57824.1|  hypothetical protein B456_009G182300                    246   1e-78   Gossypium raimondii
ref|XP_007153995.1|  hypothetical protein PHAVU_003G082300g             249   1e-78   Phaseolus vulgaris [French bean]
ref|XP_003594161.1|  1-aminocyclopropane-1-carboxylate oxidase          249   1e-78   Medicago truncatula
gb|AFJ75398.1|  1-aminocyclopropane-1-carboxylic acid oxidase           249   1e-78   Salvia miltiorrhiza [Chinese salvia]
gb|AHL69752.1|  aminocyclopropanecarboxylate oxidase                    249   1e-78   Picrorhiza kurrooa
ref|NP_001241899.1|  1-aminocyclopropane-1-carboxylate oxidase-like     249   1e-78   
ref|XP_009791489.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    249   2e-78   Nicotiana sylvestris
emb|CAA67216.1|  ACC oxidase                                            249   2e-78   Malus domestica [apple tree]
gb|AHA06004.1|  1-aminocyclopropane-1-carboxylate oxidase               249   2e-78   Lupinus luteus
gb|AAC48977.1|  1-aminocyclopropane-1-carboxylate oxidase               249   2e-78   Pelargonium x hortorum [bedding geranium]
gb|KHN32985.1|  1-aminocyclopropane-1-carboxylate oxidase               249   2e-78   Glycine soja [wild soybean]
sp|Q08507.1|ACCO3_PETHY  RecName: Full=1-aminocyclopropane-1-carb...    249   2e-78   Petunia x hybrida [garden petunia]
emb|CAD21844.1|  ACC oxidase 1                                          249   2e-78   Fagus sylvatica
ref|XP_003534723.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    249   2e-78   Glycine max [soybeans]
gb|AEM62877.1|  ACC oxidase 1                                           249   2e-78   Actinidia chinensis
dbj|BAC66950.1|  ACC oxidase                                            248   2e-78   Striga hermonthica [purple witchweed]
emb|CAJ56064.1|  ACC oxidase                                            248   3e-78   Vigna radiata [mung bean]
ref|XP_008371045.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    249   3e-78   Malus domestica [apple tree]
emb|CAH18930.1|  1-aminocyclopropane-1-carboxylate oxidase              248   3e-78   Pyrus communis
sp|P31237.1|ACCO_ACTDE  RecName: Full=1-aminocyclopropane-1-carbo...    248   3e-78   Actinidia deliciosa [Chinese gooseberry]
gb|AEM62885.1|  ACC oxidase 6                                           248   3e-78   Actinidia chinensis
gb|ABW91146.1|  ACC oxidase 1                                           248   4e-78   Ziziphus jujuba [Chinese jujube]
gb|AEP19803.1|  ACC oxidase 1                                           248   4e-78   Ziziphus jujuba [Chinese jujube]
gb|KDO78385.1|  hypothetical protein CISIN_1g018920mg                   244   4e-78   Citrus sinensis [apfelsine]
gb|AAZ83342.1|  ACC oxidase 1                                           248   5e-78   Gossypium hirsutum [American cotton]
gb|KJB57823.1|  hypothetical protein B456_009G182300                    248   5e-78   Gossypium raimondii
gb|ABK59094.1|  1-amino-cyclopropane-1-carboxylic acid oxidase 3        248   5e-78   Manihot esculenta [manioc]
gb|AFK48521.1|  unknown                                                 247   6e-78   Lotus japonicus
emb|CAH58646.1|  aminocyclopropan-1-carboxylate oxidase                 247   9e-78   Plantago major [cart-track plant]
ref|XP_009593567.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    247   9e-78   Nicotiana tomentosiformis
ref|XP_002316589.1|  aminocyclopropane carboxylate oxidase family...    247   1e-77   Populus trichocarpa [western balsam poplar]
gb|AAK07883.1|AF315316_1  ACC oxidase                                   247   1e-77   Vigna radiata [mung bean]
gb|AAC48922.1|  1-aminocyclopropane-1-carboxylate oxidase homolog       246   1e-77   Vigna radiata [mung bean]
gb|AEM62881.1|  ACC oxidase 4                                           246   1e-77   Actinidia chinensis
gb|AEM62882.1|  ACC oxidase 4                                           246   2e-77   Actinidia deliciosa [Chinese gooseberry]
gb|ACU24032.1|  unknown                                                 246   2e-77   Glycine max [soybeans]
gb|AAC98808.1|  ACC oxidase                                             246   2e-77   Carica papaya [mamon]
gb|KHG24528.1|  1-aminocyclopropane-1-carboxylate oxidase               245   2e-77   Gossypium arboreum [tree cotton]
ref|NP_001233867.1|  1-aminocyclopropane-1-carboxylate oxidase          246   2e-77   
dbj|BAH80550.1|  1-aminocyclopropane-1-carboxylate oxidase              244   2e-77   Eucalyptus grandis [rose gum]
gb|EYU27738.1|  hypothetical protein MIMGU_mgv1a010275mg                246   2e-77   Erythranthe guttata [common monkey flower]
emb|CAA60576.1|  1-aminocyclopropane-1-carboxylate oxidase              246   3e-77   Pyrus communis
ref|XP_006449820.1|  hypothetical protein CICLE_v10015965mg             245   4e-77   Citrus clementina [clementine]
ref|NP_001267871.1|  aconitase 2, mitochondrial                         245   4e-77   Vitis vinifera
emb|CAJ56066.1|  ACC oxidase                                            245   4e-77   Vigna radiata [mung bean]
sp|O48882.1|ACCO2_MALDO  RecName: Full=1-aminocyclopropane-1-carb...    246   5e-77   Malus domestica [apple tree]
gb|AFK45850.1|  unknown                                                 245   5e-77   Lotus japonicus
gb|KHG24527.1|  1-aminocyclopropane-1-carboxylate oxidase               244   5e-77   Gossypium arboreum [tree cotton]
gb|AGF95124.1|  1-aminocyclopropane-1-carboxylate oxidase               245   7e-77   Prunus persica
gb|AGG20315.1|  1-aminocyclopropane-1-carboxylate oxidase 4             245   7e-77   Capsicum annuum
ref|XP_009609240.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    244   7e-77   Nicotiana tomentosiformis
ref|XP_010035505.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    245   7e-77   Eucalyptus grandis [rose gum]
ref|XP_007147675.1|  hypothetical protein PHAVU_006G144900g             244   7e-77   Phaseolus vulgaris [French bean]
gb|ACJ84384.1|  unknown                                                 241   8e-77   Medicago truncatula
emb|CDP21175.1|  unnamed protein product                                239   9e-77   Coffea canephora [robusta coffee]
ref|XP_007026207.1|  Ethylene-forming enzyme                            244   9e-77   
gb|AAF64528.1|AF254125_1  ACC oxidase                                   244   9e-77   Carica papaya [mamon]
ref|XP_009630256.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    244   1e-76   Nicotiana tomentosiformis
gb|AEM62883.1|  ACC oxidase 5                                           244   1e-76   Actinidia chinensis
gb|EYU33867.1|  hypothetical protein MIMGU_mgv1a010647mg                244   1e-76   Erythranthe guttata [common monkey flower]
ref|XP_009789991.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    244   2e-76   Nicotiana sylvestris
ref|XP_006348170.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    244   2e-76   Solanum tuberosum [potatoes]
ref|XP_004293334.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    243   2e-76   Fragaria vesca subsp. vesca
gb|AEM62878.1|  ACC oxidase 2                                           243   3e-76   Actinidia deliciosa [Chinese gooseberry]
gb|AEM62884.1|  ACC oxidase 5                                           243   3e-76   Actinidia deliciosa [Chinese gooseberry]
gb|AAL37174.1|AF320071_1  1-aminocyclopropane-1-carboxylate oxidase     243   3e-76   Carica papaya [mamon]
ref|XP_009768154.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    243   3e-76   Nicotiana sylvestris
emb|CAH65725.1|  1-aminocyclopropane-1-carboxylate oxidase              243   3e-76   Carica papaya [mamon]
gb|AAL78058.1|  ripening-induced ACC oxidase                            243   3e-76   Carica papaya [mamon]
sp|Q08508.1|ACCO4_PETHY  RecName: Full=1-aminocyclopropane-1-carb...    243   3e-76   Petunia x hybrida [garden petunia]
gb|AAK57516.1|  ACC oxidase                                             243   3e-76   Carica papaya [mamon]
gb|AEM62879.1|  ACC oxidase 3                                           243   4e-76   Actinidia chinensis
gb|AAA99793.1|  1-aminocyclopropane-1-carboxylic acid oxidase           243   4e-76   Nicotiana glutinosa
gb|AAA99792.1|  1-aminocyclopropane-1-carboxylic acid oxidase           243   4e-76   Nicotiana glutinosa
emb|CAN85573.1|  ACC oxidase 2                                          243   4e-76   Hevea brasiliensis [jebe]
gb|KEH35231.1|  1-aminocyclopropane-1-carboxylate oxidase               239   4e-76   Medicago truncatula
ref|XP_010052892.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    243   5e-76   Eucalyptus grandis [rose gum]
gb|ACS71641.1|  ACC oxidase                                             243   5e-76   Dorcoceras hygrometricum
emb|CAN68493.1|  hypothetical protein VITISV_042552                     242   5e-76   Vitis vinifera
emb|CAH64841.1|  1-aminocyclopropane-1-carboxylate oxidase              243   5e-76   Carica papaya [mamon]
gb|AAP41850.1|  1-aminocyclopropane-1-carboxylate oxidase               243   5e-76   Hevea brasiliensis [jebe]
ref|XP_010035513.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    243   6e-76   Eucalyptus grandis [rose gum]
emb|CDP04457.1|  unnamed protein product                                242   7e-76   Coffea canephora [robusta coffee]
gb|AAD28197.2|AF115262_1  1-aminocyclopropane-1-carboxylate oxidase     242   7e-76   Trifolium repens [creeping white clover]
gb|AEM62880.1|  ACC oxidase 3                                           242   7e-76   Actinidia deliciosa [Chinese gooseberry]
emb|CAA58232.1|  1-amniocyclopropane-1-carboxylate oxidase              242   7e-76   Nicotiana tabacum [American tobacco]
emb|CAJ56067.1|  ACC oxidase                                            242   8e-76   Vigna radiata [mung bean]
ref|XP_010035506.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    242   8e-76   Eucalyptus grandis [rose gum]
dbj|BAA19605.1|  ACC-oxidase                                            242   9e-76   Vigna angularis [azuki bean]
ref|XP_010035507.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    242   9e-76   Eucalyptus grandis [rose gum]
ref|XP_010099139.1|  1-aminocyclopropane-1-carboxylate oxidase          242   9e-76   Morus notabilis
dbj|BAF33504.1|  ACC synthase                                           241   1e-75   Orobanche minor
gb|AAL35971.1|  1-aminocyclopropanecarboxylic acid oxidase              241   1e-75   Medicago truncatula
ref|XP_010035510.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    242   1e-75   Eucalyptus grandis [rose gum]
ref|NP_001233928.1|  1-aminocyclopropane-1-carboxylate oxidase 4        241   1e-75   Solanum lycopersicum
dbj|BAA21541.1|  1-aminocyclopropane-1-carboxylic acid oxidase          241   1e-75   Actinidia deliciosa [Chinese gooseberry]
ref|XP_009790903.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    241   1e-75   Nicotiana sylvestris
ref|XP_010035508.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    241   1e-75   Eucalyptus grandis [rose gum]
gb|KJB10710.1|  hypothetical protein B456_001G217400                    241   1e-75   Gossypium raimondii
ref|XP_004304079.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    241   1e-75   Fragaria vesca subsp. vesca
ref|XP_004502173.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    241   1e-75   Cicer arietinum [garbanzo]
ref|XP_010035511.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    241   1e-75   Eucalyptus grandis [rose gum]
ref|XP_009781832.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    241   2e-75   Nicotiana sylvestris
gb|ACJ84896.1|  unknown                                                 238   2e-75   Medicago truncatula
prf||1909340A  Pch313 protein                                           241   2e-75
ref|XP_006357981.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    241   2e-75   Solanum tuberosum [potatoes]
ref|XP_009604053.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    241   2e-75   Nicotiana tomentosiformis
sp|P05116.2|ACCO1_SOLLC  RecName: Full=1-aminocyclopropane-1-carb...    241   2e-75   Solanum lycopersicum
ref|XP_010035504.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    241   2e-75   Eucalyptus grandis [rose gum]
gb|AAB70884.1|  1-aminocyclopropane-1-carboxylate oxidase               241   2e-75   Pelargonium x hortorum [bedding geranium]
dbj|BAG30908.1|  ACC oxidase                                            241   2e-75   Capsicum chinense [bonnet pepper]
dbj|BAG06705.1|  1-aminocyclopropane-1-carboxylate oxidase              241   3e-75   Ficus carica
ref|NP_001280183.1|  1-aminocyclopropane-1-carboxylate oxidase          241   3e-75   Prunus mume [ume]
gb|AGM48542.1|  1-aminocyclopropane-1-carboxylate oxidase               241   3e-75   Coffea arabica [arabica coffee]
gb|ADR73045.1|  ACC oxidase 2 isoform A                                 240   3e-75   Nicotiana tabacum [American tobacco]
gb|AFK42210.1|  unknown                                                 240   3e-75   Medicago truncatula
emb|CDP05673.1|  unnamed protein product                                241   3e-75   Coffea canephora [robusta coffee]
ref|XP_003601593.1|  1-aminocyclopropane-1-carboxylate oxidase          240   3e-75   Medicago truncatula
sp|P54847.1|ACCO3_CUCME  RecName: Full=1-aminocyclopropane-1-carb...    240   4e-75   Cucumis melo [Oriental melon]
ref|XP_008440054.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    240   4e-75   Cucumis melo [Oriental melon]
gb|AEK70335.1|  1-aminocyclopropane-1-carboxylate oxidase               240   4e-75   Paeonia lactiflora [common garden peony]
sp|Q43792.1|ACCO_TOBAC  RecName: Full=1-aminocyclopropane-1-carbo...    240   5e-75   Nicotiana tabacum [American tobacco]
emb|CAA71738.1|  1-aminocyclopropane-1-carboxylate oxidase              240   6e-75   Betula pendula [white birch]
dbj|BAH66891.1|  1-aminocyclopropane-1-carboxylate oxidase              239   6e-75   Prunus mume [ume]
emb|CAN85569.1|  ACC oxidase 1                                          239   6e-75   Hevea brasiliensis [jebe]
gb|AFU90135.1|  1-aminocyclopropane-1-carboxylate oxidase               239   7e-75   Paeonia lactiflora [common garden peony]
emb|CDP05674.1|  unnamed protein product                                239   7e-75   Coffea canephora [robusta coffee]
ref|XP_007215698.1|  hypothetical protein PRUPE_ppa008791mg             239   8e-75   Prunus persica
ref|XP_009613638.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    239   1e-74   Nicotiana tomentosiformis
ref|XP_008342143.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    239   1e-74   
gb|AHN13883.1|  1-aminocyclopropane-1-carboxylate oxidase 1             239   1e-74   Coffea arabica [arabica coffee]
gb|ACU18811.1|  unknown                                                 236   1e-74   Glycine max [soybeans]
ref|XP_009629716.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    239   2e-74   Nicotiana tomentosiformis
ref|NP_001275482.1|  1-aminocyclopropane-1-carboxylate oxidase          238   2e-74   Solanum tuberosum [potatoes]
emb|CAN85572.1|  ACC oxidase 1                                          238   2e-74   Hevea brasiliensis [jebe]
ref|XP_006383841.1|  aminocyclopropane carboxylate oxidase family...    238   2e-74   Populus trichocarpa [western balsam poplar]
gb|KDP20691.1|  hypothetical protein JCGZ_21162                         238   3e-74   Jatropha curcas
gb|AFZ76981.1|  ACC oxidase                                             238   3e-74   Boehmeria nivea [Chinese silk-plant]
ref|XP_004134785.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    238   3e-74   
emb|CAN85571.1|  ACC oxidase 3                                          238   3e-74   Hevea brasiliensis [jebe]
ref|XP_011047191.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    238   3e-74   Populus euphratica
ref|XP_010035512.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    238   3e-74   Eucalyptus grandis [rose gum]
gb|ABK96379.1|  unknown                                                 238   3e-74   Populus trichocarpa x Populus deltoides
gb|ABI95858.1|  1-aminocyclopropane-1-carboxylate oxidase               238   3e-74   Nicotiana suaveolens
gb|ACO91560.1|  1-aminocyclopropane-1-carboxylate oxidase               238   3e-74   Paeonia suffruticosa [moutan peony]
ref|XP_009365121.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    238   4e-74   Pyrus x bretschneideri [bai li]
gb|AFJ75135.1|  ACC oxidase                                             237   4e-74   Malus domestica [apple tree]
dbj|BAA83466.1|  ACC oxidase                                            238   4e-74   Nicotiana tabacum [American tobacco]
emb|CAI64499.1|  1-aminocyclopropane-1-carboxylate oxidase 1            238   4e-74   Prunus domestica subsp. syriaca [Mirabelle plum]
gb|AIR72293.1|  1-amino-cyclopropane-1-carboxylic acid oxidase          238   4e-74   Prunus salicina [Japanese plum]
gb|ACX71872.1|  ACC oxidase 1                                           238   5e-74   Lithospermum erythrorhizon
gb|AFJ75134.1|  ACC oxidase                                             237   5e-74   Malus domestica [apple tree]
gb|KDP30812.1|  hypothetical protein JCGZ_13755                         237   6e-74   Jatropha curcas
gb|ADK39027.1|  1-aminocyclopropane-1-carboxylic acid oxidase           237   6e-74   Betula luminifera [liang ye hua]
gb|ACU20024.1|  unknown                                                 234   7e-74   Glycine max [soybeans]
ref|XP_002535327.1|  1-aminocyclopropane-1-carboxylate oxidase, p...    237   9e-74   Ricinus communis
dbj|BAB89352.1|  1-aminocyclopropane-1-carboxylate oxidase              237   1e-73   Diospyros kaki [Japanese persimmon]
ref|XP_006595831.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    236   1e-73   
gb|AAB02051.1|  1-aminocyclopropane-1-carboxylate oxidase               236   1e-73   Carica papaya [mamon]
gb|KHN44756.1|  1-aminocyclopropane-1-carboxylate oxidase               236   1e-73   Glycine soja [wild soybean]
sp|Q08506.1|ACCO1_PETHY  RecName: Full=1-aminocyclopropane-1-carb...    236   1e-73   Petunia x hybrida [garden petunia]
ref|XP_007049183.1|  Ethylene-forming enzyme                            236   1e-73   Theobroma cacao [chocolate]
ref|XP_004507658.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    236   1e-73   
gb|AFJ75133.1|  ACC oxidase                                             236   1e-73   Malus domestica [apple tree]
dbj|BAC53656.1|  1-aminocyclopropene-1-carboxylate oxidase              236   1e-73   Malus domestica [apple tree]
ref|XP_010057880.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    236   1e-73   Eucalyptus grandis [rose gum]
gb|ACU24333.1|  unknown                                                 233   2e-73   Glycine max [soybeans]
ref|XP_008348143.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    236   2e-73   
gb|ABW91147.1|  ACC oxidase 2                                           236   2e-73   Ziziphus jujuba [Chinese jujube]
gb|KHG21578.1|  1-aminocyclopropane-1-carboxylate oxidase 3             236   2e-73   Gossypium arboreum [tree cotton]
ref|XP_010522369.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    236   2e-73   Tarenaya hassleriana [spider flower]
gb|AGV54270.1|  1-aminocyclopropane-1-carboxylic acid oxidase           236   2e-73   Phaseolus vulgaris [French bean]
ref|XP_007141655.1|  hypothetical protein PHAVU_008G214200g             236   2e-73   Phaseolus vulgaris [French bean]
ref|XP_006584893.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    235   3e-73   Glycine max [soybeans]
ref|XP_003519448.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    235   3e-73   Glycine max [soybeans]
gb|ABC69167.2|  1-aminocyclopropane-1-carboxylate oxidase               235   3e-73   Paeonia suffruticosa [moutan peony]
gb|AAC67233.1|  ACC oxidase 2                                           235   4e-73   Cucumis sativus [cucumbers]
dbj|BAD60998.1|  1-aminocyclopropane-1-carboxylate oxidase              235   4e-73   Pyrus pyrifolia [sha li]
gb|KDP30813.1|  hypothetical protein JCGZ_13756                         235   4e-73   Jatropha curcas
gb|AFF19571.1|  1-aminocyclopropane-1-carboxylate oxidase               235   4e-73   Momordica charantia [balsam pear]
gb|AEM65196.1|  ACC oxidase                                             235   5e-73   Garcinia mangostana [mangosteen]
ref|XP_002320487.1|  1-aminocyclopropane-1-carboxylate oxidase fa...    235   5e-73   Populus trichocarpa [western balsam poplar]
emb|CAA82646.1|  ethylene forming enzyme (EFE)                          235   5e-73   Nicotiana tabacum [American tobacco]
gb|KHG22879.1|  1-aminocyclopropane-1-carboxylate oxidase               235   5e-73   Gossypium arboreum [tree cotton]
gb|KHN00185.1|  1-aminocyclopropane-1-carboxylate oxidase               234   6e-73   Glycine soja [wild soybean]
gb|KJB67282.1|  hypothetical protein B456_010G184900                    235   6e-73   Gossypium raimondii
ref|XP_007160495.1|  hypothetical protein PHAVU_002G326600g             232   6e-73   Phaseolus vulgaris [French bean]
dbj|BAA94601.1|  1-aminocyclopropane-1-carboxylate oxidase              234   6e-73   Populus x canadensis [Canadian poplar]
gb|AEM42994.1|  ACC oxidase                                             234   6e-73   Siraitia grosvenorii [arhat fruit]
ref|XP_006351971.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    234   7e-73   Solanum tuberosum [potatoes]
dbj|BAD60999.1|  1-aminocyclopropane-1-carboxylate oxidase              234   7e-73   Pyrus pyrifolia [sha li]
gb|AHW85523.1|  1-aminocyclopropane-1-carboxylate oxidase               234   7e-73   Malus floribunda [Japanese crab apple]
ref|XP_004172177.1|  PREDICTED: LOW QUALITY PROTEIN: 1-aminocyclo...    234   1e-72   
gb|KFK42831.1|  hypothetical protein AALP_AA1G045000                    234   1e-72   Arabis alpina [alpine rockcress]
dbj|BAB83762.1|  1-aminocyclopropane-1-carboxylic acid oxidase          234   1e-72   Phaseolus lunatus
gb|AAB05171.1|  ACC oxidase                                             234   1e-72   Nicotiana glutinosa
gb|AAA33708.1|  ethylene-forming enzyme                                 234   1e-72   Petunia x hybrida [garden petunia]
dbj|BAH15312.1|  ACC oxidase 2                                          233   2e-72   Lactuca sativa [cultivated lettuce]
gb|AAB71421.1|  1-aminocyclopropapne-1-carboxylic acid oxidase          233   2e-72   Helianthus annuus
gb|ADR73046.1|  ACC oxidase 2 isoform B                                 233   2e-72   Nicotiana tabacum [American tobacco]
gb|AGN52989.1|  ACC oxidase                                             233   2e-72   Euphorbia esula [wolf's milk]
sp|Q8S932.1|ACCO_DIOKA  RecName: Full=1-aminocyclopropane-1-carbo...    233   2e-72   Diospyros kaki [Japanese persimmon]
gb|AEC32838.1|  1-aminocyclopropane-1-carboxylate oxidase               233   2e-72   Psidium guajava [guava]
emb|CBI28867.3|  unnamed protein product                                233   3e-72   Vitis vinifera
gb|AAB70883.1|  1-aminocyclopropane-1-carboxylate oxidase               233   3e-72   Pelargonium x hortorum [bedding geranium]
gb|ACU82854.3|  1-aminocyclopropane-1-carboxylate oxidase               233   3e-72   Eriobotrya japonica [loquat]
gb|AAR99394.1|  ACC oxidase ACO1                                        233   3e-72   Nicotiana attenuata
ref|XP_007160496.1|  hypothetical protein PHAVU_002G326600g             232   4e-72   Phaseolus vulgaris [French bean]
gb|KJB22700.1|  hypothetical protein B456_004G062100                    229   6e-72   Gossypium raimondii
gb|KHG03155.1|  1-aminocyclopropane-1-carboxylate oxidase 1             232   7e-72   Gossypium arboreum [tree cotton]
gb|AAZ83344.1|  ACC oxidase 3                                           232   7e-72   Gossypium hirsutum [American cotton]
gb|AFK41584.1|  unknown                                                 232   7e-72   Lotus japonicus
ref|XP_010475176.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    232   7e-72   Camelina sativa [gold-of-pleasure]
gb|AAU10090.1|  1-aminocyclopropane-1-carboxylate oxidase               232   7e-72   Fragaria x ananassa
ref|XP_004251527.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    232   8e-72   
gb|AEC32837.1|  1-aminocyclopropane-1-carboxylate oxidase               232   9e-72   Psidium guajava [guava]
gb|AAZ83343.1|  ACC oxidase 2                                           231   1e-71   Gossypium hirsutum [American cotton]
gb|ABI33224.1|  ACC oxidase                                             231   1e-71   Camellia sinensis [black tea]
gb|ABK58140.1|  1-amino-cyclopropane-1-carboxylic acid oxidase          231   1e-71   Manihot esculenta [manioc]
ref|XP_010252569.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    231   2e-71   Nelumbo nucifera [Indian lotus]
ref|NP_171994.1|  1-aminocyclopropane-1-carboxylate oxidase             231   2e-71   Arabidopsis thaliana [mouse-ear cress]
dbj|BAQ21979.1|  1-aminocyclopropane-1-carboxylate oxidase              231   2e-71   Gentiana triflora
emb|CAA47251.1|  ethylene-forming enzyme                                231   2e-71   Arabidopsis thaliana [mouse-ear cress]
gb|KJB22699.1|  hypothetical protein B456_004G062100                    231   2e-71   Gossypium raimondii
gb|AAK43970.1|AF370155_1  putative 1-aminocyclopropane-1-carboxyl...    231   3e-71   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002892259.1|  hypothetical protein ARALYDRAFT_887679             231   3e-71   
gb|ABA01476.1|  ACC oxidase ACO4                                        230   3e-71   Gossypium hirsutum [American cotton]
ref|XP_010457570.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    230   5e-71   Camelina sativa [gold-of-pleasure]
sp|P07920.1|ACCO2_SOLLC  RecName: Full=1-aminocyclopropane-1-carb...    229   5e-71   Solanum lycopersicum
gb|ABB97398.1|  ACC oxidase                                             229   6e-71   Trifolium repens [creeping white clover]
ref|XP_003616885.1|  1-aminocyclopropane-1-carboxylate oxidase          227   6e-71   
ref|XP_006447652.1|  hypothetical protein CICLE_v10015962mg             227   6e-71   
gb|AIS71925.1|  1-aminocyclopropane-1-carboxylate oxidase 1             229   9e-71   Citrullus lanatus [wild melon]
gb|AFK29447.1|  1-aminocyclopropane-1-carboxylate oxidase               229   1e-70   Arabidopsis kamchatica
ref|XP_002302856.1|  1-aminocyclopropane-1-carboxylate oxidase fa...    229   1e-70   Populus trichocarpa [western balsam poplar]
gb|AAC12934.1|  1-aminocyclopropane-1-carboxylic acid oxidase           229   1e-70   Phaseolus vulgaris [French bean]
gb|ADB03782.1|  1-aminocyclopropane-1-carboxylate oxidase               228   1e-70   Ipomoea batatas [batate]
ref|XP_006418070.1|  hypothetical protein EUTSA_v10008207mg             228   2e-70   Eutrema salsugineum [saltwater cress]
ref|XP_009119214.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    228   2e-70   Brassica rapa
ref|XP_010688910.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    228   2e-70   Beta vulgaris subsp. vulgaris [field beet]
gb|AAT99445.1|  ripening related ACC oxidase 2                          228   2e-70   Carica papaya [mamon]
ref|XP_010686763.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    228   2e-70   Beta vulgaris subsp. vulgaris [field beet]
gb|KDO54311.1|  hypothetical protein CISIN_1g020953mg                   228   2e-70   Citrus sinensis [apfelsine]
ref|XP_010484553.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    228   2e-70   Camelina sativa [gold-of-pleasure]
ref|XP_006447653.1|  hypothetical protein CICLE_v10015962mg             228   2e-70   Citrus clementina [clementine]
gb|KDO78383.1|  hypothetical protein CISIN_1g018920mg                   229   2e-70   Citrus sinensis [apfelsine]
gb|AAO13735.1|AF252853_1  putative 1-aminocyclopropane-1-carboxyl...    228   3e-70   Brassica oleracea
ref|XP_003616884.1|  1-aminocyclopropane-1-carboxylate oxidase          228   3e-70   Medicago truncatula
emb|CDY18281.1|  BnaC05g03040D                                          228   3e-70   
gb|ADX66712.1|  ACO1 protein                                            228   3e-70   
gb|AAD28198.2|AF115263_1  1-aminocyclopropane-1-carboxylate oxidase     227   3e-70   
gb|AFK49530.1|  unknown                                                 228   4e-70   
dbj|BAI39989.1|  ACC oxidase                                            228   4e-70   
ref|NP_001284392.1|  1-aminocyclopropane-1-carboxylate oxidase 1        228   4e-70   
gb|KHG23673.1|  1-aminocyclopropane-1-carboxylate oxidase               227   4e-70   
emb|CAB97173.1|  putative 1-aminocyclopropane-1-carboxylic acid o...    228   4e-70   
gb|ACL68417.3|  ACC oxidase                                             227   4e-70   
gb|AAB97368.1|  1-aminocyclopropane-1-carboxylate oxidase               227   5e-70   
gb|AAS16934.1|  1-aminocyclopropane-1-carboxylate oxidase 2             227   6e-70   
dbj|BAH15311.1|  ACC oxidase 1                                          226   7e-70   
emb|CDY53397.1|  BnaAnng12450D                                          227   7e-70   
ref|XP_007141649.1|  hypothetical protein PHAVU_008G213800g             226   8e-70   
gb|ABK97619.1|  1-aminocyclopropane-1-carboxylic acid oxidase           226   9e-70   
gb|AFK29449.1|  1-aminocyclopropane-1-carboxylate oxidase               226   1e-69   
gb|ACJ84876.1|  unknown                                                 223   1e-69   
emb|CAA71140.1|  1-aminocyclopropane-1-carboxylic acid oxidase          226   1e-69   
ref|XP_007144188.1|  hypothetical protein PHAVU_007G135600g             226   1e-69   
ref|XP_011047006.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    226   1e-69   
gb|KJB67305.1|  hypothetical protein B456_010G185000                    222   2e-69   
gb|ACY76262.1|  ACC oxidase                                             226   2e-69   
ref|NP_001275812.1|  ACC oxidase                                        226   2e-69   
gb|KJB42846.1|  hypothetical protein B456_007G170100                    225   2e-69   
ref|XP_010546539.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    226   2e-69   
gb|ABB97399.1|  ACC oxidase                                             225   2e-69   
gb|KJB08659.1|  hypothetical protein B456_001G096300                    225   2e-69   
dbj|BAA96787.1|  1-aminocyclopropane-1-carboxylate oxidase              223   5e-69   
gb|KHN44760.1|  1-aminocyclopropane-1-carboxylate oxidase               224   5e-69   
gb|KHN44761.1|  1-aminocyclopropane-1-carboxylate oxidase               224   6e-69   
ref|XP_003545587.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    224   9e-69   
dbj|BAE20195.1|  aco                                                    223   2e-68   
gb|KJB67306.1|  hypothetical protein B456_010G185000                    222   3e-68   
ref|XP_006305365.1|  hypothetical protein CARUB_v10009749mg             223   3e-68   
pdb|1W9Y|A  Chain A, The Structure Of Acc Oxidase                       223   3e-68   
gb|ABC02397.1|  1-aminocyclopropane-1-carboxylate oxidase               222   4e-68   
ref|XP_004151282.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    222   4e-68   
gb|AAC67232.1|  ACC oxidase 1                                           221   4e-68   
gb|ACU23120.1|  unknown                                                 219   4e-68   
gb|AAO37687.1|  1-aminocyclopropane-1-carboxylic acid oxidase 1         221   4e-68   
emb|CAA67119.1|  ACC oxidase                                            221   4e-68   
gb|AAN86821.1|  1-aminocyclopropane-1-carboxylate oxidase 2             221   7e-68   
emb|CBA35164.1|  ACC oxidase                                            221   1e-67   
ref|XP_004165740.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    221   1e-67   
dbj|BAA33378.1|  ACC oxidase                                            221   1e-67   
gb|KHN38493.1|  1-aminocyclopropane-1-carboxylate oxidase               220   2e-67   
ref|NP_001242835.1|  uncharacterized protein LOC100819184               220   2e-67   
ref|NP_001241509.1|  uncharacterized protein LOC100815336               220   2e-67   
dbj|BAE20196.1|  aco                                                    220   2e-67   
ref|XP_003545591.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    220   3e-67   
ref|NP_001234024.1|  1-aminocyclopropane-1-carboxylate oxidase 1        219   3e-67   
ref|XP_010270047.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    220   3e-67   
gb|AAP94014.1|  ACC oxidase AC02                                        219   3e-67   
dbj|BAE20197.1|  aco                                                    219   4e-67   
ref|XP_008456405.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    219   4e-67   
gb|ABL67953.2|  1-aminocyclopropane-1-carboxylate oxidase               219   5e-67   
ref|NP_001267694.1|  1-aminocyclopropane-1-carboxylate oxidase 1-...    219   6e-67   
gb|AAC67234.1|  ACC oxidase 3                                           219   6e-67   
gb|AAR22910.1|  ACC oxidase                                             219   7e-67   
gb|AAC49833.1|  1-aminocyclopropane-1-carboxylic acid oxidase           218   9e-67   
dbj|BAE20198.1|  aco                                                    216   1e-65   
dbj|BAF44098.1|  1-aminocyclopropane-1-carboxylate oxidase              214   1e-65   
gb|AEX08302.1|  1-aminocyclopropane-1-carboxylate oxidase               212   1e-65   
ref|XP_003616886.1|  1-aminocyclopropane-1-carboxylate oxidase          216   2e-65   
gb|AFV50550.1|  1-aminocyclopropane-1-carboxylate oxidase               214   2e-65   
ref|XP_003610488.1|  1-aminocyclopropane-1-carboxylate oxidase          216   2e-65   
gb|AEX08300.1|  1-aminocyclopropane-1-carboxylate oxidase               211   2e-65   
emb|CAD21843.1|  ACC oxidase 1                                          213   6e-65   
gb|AEX08288.1|  1-aminocyclopropane-1-carboxylate oxidase               209   2e-64   
gb|ABG78034.1|  1-aminocyclopropane-1-carboxylate oxidase               212   2e-64   
emb|CAH64549.1|  1-aminocyclopropane-1-carboxylate oxidase              210   5e-64   
gb|ABU23719.1|  1-aminocyclopropane-1-carboxylate oxidase               210   6e-64   
gb|AEX08307.1|  1-aminocyclopropane-1-carboxylate oxidase               206   2e-63   
ref|XP_006306083.1|  hypothetical protein CARUB_v10011493mg             210   2e-63   
gb|AAM20919.1|AF441282_1  1-aminocyclopropane-1-carboxylate oxidase     209   2e-63   
sp|P19464.1|ACCO_PERAE  RecName: Full=1-aminocyclopropane-1-carbo...    210   3e-63   
gb|EPS72760.1|  hypothetical protein M569_01997                         209   5e-63   
gb|AEX08306.1|  1-aminocyclopropane-1-carboxylate oxidase               204   7e-63   
emb|CDY08654.1|  BnaC04g19630D                                          209   9e-63   
ref|XP_006417277.1|  hypothetical protein EUTSA_v10008225mg             207   4e-62   
ref|XP_002889907.1|  predicted protein                                  207   5e-62   
gb|AAA33273.1|  amino-cyclopropane carboxylic acid oxidase              206   6e-62   
gb|AGC25242.1|  ACC oxidase                                             206   8e-62   
ref|XP_006647976.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    206   1e-61   
emb|CDY32039.1|  BnaA03g60430D                                          206   1e-61   
ref|XP_009148622.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    206   1e-61   
ref|XP_010493627.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    205   2e-61   
gb|AAC49824.1|  1-aminocyclopropane-1-carboxylic acid oxidase           204   2e-61   
ref|XP_010943257.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    205   2e-61   
emb|CAA57285.1|  ACC oxidase                                            205   2e-61   
emb|CDY34603.1|  BnaC08g41620D                                          205   2e-61   
ref|XP_010533786.1|  PREDICTED: LOW QUALITY PROTEIN: 1-aminocyclo...    204   3e-61   
gb|AGC96124.1|  1-aminocyclopropane-1-carboxylate oxidase protein       203   3e-61   
gb|AAP94013.1|  ACC oxidase AC01                                        203   3e-61   
gb|ACD87811.1|  putative ACC oxidase                                    202   3e-61   
sp|P31528.1|ACCO_DIACA  RecName: Full=Probable 1-aminocyclopropan...    204   4e-61   
gb|AAC49825.1|  1-aminocyclopropane-1-carboxylic acid oxidase           198   4e-61   
gb|AGE15421.1|  1-aminocyclopropane-1-carboxylate oxidase               204   4e-61   
ref|XP_009123393.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    204   5e-61   
ref|XP_009118157.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    204   6e-61   
ref|XP_006391897.1|  hypothetical protein EUTSA_v10023595mg             204   6e-61   
ref|XP_002888029.1|  hypothetical protein ARALYDRAFT_475105             204   7e-61   
gb|AAB65753.1|  1-aminocyclopropane-1-carboxylic acid oxidase           204   8e-61   
emb|CAC39107.1|  ACC oxidase                                            203   8e-61   
gb|ACT22772.1|  ACC oxidase 2                                           203   9e-61   
ref|XP_008805606.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    203   1e-60   
gb|ABY26553.1|  ACC oxidase                                             203   1e-60   
ref|NP_176428.1|  1-aminocyclopropane-1-carboxylate oxidase 2           202   2e-60   
gb|ABB89910.1|  1-aminocyclopropane-1-carboxylate oxidase               201   2e-60   
gb|AFI41198.1|  ACC oxidase 2                                           202   2e-60   
gb|AAC27484.1|  ACC oxidase                                             202   2e-60   
gb|AAT72475.1|  AT1G05010                                               198   4e-60   
gb|KFK43467.1|  hypothetical protein AALP_AA1G128800                    201   5e-60   
emb|CAA11200.1|  ACC oxidase                                            201   6e-60   
gb|KFK40603.1|  hypothetical protein AALP_AA2G017200                    201   6e-60   
gb|AAB00556.1|  1-aminocyclopropane-1-carboxylate oxidase               201   6e-60   
gb|AFK29147.1|  ACC-oxidase                                             200   6e-60   
gb|AFO63016.1|  ACC oxidase                                             201   6e-60   
gb|ABV45543.1|  1-aminocyclopropane-1-carboxylate oxidase               201   8e-60   
gb|ABC02869.1|  1-aminocyclopropane-1-carboxylate oxidase               200   8e-60   
gb|ACO37154.1|  ACC oxidase                                             199   9e-60   
ref|XP_009410048.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    201   1e-59   
emb|CAE53174.1|  1-aminocyclopropane-1-carboxylate oxidase              201   1e-59   
gb|AAA32981.1|  amino-cyclopropane-carboxylic acid oxidase              201   1e-59   
gb|ABY53430.1|  1-aminocyclopropane-1-carboxylate oxidase               200   1e-59   
ref|NP_172665.1|  1-aminocyclopropane-1-carboxylate oxidase             201   1e-59   
dbj|BAK04182.1|  predicted protein                                      201   2e-59   
gb|KEH32649.1|  non-heme dioxygenase in morphine synthesis amino-...    211   2e-59   
gb|AEX08286.1|  1-aminocyclopropane-1-carboxylate oxidase               196   2e-59   
gb|AAR00930.1|U86045_1  1-aminocyclopropane-1-carboxylate oxidase       200   2e-59   
ref|XP_003570545.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    200   2e-59   
ref|XP_006302557.1|  hypothetical protein CARUB_v10020664mg             199   3e-59   
dbj|BAB11918.1|  1-aminocyclopropane-1-carboxylate oxidase              197   4e-59   
gb|EAY87690.1|  hypothetical protein OsI_09105                          199   5e-59   
gb|AAY85373.1|  1-aminocyclopropane-1-carboxylate oxidase               195   5e-59   
ref|XP_004954061.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    199   5e-59   
gb|AEX08324.1|  1-aminocyclopropane-1-carboxylate oxidase               194   6e-59   
ref|XP_010913394.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    199   6e-59   
ref|XP_008803519.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    199   7e-59   
ref|NP_001048259.1|  Os02g0771600                                       198   8e-59   
emb|CAH65483.1|  1-aminocyclopropane-1-carboxylate oxidase              192   1e-58   
gb|ABM74187.1|  1-aminocyclopropane-1-carboxylate oxidase               198   1e-58   
dbj|BAK03337.1|  predicted protein                                      198   1e-58   
gb|AAC05507.1|  1-aminocyclopropane-1-carboxylate oxidase               197   1e-58   
gb|AEX08295.1|  1-aminocyclopropane-1-carboxylate oxidase               193   2e-58   
gb|AEX08296.1|  1-aminocyclopropane-1-carboxylate oxidase               193   2e-58   
emb|CAA64856.1|  1-aminocyclopropane-1-carboxylate oxidase              197   2e-58   
gb|ABR53742.1|  1-aminocyclopropane-1-carboxylate oxidase 2             196   2e-58   
ref|XP_009387204.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    197   3e-58   
gb|ABU23720.1|  1-aminocyclopropane-1-carboxylate oxidase               195   3e-58   
gb|ABO65266.1|  1-aminocyclopropane-1-carboxylate oxidase               197   3e-58   
gb|ABU23721.1|  1-aminocyclopropane-1-carboxylate oxidase               195   4e-58   
gb|ABW20470.1|  ACC oxidase                                             196   4e-58   
ref|XP_010473457.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    196   5e-58   
ref|XP_010418231.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    196   5e-58   
gb|AAM74522.1|  fruit ripening-related ACC oxidase                      194   6e-58   
ref|XP_010430292.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    196   9e-58   
gb|AEX08293.1|  1-aminocyclopropane-1-carboxylate oxidase               191   1e-57   
gb|AEO92024.1|  1-aminocyclopropane-1-carboxylic acid oxidase           194   1e-57   
dbj|BAA81897.1|  1-aminocyclopropane-1-carboxylic acid oxidase          193   1e-57   
gb|AEX08310.1|  1-aminocyclopropane-1-carboxylate oxidase               191   2e-57   
gb|AEX08323.1|  1-aminocyclopropane-1-carboxylate oxidase               190   2e-57   
gb|AFO63019.1|  ACC oxidase                                             194   2e-57   
gb|AEX08297.1|  1-aminocyclopropane-1-carboxylate oxidase               190   3e-57   
gb|AEX08303.1|  1-aminocyclopropane-1-carboxylate oxidase               190   3e-57   
dbj|BAJ90796.1|  predicted protein                                      194   3e-57   
gb|AEX08281.1|  1-aminocyclopropane-1-carboxylate oxidase               190   3e-57   
gb|AEZ06406.1|  1-aminocycloproane-1-carboxylate oxidase                194   3e-57   
gb|AEX08283.1|  1-aminocyclopropane-1-carboxylate oxidase               190   3e-57   
gb|AEX08290.1|  1-aminocyclopropane-1-carboxylate oxidase               190   3e-57   
dbj|BAB32502.1|  1-aminocyclopropane-1-carboxylate oxidase              194   4e-57   
gb|AFO63018.1|  ACC oxidase                                             194   5e-57   
ref|XP_009113083.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    194   5e-57   
gb|KCW46927.1|  hypothetical protein EUGRSUZ_K00741                     192   6e-57   
ref|XP_002452894.1|  hypothetical protein SORBIDRAFT_04g034520          193   6e-57   
gb|KCW46928.1|  hypothetical protein EUGRSUZ_K00742                     192   6e-57   
gb|AEX08321.1|  1-aminocyclopropane-1-carboxylate oxidase               189   7e-57   
gb|AEX08284.1|  1-aminocyclopropane-1-carboxylate oxidase               189   7e-57   
gb|KCW46929.1|  hypothetical protein EUGRSUZ_K00743                     192   7e-57   
gb|AEX08294.1|  1-aminocyclopropane-1-carboxylate oxidase               189   9e-57   
gb|AHJ14562.1|  ACC oxidase                                             193   9e-57   
emb|CAA04872.1|  1-aminocyclopropane-1-carboxylate oxidase              187   9e-57   
gb|AEX08289.1|  1-aminocyclopropane-1-carboxylate oxidase               189   1e-56   
emb|CAD44994.1|  putative 1-aminocyclopropane-1-carboxylate oxidase     191   1e-56   
gb|AEX08298.1|  1-aminocyclopropane-1-carboxylate oxidase               188   2e-56   
ref|NP_001063330.1|  Os09g0451400                                       192   2e-56   
gb|AEX08291.1|  1-aminocyclopropane-1-carboxylate oxidase               188   2e-56   
emb|CAA59749.1|  1-aminocyclopropane-1-carboxylate oxidase (ACC o...    192   2e-56   
ref|XP_009413270.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    192   2e-56   
sp|A2Z1W9.1|ACCO1_ORYSI  RecName: Full=1-aminocyclopropane-1-carb...    192   2e-56   
sp|Q09052.1|ACCO1_BRAJU  RecName: Full=1-aminocyclopropane-1-carb...    192   2e-56   
gb|ABR53743.1|  1-aminocyclopropane-1-carboxylate oxidase 3             191   3e-56   
gb|AEX08320.1|  1-aminocyclopropane-1-carboxylate oxidase               187   5e-56   
gb|AEX08316.1|  1-aminocyclopropane-1-carboxylate oxidase               186   7e-56   
gb|ABR53741.1|  1-aminocyclopropane-1-carboxylate oxidase 1             189   8e-56   
gb|AAB65754.1|  1-aminocyclopropane-1-carboxylic acid oxidase           191   9e-56   
gb|AEX08312.1|  1-aminocyclopropane-1-carboxylate oxidase               186   2e-55   
emb|CAI38682.1|  1-aminocyclopropane-1-carboxylate oxidase              184   2e-55   
ref|XP_002462474.1|  hypothetical protein SORBIDRAFT_02g026280          190   2e-55   
gb|AEX08317.1|  1-aminocyclopropane-1-carboxylate oxidase               185   2e-55   
ref|XP_003578206.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    189   3e-55   
ref|XP_008651663.1|  PREDICTED: uncharacterized protein LOC100382...    189   3e-55   
ref|NP_001130227.1|  1-aminocyclopropane-1-carboxylate oxidase 1A...    189   3e-55   
gb|AAS09956.1|  1-aminocyclopropane-1-carboxylate oxidase               189   3e-55   
gb|ACS34759.1|  1-aminocyclopropane-1-carboxylate oxidase               189   5e-55   
dbj|BAK00833.1|  predicted protein                                      189   5e-55   
gb|AFO63015.1|  ACC oxidase                                             188   6e-55   
gb|ACH99202.1|  1-aminocyclopropane-1-carboxylate oxidase               188   6e-55   
gb|AEX08287.1|  1-aminocyclopropane-1-carboxylate oxidase               184   9e-55   
ref|NP_001105235.1|  ACC oxidase20                                      188   1e-54   
dbj|BAA96786.1|  1-aminocyclopropane-1-carboxylate oxidase              186   1e-54   
emb|CAH65482.1|  1-aminocyclopropane-1-carboxylate oxidase              185   2e-54   
emb|CDP11301.1|  unnamed protein product                                180   3e-54   
gb|ACA63697.1|  1-aminocyclopropane-1-carboxylic acid oxidase           184   6e-54   
sp|Q39705.1|ACCO2_DORSP  RecName: Full=1-aminocyclopropane-1-carb...    186   7e-54   
emb|CAD44265.2|  putative aminocyclopropane carboxylate oxidase         186   7e-54   
gb|AAQ84308.1|  1-aminocyclopropane-1-carboxylic acid oxidase           184   7e-54   
gb|EEC84681.1|  hypothetical protein OsI_31599                          186   8e-54   
ref|NP_001063329.1|  Os09g0451000                                       186   8e-54   
gb|AAR00506.1|  1-aminocyclopropane-1-carboxylate oxidase               186   8e-54   
gb|AAF65472.1|AF252628_1  1-aminocyclopropane-1-carboxylate oxidase     185   9e-54   



>gb|ABL67954.2| 1-aminocyclopropane-1-carboxylate oxidase [Ipomoea nil]
Length=319

 Score =   300 bits (768),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 166/167 (99%), Positives = 166/167 (99%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC
Sbjct  1    MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAME
Sbjct  61   MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAME  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LEKLAENLLDLLCENLGLEKGYLKK FSGSKGPNFGTKVSNYPPCPK
Sbjct  121  LEKLAENLLDLLCENLGLEKGYLKKPFSGSKGPNFGTKVSNYPPCPK  167



>gb|AAD28196.2|AF115261_1 1-aminocyclopropane-1-carboxylate oxidase [Trifolium repens]
 gb|ABB97396.1| ACC oxidase [Trifolium repens]
Length=318

 Score =   258 bits (658),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 137/167 (82%), Positives = 154/167 (92%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M +FPI+++ +LNTEER + ME+IKDACENWGFFELV+HGISIE+MD VEKLTKDHYKKC
Sbjct  1    MENFPIVDMGKLNTEERKSTMEKIKDACENWGFFELVNHGISIEMMDKVEKLTKDHYKKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRFKEMV++KGL+ VQ+EINDLDWESTFFL+HLP SNISEIPDL+D YRK+MKEFA +
Sbjct  61   MEQRFKEMVSSKGLECVQSEINDLDWESTFFLRHLPFSNISEIPDLDDDYRKIMKEFAQK  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LE LAE LLDLLCENLGLEKGYLKK F GSKGPNFGTKVSNYPPCPK
Sbjct  121  LENLAEELLDLLCENLGLEKGYLKKVFYGSKGPNFGTKVSNYPPCPK  167



>ref|XP_004486198.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase-like [Cicer 
arietinum]
Length=316

 Score =   256 bits (653),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 137/167 (82%), Positives = 155/167 (93%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M +FPI+++ +LNTEER A ++++KDACENWGFFELV+HGISIELMDTVEKLTK+HYKKC
Sbjct  1    MENFPIVDMGKLNTEERKATLDKMKDACENWGFFELVNHGISIELMDTVEKLTKEHYKKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRFKEMV +KGL+ VQ+EINDLDWESTFFL+HLPVSNISEIPDL+  YRKVMKEFA++
Sbjct  61   MEQRFKEMVESKGLEYVQSEINDLDWESTFFLRHLPVSNISEIPDLDQDYRKVMKEFAVK  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LEKLAE LLD LCENLGLEKGYLKK F GSKGPNFGTKVSNYPPCPK
Sbjct  121  LEKLAEELLDYLCENLGLEKGYLKKVFYGSKGPNFGTKVSNYPPCPK  167



>ref|XP_008224728.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase 1 [Prunus 
mume]
Length=318

 Score =   255 bits (652),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 139/167 (83%), Positives = 158/167 (95%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M +FP+++L+Q+N E+R A ME+I DACENWGFFELV+HGIS ELMDTVEKLTK+HYKKC
Sbjct  1    MEAFPVVDLSQINGEKREATMEKINDACENWGFFELVNHGISHELMDTVEKLTKEHYKKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRFKEMVA+KGL+AVQ+EI+DLDWESTFFL+HLPVSNIS+IPDL++ YRKVMKEFA+E
Sbjct  61   MEQRFKEMVASKGLEAVQSEIHDLDWESTFFLRHLPVSNISQIPDLDEDYRKVMKEFAVE  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LEKLAE LLDLLCENLGLEKGYLKKAF GSKGPNFGTKVSNYPPCPK
Sbjct  121  LEKLAEQLLDLLCENLGLEKGYLKKAFYGSKGPNFGTKVSNYPPCPK  167



>dbj|BAF33502.1| ACC oxidase [Phelipanche ramosa]
Length=318

 Score =   255 bits (652),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 137/167 (82%), Positives = 152/167 (91%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            MA+FP+IN+ +LN EER A ME IKDACENWGFFELV+HGI+ E MDTVE+LTK+HYKKC
Sbjct  1    MATFPVINMEKLNGEERSATMEMIKDACENWGFFELVNHGITAEFMDTVERLTKEHYKKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRFKEMV +KGL+A+Q+EI DLDWESTFFL+HLPVSNISEIPDLED YRKVMKEFA +
Sbjct  61   MEQRFKEMVTSKGLEAIQSEITDLDWESTFFLRHLPVSNISEIPDLEDEYRKVMKEFAGQ  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LEKLAE LLDLLCENLGLEKGYLKK F G+ GPNFGTKVSNYPPCPK
Sbjct  121  LEKLAEQLLDLLCENLGLEKGYLKKVFYGTTGPNFGTKVSNYPPCPK  167



>sp|P31239.1|ACCO_PEA RecName: Full=1-aminocyclopropane-1-carboxylate oxidase; Short=ACC 
oxidase; AltName: Full=Ethylene-forming enzyme; Short=EFE 
[Pisum sativum]
 gb|AAA33644.1| 1-aminocyclopropane-1-carboxylate oxidase [Pisum sativum]
Length=317

 Score =   254 bits (650),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 137/167 (82%), Positives = 156/167 (93%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M +FPI+++ +LNTE+R + ME IKDACENWGFFE V+HGISIE+MDTVEKLTK+HYKKC
Sbjct  1    MENFPIVDMGKLNTEDRKSTMELIKDACENWGFFECVNHGISIEMMDTVEKLTKEHYKKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRFKEMVA KGL+ VQ+EI+DLDWESTFFL+HLPVS+ISEIPDL+D YRKVMKEFA++
Sbjct  61   MEQRFKEMVATKGLECVQSEIDDLDWESTFFLRHLPVSSISEIPDLDDDYRKVMKEFALK  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LE+LAE LLDLLCENLGLEKGYLKKAF GSKGPNFGTKVSNYPPCPK
Sbjct  121  LEELAEELLDLLCENLGLEKGYLKKAFYGSKGPNFGTKVSNYPPCPK  167



>emb|CAI64500.1| 1-aminocyclopropane-1-carboxylate oxidase 2, partial [Prunus 
domestica subsp. syriaca]
Length=304

 Score =   254 bits (648),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 139/167 (83%), Positives = 157/167 (94%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M +FP+++L+Q+N E+R A ME+I DACENWGFFELV+HGIS ELMDTVEKLTK+HYKKC
Sbjct  1    METFPVVDLSQINGEKRGAAMEKINDACENWGFFELVNHGISHELMDTVEKLTKEHYKKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRFKEMVA KGL+AVQ+EI+DLDWESTFFL+HLPVSNIS+IPDL++ YRKVMKEFA+E
Sbjct  61   MEQRFKEMVANKGLEAVQSEIHDLDWESTFFLRHLPVSNISQIPDLDEDYRKVMKEFAVE  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LEKLAE LLDLLCENLGLEKGYLKKAF GSKGPNFGTKVSNYPPCPK
Sbjct  121  LEKLAEQLLDLLCENLGLEKGYLKKAFYGSKGPNFGTKVSNYPPCPK  167



>gb|ABO32691.1| ACC oxidase ACO3 [Nicotiana attenuata]
Length=316

 Score =   254 bits (649),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 138/167 (83%), Positives = 153/167 (92%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M +FP++N+  LNTE+R A ME IKDACENWGFFE+V+HGIS EL+DTVEKLTK HYKKC
Sbjct  1    METFPVVNMELLNTEQRAATMETIKDACENWGFFEVVNHGISHELLDTVEKLTKGHYKKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            ME+RFKEMVA+KGL+AVQTEI DLDWESTFFLKHLPVSNISE+PDLED YRK+MKEFA +
Sbjct  61   MEERFKEMVASKGLEAVQTEIKDLDWESTFFLKHLPVSNISEVPDLEDEYRKIMKEFAEK  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LEKLAE LLDLLCENLGLE+GYLKKAF GSKGP FGTKVSNYPPCPK
Sbjct  121  LEKLAEQLLDLLCENLGLEQGYLKKAFYGSKGPTFGTKVSNYPPCPK  167



>ref|XP_007211643.1| hypothetical protein PRUPE_ppa008813mg [Prunus persica]
 gb|EMJ12842.1| hypothetical protein PRUPE_ppa008813mg [Prunus persica]
Length=318

 Score =   254 bits (649),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 138/167 (83%), Positives = 158/167 (95%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M +FP+++L+Q+N E+R A ME++ DACENWGFFELV+HGIS ELMDTVEKLTK+HYKKC
Sbjct  1    METFPVVDLSQINGEKREATMEKMNDACENWGFFELVNHGISHELMDTVEKLTKEHYKKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRFKEMVA+KGL+AVQ+EI+DLDWESTFFL+HLPVSNIS+IPDL++ YRKVMKEFA+E
Sbjct  61   MEQRFKEMVASKGLEAVQSEIHDLDWESTFFLRHLPVSNISQIPDLDEDYRKVMKEFAVE  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LEKLAE LLDLLCENLGLEKGYLKKAF GSKGPNFGTKVSNYPPCPK
Sbjct  121  LEKLAEQLLDLLCENLGLEKGYLKKAFYGSKGPNFGTKVSNYPPCPK  167



>ref|XP_009802116.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase [Nicotiana 
sylvestris]
Length=316

 Score =   254 bits (648),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 137/167 (82%), Positives = 153/167 (92%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M +FP++N+  LNTE+R A ME IKDACENWGFFE+V+HGIS EL+DTVEKLTK HYKKC
Sbjct  1    METFPVVNMELLNTEQRAATMETIKDACENWGFFEVVNHGISHELLDTVEKLTKGHYKKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            ME+RFKEMVA+KGL+AVQTEI DLDWESTFFLKHLP+SNISE+PDLED YRK+MKEFA +
Sbjct  61   MEERFKEMVASKGLEAVQTEIKDLDWESTFFLKHLPISNISEVPDLEDEYRKIMKEFAEK  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LEKLAE LLDLLCENLGLE+GYLKKAF GSKGP FGTKVSNYPPCPK
Sbjct  121  LEKLAEQLLDLLCENLGLEQGYLKKAFYGSKGPTFGTKVSNYPPCPK  167



>gb|AGN74918.1| 1-aminocyclopropane-1-carboxylate oxidase [Morus alba]
Length=319

 Score =   254 bits (648),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 137/167 (82%), Positives = 152/167 (91%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M +FPIINL +LN EER   MEQIKDACENWGFFELV+HGI  E +DTVEK+TKDHY+KC
Sbjct  1    MENFPIINLEKLNGEERKTTMEQIKDACENWGFFELVNHGIPHEFLDTVEKMTKDHYRKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRFKE+VA+KGL+AVQ E+ND+DWESTFFL+HLPVSNISEIPDL+D YRKVM+EFA +
Sbjct  61   MEQRFKELVASKGLEAVQAEVNDMDWESTFFLRHLPVSNISEIPDLDDEYRKVMREFAKQ  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LEKLAE LLDLLCENLGLEKGYLKKAF GSKGP FGTKVSNYPPCPK
Sbjct  121  LEKLAEELLDLLCENLGLEKGYLKKAFYGSKGPTFGTKVSNYPPCPK  167



>dbj|BAD06178.1| ACC oxidase [Pisum sativum var. macrocarpon]
Length=323

 Score =   254 bits (648),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 137/167 (82%), Positives = 156/167 (93%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M +FPI+++ +LNTE+R + ME IKDACENWGFFE V+HGISIE+MDTVEKLTK+HYKKC
Sbjct  1    MENFPIVDMGKLNTEDRKSTMELIKDACENWGFFECVNHGISIEMMDTVEKLTKEHYKKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRFKEMVA KGL+ VQ+EI+DLDWESTFFL+HLPVS+ISEIPDL+D YRKVMKEFA++
Sbjct  61   MEQRFKEMVATKGLECVQSEIDDLDWESTFFLRHLPVSSISEIPDLDDDYRKVMKEFALK  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LE+LAE LLDLLCENLGLEKGYLKKAF GSKGPNFGTKVSNYPPCPK
Sbjct  121  LEELAEELLDLLCENLGLEKGYLKKAFYGSKGPNFGTKVSNYPPCPK  167



>ref|XP_011096014.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase [Sesamum 
indicum]
Length=317

 Score =   252 bits (644),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 135/167 (81%), Positives = 154/167 (92%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            MA+FP++N+ +LN EER A M  IKDACENWGFFEL++HGI+ E +DTVE+LTK+HY+KC
Sbjct  1    MATFPVVNMEKLNGEERTATMAVIKDACENWGFFELLNHGIAPEFLDTVERLTKEHYRKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRFKEMVA+KGL+AVQ+EINDLDWESTFFL+HLPVSNISEIPDL++ YRKVMKEFA +
Sbjct  61   MEQRFKEMVASKGLEAVQSEINDLDWESTFFLRHLPVSNISEIPDLDEEYRKVMKEFAAQ  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LEKLAE LLDLLCENLGLEKGYLKKAF GSKGP FGTKVSNYPPCPK
Sbjct  121  LEKLAEQLLDLLCENLGLEKGYLKKAFYGSKGPTFGTKVSNYPPCPK  167



>ref|NP_001289250.1| 1-aminocyclopropane-1-carboxylate oxidase 1 [Pyrus x bretschneideri]
 dbj|BAA76387.1| ACC oxidase [Pyrus pyrifolia]
 gb|ABO38176.1| ACC oxidase [Pyrus pyrifolia]
 gb|ABY51681.2| 1-aminocyclopropane-1-carboxylate oxidase [Pyrus x bretschneideri]
 gb|ACJ12491.1| 1-aminocyclopropane-1-carboxylate [Pyrus x bretschneideri]
 gb|AFA46526.1| ACC oxidase [Pyrus pyrifolia]
Length=314

 Score =   252 bits (643),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 137/167 (82%), Positives = 154/167 (92%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            MA+FP+++L+ +N EER A +E+I DACENWGFFELV+HGIS EL+DTVEK+TKDHYKK 
Sbjct  1    MATFPVVDLSLVNGEERVATLEKINDACENWGFFELVNHGISTELLDTVEKMTKDHYKKT  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRFKEMVAAKGLDAVQ+EI+DLDWESTFFL+HLP SNISE+PDLE+ YRK MKEFA+E
Sbjct  61   MEQRFKEMVAAKGLDAVQSEIHDLDWESTFFLRHLPSSNISEVPDLEEDYRKTMKEFAVE  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LEKLAE LLDLLCENLGLEKGYLKK F GSKGPNFGTKVSNYPPCPK
Sbjct  121  LEKLAEKLLDLLCENLGLEKGYLKKVFYGSKGPNFGTKVSNYPPCPK  167



>gb|ABF61805.1| 1-aminocyclopropane-1-carboxylate oxidase [Medicago sativa]
Length=317

 Score =   252 bits (643),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 137/167 (82%), Positives = 152/167 (91%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M +FP++++ +LNTEER A ME IKDACENWGFFE V+HGISIELMD VEKLTK+HYKKC
Sbjct  1    MENFPVVDMGKLNTEERKATMEMIKDACENWGFFECVNHGISIELMDKVEKLTKEHYKKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRFKEMVA+KGL+ VQ+EINDLDWESTFFL+HLP SNISEIPDL++ YRK MKEFA +
Sbjct  61   MEQRFKEMVASKGLECVQSEINDLDWESTFFLRHLPSSNISEIPDLDEDYRKTMKEFAEK  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LEKLAE LLDLLCENLGLEKGYLKK F GSKGPNFGTKVSNYPPCPK
Sbjct  121  LEKLAEELLDLLCENLGLEKGYLKKVFYGSKGPNFGTKVSNYPPCPK  167



>ref|XP_003594162.1| 1-aminocyclopropane-1-carboxylate oxidase [Medicago truncatula]
 gb|AES64413.1| 1-aminocyclopropane-1-carboxylate oxidase [Medicago truncatula]
Length=225

 Score =   249 bits (635),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 136/167 (81%), Positives = 151/167 (90%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M +FP++++ +LNTEER A ME IKDACENWGFFE V+H ISIELMD VEKLTK+HYKKC
Sbjct  1    MENFPVVDMGKLNTEERKATMEMIKDACENWGFFECVNHSISIELMDKVEKLTKEHYKKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRFKEMVA+KGL+ VQ+EINDLDWESTFFL+HLP SNISEIPDL++ YRK MKEFA +
Sbjct  61   MEQRFKEMVASKGLECVQSEINDLDWESTFFLRHLPSSNISEIPDLDEDYRKTMKEFAEK  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LEKLAE LLDLLCENLGLEKGYLKK F GSKGPNFGTKVSNYPPCPK
Sbjct  121  LEKLAEELLDLLCENLGLEKGYLKKVFYGSKGPNFGTKVSNYPPCPK  167



>ref|XP_011086213.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase-like [Sesamum 
indicum]
Length=317

 Score =   252 bits (643),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 135/167 (81%), Positives = 152/167 (91%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            MA+FP+IN+ +LN E R A ME IKDACENWGFFE+V+HGI+ E MDTVEKLTK+HY+KC
Sbjct  1    MATFPVINMEKLNGEGRAATMEMIKDACENWGFFEVVNHGIAPEFMDTVEKLTKEHYRKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRFKEMVA KGL+AVQ+EINDLDWESTFFL+HLPVSN+S++PDLE  YR+VMKEFA +
Sbjct  61   MEQRFKEMVAKKGLEAVQSEINDLDWESTFFLRHLPVSNMSQVPDLEAEYRRVMKEFAAQ  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LEKLAE LLDLLCENLGLEKGYLKK F GSKGPNFGTKVSNYPPCPK
Sbjct  121  LEKLAEQLLDLLCENLGLEKGYLKKVFYGSKGPNFGTKVSNYPPCPK  167



>ref|XP_002273430.3| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase [Vitis vinifera]
Length=318

 Score =   252 bits (643),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 137/167 (82%), Positives = 151/167 (90%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M SFP+IN+  LN EER A ME IKDACENWGFFELV+HGIS ELMDTVEKLTK+HYKKC
Sbjct  1    MESFPVINMENLNGEERAATMENIKDACENWGFFELVNHGISHELMDTVEKLTKEHYKKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRFKE+VA+KGL+AVQ+EINDLDWESTFFL+HLP SN+SEIPDLE+ YRK MKEF   
Sbjct  61   MEQRFKEVVASKGLEAVQSEINDLDWESTFFLRHLPTSNMSEIPDLEEDYRKAMKEFTAH  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LEKLAE LLDLLCENLGLEKGYLKKAF GS+GP+FGTKVSNYPPCP+
Sbjct  121  LEKLAELLLDLLCENLGLEKGYLKKAFYGSQGPSFGTKVSNYPPCPQ  167



>gb|ACU23036.1| unknown [Glycine max]
Length=202

 Score =   248 bits (632),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 134/166 (81%), Positives = 153/166 (92%), Gaps = 0/166 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            MA+FP++++ +LNTEERPA ME IKDACENWGFFELV+HGISIELMDTVEKLTK+HYKK 
Sbjct  1    MANFPVVDVGKLNTEERPAAMEIIKDACENWGFFELVNHGISIELMDTVEKLTKEHYKKT  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRFKEMV +KGL++VQ+EINDLDWESTFFL+HLP+SN+S+  DL+  YRK MK+FA+E
Sbjct  61   MEQRFKEMVTSKGLESVQSEINDLDWESTFFLRHLPLSNVSDNADLDQDYRKTMKKFALE  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCP  584
            LEKLAE LLDLLCENLGLEKGYLKK F GSKGPNFGTKVSNYPPCP
Sbjct  121  LEKLAEQLLDLLCENLGLEKGYLKKVFYGSKGPNFGTKVSNYPPCP  166



>gb|AAF36484.1|AF129074_1 1-aminocyclopropane-1-carboxylate oxidase [Prunus persica]
Length=318

 Score =   252 bits (643),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 137/167 (82%), Positives = 157/167 (94%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M +FP+++L+Q+  E+R A ME++ DACENWGFFELV+HGIS ELMDTVEKLTK+HYKKC
Sbjct  1    METFPVVDLSQITGEKREAAMEKMNDACENWGFFELVNHGISHELMDTVEKLTKEHYKKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRFKEMVA+KGL+AVQ+EI+DLDWESTFFL+HLPVSNIS+IPDL++ YRKVMKEFA+E
Sbjct  61   MEQRFKEMVASKGLEAVQSEIHDLDWESTFFLRHLPVSNISQIPDLDEDYRKVMKEFAVE  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LEKLAE LLDLLCENLGLEKGYLKKAF GSKGPNFGTKVSNYPPCPK
Sbjct  121  LEKLAEQLLDLLCENLGLEKGYLKKAFYGSKGPNFGTKVSNYPPCPK  167



>ref|NP_001275208.1| 1-aminocyclopropane-1-carboxylate oxidase [Solanum tuberosum]
 gb|AAK68076.1|AF384821_1 1-aminocyclopropane-1-carboxylate oxidase [Solanum tuberosum]
Length=319

 Score =   252 bits (643),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 136/167 (81%), Positives = 154/167 (92%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M +FP++N+  LNTE+R AI+E+IKDACENWGFFE++ HGIS +LMDTVEK TK+HYKKC
Sbjct  1    METFPVVNMEMLNTEKRAAILEKIKDACENWGFFEVIYHGISHDLMDTVEKFTKEHYKKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRFKEMVA+KGL+AVQTEI+DLDWESTFFLKHLPVSNISE+PDLED YRK+MKEFA +
Sbjct  61   MEQRFKEMVASKGLEAVQTEIDDLDWESTFFLKHLPVSNISEVPDLEDDYRKIMKEFADK  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LEKLAE LLDLLCENLGLE+GYLKK F GSKGP FGTKVSNYPPCPK
Sbjct  121  LEKLAEQLLDLLCENLGLEQGYLKKVFYGSKGPTFGTKVSNYPPCPK  167



>ref|XP_010110622.1| 1-aminocyclopropane-1-carboxylate oxidase 3 [Morus notabilis]
 gb|EXC27244.1| 1-aminocyclopropane-1-carboxylate oxidase 3 [Morus notabilis]
Length=319

 Score =   251 bits (642),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 136/167 (81%), Positives = 151/167 (90%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M +FPIINL +LN EER   MEQIKDACENWGFFELV+H I  E +DTVEK+TKDHY+KC
Sbjct  1    MENFPIINLEKLNGEERKTTMEQIKDACENWGFFELVNHSIPHEFLDTVEKMTKDHYRKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRFKE+VA+KGL+AVQ E+ND+DWESTFFL+HLPVSNISEIPDL+D YRKVM+EFA +
Sbjct  61   MEQRFKELVASKGLEAVQAEVNDMDWESTFFLRHLPVSNISEIPDLDDEYRKVMREFAKQ  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LEKLAE LLDLLCENLGLEKGYLKKAF GSKGP FGTKVSNYPPCPK
Sbjct  121  LEKLAEELLDLLCENLGLEKGYLKKAFYGSKGPTFGTKVSNYPPCPK  167



>ref|XP_011000640.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase [Populus 
euphratica]
 ref|XP_011014997.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase [Populus 
euphratica]
 ref|XP_011014999.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase [Populus 
euphratica]
Length=318

 Score =   251 bits (640),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 135/167 (81%), Positives = 157/167 (94%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M SFP+I+L++LN EER   ME+I+DACENWGFFELV+HGIS +L+DTVE+LTK+HY+KC
Sbjct  1    MESFPVIDLSKLNGEERKPTMEKIEDACENWGFFELVNHGISHDLLDTVERLTKEHYRKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRFKEMVA+KGL+AVQ+EI+DLDWESTFFL+HLP SN++EIPDLE+ YRKVMKEFA+E
Sbjct  61   MEQRFKEMVASKGLEAVQSEISDLDWESTFFLRHLPESNMAEIPDLEEDYRKVMKEFALE  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            +EKLAE LLDLLCENLGLEKGYLKKAF GSKGPNFGTKVSNYPPCPK
Sbjct  121  VEKLAEQLLDLLCENLGLEKGYLKKAFYGSKGPNFGTKVSNYPPCPK  167



>ref|XP_003529653.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase-like [Glycine 
max]
 gb|KHN28772.1| 1-aminocyclopropane-1-carboxylate oxidase [Glycine soja]
Length=318

 Score =   250 bits (638),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 134/167 (80%), Positives = 153/167 (92%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M  FP++++  LN EER A ME IKDACENWGFFELV+HGISIELMDTVE++TK+HYKKC
Sbjct  1    MEKFPVVDMGNLNNEERSATMEIIKDACENWGFFELVNHGISIELMDTVERMTKEHYKKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRFKEMVA+KGL++ Q+EINDLDWESTFFL+HLP SNISEIPDL++ YRKVMK+FA+E
Sbjct  61   MEQRFKEMVASKGLESAQSEINDLDWESTFFLRHLPASNISEIPDLDEDYRKVMKDFAVE  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LE+LAE +LDLLCENLGLEKGYLKK F GSKGPNFGTKVSNYPPCPK
Sbjct  121  LEELAELVLDLLCENLGLEKGYLKKVFYGSKGPNFGTKVSNYPPCPK  167



>ref|NP_001281047.1| 1-aminocyclopropane-1-carboxylate oxidase 1 [Malus domestica]
 gb|ABA03057.1| ACC oxidase [Malus domestica]
Length=313

 Score =   250 bits (638),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 136/167 (81%), Positives = 153/167 (92%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            MA+FP+++L+ +N EER A +E+I DACENWGFFELV+HG+S EL+DTVEK+TKDHYKK 
Sbjct  1    MATFPVVDLSLVNGEERAATLEKINDACENWGFFELVNHGMSTELLDTVEKMTKDHYKKT  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRFKEMVAAKGLD VQ+EI+DLDWESTFFL+HLP SNISEIPDLE+ YRK MKEFA+E
Sbjct  61   MEQRFKEMVAAKGLDDVQSEIHDLDWESTFFLRHLPSSNISEIPDLEEEYRKTMKEFAVE  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LEKLAE LLDLLCENLGLEKGYLKK F GSKGPNFGTKVSNYPPCPK
Sbjct  121  LEKLAEKLLDLLCENLGLEKGYLKKVFYGSKGPNFGTKVSNYPPCPK  167



>emb|CAJ56065.1| ACC oxidase [Vigna radiata]
Length=317

 Score =   250 bits (638),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 137/166 (83%), Positives = 153/166 (92%), Gaps = 0/166 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            MASFP++++ +LNTEER A ME IKDACENWGFFELV+HGISIELMDTVEKLTK+HYKK 
Sbjct  1    MASFPVVDMGKLNTEERGAAMEMIKDACENWGFFELVNHGISIELMDTVEKLTKEHYKKT  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRFKEMVA KGL++VQ+EINDLDWESTFFL+HLPVSN+SE  DL+  YRK+MK+FA E
Sbjct  61   MEQRFKEMVANKGLESVQSEINDLDWESTFFLRHLPVSNVSENTDLDQDYRKIMKQFAEE  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCP  584
            LEKLAE+LLDLLCENLGLEKGYLKK F GSKGPNFGTKVSNYPPCP
Sbjct  121  LEKLAEHLLDLLCENLGLEKGYLKKVFYGSKGPNFGTKVSNYPPCP  166



>ref|NP_001234638.1| 1-aminocyclopropane-1-carboxylate oxidase [Solanum lycopersicum]
 gb|ABP68407.1| 1-aminocyclopropane-1-carboxylate oxidase [Solanum lycopersicum]
Length=319

 Score =   250 bits (638),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 134/167 (80%), Positives = 153/167 (92%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M +FP++N+  LNTE+R A +E+IKDACENWGFFE+++HGIS EL+DTVEK TK+HYKKC
Sbjct  1    METFPVVNMEMLNTEKRAAALEKIKDACENWGFFEVINHGISHELLDTVEKFTKEHYKKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRFKEMVA+KGL+ VQTEI+DLDWESTFFLKHLPVSNISE+PDLED YRK+MKEFA +
Sbjct  61   MEQRFKEMVASKGLEGVQTEIDDLDWESTFFLKHLPVSNISEVPDLEDDYRKIMKEFADK  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LEKLAE LLDLLCENLGLE+GYLKK F GSKGP FGTKVSNYPPCPK
Sbjct  121  LEKLAEQLLDLLCENLGLEQGYLKKVFYGSKGPTFGTKVSNYPPCPK  167



>ref|XP_003549632.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase-like [Glycine 
max]
 gb|KHN03507.1| 1-aminocyclopropane-1-carboxylate oxidase [Glycine soja]
Length=319

 Score =   250 bits (638),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 134/168 (80%), Positives = 155/168 (92%), Gaps = 1/168 (1%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELM-DTVEKLTKDHYKK  263
            M +FP++++  LN EER A ME IKDACENWGFFELV+HGISIELM DTVE++TK+HYKK
Sbjct  1    MENFPVVDMGNLNNEERSATMEIIKDACENWGFFELVNHGISIELMMDTVERMTKEHYKK  60

Query  264  CMEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAM  443
            CMEQRF+EMVA+KGL++ Q+EINDLDWESTFFL+HLPVSNISEIPDL++ YRKVMK+FA+
Sbjct  61   CMEQRFQEMVASKGLESAQSEINDLDWESTFFLRHLPVSNISEIPDLDEDYRKVMKDFAV  120

Query  444  eleklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            ELEKLAE +L+LLCENLGLEKGYLKK F GSKGPNFGTKVSNYPPCPK
Sbjct  121  ELEKLAELVLELLCENLGLEKGYLKKVFCGSKGPNFGTKVSNYPPCPK  168



>sp|Q00985.1|ACCO1_MALDO RecName: Full=1-aminocyclopropane-1-carboxylate oxidase 1; Short=ACC 
oxidase 1; AltName: Full=Ethylene-forming enzyme; Short=EFE; 
AltName: Full=PAE12; AltName: Full=Protein AP4 [Malus 
domestica]
 emb|CAA43662.1| ethylene related [Malus domestica]
 gb|AAA33412.1| ripening-related protein [Malus sylvestris]
 emb|CAA74328.1| ACC oxidase [Malus domestica]
 gb|AAC36461.1| ACC oxidase [Malus domestica]
 gb|ABA03055.1| ACC oxidase [Malus domestica]
 prf||1905416A aminocyclopropane carboxylate oxidase
Length=314

 Score =   249 bits (637),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 136/167 (81%), Positives = 153/167 (92%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            MA+FP+++L+ +N EER A +E+I DACENWGFFELV+HG+S EL+DTVEK+TKDHYKK 
Sbjct  1    MATFPVVDLSLVNGEERAATLEKINDACENWGFFELVNHGMSTELLDTVEKMTKDHYKKT  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRFKEMVAAKGLD VQ+EI+DLDWESTFFL+HLP SNISEIPDLE+ YRK MKEFA+E
Sbjct  61   MEQRFKEMVAAKGLDDVQSEIHDLDWESTFFLRHLPSSNISEIPDLEEEYRKTMKEFAVE  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LEKLAE LLDLLCENLGLEKGYLKK F GSKGPNFGTKVSNYPPCPK
Sbjct  121  LEKLAEKLLDLLCENLGLEKGYLKKVFYGSKGPNFGTKVSNYPPCPK  167



>ref|XP_009355918.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase 2 [Pyrus 
x bretschneideri]
 dbj|BAD61004.1| 1-aminocyclopropane-1-carboxylate oxidase [Pyrus pyrifolia]
Length=314

 Score =   249 bits (637),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 135/167 (81%), Positives = 153/167 (92%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            MA+FP+++++ +N EER A +E+I DACENWGFFELV+HGIS EL+DTVEK+ KDHYKK 
Sbjct  1    MATFPVVDMSLVNGEERAATLEKINDACENWGFFELVNHGISTELLDTVEKMNKDHYKKT  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRFKEMV AKGLDAVQ++I+DLDWESTFFL+HLP SNISEIPDLE+ YRK MKEFA+E
Sbjct  61   MEQRFKEMVVAKGLDAVQSQIHDLDWESTFFLRHLPSSNISEIPDLEEDYRKTMKEFAVE  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LEKLAE LLDLLCENLGLEKGYLKKAF GSKGPNFGTKVSNYPPCPK
Sbjct  121  LEKLAETLLDLLCENLGLEKGYLKKAFYGSKGPNFGTKVSNYPPCPK  167



>gb|ACU24286.1| unknown [Glycine max]
Length=318

 Score =   249 bits (637),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 133/167 (80%), Positives = 153/167 (92%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M  FP++++  LN EER A ME IKDACENWGFFELV+HG+SIELMDTVE++TK+HYKKC
Sbjct  1    MEKFPVVDMGNLNNEERSATMEIIKDACENWGFFELVNHGVSIELMDTVERMTKEHYKKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRFKEMVA+KGL++ Q+EINDLDWESTFFL+HLP SNISEIPDL++ YRKVMK+FA+E
Sbjct  61   MEQRFKEMVASKGLESAQSEINDLDWESTFFLRHLPASNISEIPDLDEDYRKVMKDFAVE  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LE+LAE +LDLLCENLGLEKGYLKK F GSKGPNFGTKVSNYPPCPK
Sbjct  121  LEELAELVLDLLCENLGLEKGYLKKVFYGSKGPNFGTKVSNYPPCPK  167



>gb|KJB57824.1| hypothetical protein B456_009G182300 [Gossypium raimondii]
Length=238

 Score =   246 bits (629),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 135/165 (82%), Positives = 152/165 (92%), Gaps = 0/165 (0%)
 Frame = +3

Query  93   SFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKCME  272
            +FP+I+ ++LN EER A ME IKDACENWGFFELV+HGIS ELMDTVE+LTK+HY+KCME
Sbjct  4    TFPVIDFSKLNGEERAAAMEMIKDACENWGFFELVNHGISHELMDTVERLTKEHYRKCME  63

Query  273  QRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMele  452
            QRFKEMVA+KGL+AVQ+EIND+DWESTFFL+HLP SN+SEIPDLE+ YRKVMKEFA+ELE
Sbjct  64   QRFKEMVASKGLEAVQSEINDMDWESTFFLRHLPESNMSEIPDLEEDYRKVMKEFAVELE  123

Query  453  klaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            KLAE LLDLLCENLGLE GYLKK F GSKGP FGTKVSNYPPCPK
Sbjct  124  KLAEQLLDLLCENLGLEPGYLKKVFYGSKGPTFGTKVSNYPPCPK  168



>ref|XP_007153995.1| hypothetical protein PHAVU_003G082300g [Phaseolus vulgaris]
 gb|ESW25989.1| hypothetical protein PHAVU_003G082300g [Phaseolus vulgaris]
Length=318

 Score =   249 bits (636),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 133/167 (80%), Positives = 154/167 (92%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M +FP++++  LN EER A ME+IKDACENWGFFELV+HGIS+ELMD+VE+LTK+HY+ C
Sbjct  1    MENFPVVDMGNLNNEERGATMEKIKDACENWGFFELVNHGISLELMDSVERLTKEHYRTC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRFKEMVA+KGL++ Q+EINDLDWESTFFL+HLPVSNISEIPDL + +RKVMK+FA+E
Sbjct  61   MEQRFKEMVASKGLESAQSEINDLDWESTFFLRHLPVSNISEIPDLGEDHRKVMKDFAVE  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LEKLAE LLDLLCENLGLEKGYLKK F GSKGPNFGTKVSNYPPCPK
Sbjct  121  LEKLAELLLDLLCENLGLEKGYLKKVFYGSKGPNFGTKVSNYPPCPK  167



>ref|XP_003594161.1| 1-aminocyclopropane-1-carboxylate oxidase [Medicago truncatula]
 gb|ABD32649.1| 2OG-Fe(II) oxygenase [Medicago truncatula]
 gb|AES64412.1| 1-aminocyclopropane-1-carboxylate oxidase [Medicago truncatula]
 gb|AFK40757.1| unknown [Medicago truncatula]
Length=317

 Score =   249 bits (636),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 136/167 (81%), Positives = 151/167 (90%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M +FP++++ +LNTEER A ME IKDACENWGFFE V+H ISIELMD VEKLTK+HYKKC
Sbjct  1    MENFPVVDMGKLNTEERKATMEMIKDACENWGFFECVNHSISIELMDKVEKLTKEHYKKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRFKEMVA+KGL+ VQ+EINDLDWESTFFL+HLP SNISEIPDL++ YRK MKEFA +
Sbjct  61   MEQRFKEMVASKGLECVQSEINDLDWESTFFLRHLPSSNISEIPDLDEDYRKTMKEFAEK  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LEKLAE LLDLLCENLGLEKGYLKK F GSKGPNFGTKVSNYPPCPK
Sbjct  121  LEKLAEELLDLLCENLGLEKGYLKKVFYGSKGPNFGTKVSNYPPCPK  167



>gb|AFJ75398.1| 1-aminocyclopropane-1-carboxylic acid oxidase [Salvia miltiorrhiza]
 gb|AFJ75399.1| 1-aminocyclopropane-1-carboxylic acid oxidase [Salvia miltiorrhiza]
Length=314

 Score =   249 bits (636),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 132/167 (79%), Positives = 152/167 (91%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            MASFP+I+L ++N EER A++ QIKDACENWGFFELV+HGI+ E MD VEKLTK+HY+KC
Sbjct  1    MASFPVISLEKINGEERAAVLAQIKDACENWGFFELVNHGIAPEFMDKVEKLTKEHYRKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRF EMVA+KGL+AVQ+EI+DLDWESTFFL+HLP+SNISEIPDL+  YR+VM+EFA +
Sbjct  61   MEQRFNEMVASKGLEAVQSEIDDLDWESTFFLRHLPISNISEIPDLDQEYREVMREFAAK  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LE LAE LLDLLCENLGLEKGYLKKAF GSKGP FGTKVSNYPPCPK
Sbjct  121  LEVLAEELLDLLCENLGLEKGYLKKAFCGSKGPTFGTKVSNYPPCPK  167



>gb|AHL69752.1| aminocyclopropanecarboxylate oxidase [Picrorhiza kurrooa]
Length=318

 Score =   249 bits (636),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 135/167 (81%), Positives = 153/167 (92%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            MA+FP++N+ +LN EER A ME IKDACENWGFFELV+HGI+ E MD VE+LTK+HYK+ 
Sbjct  1    MATFPVVNMEKLNGEERSATMEMIKDACENWGFFELVNHGIAPEFMDIVERLTKEHYKRA  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRFKEMV +KGL+AVQ+EI+DLDWESTFFL+HLPVSNISEIPDLE+ YRKVMKEFA +
Sbjct  61   MEQRFKEMVESKGLEAVQSEIDDLDWESTFFLRHLPVSNISEIPDLEEEYRKVMKEFAAQ  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LEKLAE+LLDLLCENLGLEKGYLKKAF GSKGP FGTKVSNYPPCPK
Sbjct  121  LEKLAEDLLDLLCENLGLEKGYLKKAFYGSKGPTFGTKVSNYPPCPK  167



>ref|NP_001241899.1| 1-aminocyclopropane-1-carboxylate oxidase-like [Glycine max]
 gb|AEI54340.1| 1-aminocyclopropane-1-carboxylate oxidase [Glycine max]
Length=318

 Score =   249 bits (636),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 134/166 (81%), Positives = 154/166 (93%), Gaps = 0/166 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            MA+FP++++ +LNTEER A ME IKDACENWGFFELV+HGISIELMDTVE+LTK+HYKK 
Sbjct  1    MANFPVVDMGKLNTEERAAAMEIIKDACENWGFFELVNHGISIELMDTVERLTKEHYKKT  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRFKEMVA+KGL++VQ+EINDLDWESTFFL+HLPVSN+S+  DL++ YRK MK+FA+E
Sbjct  61   MEQRFKEMVASKGLESVQSEINDLDWESTFFLRHLPVSNVSDNSDLDEEYRKTMKKFALE  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCP  584
            LEKLAE LLDLLCENLGLEKGYLKK F GSKGPNFGTKVSNYPPCP
Sbjct  121  LEKLAEQLLDLLCENLGLEKGYLKKVFYGSKGPNFGTKVSNYPPCP  166



>ref|XP_009791489.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase-like [Nicotiana 
sylvestris]
Length=320

 Score =   249 bits (636),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 136/167 (81%), Positives = 153/167 (92%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M +FP+I++  LNTE+R A ME+IKDACENWGF ELV+HGIS ELMDTVEKLTK+HYKKC
Sbjct  1    METFPVIDMEMLNTEQRAATMEKIKDACENWGFLELVNHGISHELMDTVEKLTKEHYKKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRFKEMVA KGL+AVQ EI+DLDWESTFFLKHLPVSNIS++PDL D YRKVMKEFA +
Sbjct  61   MEQRFKEMVANKGLEAVQAEIDDLDWESTFFLKHLPVSNISDVPDLVDDYRKVMKEFAQK  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LEKLAE+LLDLLCENLGLE+GYLKKAF G+KGP FGTKV+NYPPCPK
Sbjct  121  LEKLAEDLLDLLCENLGLEQGYLKKAFYGTKGPTFGTKVANYPPCPK  167



>emb|CAA67216.1| ACC oxidase [Malus domestica]
 emb|CAA04895.1| ACC oxidase [Malus domestica]
Length=314

 Score =   249 bits (635),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 136/167 (81%), Positives = 153/167 (92%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            MA+FP+++L+ +N EER A +E+I DACENWGFFELV+HG+S EL+DTVEK+TKDHYKK 
Sbjct  1    MATFPVVDLSLVNGEERAATLEKINDACENWGFFELVNHGMSTELLDTVEKMTKDHYKKT  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRFKEMVAAKGLD VQ+EI+DLDWESTFFL+HLP SNISEIPDLE+ YRK MKEFA+E
Sbjct  61   MEQRFKEMVAAKGLDDVQSEIHDLDWESTFFLRHLPSSNISEIPDLEEDYRKTMKEFAVE  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LEKLAE LLDLLCENLGLEKGYLKK F GSKGPNFGTKVSNYPPCPK
Sbjct  121  LEKLAEKLLDLLCENLGLEKGYLKKVFYGSKGPNFGTKVSNYPPCPK  167



>gb|AHA06004.1| 1-aminocyclopropane-1-carboxylate oxidase [Lupinus luteus]
Length=317

 Score =   249 bits (635),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 136/167 (81%), Positives = 151/167 (90%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M +FPI+++ +LNTEER   M+ IKDACENWGFFELV+HGISIELMDTVE+LTK+HYKKC
Sbjct  1    MENFPIVDIGKLNTEERVPTMDIIKDACENWGFFELVNHGISIELMDTVERLTKEHYKKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRF EMV +K L++VQ+EI DLDWESTFFL+HLPVSNISE PDL+D YRKVMKEFA E
Sbjct  61   MEQRFNEMVTSKSLESVQSEIKDLDWESTFFLRHLPVSNISETPDLDDDYRKVMKEFAQE  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LEKLAE LLDLLCENLGLEKGYLKK F GSKGPNFGTKVSNYPPCPK
Sbjct  121  LEKLAEQLLDLLCENLGLEKGYLKKVFYGSKGPNFGTKVSNYPPCPK  167



>gb|AAC48977.1| 1-aminocyclopropane-1-carboxylate oxidase [Pelargonium x hortorum]
 prf||2104412A aminocyclopropane carboxylate oxidase
Length=318

 Score =   249 bits (635),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 132/167 (79%), Positives = 150/167 (90%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M SFP+IN+ +LN EER A ME+IKDACENWGFFEL++HGI  EL+DTVEK+TK+HY+KC
Sbjct  1    MESFPVINMEKLNGEERAATMEKIKDACENWGFFELLNHGIPYELLDTVEKMTKEHYRKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRFKEMVA+KGL+ V+ E+ DLDWESTFFLKHLP SNIS++PDL+D YRKVMKEFA +
Sbjct  61   MEQRFKEMVASKGLEGVEVEVEDLDWESTFFLKHLPESNISQVPDLQDEYRKVMKEFAAK  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LEKLAE LLDLL ENLGLEKGYLKKAF GSKGP FGTKVSNYPPCPK
Sbjct  121  LEKLAEELLDLLSENLGLEKGYLKKAFYGSKGPTFGTKVSNYPPCPK  167



>gb|KHN32985.1| 1-aminocyclopropane-1-carboxylate oxidase [Glycine soja]
Length=318

 Score =   249 bits (635),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 134/166 (81%), Positives = 154/166 (93%), Gaps = 0/166 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            MA+FP++++ +LNTEER A ME IKDACENWGFFELV+HGISIELMDTVE+LTK+HYKK 
Sbjct  1    MANFPVVDMGKLNTEERAAAMEIIKDACENWGFFELVNHGISIELMDTVERLTKEHYKKT  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRFKEMVA+KGL++VQ+EINDLDWESTFFL+HLPVSN+S+  DL++ YRK MK+FA+E
Sbjct  61   MEQRFKEMVASKGLESVQSEINDLDWESTFFLRHLPVSNVSDNSDLDEEYRKTMKKFALE  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCP  584
            LEKLAE LLDLLCENLGLEKGYLKK F GSKGPNFGTKVSNYPPCP
Sbjct  121  LEKLAEQLLDLLCENLGLEKGYLKKVFYGSKGPNFGTKVSNYPPCP  166



>sp|Q08507.1|ACCO3_PETHY RecName: Full=1-aminocyclopropane-1-carboxylate oxidase 3; Short=ACC 
oxidase 3; AltName: Full=Ethylene-forming enzyme; Short=EFE 
[Petunia x hybrida]
 gb|AAA33697.1| 1-aminocyclopropane-1-carboxylate oxidase [Petunia x hybrida]
Length=320

 Score =   249 bits (635),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 136/167 (81%), Positives = 150/167 (90%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M +FPIINL +LN  ER A ME IKDACENWGFFELV+HGI  E+MDTVEKLTK HYKKC
Sbjct  1    MENFPIINLEKLNGSERDATMEMIKDACENWGFFELVNHGIPHEVMDTVEKLTKGHYKKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRFKE+VA+KGL+AVQ E+ DLDWESTFFL+HLPVSNISE+PDL+D YR+VM++FA  
Sbjct  61   MEQRFKELVASKGLEAVQAEVTDLDWESTFFLRHLPVSNISEVPDLDDEYREVMRDFAKR  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LEKLAE LLDLLCENLGLEKGYLKKAF GSKGPNFGTKVSNYPPCPK
Sbjct  121  LEKLAEELLDLLCENLGLEKGYLKKAFYGSKGPNFGTKVSNYPPCPK  167



>emb|CAD21844.1| ACC oxidase 1 [Fagus sylvatica]
Length=319

 Score =   249 bits (635),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 134/167 (80%), Positives = 151/167 (90%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M +FP+INL +LN EER   ME+IKDACENWGFFELV+HG+  EL+DTVE+L K+HYKKC
Sbjct  1    MENFPVINLEKLNGEERGTTMEKIKDACENWGFFELVNHGLPHELLDTVERLAKEHYKKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRFKE+V A+GL+ VQTE+NDLDWESTF ++HLP SNISEIPDLED YRKVMKEFA++
Sbjct  61   MEQRFKELVTAQGLEGVQTEVNDLDWESTFHVRHLPQSNISEIPDLEDEYRKVMKEFALK  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LEKLAE LLDLLCENLGLEKGYLKKAF GSKGPNFGTKVSNYPPCPK
Sbjct  121  LEKLAEELLDLLCENLGLEKGYLKKAFHGSKGPNFGTKVSNYPPCPK  167



>ref|XP_003534723.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase [Glycine 
max]
 gb|KHN40848.1| 1-aminocyclopropane-1-carboxylate oxidase [Glycine soja]
Length=318

 Score =   249 bits (635),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 134/166 (81%), Positives = 153/166 (92%), Gaps = 0/166 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            MA+FP++++ +LNTEERPA ME IKDACENWGFFELV+HGISIELMDTVEKLTK+HYKK 
Sbjct  1    MANFPVVDMGKLNTEERPAAMEIIKDACENWGFFELVNHGISIELMDTVEKLTKEHYKKT  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRFKEMV +KGL++VQ+EINDLDWESTFFL+HLP+SN+S+  DL+  YRK MK+FA+E
Sbjct  61   MEQRFKEMVTSKGLESVQSEINDLDWESTFFLRHLPLSNVSDNADLDQDYRKTMKKFALE  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCP  584
            LEKLAE LLDLLCENLGLEKGYLKK F GSKGPNFGTKVSNYPPCP
Sbjct  121  LEKLAEQLLDLLCENLGLEKGYLKKVFYGSKGPNFGTKVSNYPPCP  166



>gb|AEM62877.1| ACC oxidase 1 [Actinidia chinensis]
 gb|AEY77404.1| ACC oxidase-like protein [Actinidia deliciosa]
Length=319

 Score =   249 bits (635),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 135/167 (81%), Positives = 151/167 (90%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M +FP+I++ +LN EER   ME+IKDACENWGFFELV+HGIS ELMDTVE+LTK+HY KC
Sbjct  1    MEAFPVIDMEKLNGEERAPTMEKIKDACENWGFFELVNHGISHELMDTVERLTKEHYNKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRFKEMVA KGL+AVQ+EINDLDWESTFFL+HLPVSNISEIPDLE  +RK MKEFA +
Sbjct  61   MEQRFKEMVATKGLEAVQSEINDLDWESTFFLRHLPVSNISEIPDLEQDHRKAMKEFAEK  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LEKLAE LLDLLCEN+GLEKGYLKKAF GSKGP FGTKVSNYPPCP+
Sbjct  121  LEKLAEQLLDLLCENVGLEKGYLKKAFYGSKGPTFGTKVSNYPPCPR  167



>dbj|BAC66950.1| ACC oxidase [Striga hermonthica]
Length=318

 Score =   248 bits (634),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 135/167 (81%), Positives = 150/167 (90%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            MA+FP+IN+A+LN E RPA M QI+DAC+NWGFFE+V+HGIS E MD VE+LTK+HYKKC
Sbjct  1    MATFPVINMAKLNGEGRPATMAQIEDACQNWGFFEVVNHGISAEFMDRVERLTKEHYKKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRFKEMVAAKGL+AVQ+EINDLDWESTFFL+HLP SNISEIPDL   YR+VMKEFA  
Sbjct  61   MEQRFKEMVAAKGLEAVQSEINDLDWESTFFLRHLPSSNISEIPDLHPEYREVMKEFAAH  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LEKLAE+LLDLLCENLGLE GYLKK F GSKGP FGTKVSNYPPCPK
Sbjct  121  LEKLAEHLLDLLCENLGLEMGYLKKVFYGSKGPTFGTKVSNYPPCPK  167



>emb|CAJ56064.1| ACC oxidase [Vigna radiata]
Length=317

 Score =   248 bits (634),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 136/166 (82%), Positives = 153/166 (92%), Gaps = 0/166 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            MA+FP++++ +LNTEER A ME IKDACENWGFFELV+HGISIELMDTVEKLTK+HYKK 
Sbjct  1    MANFPVVDMGKLNTEERGAAMEMIKDACENWGFFELVNHGISIELMDTVEKLTKEHYKKT  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRFKEMVA KGL++VQ+EINDLDWESTFFL+HLPVSN+SE  DL+  YRK+MK+FA E
Sbjct  61   MEQRFKEMVANKGLESVQSEINDLDWESTFFLRHLPVSNVSENTDLDQDYRKIMKQFAEE  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCP  584
            LEKLAE+LLDLLCENLGLEKGYLKK F GSKGPNFGTKVSNYPPCP
Sbjct  121  LEKLAEHLLDLLCENLGLEKGYLKKVFYGSKGPNFGTKVSNYPPCP  166



>ref|XP_008371045.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase 2 [Malus 
domestica]
Length=330

 Score =   249 bits (635),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 136/167 (81%), Positives = 153/167 (92%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            MA+FP++++  +N EER A +E+I DACENWGFFELV+HGIS EL+DTVEK+ KDHYKK 
Sbjct  1    MATFPVVDMDLINGEERAATLEKINDACENWGFFELVNHGISTELLDTVEKMNKDHYKKT  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRFKEMVAAKGL+AVQ+EI+DLDWESTFFL+HLP SNISEIPDLE+ YRK MKEFA+E
Sbjct  61   MEQRFKEMVAAKGLEAVQSEIHDLDWESTFFLRHLPSSNISEIPDLEEDYRKTMKEFAVE  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LEKLAE LLDLLCENLGLEKGYLKKAF GSKGPNFGTKVSNYPPCPK
Sbjct  121  LEKLAEKLLDLLCENLGLEKGYLKKAFYGSKGPNFGTKVSNYPPCPK  167



>emb|CAH18930.1| 1-aminocyclopropane-1-carboxylate oxidase [Pyrus communis]
Length=314

 Score =   248 bits (633),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 136/167 (81%), Positives = 153/167 (92%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            MA+FP+++L+ +N EER A +E+I DACENWGFFELV+HGIS EL+DTVEK+TKDHYKK 
Sbjct  1    MATFPVVDLSLVNGEERVATLEKINDACENWGFFELVNHGISTELLDTVEKMTKDHYKKT  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRFKEMVAAKGLDAVQ+EI+DLDWESTFFL+HLP SNISE+PDLE+ YRK MKEFA+E
Sbjct  61   MEQRFKEMVAAKGLDAVQSEIHDLDWESTFFLRHLPSSNISEVPDLEEDYRKTMKEFAVE  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LEKLAE LLDLLCENLGLEKGYLKK F GSKGPNFGTKVSNYPPC K
Sbjct  121  LEKLAEKLLDLLCENLGLEKGYLKKVFLGSKGPNFGTKVSNYPPCHK  167



>sp|P31237.1|ACCO_ACTDE RecName: Full=1-aminocyclopropane-1-carboxylate oxidase; Short=ACC 
oxidase; AltName: Full=Ethylene-forming enzyme; Short=EFE 
[Actinidia deliciosa]
 gb|AAA18566.1| tomato and apple ACC oxidase homologue [Actinidia deliciosa]
Length=319

 Score =   248 bits (634),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 135/167 (81%), Positives = 151/167 (90%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M +FP+I++ +LN EER   ME+IKDACENWGFFELV+HGIS ELMDTVE+LTK+HY KC
Sbjct  1    MEAFPVIDMEKLNGEERAPTMEKIKDACENWGFFELVNHGISHELMDTVERLTKEHYNKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRFKEMVA KGL+AVQ+EINDLDWESTFFL+HLPVSNISEIPDLE  +RK MKEFA +
Sbjct  61   MEQRFKEMVATKGLEAVQSEINDLDWESTFFLRHLPVSNISEIPDLEQDHRKAMKEFAEK  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LEKLAE LLDLLCEN+GLEKGYLKKAF GSKGP FGTKVSNYPPCP+
Sbjct  121  LEKLAEQLLDLLCENVGLEKGYLKKAFYGSKGPTFGTKVSNYPPCPR  167



>gb|AEM62885.1| ACC oxidase 6 [Actinidia chinensis]
Length=317

 Score =   248 bits (634),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 136/167 (81%), Positives = 152/167 (91%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M +FP+I++ +LN EER A ME IKDACENWGFFEL++HGIS ELMDTVE LTK HYKKC
Sbjct  1    MEAFPVIDMEKLNGEERAASMEVIKDACENWGFFELMNHGISHELMDTVEMLTKGHYKKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRFKEMVA+KGL+AVQ+EI+DLDWESTFFL+HLPVSNISEIPDLE+ YRK MKEFA +
Sbjct  61   MEQRFKEMVASKGLEAVQSEIDDLDWESTFFLRHLPVSNISEIPDLEEDYRKTMKEFAEK  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LEKLAE LLDLLCENLG+EKGYLKKAF GSKGP FGTKVSNYPPCP+
Sbjct  121  LEKLAEQLLDLLCENLGIEKGYLKKAFYGSKGPTFGTKVSNYPPCPR  167



>gb|ABW91146.1| ACC oxidase 1 [Ziziphus jujuba]
Length=319

 Score =   248 bits (633),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 131/167 (78%), Positives = 150/167 (90%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M +FP+INL  LN E R A MEQI+DACENWGFFELV+HGI+ E MD +E++TK+HY+KC
Sbjct  1    MENFPVINLENLNGEGRKATMEQIRDACENWGFFELVNHGIAPEFMDKIERMTKEHYRKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRFKE+VA+KGL+AVQTE++D+DWESTFFL+HLPVSNISEIPDL D YRK MKEFA++
Sbjct  61   MEQRFKELVASKGLEAVQTEVSDMDWESTFFLRHLPVSNISEIPDLHDDYRKAMKEFALK  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LE LAE LLDLLCENLGLEKGYLKKAF GSKGP FGTKVSNYPPCPK
Sbjct  121  LETLAEELLDLLCENLGLEKGYLKKAFYGSKGPTFGTKVSNYPPCPK  167



>gb|AEP19803.1| ACC oxidase 1 [Ziziphus jujuba]
Length=319

 Score =   248 bits (633),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 131/167 (78%), Positives = 150/167 (90%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M +FP+INL  LN E R A MEQI+DACENWGFFELV+HGI+ E MD +E++TK+HY+KC
Sbjct  1    MENFPVINLENLNGEGRKATMEQIRDACENWGFFELVNHGIAPEFMDKIERMTKEHYRKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRFKE+VA+KGL+AVQTE++D+DWESTFFL+HLPVSNISEIPDL D YRK MKEFA++
Sbjct  61   MEQRFKELVASKGLEAVQTEVSDMDWESTFFLRHLPVSNISEIPDLHDDYRKAMKEFALK  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LE LAE LLDLLCENLGLEKGYLKKAF GSKGP FGTKVSNYPPCPK
Sbjct  121  LETLAEELLDLLCENLGLEKGYLKKAFYGSKGPTFGTKVSNYPPCPK  167



>gb|KDO78385.1| hypothetical protein CISIN_1g018920mg [Citrus sinensis]
Length=225

 Score =   244 bits (624),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 130/167 (78%), Positives = 153/167 (92%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M +FPII+L++LN +ER A ME I DACENWGFFELV+HGIS EL+DTV++LTK+HY KC
Sbjct  1    MENFPIIDLSKLNGDERSATMEMINDACENWGFFELVNHGISHELLDTVQRLTKEHYGKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            M+QRFK+MVA+KGL+AVQ+E+NDLDWESTFFL+HLPVSN++EIPDLED YRK MKEFA+E
Sbjct  61   MDQRFKQMVASKGLEAVQSEVNDLDWESTFFLRHLPVSNMAEIPDLEDDYRKAMKEFAVE  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LEK+AE LL+LLCENLGLE+GYLKK F GSKGP FGTKVSNYPPCPK
Sbjct  121  LEKVAEQLLELLCENLGLEEGYLKKVFYGSKGPTFGTKVSNYPPCPK  167



>gb|AAZ83342.1| ACC oxidase 1 [Gossypium hirsutum]
Length=319

 Score =   248 bits (633),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 135/165 (82%), Positives = 152/165 (92%), Gaps = 0/165 (0%)
 Frame = +3

Query  93   SFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKCME  272
            +FP+I+ ++LN EER A ME IKDACENWGFFELV+HGIS ELMDTVE+LTK+HY+KCME
Sbjct  4    TFPVIDFSKLNGEERAAAMEMIKDACENWGFFELVNHGISHELMDTVERLTKEHYRKCME  63

Query  273  QRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMele  452
            QRFKEMVA+KGL+AVQ+EIND+DWESTFFL+HLP SN+SEIPDLE+ YRKVMKEFA+ELE
Sbjct  64   QRFKEMVASKGLEAVQSEINDMDWESTFFLRHLPESNMSEIPDLEEDYRKVMKEFAVELE  123

Query  453  klaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            KLAE LLDLLCENLGLE GYLKK F GSKGP FGTKVSNYPPCPK
Sbjct  124  KLAEQLLDLLCENLGLEPGYLKKVFYGSKGPTFGTKVSNYPPCPK  168



>gb|KJB57823.1| hypothetical protein B456_009G182300 [Gossypium raimondii]
Length=319

 Score =   248 bits (632),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 135/165 (82%), Positives = 152/165 (92%), Gaps = 0/165 (0%)
 Frame = +3

Query  93   SFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKCME  272
            +FP+I+ ++LN EER A ME IKDACENWGFFELV+HGIS ELMDTVE+LTK+HY+KCME
Sbjct  4    TFPVIDFSKLNGEERAAAMEMIKDACENWGFFELVNHGISHELMDTVERLTKEHYRKCME  63

Query  273  QRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMele  452
            QRFKEMVA+KGL+AVQ+EIND+DWESTFFL+HLP SN+SEIPDLE+ YRKVMKEFA+ELE
Sbjct  64   QRFKEMVASKGLEAVQSEINDMDWESTFFLRHLPESNMSEIPDLEEDYRKVMKEFAVELE  123

Query  453  klaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            KLAE LLDLLCENLGLE GYLKK F GSKGP FGTKVSNYPPCPK
Sbjct  124  KLAEQLLDLLCENLGLEPGYLKKVFYGSKGPTFGTKVSNYPPCPK  168



>gb|ABK59094.1| 1-amino-cyclopropane-1-carboxylic acid oxidase 3 [Manihot esculenta]
Length=312

 Score =   248 bits (632),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 133/167 (80%), Positives = 154/167 (92%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M +FP+I+L++L+ EER   ME I+DACENWGFFELV+HGIS ELMDTVE+LTK+HYKKC
Sbjct  1    METFPVIDLSKLSGEERKPTMEMIQDACENWGFFELVNHGISHELMDTVERLTKEHYKKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRFKEMVA+KGL+AVQ+EI+DLDWESTFFL+HLPVSN++EIPDL++ YRK MKEFA E
Sbjct  61   MEQRFKEMVASKGLEAVQSEISDLDWESTFFLRHLPVSNMAEIPDLDEEYRKTMKEFAEE  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LEKLAE LL++LCENLGLEKGYLKKAF GSKGP FGTKVSNYPPCPK
Sbjct  121  LEKLAEQLLEVLCENLGLEKGYLKKAFYGSKGPTFGTKVSNYPPCPK  167



>gb|AFK48521.1| unknown [Lotus japonicus]
Length=309

 Score =   247 bits (631),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 132/167 (79%), Positives = 152/167 (91%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M +FP++++ +LNTEE+   ME IKDACENWGFFELV+HGIS+ELMDTVE+L K+HYKK 
Sbjct  1    MENFPVVDMGKLNTEEKAGTMEIIKDACENWGFFELVNHGISLELMDTVERLAKEHYKKR  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRFKEMVA+KGL++ Q+EINDLDWESTFFL+HLPVSNISEIPDL+D YRK MKEFA+E
Sbjct  61   MEQRFKEMVASKGLESAQSEINDLDWESTFFLRHLPVSNISEIPDLDDDYRKAMKEFALE  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            L+KLAE LLDLLCENLGLE GYLKK F GSKGPNFG+KVSNYPPCPK
Sbjct  121  LQKLAELLLDLLCENLGLENGYLKKVFYGSKGPNFGSKVSNYPPCPK  167



>emb|CAH58646.1| aminocyclopropan-1-carboxylate oxidase [Plantago major]
Length=318

 Score =   247 bits (631),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 134/167 (80%), Positives = 150/167 (90%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            MA+FP++N+  LN +ER + M+ IKDACENWGFFELV+HGI+ E MDTVEKLTKDHY++ 
Sbjct  1    MATFPVVNMENLNGDERSSTMDIIKDACENWGFFELVNHGIAPEFMDTVEKLTKDHYRRS  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRF EMVA KGL+AVQ+EI DLDWESTFFL+HLPVSNISEIPDL+D YRKVMKEFA +
Sbjct  61   MEQRFNEMVANKGLEAVQSEIEDLDWESTFFLRHLPVSNISEIPDLQDEYRKVMKEFASQ  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LEKLAE LLDLLCENLGLEKGYLKKAF GSKGP FGTKVSNYPPCPK
Sbjct  121  LEKLAEVLLDLLCENLGLEKGYLKKAFYGSKGPTFGTKVSNYPPCPK  167



>ref|XP_009593567.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase-like [Nicotiana 
tomentosiformis]
Length=321

 Score =   247 bits (631),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 134/167 (80%), Positives = 154/167 (92%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M +FP++++  LNTE+R AIME++KDACENWGF ELV+HGIS ELMDTVEKLTK+HYKKC
Sbjct  1    METFPVVDMEMLNTEQRAAIMEKLKDACENWGFLELVNHGISHELMDTVEKLTKEHYKKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRFKEMVA KGL+AVQTEI+DLDWE TFFLKHLPVSNIS++PDL+  YRKVMKEFA +
Sbjct  61   MEQRFKEMVANKGLEAVQTEIDDLDWEITFFLKHLPVSNISDVPDLDHDYRKVMKEFAQK  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LEKLAE+LLDLLCENLGLE+GYLKKAF G+KGP FGTKV+NYPPCPK
Sbjct  121  LEKLAEDLLDLLCENLGLEQGYLKKAFYGTKGPTFGTKVANYPPCPK  167



>ref|XP_002316589.1| aminocyclopropane carboxylate oxidase family protein [Populus 
trichocarpa]
 gb|EEE97201.1| aminocyclopropane carboxylate oxidase family protein [Populus 
trichocarpa]
Length=318

 Score =   247 bits (630),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 133/167 (80%), Positives = 155/167 (93%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M SFP+I+L++LN EER   ME+I+DACENWGFFELV+HGIS +L+DTVE+ TK+HY+KC
Sbjct  1    MESFPVIDLSKLNGEERKPTMEKIEDACENWGFFELVNHGISHDLLDTVERRTKEHYRKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRFKEMVA+KGL+ VQ+EI+DLDWESTFFL+HLP SN++EIPDLE+ YRKVMKEFA+E
Sbjct  61   MEQRFKEMVASKGLEGVQSEISDLDWESTFFLRHLPESNMAEIPDLEEDYRKVMKEFALE  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            +EKLAE LLDLLCENLGLEKGYLKKAF GSKGPNFGTKVSNYPPCPK
Sbjct  121  VEKLAEQLLDLLCENLGLEKGYLKKAFYGSKGPNFGTKVSNYPPCPK  167



>gb|AAK07883.1|AF315316_1 ACC oxidase [Vigna radiata]
 gb|AAC48921.1| 1-aminocylopropane-1-carboxylate oxidase homolog [Vigna radiata]
 prf||2102361A aminocyclopropane carboxylate oxidase
Length=317

 Score =   247 bits (630),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 135/166 (81%), Positives = 152/166 (92%), Gaps = 0/166 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            MA+FP++++ +LNTEER   ME IKDACENWGFFELV+HGISIELMDTVEKLTK+HYKK 
Sbjct  1    MANFPVVDMGKLNTEERGTAMEMIKDACENWGFFELVNHGISIELMDTVEKLTKEHYKKT  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRFKEMVA KGL++VQ+EINDLDWESTFFL+HLPVSN+SE  DL+  YRK+MK+FA E
Sbjct  61   MEQRFKEMVANKGLESVQSEINDLDWESTFFLRHLPVSNVSENTDLDQDYRKIMKQFAEE  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCP  584
            LEKLAE+LLDLLCENLGLEKGYLKK F GSKGPNFGTKVSNYPPCP
Sbjct  121  LEKLAEHLLDLLCENLGLEKGYLKKVFYGSKGPNFGTKVSNYPPCP  166



>gb|AAC48922.1| 1-aminocyclopropane-1-carboxylate oxidase homolog [Vigna radiata]
Length=308

 Score =   246 bits (628),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 129/163 (79%), Positives = 152/163 (93%), Gaps = 0/163 (0%)
 Frame = +3

Query  99   PIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKCMEQR  278
            P++++  LN EER A ME+IKDACENWGFFE+V+HGISIELMD+V++LTK+HYK+CME+R
Sbjct  1    PVVDMKNLNNEERGATMEKIKDACENWGFFEVVNHGISIELMDSVDRLTKEHYKRCMEER  60

Query  279  FKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMelekl  458
            FKEMVA+KGL+  ++EINDLDWESTFFL+HLPVSNISEIPDL D YRKVMK+FA+ELEKL
Sbjct  61   FKEMVASKGLECAESEINDLDWESTFFLRHLPVSNISEIPDLADDYRKVMKDFAVELEKL  120

Query  459  aenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            AE +L+L+CENLGLEKGYLKKAF GSKGPNFGTKVSNYPPCPK
Sbjct  121  AELVLELVCENLGLEKGYLKKAFYGSKGPNFGTKVSNYPPCPK  163



>gb|AEM62881.1| ACC oxidase 4 [Actinidia chinensis]
Length=317

 Score =   246 bits (629),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 136/166 (82%), Positives = 148/166 (89%), Gaps = 0/166 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M +FPII++ +LN EER A ME IKDACENWGFFEL++HGIS ELMDTVE LTK HYKKC
Sbjct  1    MEAFPIIDMEKLNGEERAATMEVIKDACENWGFFELMNHGISHELMDTVEMLTKGHYKKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRFKEMVA KGL+AVQ+EINDLDWESTFFL+HLPVSNI EIPDLE+ YRK MKEFA +
Sbjct  61   MEQRFKEMVANKGLEAVQSEINDLDWESTFFLRHLPVSNIFEIPDLEEDYRKTMKEFAEK  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCP  584
            LEKLAE LLDLLCENL +EKGYLKKAF GSKGP FGTKVSNYPPCP
Sbjct  121  LEKLAEQLLDLLCENLEIEKGYLKKAFYGSKGPTFGTKVSNYPPCP  166



>gb|AEM62882.1| ACC oxidase 4 [Actinidia deliciosa]
Length=317

 Score =   246 bits (629),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 136/166 (82%), Positives = 148/166 (89%), Gaps = 0/166 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M +FPII++ +LN EER A ME IKDACENWGFFEL++HGIS ELMDTVE LTK HYKKC
Sbjct  1    MEAFPIIDMEKLNGEERAATMEVIKDACENWGFFELMNHGISHELMDTVEMLTKGHYKKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRFKEMVA KGL+AVQ+EINDLDWESTFFL+HLPVSNI EIPDLE+ YRK MKEFA +
Sbjct  61   MEQRFKEMVANKGLEAVQSEINDLDWESTFFLRHLPVSNIFEIPDLEEDYRKTMKEFAEK  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCP  584
            LEKLAE LLDLLCENL +EKGYLKKAF GSKGP FGTKVSNYPPCP
Sbjct  121  LEKLAEQLLDLLCENLEIEKGYLKKAFYGSKGPTFGTKVSNYPPCP  166



>gb|ACU24032.1| unknown [Glycine max]
Length=318

 Score =   246 bits (629),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 133/166 (80%), Positives = 154/166 (93%), Gaps = 0/166 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            MA+FP++++ +LNTEER A ME IKDACENWGFFELV+HGISIELMDTVE+LTK++YKK 
Sbjct  1    MANFPVVDMGKLNTEERAAAMEIIKDACENWGFFELVNHGISIELMDTVERLTKEYYKKT  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRFKEMVA+KGL++VQ+EINDLDWESTFFL+HLPVSN+S+  DL++ YRK MK+FA+E
Sbjct  61   MEQRFKEMVASKGLESVQSEINDLDWESTFFLRHLPVSNVSDNSDLDEGYRKTMKKFALE  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCP  584
            LEKLAE LLDLLCENLGLEKGYLKK F GSKGPNFGTKVSNYPPCP
Sbjct  121  LEKLAEQLLDLLCENLGLEKGYLKKVFYGSKGPNFGTKVSNYPPCP  166



>gb|AAC98808.1| ACC oxidase [Carica papaya]
 emb|CAE53415.1| 1-aminocyclopropane-1-carboxylate oxidase [Carica papaya]
 emb|CAH68522.1| 1-aminocyclopropane-1-carboxylate oxidase [Carica papaya]
Length=318

 Score =   246 bits (628),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 131/167 (78%), Positives = 150/167 (90%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M +FP+I+L++LN EER + ME I DACENWGFFELV+HGIS +LMDTVE+LTK+HYKKC
Sbjct  1    MENFPVIDLSKLNGEERASTMELIHDACENWGFFELVNHGISHDLMDTVERLTKEHYKKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRFKEMV + GL+AVQ+EIND+DWESTFFL+HLP SN+ EIPDLED YRK MKEFA+ 
Sbjct  61   MEQRFKEMVESNGLEAVQSEINDMDWESTFFLRHLPASNMHEIPDLEDDYRKAMKEFAVG  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            L+KLAE +LDLLCENLGLEKGYLKK F GSKGPNFGTKVSNYPPCPK
Sbjct  121  LQKLAEQMLDLLCENLGLEKGYLKKVFYGSKGPNFGTKVSNYPPCPK  167



>gb|KHG24528.1| 1-aminocyclopropane-1-carboxylate oxidase [Gossypium arboreum]
Length=288

 Score =   245 bits (626),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 133/165 (81%), Positives = 151/165 (92%), Gaps = 0/165 (0%)
 Frame = +3

Query  93   SFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKCME  272
            +FP+I+ ++LN EER A ME IKDACENWGFFELV+HGIS ELM+TVE+LTK+HY+KCME
Sbjct  4    TFPVIDFSKLNGEERAAAMEMIKDACENWGFFELVNHGISHELMETVERLTKEHYRKCME  63

Query  273  QRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMele  452
            QRFKEMV +KGL+AVQ+EIND+DWESTFFL+HLP SN+SEIPDLE+ YRKVMKEFA+ELE
Sbjct  64   QRFKEMVVSKGLEAVQSEINDMDWESTFFLRHLPESNMSEIPDLEEDYRKVMKEFAVELE  123

Query  453  klaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            KLAE LLDLLCENLGLE GYLKK F GSKGP FGTKVSNYPPCPK
Sbjct  124  KLAEQLLDLLCENLGLEPGYLKKVFYGSKGPTFGTKVSNYPPCPK  168



>ref|NP_001233867.1| 1-aminocyclopropane-1-carboxylate oxidase [Solanum lycopersicum]
 dbj|BAA34924.1| 1-aminocyclopropane-1-carboxylate oxidase [Solanum lycopersicum]
Length=320

 Score =   246 bits (628),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 133/166 (80%), Positives = 153/166 (92%), Gaps = 0/166 (0%)
 Frame = +3

Query  90   ASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKCM  269
            ++FP++++  L TE+RP  M++IKDACENWGFFELV+HGIS EL+D VE LTK HYKKCM
Sbjct  3    SNFPVVDMGLLQTEKRPEAMDKIKDACENWGFFELVNHGISHELLDAVENLTKGHYKKCM  62

Query  270  EQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMel  449
            EQRFKEMVA+KGL+AVQTEI+DLDWESTFFLKHLPVSN+ E+PDL+D YRKVMK+FA++L
Sbjct  63   EQRFKEMVASKGLEAVQTEIDDLDWESTFFLKHLPVSNVYEVPDLDDEYRKVMKDFALKL  122

Query  450  eklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            EKLAENLLDLLCENLGLEKGYLKKAF GSKGP FGTKVSNYPPCPK
Sbjct  123  EKLAENLLDLLCENLGLEKGYLKKAFYGSKGPTFGTKVSNYPPCPK  168



>dbj|BAH80550.1| 1-aminocyclopropane-1-carboxylate oxidase [Eucalyptus grandis]
Length=271

 Score =   244 bits (623),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 130/167 (78%), Positives = 151/167 (90%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M SFP+IN+  LN E+R   M++IKDACENWGFFELV+HGI  ELMDTVE++TK+HYKKC
Sbjct  1    MESFPVINMENLNGEKRAITMDKIKDACENWGFFELVNHGIPPELMDTVERMTKEHYKKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRF+E+VA+KGL+ VQTE++DLDWESTF LKHLPVSNIS+IPDL+D YRKVMKEFA++
Sbjct  61   MEQRFRELVASKGLEYVQTEVHDLDWESTFHLKHLPVSNISQIPDLDDDYRKVMKEFAVK  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LEKLAE L+D+LCENLGLEKGYLKK F GS GPNFGTKVSNYPPCPK
Sbjct  121  LEKLAEELMDMLCENLGLEKGYLKKVFHGSNGPNFGTKVSNYPPCPK  167



>gb|EYU27738.1| hypothetical protein MIMGU_mgv1a010275mg [Erythranthe guttata]
Length=317

 Score =   246 bits (627),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 133/167 (80%), Positives = 149/167 (89%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            MA+FP++N+ +LN +ER A ME I+DAC NWGFFELV+HGIS E MD VEKLTK+HY+K 
Sbjct  1    MATFPVVNMEKLNGDERSATMELIEDACANWGFFELVNHGISPEFMDRVEKLTKEHYRKS  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            ME RFKEMVA+KGLDAVQ+EI DLDWESTFFL+HLP+SNISE+PDLED YRKVMKEFA +
Sbjct  61   MEARFKEMVASKGLDAVQSEIEDLDWESTFFLRHLPISNISEVPDLEDEYRKVMKEFAGK  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LE LAE LLDLLCENLGLEKGYLKKAF GSKGP FGTKVSNYPPCPK
Sbjct  121  LEVLAEKLLDLLCENLGLEKGYLKKAFYGSKGPTFGTKVSNYPPCPK  167



>emb|CAA60576.1| 1-aminocyclopropane-1-carboxylate oxidase [Pyrus communis]
Length=313

 Score =   246 bits (627),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 135/167 (81%), Positives = 154/167 (92%), Gaps = 1/167 (1%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            MA+FP+++L+ +N EER A +E+I DACENWGFFELV+HG+S EL+DTVEK+TKDHYKK 
Sbjct  1    MATFPVVDLSLVNGEERVATLEKINDACENWGFFELVNHGMSTELLDTVEKMTKDHYKKT  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRFKEMVAAKGLDAVQ++I+DLDWESTFFL+HLP SNISE+PDLE+ YRK MKEFA+E
Sbjct  61   MEQRFKEMVAAKGLDAVQSDIHDLDWESTFFLRHLP-SNISEVPDLEEDYRKTMKEFAVE  119

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LEKLAE LLDLLCENLGLEKGYLKK F GSKGPNFGTKVSNYPPCPK
Sbjct  120  LEKLAEKLLDLLCENLGLEKGYLKKVFYGSKGPNFGTKVSNYPPCPK  166



>ref|XP_006449820.1| hypothetical protein CICLE_v10015965mg [Citrus clementina]
 ref|XP_006467364.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase-like [Citrus 
sinensis]
 gb|ESR63060.1| hypothetical protein CICLE_v10015965mg [Citrus clementina]
 gb|KDO78384.1| hypothetical protein CISIN_1g018920mg [Citrus sinensis]
Length=318

 Score =   245 bits (626),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 130/167 (78%), Positives = 153/167 (92%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M +FPII+L++LN +ER A ME I DACENWGFFELV+HGIS EL+DTV++LTK+HY KC
Sbjct  1    MENFPIIDLSKLNGDERSATMEMINDACENWGFFELVNHGISHELLDTVQRLTKEHYGKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            M+QRFK+MVA+KGL+AVQ+E+NDLDWESTFFL+HLPVSN++EIPDLED YRK MKEFA+E
Sbjct  61   MDQRFKQMVASKGLEAVQSEVNDLDWESTFFLRHLPVSNMAEIPDLEDDYRKAMKEFAVE  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LEK+AE LL+LLCENLGLE+GYLKK F GSKGP FGTKVSNYPPCPK
Sbjct  121  LEKVAEQLLELLCENLGLEEGYLKKVFYGSKGPTFGTKVSNYPPCPK  167



>ref|NP_001267871.1| aconitase 2, mitochondrial [Vitis vinifera]
 gb|AFU66005.1| 1-aminocyclopropane-1-carboxylic acid oxidase 2 [Vitis vinifera]
Length=318

 Score =   245 bits (626),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 133/167 (80%), Positives = 149/167 (89%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M +FP+IN+  LN EER A ME IKDACENWGFFELV+HGIS E MD VEKLTK HY+KC
Sbjct  1    MEAFPVINMEMLNGEERGATMEMIKDACENWGFFELVNHGISHEQMDAVEKLTKGHYRKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRFKE+VAAK L+ VQTEI D+DWESTFFL+HLPVSN+S+ PDL++ YRKVMK+FA++
Sbjct  61   MEQRFKELVAAKALEGVQTEIKDMDWESTFFLRHLPVSNVSDFPDLDEEYRKVMKDFALK  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LEKLAE LLDLLCENLGLEKGYLKKAF GSKGPNFGTKVSNYPPCPK
Sbjct  121  LEKLAEELLDLLCENLGLEKGYLKKAFHGSKGPNFGTKVSNYPPCPK  167



>emb|CAJ56066.1| ACC oxidase [Vigna radiata]
Length=317

 Score =   245 bits (626),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 135/166 (81%), Positives = 152/166 (92%), Gaps = 0/166 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            MA+FP++++ +LNTEER A ME IKDACENWGFFELV+HGISIELMDTVEKLTK+HYKK 
Sbjct  1    MANFPVVDMGKLNTEERGAAMEMIKDACENWGFFELVNHGISIELMDTVEKLTKEHYKKT  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRFKEMVA KGL++VQ+EINDLDWESTFFL+HLPVSN+SE  DL+  YRK+MK+FA E
Sbjct  61   MEQRFKEMVANKGLESVQSEINDLDWESTFFLRHLPVSNVSENTDLDQDYRKIMKQFAEE  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCP  584
            LEKLAE+LLDLLCENLGLEK YLKK F GSKGPNFGTKVSNYPPCP
Sbjct  121  LEKLAEHLLDLLCENLGLEKRYLKKVFYGSKGPNFGTKVSNYPPCP  166



>sp|O48882.1|ACCO2_MALDO RecName: Full=1-aminocyclopropane-1-carboxylate oxidase 2; Short=ACC 
oxidase 2; AltName: Full=Ethylene-forming enzyme; Short=EFE 
[Malus domestica]
 gb|AAB94031.1| 1-aminocyclopropane-1-carboxylate oxidase [Malus domestica]
Length=330

 Score =   246 bits (627),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 135/167 (81%), Positives = 152/167 (91%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            MA+FP++++  +N EER A +E+I DACENWGFFELV+HGIS EL+DTVEK+ KDHYKK 
Sbjct  1    MATFPVVDMDLINGEERAATLEKINDACENWGFFELVNHGISTELLDTVEKMNKDHYKKT  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRFKEMVAAKGL+AVQ+EI+ LDWESTFFL+HLP SNISEIPDLE+ YRK MKEFA+E
Sbjct  61   MEQRFKEMVAAKGLEAVQSEIHYLDWESTFFLRHLPSSNISEIPDLEEDYRKTMKEFAVE  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LEKLAE LLDLLCENLGLEKGYLKKAF GSKGPNFGTKVSNYPPCPK
Sbjct  121  LEKLAEKLLDLLCENLGLEKGYLKKAFYGSKGPNFGTKVSNYPPCPK  167



>gb|AFK45850.1| unknown [Lotus japonicus]
Length=318

 Score =   245 bits (626),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 133/167 (80%), Positives = 153/167 (92%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            MA+FP++++++LNTEER A ME IKD CENWGFFELV+H IS E MDTVE+LTK+HYK+ 
Sbjct  1    MANFPVVDMSKLNTEERVATMELIKDVCENWGFFELVNHEISTEFMDTVERLTKEHYKRF  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRFKEMVA KGL+ VQ+EI+DLDWESTFFL+HLP SNISE+PDL++ YRKVMKEFA++
Sbjct  61   MEQRFKEMVATKGLETVQSEIDDLDWESTFFLRHLPSSNISEVPDLDEDYRKVMKEFAVK  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LEKLAENLLDLLCENLGLEKGYLKK F GSKGPNFGTKVSNYPPCPK
Sbjct  121  LEKLAENLLDLLCENLGLEKGYLKKVFYGSKGPNFGTKVSNYPPCPK  167



>gb|KHG24527.1| 1-aminocyclopropane-1-carboxylate oxidase [Gossypium arboreum]
Length=302

 Score =   244 bits (624),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 133/165 (81%), Positives = 151/165 (92%), Gaps = 0/165 (0%)
 Frame = +3

Query  93   SFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKCME  272
            +FP+I+ ++LN EER A ME IKDACENWGFFELV+HGIS ELM+TVE+LTK+HY+KCME
Sbjct  4    TFPVIDFSKLNGEERAAAMEMIKDACENWGFFELVNHGISHELMETVERLTKEHYRKCME  63

Query  273  QRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMele  452
            QRFKEMV +KGL+AVQ+EIND+DWESTFFL+HLP SN+SEIPDLE+ YRKVMKEFA+ELE
Sbjct  64   QRFKEMVVSKGLEAVQSEINDMDWESTFFLRHLPESNMSEIPDLEEDYRKVMKEFAVELE  123

Query  453  klaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            KLAE LLDLLCENLGLE GYLKK F GSKGP FGTKVSNYPPCPK
Sbjct  124  KLAEQLLDLLCENLGLEPGYLKKVFYGSKGPTFGTKVSNYPPCPK  168



>gb|AGF95124.1| 1-aminocyclopropane-1-carboxylate oxidase, partial [Prunus persica]
Length=335

 Score =   245 bits (626),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 129/170 (76%), Positives = 152/170 (89%), Gaps = 0/170 (0%)
 Frame = +3

Query  75   RQRKMASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDH  254
            R+R+M +FPIINL  LN E R A ME+IKDACENWGFFELV HGI  E +DTVE+LTK+H
Sbjct  13   REREMENFPIINLEGLNGEGRKATMEKIKDACENWGFFELVSHGIPTEFLDTVERLTKEH  72

Query  255  YKKCMEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKE  434
            Y++C+EQRFKE+VA+KGL+AV+TE+ND+DWESTF+L+HLP SNISE+PDLED YR VMKE
Sbjct  73   YRQCLEQRFKELVASKGLEAVKTEVNDMDWESTFYLRHLPKSNISEVPDLEDQYRNVMKE  132

Query  435  FAMeleklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCP  584
            FA++LEKLAE LLDLLCENLGLE+GYLKKAF G+ GP FGTKVSNYPPCP
Sbjct  133  FALKLEKLAEQLLDLLCENLGLEQGYLKKAFYGTNGPTFGTKVSNYPPCP  182



>gb|AGG20315.1| 1-aminocyclopropane-1-carboxylate oxidase 4 [Capsicum annuum]
Length=320

 Score =   245 bits (625),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 133/165 (81%), Positives = 149/165 (90%), Gaps = 0/165 (0%)
 Frame = +3

Query  93   SFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKCME  272
            +FP++++  L TE+R   M++IKDACENWGFFELVDHGIS EL+D VE  TK HYKKCME
Sbjct  4    TFPVVDMGLLQTEKRAETMDKIKDACENWGFFELVDHGISHELLDAVENFTKGHYKKCME  63

Query  273  QRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMele  452
            QRFKEMVA+KGL+AVQTEINDLDWESTFFLKHLPVSN+ E+PDL+D YR VMKEFA++LE
Sbjct  64   QRFKEMVASKGLEAVQTEINDLDWESTFFLKHLPVSNVYEVPDLDDEYRNVMKEFALKLE  123

Query  453  klaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            KLAENLLDLLCENLGLEKGYLKKAF GSKGP FGTKVSNYPPCPK
Sbjct  124  KLAENLLDLLCENLGLEKGYLKKAFYGSKGPTFGTKVSNYPPCPK  168



>ref|XP_009609240.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase-like [Nicotiana 
tomentosiformis]
Length=316

 Score =   244 bits (624),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 132/167 (79%), Positives = 149/167 (89%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M +FP++N+  LNTE+R A ME IKDACENWGFFE+V HGI  EL+D VEKLTK HY KC
Sbjct  1    METFPVVNMELLNTEQRAATMETIKDACENWGFFEVVKHGICHELLDRVEKLTKGHYNKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            ME+RFKEMVA+KGL+AVQTEI DLDWESTFFLKHLP+SNIS++PDLED YRK+MKEFA +
Sbjct  61   MEERFKEMVASKGLEAVQTEIKDLDWESTFFLKHLPLSNISQVPDLEDEYRKIMKEFADK  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LEKLAE LL+LLCENLGLE+GYLKKAF GSKGP FGTKVSNYPPCPK
Sbjct  121  LEKLAEQLLELLCENLGLEQGYLKKAFYGSKGPTFGTKVSNYPPCPK  167



>ref|XP_010035505.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase 1-like [Eucalyptus 
grandis]
 gb|KCW46926.1| hypothetical protein EUGRSUZ_K00740 [Eucalyptus grandis]
Length=320

 Score =   245 bits (625),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 132/167 (79%), Positives = 151/167 (90%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M SFP+IN+  LN EER   M++IKDACENWGFFELV+HGI  ELMDTVE++TK HYKKC
Sbjct  1    MESFPVINIENLNGEERAITMDKIKDACENWGFFELVNHGIPPELMDTVERMTKGHYKKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRF+E+VA+KGL+ V+TE++DLDWESTF LKHLPVSNI +IPDL+D YRKVMKEFA++
Sbjct  61   MEQRFRELVASKGLEYVETEVHDLDWESTFHLKHLPVSNIYQIPDLDDDYRKVMKEFAVK  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LEKLAE L+DLLCENLGLEKGYLKKAF GSKGPNFGTKVSNYPPCPK
Sbjct  121  LEKLAEELMDLLCENLGLEKGYLKKAFHGSKGPNFGTKVSNYPPCPK  167



>ref|XP_007147675.1| hypothetical protein PHAVU_006G144900g [Phaseolus vulgaris]
 gb|ESW19669.1| hypothetical protein PHAVU_006G144900g [Phaseolus vulgaris]
Length=317

 Score =   244 bits (624),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 132/166 (80%), Positives = 153/166 (92%), Gaps = 0/166 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            MA+FP++++ +LNTEER A ME IKDACENWGF ELV+HGISIELMDTVE+ TK+HYKK 
Sbjct  1    MANFPVVDMEKLNTEERGAAMETIKDACENWGFLELVNHGISIELMDTVERFTKEHYKKT  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRFKEMVA KGL++V++EINDLDWESTFFL+HLPVSN+SE  DL++ YRK+MK+FA+E
Sbjct  61   MEQRFKEMVANKGLESVESEINDLDWESTFFLRHLPVSNVSENADLDEDYRKIMKQFALE  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCP  584
            LEKLAE+LLDLLCENLGLEKGYLKK F GSKGPNFGTKVSNYPPCP
Sbjct  121  LEKLAEHLLDLLCENLGLEKGYLKKVFYGSKGPNFGTKVSNYPPCP  166



>gb|ACJ84384.1| unknown [Medicago truncatula]
Length=203

 Score =   241 bits (614),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 130/167 (78%), Positives = 148/167 (89%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M +FPIINL  LN +ER A ME+IKDACENWGFFELV+HGI  +LMDTVE+LTK+HY+KC
Sbjct  1    MDNFPIINLENLNGDERKATMEKIKDACENWGFFELVNHGIPHDLMDTVERLTKEHYRKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRFKE+V++KGL+AVQTE+ D+DWESTF L+HLP SNISEIPDL D YRK MKEFA++
Sbjct  61   MEQRFKELVSSKGLEAVQTEVKDMDWESTFHLRHLPESNISEIPDLSDEYRKSMKEFALK  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LE LAE LLDLLCENLGLEKGYLKKA  GSKGP FGTKV+NYPPCPK
Sbjct  121  LETLAEELLDLLCENLGLEKGYLKKALYGSKGPTFGTKVTNYPPCPK  167



>emb|CDP21175.1| unnamed protein product, partial [Coffea canephora]
Length=174

 Score =   239 bits (611),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 128/167 (77%), Positives = 148/167 (89%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M +FP+IN+  LN ++R + ME IKDACENWGFFELV+HGI  E+MDTVE+LTK HYKKC
Sbjct  1    MENFPVINMKNLNGDKRASTMEHIKDACENWGFFELVNHGIPHEMMDTVERLTKGHYKKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRFKE+VA+K L+ VQ EI D+DWESTFFL+HLPVSNIS++PDL++ YR +MKEFA+ 
Sbjct  61   MEQRFKELVASKALEGVQVEITDMDWESTFFLRHLPVSNISQVPDLDNEYRTIMKEFAVR  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LEKLAE LLDLLCENLGLEKGYLKKAF GSKGPNFGTKVSNYPPCPK
Sbjct  121  LEKLAEELLDLLCENLGLEKGYLKKAFYGSKGPNFGTKVSNYPPCPK  167



>ref|XP_007026207.1| Ethylene-forming enzyme [Theobroma cacao]
 gb|EOY28829.1| Ethylene-forming enzyme [Theobroma cacao]
Length=319

 Score =   244 bits (624),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 132/166 (80%), Positives = 151/166 (91%), Gaps = 0/166 (0%)
 Frame = +3

Query  90   ASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKCM  269
             +FP+I+ ++L+ EER A ME IKDACENWGFFEL++HGIS EL+DTVE+LTK+HY+KCM
Sbjct  3    TTFPVIDFSKLDGEERGATMEMIKDACENWGFFELMNHGISHELLDTVERLTKEHYRKCM  62

Query  270  EQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMel  449
            EQRFKEMVA+KGL+AVQ EINDLDWESTFFL+HLP SNISEIPDLE+ YRKVMKEFA+EL
Sbjct  63   EQRFKEMVASKGLEAVQFEINDLDWESTFFLRHLPESNISEIPDLEEEYRKVMKEFAVEL  122

Query  450  eklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            EKLAE LL+LLCENLGLEKGYLK  F GS+GP FGTKVSNYPPCPK
Sbjct  123  EKLAEQLLNLLCENLGLEKGYLKNVFYGSRGPTFGTKVSNYPPCPK  168



>gb|AAF64528.1|AF254125_1 ACC oxidase [Carica papaya]
Length=318

 Score =   244 bits (624),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 130/167 (78%), Positives = 149/167 (89%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M +FP+I+L++LN EER + ME I DACENWGFFELV+HGIS +LMDTVE+LTK+HYKKC
Sbjct  1    MENFPVIDLSKLNGEERASTMELIHDACENWGFFELVNHGISHDLMDTVERLTKEHYKKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRFKEMV + GL+AVQ+EIND+DWESTFFL+HLP SN+ EIPDLED YRK MKEFA+ 
Sbjct  61   MEQRFKEMVESNGLEAVQSEINDMDWESTFFLRHLPASNMHEIPDLEDDYRKAMKEFAVG  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            L+KLAE +LDLLCENLGLEKGYLKK F GSKGPNFGTKV NYPPCPK
Sbjct  121  LQKLAEQMLDLLCENLGLEKGYLKKVFYGSKGPNFGTKVRNYPPCPK  167



>ref|XP_009630256.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase 1 [Nicotiana 
tomentosiformis]
Length=319

 Score =   244 bits (624),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 130/167 (78%), Positives = 145/167 (87%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M +FPIINL +LN  ER A ME IKDACENWGFFELV+HGI  E+MDTVEKLTK HYKKC
Sbjct  1    MENFPIINLEKLNGSERAATMEMIKDACENWGFFELVNHGIPHEVMDTVEKLTKGHYKKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRFKE+VA+KGL+ VQ E+ D+DWESTFFL+HLPVSNISE+PDL+D YR+VM++FA  
Sbjct  61   MEQRFKELVASKGLEGVQAEVTDMDWESTFFLRHLPVSNISEVPDLDDQYREVMRDFAKR  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LE LAE LL LLCENLGLEKGYLK  F GSKGPNFGTKVSNYPPCPK
Sbjct  121  LENLAEELLYLLCENLGLEKGYLKNVFYGSKGPNFGTKVSNYPPCPK  167



>gb|AEM62883.1| ACC oxidase 5 [Actinidia chinensis]
Length=318

 Score =   244 bits (623),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 128/167 (77%), Positives = 150/167 (90%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M +FP+IN+ +LN E+R A ME I DACENWGFFELV+HGISIEL+D VE++TK+HYKKC
Sbjct  1    METFPVINMQKLNGEQRGATMELINDACENWGFFELVNHGISIELLDRVERMTKEHYKKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRFKE+VA+K L+ VQ E+  +DWESTFFL+HLP SNISE+PDL+D YRKVMKEFA++
Sbjct  61   MEQRFKELVASKALEGVQAEVTTMDWESTFFLRHLPQSNISEVPDLDDEYRKVMKEFALK  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LE LAE LLDLLCENLGLEKGYLKKAF+G+KGPNFGTKVSNYPPCPK
Sbjct  121  LENLAEELLDLLCENLGLEKGYLKKAFNGTKGPNFGTKVSNYPPCPK  167



>gb|EYU33867.1| hypothetical protein MIMGU_mgv1a010647mg [Erythranthe guttata]
Length=306

 Score =   244 bits (622),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 135/167 (81%), Positives = 147/167 (88%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            MASFP+IN+ +L+ EER A M  I DACENWGFFELV+HGI  E+MDTVEKLTKDHYKKC
Sbjct  1    MASFPVINMEKLHGEERGATMAMINDACENWGFFELVNHGIGREIMDTVEKLTKDHYKKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRFKEMVA  GL+ V++EI DLDWE+TFFL+HLP+SNISE  DLED YRKVMKEFA  
Sbjct  61   MEQRFKEMVAKTGLENVESEIKDLDWETTFFLRHLPLSNISEFHDLEDEYRKVMKEFAAR  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LEKLAE LLDLLCENLGLEKGYLKKAF GSKGPNFGTKVSNYPPCPK
Sbjct  121  LEKLAEELLDLLCENLGLEKGYLKKAFYGSKGPNFGTKVSNYPPCPK  167



>ref|XP_009789991.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase 3-like [Nicotiana 
sylvestris]
Length=319

 Score =   244 bits (622),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 132/167 (79%), Positives = 149/167 (89%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M  FPIINL +LN  ER AIM++IKDACENWGFFELV+HGI  E+MD VEKLTK HYKKC
Sbjct  1    MEKFPIINLEKLNGTERAAIMDKIKDACENWGFFELVNHGIPHEVMDRVEKLTKGHYKKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRFKE+VA+KGL+AVQ E+ DLDWESTFFL+HLPVSNIS++PDL+D YR+VM++FA  
Sbjct  61   MEQRFKELVASKGLEAVQAEVTDLDWESTFFLRHLPVSNISQVPDLDDEYREVMRDFAKR  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LEKLAE LLDLLCENLGLEKGYLKK F G+KGPNFGTKVSNYPPCPK
Sbjct  121  LEKLAEELLDLLCENLGLEKGYLKKVFFGTKGPNFGTKVSNYPPCPK  167



>ref|XP_006348170.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase-like [Solanum 
tuberosum]
Length=320

 Score =   244 bits (622),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 132/166 (80%), Positives = 153/166 (92%), Gaps = 0/166 (0%)
 Frame = +3

Query  90   ASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKCM  269
            ++FP++++  L TE+RP  M++IKDACENWGFFE+V+HGIS EL+DTVE LTK HYKKCM
Sbjct  3    SNFPVVDMGLLQTEKRPEAMDKIKDACENWGFFEVVNHGISHELLDTVENLTKGHYKKCM  62

Query  270  EQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMel  449
            EQRFKEMVA+KGL+AVQTEI+DLDWESTFFLKHLPVSN+ E+PDL+D YRKVMK+FA++L
Sbjct  63   EQRFKEMVASKGLEAVQTEIDDLDWESTFFLKHLPVSNVYEVPDLDDEYRKVMKDFALKL  122

Query  450  eklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            EKLAENLLDLLCENLGLEKGYLKKAF GSKG  FGTKVSNYPPCPK
Sbjct  123  EKLAENLLDLLCENLGLEKGYLKKAFYGSKGSTFGTKVSNYPPCPK  168



>ref|XP_004293334.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase 1 [Fragaria 
vesca subsp. vesca]
Length=312

 Score =   243 bits (621),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 132/167 (79%), Positives = 152/167 (91%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M +FP++N+ QLN E+R A ME+I DACENWGFFEL++HGIS ELMD VEKLTK+HY+KC
Sbjct  1    MENFPVVNMEQLNGEKRAATMEKINDACENWGFFELMNHGISHELMDKVEKLTKEHYRKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRFKEMVA+KGL+AV +EI DLDWESTFFL+HLP SNIS++PDL++ YR+ MKEFA+E
Sbjct  61   MEQRFKEMVASKGLEAVNSEIEDLDWESTFFLRHLPFSNISQVPDLDEDYREAMKEFAVE  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LEKLAE LLDLLCENLGLEKGYLKKAF GSKGPNFGTKVSNYPPCPK
Sbjct  121  LEKLAEQLLDLLCENLGLEKGYLKKAFYGSKGPNFGTKVSNYPPCPK  167



>gb|AEM62878.1| ACC oxidase 2 [Actinidia deliciosa]
Length=319

 Score =   243 bits (621),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 133/166 (80%), Positives = 150/166 (90%), Gaps = 0/166 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M +FP+I++ +L  +ER   ME+I DACENWGFFEL++HGIS ELMDTVE+LTK+HYKKC
Sbjct  1    METFPVIDMEKLTGKERSPTMEKINDACENWGFFELMNHGISHELMDTVERLTKEHYKKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRFKEMVA KGL+AVQ+EI+DLDWESTFFL+HLPVSNISEIPDLE  +RK MKEFA +
Sbjct  61   MEQRFKEMVATKGLEAVQSEIDDLDWESTFFLRHLPVSNISEIPDLEQDHRKAMKEFAEK  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCP  584
            LEKLAE LLDLLCENLGLEKGYLKKAFSGSKGP FGTKVSNYPPCP
Sbjct  121  LEKLAEQLLDLLCENLGLEKGYLKKAFSGSKGPTFGTKVSNYPPCP  166



>gb|AEM62884.1| ACC oxidase 5 [Actinidia deliciosa]
Length=318

 Score =   243 bits (621),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 128/167 (77%), Positives = 149/167 (89%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M +FP+IN+ +LN E+R A ME I DACENWGFFELV+HGISIEL+D VE++TK+HYKKC
Sbjct  1    METFPVINMEKLNGEQRGATMELINDACENWGFFELVNHGISIELLDRVERMTKEHYKKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRFKE+VA+K L+ VQ E+  +DWESTFFL+HLP SNISE+PDL+D YRKVMKEFA++
Sbjct  61   MEQRFKELVASKALEGVQAEVTTMDWESTFFLRHLPQSNISEVPDLDDEYRKVMKEFALK  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LE LAE LLDLLCENLGLEKGYLKKAF G+KGPNFGTKVSNYPPCPK
Sbjct  121  LENLAEELLDLLCENLGLEKGYLKKAFHGTKGPNFGTKVSNYPPCPK  167



>gb|AAL37174.1|AF320071_1 1-aminocyclopropane-1-carboxylate oxidase [Carica papaya]
Length=318

 Score =   243 bits (621),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 129/167 (77%), Positives = 148/167 (89%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M +FP+I+L++LN EER   ME I DACENWGFFELV+HGIS +LMDTVE+LTK+HY KC
Sbjct  1    MENFPVIDLSKLNGEERALTMELIHDACENWGFFELVNHGISHDLMDTVERLTKEHYMKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRFKEMV + GL+AVQ+EIND+DWESTFFL+HLP SN+ EIPDLED YRK MKEFA+ 
Sbjct  61   MEQRFKEMVESNGLEAVQSEINDMDWESTFFLRHLPASNMHEIPDLEDDYRKAMKEFAVG  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            L+KLAE +LDLLCENLGL+KGYLKK F GSKGPNFGTKVSNYPPCPK
Sbjct  121  LQKLAEQMLDLLCENLGLQKGYLKKVFYGSKGPNFGTKVSNYPPCPK  167



>ref|XP_009768154.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase 1 [Nicotiana 
sylvestris]
Length=319

 Score =   243 bits (621),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 131/167 (78%), Positives = 146/167 (87%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M +FPIINL +LN  E+ A ME IKDACENWGFFELV+HGI  E+MDTVEKLTK HYKKC
Sbjct  1    MENFPIINLEKLNGSEKAATMEMIKDACENWGFFELVNHGIPHEVMDTVEKLTKGHYKKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRFKE+VA+KGL+ VQ E+ D+DWESTFFL+HLPVSNISE+PDL+D YR+VMK+FA  
Sbjct  61   MEQRFKELVASKGLEGVQAEVTDMDWESTFFLRHLPVSNISEVPDLDDQYREVMKDFAKR  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LE LAE LLDLLCENLGLEKGYLK  F GSKGPNFGTKVSNYPPCPK
Sbjct  121  LENLAEELLDLLCENLGLEKGYLKNVFYGSKGPNFGTKVSNYPPCPK  167



>emb|CAH65725.1| 1-aminocyclopropane-1-carboxylate oxidase [Carica papaya]
Length=309

 Score =   243 bits (620),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 127/167 (76%), Positives = 151/167 (90%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M +FP+IN+  LN EER A M++I+DACENWGFFELV+HGI IEL+DTVE+LTK HY+KC
Sbjct  1    MENFPVINMEGLNGEERAATMKKIEDACENWGFFELVNHGIPIELLDTVERLTKGHYRKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRFKE++A+KGLD +QTE+ D+DWESTFF++HLP  NI+EIPDL+D YRKVMKEFA++
Sbjct  61   MEQRFKEIMASKGLDGIQTEVTDMDWESTFFIRHLPEPNIAEIPDLDDEYRKVMKEFALK  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LEK+AE LLDLLCENLGLEKGYLKKAF GS+GP FGTKVSNYPPCPK
Sbjct  121  LEKIAEELLDLLCENLGLEKGYLKKAFYGSRGPTFGTKVSNYPPCPK  167



>gb|AAL78058.1| ripening-induced ACC oxidase [Carica papaya]
Length=310

 Score =   243 bits (620),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 127/167 (76%), Positives = 151/167 (90%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M +FP+IN+  LN EER A M++I+DACENWGFFELV+HGI IEL+DTVE+LTK HY+KC
Sbjct  1    MENFPVINMEGLNGEERAATMKKIEDACENWGFFELVNHGIPIELLDTVERLTKGHYRKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRFKE++A+KGLD +QTE+ D+DWESTFF++HLP  NI+EIPDL+D YRKVMKEFA++
Sbjct  61   MEQRFKEIMASKGLDGIQTEVTDMDWESTFFIRHLPEPNIAEIPDLDDEYRKVMKEFALK  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LEK+AE LLDLLCENLGLEKGYLKKAF GS+GP FGTKVSNYPPCPK
Sbjct  121  LEKIAEELLDLLCENLGLEKGYLKKAFYGSRGPTFGTKVSNYPPCPK  167



>sp|Q08508.1|ACCO4_PETHY RecName: Full=1-aminocyclopropane-1-carboxylate oxidase 4; Short=ACC 
oxidase 4; AltName: Full=Ethylene-forming enzyme; Short=EFE 
[Petunia x hybrida]
 gb|AAA33698.1| 1-aminocyclopropane-1-carboxylate oxidase [Petunia x hybrida]
Length=319

 Score =   243 bits (620),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 134/167 (80%), Positives = 147/167 (88%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M +FPIINL  L   ER A ME IKDACENWGFFELV+HGI  E+MDTVEK TK HYKKC
Sbjct  1    MENFPIINLENLCGAERDATMEMIKDACENWGFFELVNHGIPHEVMDTVEKFTKGHYKKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRFKE+VA+KGL+AVQ E+ DLDWESTFFL+HLPVSNISE+PDL+D YR+VM++FA  
Sbjct  61   MEQRFKELVASKGLEAVQAEVTDLDWESTFFLRHLPVSNISEVPDLDDEYREVMRDFAKR  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LEKLAE LLDLLCENLGLEKGYLKKAF GSKGPNFGTKVSNYPPCPK
Sbjct  121  LEKLAEELLDLLCENLGLEKGYLKKAFYGSKGPNFGTKVSNYPPCPK  167



>gb|AAK57516.1| ACC oxidase [Carica papaya]
 gb|AAS16933.1| 1-aminocyclopropane-1-carboxylate oxidase 1 [Carica papaya]
 gb|AAT99444.1| ripening related ACC oxidase 1 [Carica papaya]
Length=318

 Score =   243 bits (620),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 130/167 (78%), Positives = 148/167 (89%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M +FP+I+L++LN EER   ME I DACENWGFFELV+HGIS +LMDTVE+LTK+HY KC
Sbjct  1    MENFPVIDLSKLNGEERALTMELIHDACENWGFFELVNHGISHDLMDTVERLTKEHYMKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRFKEMV + GL+AVQ+EIND+DWESTFFL+HLP SN+ EIPDLED YRK MKEFA+ 
Sbjct  61   MEQRFKEMVESNGLEAVQSEINDMDWESTFFLRHLPASNMHEIPDLEDDYRKAMKEFAVG  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            L+KLAE +LDLLCENLGLEKGYLKK F GSKGPNFGTKVSNYPPCPK
Sbjct  121  LQKLAEQMLDLLCENLGLEKGYLKKVFYGSKGPNFGTKVSNYPPCPK  167



>gb|AEM62879.1| ACC oxidase 3 [Actinidia chinensis]
Length=319

 Score =   243 bits (620),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 133/167 (80%), Positives = 151/167 (90%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M +FP+I++ +L  +ER   ME+I DACENWGFFEL++HGIS ELMDTVE+LTK+HYKKC
Sbjct  1    MEAFPVIDMEKLTGKERSPTMEKINDACENWGFFELMNHGISHELMDTVERLTKEHYKKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRFKEMVA KGL+AVQ+EI+DLDWESTFFL+HLPVSNISEIPDLE  +RK MKEFA +
Sbjct  61   MEQRFKEMVATKGLEAVQSEIDDLDWESTFFLRHLPVSNISEIPDLEQDHRKSMKEFAEK  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LEKLAE LLDLLCENLGLEKGYLKKAFSGSKGP FGTKVSNYPPCP+
Sbjct  121  LEKLAEQLLDLLCENLGLEKGYLKKAFSGSKGPTFGTKVSNYPPCPQ  167



>gb|AAA99793.1| 1-aminocyclopropane-1-carboxylic acid oxidase [Nicotiana glutinosa]
Length=316

 Score =   243 bits (619),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 131/167 (78%), Positives = 149/167 (89%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M SFP++N+  LN+E+R A ME IKDACENWGFFE+V+HGIS EL+DTVEK TK HY +C
Sbjct  1    MESFPVVNMELLNSEQRAATMETIKDACENWGFFEVVNHGISHELLDTVEKFTKGHYNEC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            ME+RFKEMVA+KGL+AVQTEI DLDWESTF+LKHLPVS IS++PDLED YRK+MKEFA +
Sbjct  61   MERRFKEMVASKGLEAVQTEIKDLDWESTFYLKHLPVSTISQVPDLEDEYRKIMKEFAEK  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LEKLAE LLDLLCENLGLE+GYLKKAF GS GP FGTKVSNYPPCPK
Sbjct  121  LEKLAEQLLDLLCENLGLEQGYLKKAFYGSNGPTFGTKVSNYPPCPK  167



>gb|AAA99792.1| 1-aminocyclopropane-1-carboxylic acid oxidase [Nicotiana glutinosa]
Length=320

 Score =   243 bits (619),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 133/167 (80%), Positives = 146/167 (87%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M +FPIINL +LN  ER   ME IKDACENWGFFELV+HGI  E+MDTVEKLTK HYKKC
Sbjct  1    MENFPIINLEKLNGSERADTMEMIKDACENWGFFELVNHGIPHEVMDTVEKLTKGHYKKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRFKE+VA KGL+AVQ E+ DLDWESTFFL+HLPVSNISE+PDL+D YR+VM++FA  
Sbjct  61   MEQRFKELVANKGLEAVQAEVTDLDWESTFFLRHLPVSNISEVPDLDDQYREVMRDFAKR  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LEKLAE LLDLLCENLGLEKGYLK  F GSKGPNFGTKVSNYPPCPK
Sbjct  121  LEKLAEELLDLLCENLGLEKGYLKNVFYGSKGPNFGTKVSNYPPCPK  167



>emb|CAN85573.1| ACC oxidase 2 [Hevea brasiliensis]
Length=318

 Score =   243 bits (619),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 129/164 (79%), Positives = 148/164 (90%), Gaps = 0/164 (0%)
 Frame = +3

Query  96   FPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKCMEQ  275
            FP+INL +LN EER A M +IKDACENWGFFEL++HGI  E MDTVE++TK HY+KCMEQ
Sbjct  3    FPVINLGKLNGEERAATMAKIKDACENWGFFELLNHGIEPEFMDTVERMTKGHYRKCMEQ  62

Query  276  RFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMelek  455
            RFKEMVA+KGL+ VQTEI D+DWESTFFL+HLP SNI+++PDL+D YRKVMK+FA +LEK
Sbjct  63   RFKEMVASKGLEGVQTEIKDMDWESTFFLRHLPESNIAQVPDLDDEYRKVMKDFAAKLEK  122

Query  456  laenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LAE LLDLLCENLGLEKGYLKKAF GS+GPNFGTKVSNYPPCPK
Sbjct  123  LAEELLDLLCENLGLEKGYLKKAFYGSRGPNFGTKVSNYPPCPK  166



>gb|KEH35231.1| 1-aminocyclopropane-1-carboxylate oxidase [Medicago truncatula]
Length=229

 Score =   239 bits (611),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 130/167 (78%), Positives = 148/167 (89%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M +FPIINL  LN +ER A ME+IKDACENWGFFELV+HGI  +LMDTVE+LTK+HY+KC
Sbjct  1    MDNFPIINLENLNGDERKATMEKIKDACENWGFFELVNHGIPHDLMDTVERLTKEHYRKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRFKE+V++KGL+AVQTE+ D+DWESTF L+HLP SNISEIPDL D YRK MKEFA++
Sbjct  61   MEQRFKELVSSKGLEAVQTEVKDMDWESTFHLRHLPESNISEIPDLSDEYRKSMKEFALK  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LE LAE LLDLLCENLGLEKGYLKKA  GSKGP FGTKV+NYPPCPK
Sbjct  121  LETLAEELLDLLCENLGLEKGYLKKALYGSKGPTFGTKVANYPPCPK  167



>ref|XP_010052892.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase [Eucalyptus 
grandis]
 gb|KCW77022.1| hypothetical protein EUGRSUZ_D01368 [Eucalyptus grandis]
Length=319

 Score =   243 bits (619),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 131/166 (79%), Positives = 150/166 (90%), Gaps = 0/166 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M  FP+INL +LN EER   ME I+DACENWGFFELV+HGIS ELMDTVE+LTK HYK+C
Sbjct  1    MEIFPVINLEKLNGEERGVTMEMIRDACENWGFFELVNHGISHELMDTVERLTKGHYKEC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            ME++FKEMVA+KGL+AVQ+EI D+DWESTFFL+HLPVSNISE+PDL++ YRKVM+EFA+E
Sbjct  61   MERKFKEMVASKGLEAVQSEIGDIDWESTFFLRHLPVSNISEVPDLKEDYRKVMREFALE  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCP  584
            +EKLAE LLDLLCENLGLEKGYLKK F GSKGP FGTKVSNYPPCP
Sbjct  121  IEKLAEQLLDLLCENLGLEKGYLKKVFYGSKGPTFGTKVSNYPPCP  166



>gb|ACS71641.1| ACC oxidase [Boea hygrometrica]
Length=317

 Score =   243 bits (619),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 132/167 (79%), Positives = 152/167 (91%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            MA+FP+IN+ +LN +ER A ME IKDACENWGFFELV+HGIS E MDTVE+LTK+HYKK 
Sbjct  1    MATFPVINMEKLNGDERSATMEIIKDACENWGFFELVNHGISPEFMDTVERLTKEHYKKT  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRFKEMV++KGL++VQ+EI DLDWESTF+L+HLPVSNI+EIPDLE  YR+V+KEF  +
Sbjct  61   MEQRFKEMVSSKGLESVQSEITDLDWESTFYLRHLPVSNITEIPDLEQEYRRVLKEFGEQ  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LEKLAENLLDLLCENLGLEKGYLKKAF G+KGP FGTKVSNYPPCPK
Sbjct  121  LEKLAENLLDLLCENLGLEKGYLKKAFYGAKGPTFGTKVSNYPPCPK  167



>emb|CAN68493.1| hypothetical protein VITISV_042552 [Vitis vinifera]
Length=307

 Score =   242 bits (618),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 132/167 (79%), Positives = 148/167 (89%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M +FP+IN+  LN EER A ME IKDACENWGFFELV+HGIS E MD VEKLTK HY+KC
Sbjct  1    MEAFPVINMEMLNGEERGATMEMIKDACENWGFFELVNHGISHEQMDAVEKLTKGHYRKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRFKE+VAAK L+ VQTEI D+DWESTFFL+HLPVSN+S+ PDL++ Y KVMK+FA++
Sbjct  61   MEQRFKELVAAKALEGVQTEIKDMDWESTFFLRHLPVSNVSDFPDLDEEYXKVMKDFALK  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LEKLAE LLDLLCENLGLEKGYLKKAF GSKGPNFGTKVSNYPPCPK
Sbjct  121  LEKLAEELLDLLCENLGLEKGYLKKAFHGSKGPNFGTKVSNYPPCPK  167



>emb|CAH64841.1| 1-aminocyclopropane-1-carboxylate oxidase [Carica papaya]
Length=318

 Score =   243 bits (619),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 129/167 (77%), Positives = 147/167 (88%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M +FP+I+L++LN EER   ME I DACENWGFFELV+HGIS +LMDTVE+LTK+HY KC
Sbjct  1    MENFPVIDLSKLNGEERALTMELIHDACENWGFFELVNHGISHDLMDTVERLTKEHYMKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRFKEMV + GL+AVQ+EIND+DWESTFFL+HLP SN+ EIPDLED YRK MKEFA+ 
Sbjct  61   MEQRFKEMVESNGLEAVQSEINDMDWESTFFLRHLPASNMHEIPDLEDDYRKAMKEFAVG  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            L+KLAE +LDLLCENLG EKGYLKK F GSKGPNFGTKVSNYPPCPK
Sbjct  121  LQKLAEQMLDLLCENLGFEKGYLKKVFYGSKGPNFGTKVSNYPPCPK  167



>gb|AAP41850.1| 1-aminocyclopropane-1-carboxylate oxidase [Hevea brasiliensis]
 emb|CAN85570.1| ACC oxidase 2 [Hevea brasiliensis]
Length=318

 Score =   243 bits (619),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 129/164 (79%), Positives = 148/164 (90%), Gaps = 0/164 (0%)
 Frame = +3

Query  96   FPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKCMEQ  275
            FP+INL +LN EER A M +IKDACENWGFFEL++HGI  E MDTVE++TK HY+KCMEQ
Sbjct  3    FPVINLGKLNGEERAATMAKIKDACENWGFFELLNHGIEPEFMDTVERMTKGHYRKCMEQ  62

Query  276  RFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMelek  455
            RFKEMVA+KGL+ VQTEI D+DWESTFFL+HLP SNI+++PDL+D YRKVMK+FA +LEK
Sbjct  63   RFKEMVASKGLEGVQTEIKDMDWESTFFLRHLPESNIAQVPDLDDEYRKVMKDFAAKLEK  122

Query  456  laenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LAE LLDLLCENLGLEKGYLKKAF GS+GPNFGTKVSNYPPCPK
Sbjct  123  LAEELLDLLCENLGLEKGYLKKAFYGSRGPNFGTKVSNYPPCPK  166



>ref|XP_010035513.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase 3-like [Eucalyptus 
grandis]
 gb|KCW46935.1| hypothetical protein EUGRSUZ_K00750 [Eucalyptus grandis]
Length=320

 Score =   243 bits (619),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 129/167 (77%), Positives = 150/167 (90%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M SFP+IN+  LN E+R   M++IKDACENWGFFELV+HGI  ELMDTVE++TK+HYKKC
Sbjct  1    MESFPVINMENLNGEKRAITMDKIKDACENWGFFELVNHGIPPELMDTVERMTKEHYKKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRF+E+VA+KGL+ VQTE++DLDWESTF LKHLPVSNIS+IPDL+D YRKVMKEFA++
Sbjct  61   MEQRFRELVASKGLEYVQTEVHDLDWESTFHLKHLPVSNISQIPDLDDDYRKVMKEFAVK  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LEKLAE L+D+LCENLGLEKGYLKK   GS GPNFGTKVSNYPPCPK
Sbjct  121  LEKLAEELMDMLCENLGLEKGYLKKVLYGSNGPNFGTKVSNYPPCPK  167



>emb|CDP04457.1| unnamed protein product [Coffea canephora]
Length=318

 Score =   242 bits (618),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 131/167 (78%), Positives = 153/167 (92%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            MA+FP+I++ +L+ EER A M  IKDACE+WGFFE+++HGIS E MDTVE+LTK+HYKKC
Sbjct  1    MATFPVIDMEKLDGEERAATMGVIKDACESWGFFEVLNHGISNEFMDTVERLTKEHYKKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            ME +FKEMV +KGL+AVQTEINDLDWESTFFL+HLPVSNISE+PDL+D YRKVMKEFA++
Sbjct  61   MELKFKEMVESKGLEAVQTEINDLDWESTFFLRHLPVSNISEVPDLDDEYRKVMKEFALQ  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LEKLAE LLDLLCENLGLEKGYLKKAF G+KGP FGTKVSNYPPCP+
Sbjct  121  LEKLAELLLDLLCENLGLEKGYLKKAFYGTKGPTFGTKVSNYPPCPR  167



>gb|AAD28197.2|AF115262_1 1-aminocyclopropane-1-carboxylate oxidase [Trifolium repens]
 gb|ABB97397.1| ACC oxidase [Trifolium repens]
Length=314

 Score =   242 bits (618),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 132/167 (79%), Positives = 149/167 (89%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M +FPIINL  LN EER A ME+IKDACENWGFFELV+HGIS +LMDTVE+LTK+HY+ C
Sbjct  1    MENFPIINLENLNGEERKATMEKIKDACENWGFFELVNHGISHDLMDTVERLTKEHYRIC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRFK++VA KGL+AVQTE+ D+DWESTF L+HLP SNISE+PDL D YRK MKEFA++
Sbjct  61   MEQRFKDLVANKGLEAVQTEVKDMDWESTFHLRHLPESNISEVPDLTDEYRKAMKEFALK  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LEKLAE LLDLLCENLGLEKGYLKKAF GSKGP FGTKV+NYPPCPK
Sbjct  121  LEKLAEELLDLLCENLGLEKGYLKKAFYGSKGPTFGTKVANYPPCPK  167



>gb|AEM62880.1| ACC oxidase 3 [Actinidia deliciosa]
Length=319

 Score =   242 bits (618),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 132/167 (79%), Positives = 151/167 (90%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M +FP+I++ +L  +ER   ME+I DACENWGFFEL++HGIS ELMDTVE+LTK+HYKKC
Sbjct  1    MEAFPVIDMEKLTGKERSPTMEKINDACENWGFFELMNHGISHELMDTVERLTKEHYKKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRFKEMVA KGL+A+Q+EI+DLDWESTFFL+HLPVSNISEIPDLE  +RK MKEFA +
Sbjct  61   MEQRFKEMVATKGLEALQSEIDDLDWESTFFLRHLPVSNISEIPDLEQDHRKAMKEFAEK  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LEKLAE LLDLLCENLGLEKGYLKKAFSGSKGP FGTKVSNYPPCP+
Sbjct  121  LEKLAEQLLDLLCENLGLEKGYLKKAFSGSKGPTFGTKVSNYPPCPQ  167



>emb|CAA58232.1| 1-amniocyclopropane-1-carboxylate oxidase [Nicotiana tabacum]
Length=308

 Score =   242 bits (617),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 133/156 (85%), Positives = 145/156 (93%), Gaps = 0/156 (0%)
 Frame = +3

Query  120  LNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKCMEQRFKEMVAA  299
            LNTE+R A ME IKDACENWGFFE+V+HGIS EL+DTVEKLTK HYKKCME+RFKEMVA+
Sbjct  4    LNTEQRAATMETIKDACENWGFFEVVNHGISHELLDTVEKLTKGHYKKCMEERFKEMVAS  63

Query  300  KGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMeleklaenlldl  479
            KGL+AVQTEI DLDWESTFFLKHLP+SNISE+PDLED YRK+MKEFA +LEKLAE LLDL
Sbjct  64   KGLEAVQTEIKDLDWESTFFLKHLPISNISEVPDLEDEYRKIMKEFAEKLEKLAEQLLDL  123

Query  480  lcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LCENLGLE+GYLKKAF GSKGP FGTKVSNYPPCPK
Sbjct  124  LCENLGLEQGYLKKAFYGSKGPTFGTKVSNYPPCPK  159



>emb|CAJ56067.1| ACC oxidase [Vigna radiata]
Length=317

 Score =   242 bits (617),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 132/166 (80%), Positives = 152/166 (92%), Gaps = 0/166 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            MA+FP++++ +LNTEER A ME IKDACENWGFFELV+HGISIELMDTVE+LTK+HYKK 
Sbjct  1    MANFPVVDMGKLNTEERGAAMEMIKDACENWGFFELVNHGISIELMDTVERLTKEHYKKT  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRFKEMVA KGL++VQ+EINDLDW+STFFL+HLPVSN+SE  DL+  YRK+MK+FA E
Sbjct  61   MEQRFKEMVANKGLESVQSEINDLDWDSTFFLRHLPVSNVSENTDLDQDYRKIMKQFAEE  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCP  584
            LEKLAE+LLDLLCENLGLEK YLK+ F GSKGPNFGTKVSNYPPCP
Sbjct  121  LEKLAEHLLDLLCENLGLEKRYLKQVFYGSKGPNFGTKVSNYPPCP  166



>ref|XP_010035506.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase 1-like [Eucalyptus 
grandis]
Length=320

 Score =   242 bits (618),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 131/167 (78%), Positives = 150/167 (90%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M +FP IN+  LN E+R   M++IKDACENWGFFELV+HGI  ELMDTVE++TK HYKKC
Sbjct  1    MENFPAINMENLNGEQRAITMDKIKDACENWGFFELVNHGIPPELMDTVERMTKGHYKKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRFKE+VA+KGL+ V+TE++DLDWESTF LKHLPVSNIS+IPDL+D YRKVMKEFA+ 
Sbjct  61   MEQRFKELVASKGLEYVETEVHDLDWESTFHLKHLPVSNISQIPDLDDDYRKVMKEFAVN  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LEKLAE+L+DLLCENLGLEKGYLKKAF GS GPNFGTKVSNYPPCPK
Sbjct  121  LEKLAEDLMDLLCENLGLEKGYLKKAFHGSNGPNFGTKVSNYPPCPK  167



>dbj|BAA19605.1| ACC-oxidase [Vigna angularis]
Length=310

 Score =   242 bits (617),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 129/167 (77%), Positives = 150/167 (90%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M +FP+INL  +N EER A++E+I+DACENWGFFELV+HGI +EL+DTVE+LTK+HY+KC
Sbjct  1    MENFPVINLENINGEERKAVLEKIEDACENWGFFELVNHGIPLELLDTVERLTKEHYRKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRFKE VA+KGL+ VQ EI D+DWESTFFL+HLP SNISEIPDL + YRK MK+FA +
Sbjct  61   MEQRFKEAVASKGLEGVQGEIKDMDWESTFFLRHLPHSNISEIPDLSEEYRKAMKDFAQK  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LEKLAE LLDLLCENLGLEKGYLKKAF GSKGPNFGTKV+NYPPCPK
Sbjct  121  LEKLAEELLDLLCENLGLEKGYLKKAFYGSKGPNFGTKVANYPPCPK  167



>ref|XP_010035507.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase 1-like [Eucalyptus 
grandis]
Length=320

 Score =   242 bits (617),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 131/167 (78%), Positives = 150/167 (90%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M +FP IN+  LN E+R   M++IKDACENWGFFELV+HGI  ELMDTVE++TK HYKKC
Sbjct  1    MENFPAINMENLNGEQRAITMDKIKDACENWGFFELVNHGIPPELMDTVERMTKGHYKKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRFKE+VA+KGL+ V+TE++DLDWESTF LKHLPVSNIS+IPDL+D YRKVMKEFA+ 
Sbjct  61   MEQRFKELVASKGLEYVETEVHDLDWESTFHLKHLPVSNISQIPDLDDDYRKVMKEFAVN  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LEKLAE+L+DLLCENLGLEKGYLKKAF GS GPNFGTKVSNYPPCPK
Sbjct  121  LEKLAEDLMDLLCENLGLEKGYLKKAFHGSNGPNFGTKVSNYPPCPK  167



>ref|XP_010099139.1| 1-aminocyclopropane-1-carboxylate oxidase [Morus notabilis]
 gb|EXB77011.1| 1-aminocyclopropane-1-carboxylate oxidase [Morus notabilis]
Length=322

 Score =   242 bits (617),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 131/165 (79%), Positives = 149/165 (90%), Gaps = 0/165 (0%)
 Frame = +3

Query  93   SFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKCME  272
            +FP+I++A+LN EER   ME I DACENWGFFEL++HGIS ELMD VE+LTK+HY+KCME
Sbjct  5    TFPVIDMAKLNGEERKETMELINDACENWGFFELMNHGISHELMDAVERLTKEHYRKCME  64

Query  273  QRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMele  452
            QRFKEMVA+KGLD VQ+EINDLDWESTFFL+H PVSN+SEIPDL+D YRK MKEFA E+E
Sbjct  65   QRFKEMVASKGLDVVQSEINDLDWESTFFLRHRPVSNMSEIPDLDDDYRKAMKEFAAEVE  124

Query  453  klaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            KLAE+LLDLLCENLGLEK Y+KK F GSKGPNFGTKVSNYPPCPK
Sbjct  125  KLAEHLLDLLCENLGLEKAYIKKVFFGSKGPNFGTKVSNYPPCPK  169



>dbj|BAF33504.1| ACC synthase [Orobanche minor]
Length=311

 Score =   241 bits (616),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 132/168 (79%), Positives = 153/168 (91%), Gaps = 1/168 (1%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M +FP+IN+ +LN EER A ME IKDACENWGFFE+++HGI+ E MD+VE+LTK+HYKKC
Sbjct  1    MTTFPVINMEKLNGEERSATMEMIKDACENWGFFEVMNHGIAPEFMDSVERLTKEHYKKC  60

Query  267  MEQRFKEMVAAKG-LDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAM  443
            ME+RF+EMVA+KG ++A+Q+EINDLDWESTFFL HLPVSNISEIP L+D YRKVMKEFA+
Sbjct  61   MEKRFEEMVASKGNIEALQSEINDLDWESTFFLTHLPVSNISEIPHLQDEYRKVMKEFAV  120

Query  444  eleklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            +LEKLAE LLDLLCENLGLEKGYLKKAF GSKGP FGTKVSNYPPCPK
Sbjct  121  QLEKLAEQLLDLLCENLGLEKGYLKKAFYGSKGPTFGTKVSNYPPCPK  168



>gb|AAL35971.1| 1-aminocyclopropanecarboxylic acid oxidase [Medicago truncatula]
Length=313

 Score =   241 bits (616),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 131/167 (78%), Positives = 148/167 (89%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M SFPIINL  LN +ER A ME+IKDACENWGFFELV+HGI  +LMDTVE+LTK+HY+KC
Sbjct  1    MDSFPIINLENLNGDERKATMEKIKDACENWGFFELVNHGIPHDLMDTVERLTKEHYRKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRFKE+V++KGL+AVQTE+ D+DWESTF L+HLP SNISEIPDL D YRK MKEFA++
Sbjct  61   MEQRFKELVSSKGLEAVQTEVKDMDWESTFHLRHLPESNISEIPDLSDEYRKSMKEFALK  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LE LAE LLDLLCENLGLEKGYLKKA  GSKGP FGTKV+NYPPCPK
Sbjct  121  LETLAEELLDLLCENLGLEKGYLKKALYGSKGPTFGTKVANYPPCPK  167



>ref|XP_010035510.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase 1-like [Eucalyptus 
grandis]
Length=320

 Score =   242 bits (617),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 130/167 (78%), Positives = 150/167 (90%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M +FP IN+  LN E+R   M++IKDACENWGFFELV+HGI  ELMDTVE++TK HYKKC
Sbjct  1    MENFPAINMENLNGEQRAITMDKIKDACENWGFFELVNHGIPPELMDTVERMTKGHYKKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRFKE+VA+ GL++V+TE++DLDWESTF LKHLPVSNIS+IPDL+D YRKVMKEFA++
Sbjct  61   MEQRFKELVASNGLESVETEVHDLDWESTFHLKHLPVSNISQIPDLDDDYRKVMKEFAVK  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LEKLAE L+DLLCENLGLEKGYLKKAF GS GPNFGTKVSNYPPCPK
Sbjct  121  LEKLAEELMDLLCENLGLEKGYLKKAFHGSNGPNFGTKVSNYPPCPK  167



>ref|NP_001233928.1| 1-aminocyclopropane-1-carboxylate oxidase 4 [Solanum lycopersicum]
 sp|P24157.1|ACCO4_SOLLC RecName: Full=1-aminocyclopropane-1-carboxylate oxidase 4; Short=ACC 
oxidase 4; AltName: Full=Ethylene-forming enzyme; Short=EFE; 
AltName: Full=Protein pHTOM5 [Solanum lycopersicum]
 emb|CAA41689.1| ethylene-forming enzyme [Solanum lycopersicum]
 emb|CAA90904.1| 1-aminocyclopropane-1-carboxylic acid oxidase [Solanum lycopersicum]
Length=316

 Score =   241 bits (616),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 131/167 (78%), Positives = 147/167 (88%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M +FPIINL  LN +ER   ME IKDACENWGFFELV+HGI  E+MDTVEKLTK HYKKC
Sbjct  1    MENFPIINLENLNGDERAKTMEMIKDACENWGFFELVNHGIPHEVMDTVEKLTKGHYKKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRFKE+VA+KGL+AVQ E+ DLDWESTFFL+HLP SNIS++PDL++ YR+VM++FA  
Sbjct  61   MEQRFKELVASKGLEAVQAEVTDLDWESTFFLRHLPTSNISQVPDLDEEYREVMRDFAKR  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LEKLAE LLDLLCENLGLEKGYLK AF GSKGPNFGTKVSNYPPCPK
Sbjct  121  LEKLAEELLDLLCENLGLEKGYLKNAFYGSKGPNFGTKVSNYPPCPK  167



>dbj|BAA21541.1| 1-aminocyclopropane-1-carboxylic acid oxidase [Actinidia deliciosa]
Length=317

 Score =   241 bits (616),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 132/164 (80%), Positives = 149/164 (91%), Gaps = 0/164 (0%)
 Frame = +3

Query  93   SFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKCME  272
            +FP+I++ +L  +ER   ME+I DACENWGFFEL++HGIS ELMDTVE+LTK+HYKKCME
Sbjct  1    TFPVIDMEKLTGKERSPTMEKINDACENWGFFELMNHGISHELMDTVERLTKEHYKKCME  60

Query  273  QRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMele  452
            QRFKEMVA KGL+AVQ+EI+DLDWESTFFL+HLPVSNISEIPDLE  +RK MKEFA +LE
Sbjct  61   QRFKEMVATKGLEAVQSEIDDLDWESTFFLRHLPVSNISEIPDLEQDHRKAMKEFAEKLE  120

Query  453  klaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCP  584
            KLAE LLDLLCENLGLEKGYLKKAFSGSKGP FGTKVSNYPPCP
Sbjct  121  KLAEQLLDLLCENLGLEKGYLKKAFSGSKGPTFGTKVSNYPPCP  164



>ref|XP_009790903.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase-like [Nicotiana 
sylvestris]
Length=320

 Score =   241 bits (616),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 129/166 (78%), Positives = 151/166 (91%), Gaps = 0/166 (0%)
 Frame = +3

Query  90   ASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKCM  269
             +FP+++L  L TE+R   +++IKDACENWGFFELV+HGIS E++DTVEKLTK+HYKKCM
Sbjct  3    TTFPVVDLGLLQTEKRAETLDKIKDACENWGFFELVNHGISHEVLDTVEKLTKEHYKKCM  62

Query  270  EQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMel  449
            EQRFKEMVA+KGL+AVQTEI+DLDWESTF+LKHLPVS + E+PDLED YR VMK+FA+ L
Sbjct  63   EQRFKEMVASKGLEAVQTEIDDLDWESTFYLKHLPVSTVYEVPDLEDKYRNVMKDFALRL  122

Query  450  eklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            EKLAE+LLDLLCENLGLE+GYLKKAF GSKGP FGTKVSNYPPCPK
Sbjct  123  EKLAEDLLDLLCENLGLEQGYLKKAFYGSKGPTFGTKVSNYPPCPK  168



>ref|XP_010035508.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase-like [Eucalyptus 
grandis]
 gb|KCW46932.1| hypothetical protein EUGRSUZ_K00746 [Eucalyptus grandis]
Length=320

 Score =   241 bits (616),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 128/167 (77%), Positives = 150/167 (90%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M SFP+IN+  LN E+R   M++IKDACENWGFFELV+HGI  E MDTVE++TK HY+KC
Sbjct  1    MESFPVINMENLNGEKRAITMDKIKDACENWGFFELVNHGIPPEFMDTVERMTKGHYRKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            M+QRF+E+VA+KGL+ VQTE++DLDWESTF LKHLP+SNIS++PDLED YRKVMKEFA++
Sbjct  61   MDQRFRELVASKGLENVQTEVHDLDWESTFHLKHLPLSNISQVPDLEDDYRKVMKEFAVK  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LEKLAE L+DLLCENLGLEKGYLKKAF GS GPNFGTKVSNYPPCPK
Sbjct  121  LEKLAEELMDLLCENLGLEKGYLKKAFHGSNGPNFGTKVSNYPPCPK  167



>gb|KJB10710.1| hypothetical protein B456_001G217400 [Gossypium raimondii]
Length=311

 Score =   241 bits (615),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 128/167 (77%), Positives = 149/167 (89%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            MA+FP+INL +LN EER  IMEQIKDACENWGFFEL++HGI  E +DTVE+LTK+HYKKC
Sbjct  1    MATFPVINLEKLNGEERATIMEQIKDACENWGFFELLNHGIPHEFLDTVERLTKEHYKKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRFKE+VA+K L+ +Q E+ D+DWESTFFL+HLP SN++EIPDL   YRKVMKEFA++
Sbjct  61   MEQRFKELVASKALEGLQAEVTDMDWESTFFLRHLPESNMAEIPDLAHEYRKVMKEFALK  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LEKLAE LLDLLCENLGLEKGYLKKAF G++GP FGTKVSNYPPCPK
Sbjct  121  LEKLAEELLDLLCENLGLEKGYLKKAFHGTRGPTFGTKVSNYPPCPK  167



>ref|XP_004304079.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase [Fragaria 
vesca subsp. vesca]
Length=320

 Score =   241 bits (616),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 129/167 (77%), Positives = 150/167 (90%), Gaps = 1/167 (1%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M +FP+IN+ +LN EER A ME IKDACENWGFFELV+HGI+ E +DTVEK+TKDHYK C
Sbjct  1    MENFPVINMEKLNGEERKATMETIKDACENWGFFELVNHGIATEFLDTVEKMTKDHYKNC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            +EQRFKE+VA+KGL+AV TE+ND+DWESTF+LKHLP SNISE+PDL++ YRKVMKEFA++
Sbjct  61   LEQRFKELVASKGLNAVNTEVNDMDWESTFYLKHLPRSNISEVPDLDEEYRKVMKEFALK  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKG-PNFGTKVSNYPPCP  584
            LEKLAE LLDL CENLGLEKGYLKKAF GS+G P FGTKVSNYPPCP
Sbjct  121  LEKLAEELLDLFCENLGLEKGYLKKAFYGSQGSPTFGTKVSNYPPCP  167



>ref|XP_004502173.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase-like [Cicer 
arietinum]
Length=313

 Score =   241 bits (615),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 131/167 (78%), Positives = 149/167 (89%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M +FP+INL  +N EER A ME+IKDACENWGFFELV+HGI  +LMDTVE+LTK+HY+KC
Sbjct  1    MENFPVINLDNINGEERKATMEKIKDACENWGFFELVNHGIPHDLMDTVERLTKEHYRKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRFKE+VA KGL+AVQTE+ D+DWESTF L+HLP SNISE+PDL D YRK MKEFA++
Sbjct  61   MEQRFKELVANKGLEAVQTEVKDMDWESTFHLRHLPESNISEVPDLTDEYRKSMKEFALK  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LEKLAE LLDLLCENLGLEKGYLKKAF GSKGP FGTKV+NYPPCPK
Sbjct  121  LEKLAEELLDLLCENLGLEKGYLKKAFYGSKGPTFGTKVANYPPCPK  167



>ref|XP_010035511.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase 3-like [Eucalyptus 
grandis]
 gb|KCW46933.1| hypothetical protein EUGRSUZ_K00747 [Eucalyptus grandis]
Length=320

 Score =   241 bits (616),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 128/167 (77%), Positives = 150/167 (90%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M SFP+IN+  LN E+R   M++IKDACENWGFFELV+HGI  E MDTVE++TK HY+KC
Sbjct  1    MESFPVINMENLNGEKRAITMDKIKDACENWGFFELVNHGIPPEFMDTVERMTKGHYRKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            M+QRF+E+VA+KGL+ VQTE++DLDWESTF LKHLP+SNIS++PDLED YRKVMKEFA++
Sbjct  61   MDQRFRELVASKGLENVQTEVHDLDWESTFHLKHLPLSNISQVPDLEDDYRKVMKEFAVK  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LEKLAE L+DLLCENLGLEKGYLKKAF GS GPNFGTKVSNYPPCPK
Sbjct  121  LEKLAEELMDLLCENLGLEKGYLKKAFHGSNGPNFGTKVSNYPPCPK  167



>ref|XP_009781832.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase [Nicotiana 
sylvestris]
Length=319

 Score =   241 bits (616),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 131/167 (78%), Positives = 147/167 (88%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M +FPIINL +LN  ER   ME IKDACENWGFFELV+HGI  E+MDTVEK+TK HYKKC
Sbjct  1    MENFPIINLEKLNGSERADTMEMIKDACENWGFFELVNHGIPHEVMDTVEKMTKGHYKKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRFKE+VA+KGL+AVQ E+ DLDWESTFFL+HLPVSNI E+PDL+D YR+VM++FA  
Sbjct  61   MEQRFKELVASKGLEAVQAEVTDLDWESTFFLRHLPVSNICEVPDLDDQYREVMRDFAKR  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LEKLAE LLDLLCENLGLEKGYLKK F G+KGPNFGTKVSNYPPCPK
Sbjct  121  LEKLAEELLDLLCENLGLEKGYLKKIFYGTKGPNFGTKVSNYPPCPK  167



>gb|ACJ84896.1| unknown [Medicago truncatula]
Length=221

 Score =   238 bits (607),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 129/167 (77%), Positives = 147/167 (88%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M +FPIINL  LN +ER A ME+IKDACENWGFFELV+HGI  +LMDTVE+LTK+HY+KC
Sbjct  1    MDNFPIINLENLNGDERKATMEKIKDACENWGFFELVNHGIPHDLMDTVERLTKEHYRKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRFKE+V++KGL+AVQTE+ D+DWES F L+HLP SNISEIPDL D YRK MKEFA++
Sbjct  61   MEQRFKELVSSKGLEAVQTEVKDMDWESAFHLRHLPESNISEIPDLSDEYRKSMKEFALK  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LE LAE LLDLLCENLGLEKGYLKKA  GSKGP FGTKV+NYPPCPK
Sbjct  121  LETLAEELLDLLCENLGLEKGYLKKALYGSKGPTFGTKVANYPPCPK  167



>prf||1909340A Pch313 protein
Length=319

 Score =   241 bits (615),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 128/167 (77%), Positives = 149/167 (89%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M +FPIINL  LN E R A ME+IKDACENWGFFELV HGI  E +DTVE+LTK+HY++C
Sbjct  1    MENFPIINLEGLNGEGRKATMEKIKDACENWGFFELVSHGIPTEFLDTVERLTKEHYRQC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            +EQRFKE+VA+KGL+AV+TE+ND+DWESTF+L+HLP SNISE+PDLED YR VMKEFA++
Sbjct  61   LEQRFKELVASKGLEAVKTEVNDMDWESTFYLRHLPKSNISEVPDLEDQYRNVMKEFALK  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LEKLAE LLDLLCENLGLE+GYLKKAF G+ GP FGTKVSNYPPCPK
Sbjct  121  LEKLAEQLLDLLCENLGLEQGYLKKAFYGTNGPTFGTKVSNYPPCPK  167



>ref|XP_006357981.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase 4-like [Solanum 
tuberosum]
Length=318

 Score =   241 bits (615),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 130/167 (78%), Positives = 147/167 (88%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M +FPIINL  LN +ER   +E IKDACENWGFFELV+HGI  E+MDTVEKLTK HYKKC
Sbjct  1    MENFPIINLENLNGDERSNTLELIKDACENWGFFELVNHGIPHEVMDTVEKLTKGHYKKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRFKE+VA+KGL+AVQ E+ DLDWESTFFL+HLPVSNIS++PDL++ YR+VM++FA  
Sbjct  61   MEQRFKELVASKGLEAVQAEVTDLDWESTFFLRHLPVSNISQVPDLDNEYREVMRDFAKR  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LEKLAE LLDLLCENL LEKGYLK AF GSKGPNFGTKVSNYPPCPK
Sbjct  121  LEKLAEELLDLLCENLELEKGYLKNAFYGSKGPNFGTKVSNYPPCPK  167



>ref|XP_009604053.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase [Nicotiana 
tomentosiformis]
Length=319

 Score =   241 bits (615),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 131/167 (78%), Positives = 146/167 (87%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M +FPIINL +LN  ER   ME IKDACENWGFFELV+HGI  E+MDTVEK+TK HYKKC
Sbjct  1    MENFPIINLEKLNGSERADTMEMIKDACENWGFFELVNHGIPHEVMDTVEKMTKGHYKKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRFKE+VA KGL+AVQ E+ DLDWESTFFL+HLPVSNISE+ DL+D YR++M++FA  
Sbjct  61   MEQRFKELVAGKGLEAVQAEVTDLDWESTFFLRHLPVSNISEVSDLDDQYREIMRDFAKR  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LEKLAE LLDLLCENLGLEKGYLKK F GSKGPNFGTKVSNYPPCPK
Sbjct  121  LEKLAEELLDLLCENLGLEKGYLKKVFYGSKGPNFGTKVSNYPPCPK  167



>sp|P05116.2|ACCO1_SOLLC RecName: Full=1-aminocyclopropane-1-carboxylate oxidase 1; Short=ACC 
oxidase 1; AltName: Full=Ethylene-forming enzyme; Short=EFE; 
AltName: Full=Protein pTOM 13 [Solanum lycopersicum]
 emb|CAA41212.1| 1-Aminocyclopropane-1-carboxylic acid oxidase [Solanum lycopersicum]
 gb|ADO32577.1| 1-aminocyclopropane-1-carboxylic acid oxidase [Solanum lycopersicum]
Length=315

 Score =   241 bits (615),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 130/167 (78%), Positives = 148/167 (89%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M +FPIINL +LN +ER   ME IKDACENWGFFELV+HGI  E+MDTVEK+TK HYKKC
Sbjct  1    MENFPIINLEKLNGDERANTMEMIKDACENWGFFELVNHGIPHEVMDTVEKMTKGHYKKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRFKE+VA+KGL+AVQ E+ DLDWESTFFL+HLP SNIS++PDL++ YR+VM++FA  
Sbjct  61   MEQRFKELVASKGLEAVQAEVTDLDWESTFFLRHLPTSNISQVPDLDEEYREVMRDFAKR  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LEKLAE LLDLLCENLGLEKGYLK AF GSKGPNFGTKVSNYPPCPK
Sbjct  121  LEKLAEELLDLLCENLGLEKGYLKNAFYGSKGPNFGTKVSNYPPCPK  167



>ref|XP_010035504.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase 3 [Eucalyptus 
grandis]
 gb|KCW46925.1| hypothetical protein EUGRSUZ_K00739 [Eucalyptus grandis]
Length=320

 Score =   241 bits (615),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 129/167 (77%), Positives = 149/167 (89%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M SFP+IN+  LN E+R   M++IKDACENWGFFELV+HGI  E MDT+E +TK HYKKC
Sbjct  1    MESFPVINMENLNGEKRAITMDKIKDACENWGFFELVNHGIPPEFMDTIESMTKGHYKKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRF E+VA+KGL+ VQTE++DLDWESTF LKHLPVSNIS+IPDL+D YR+VMKEFA++
Sbjct  61   MEQRFGELVASKGLECVQTEVHDLDWESTFHLKHLPVSNISQIPDLDDDYRRVMKEFALK  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LEKLAE L+DLLCENLGLEKGYLKKAF GS+GPNFGTKVSNYPPCPK
Sbjct  121  LEKLAEELMDLLCENLGLEKGYLKKAFYGSQGPNFGTKVSNYPPCPK  167



>gb|AAB70884.1| 1-aminocyclopropane-1-carboxylate oxidase [Pelargonium x hortorum]
Length=320

 Score =   241 bits (615),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 128/167 (77%), Positives = 148/167 (89%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M  FP+INL +LN E R   M++IKDACENWGFFE+++HGI  EL+DTVEK+TK+HYKKC
Sbjct  1    MEKFPVINLEKLNGEGRAETMDKIKDACENWGFFEVLNHGIPYELLDTVEKMTKEHYKKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRFKEMV +KGLD V+ E+ D+DWESTFFLKHLP SNIS++PDL+D+YRKVMKEFA++
Sbjct  61   MEQRFKEMVTSKGLDGVEAEVEDMDWESTFFLKHLPESNISQVPDLQDNYRKVMKEFALK  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LE LAE LLDLLCENLGLEKGYLKKAF GSKGP FGTKVSNYPPCPK
Sbjct  121  LENLAEELLDLLCENLGLEKGYLKKAFYGSKGPTFGTKVSNYPPCPK  167



>dbj|BAG30908.1| ACC oxidase [Capsicum chinense]
Length=319

 Score =   241 bits (615),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 131/167 (78%), Positives = 148/167 (89%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M +FPIINL +LN  ER   M  IKDACENWGFFELV+HGI  E+MDTVEKLTK HYKKC
Sbjct  1    MENFPIINLEKLNGAERANTMGMIKDACENWGFFELVNHGIPHEVMDTVEKLTKGHYKKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRFKE+VA+KGL+AVQ E+ DLDWESTFFL+HLPVSNIS++PDL+D YR+VM++FA  
Sbjct  61   MEQRFKELVASKGLEAVQAEVTDLDWESTFFLRHLPVSNISDVPDLDDEYREVMRDFAKR  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LEKLAE LLDLLCENLGLEKGYLKKAF G+KGPNFG+KVSNYPPCPK
Sbjct  121  LEKLAEELLDLLCENLGLEKGYLKKAFYGTKGPNFGSKVSNYPPCPK  167



>dbj|BAG06705.1| 1-aminocyclopropane-1-carboxylate oxidase [Ficus carica]
Length=322

 Score =   241 bits (614),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 131/165 (79%), Positives = 148/165 (90%), Gaps = 0/165 (0%)
 Frame = +3

Query  93   SFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKCME  272
            +FP+I++ +LN +ER   ME I DACENWGFFE+++HGIS ELMDTVE+LTK+HY+KCME
Sbjct  5    TFPVIDMTKLNGDERKTTMELINDACENWGFFEVMNHGISHELMDTVERLTKEHYRKCME  64

Query  273  QRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMele  452
            QRFKEMVA KGLD VQ+EI DLDWESTFFL+HLPVSN+SEIPDL D YRKVMKEFA ELE
Sbjct  65   QRFKEMVATKGLDVVQSEIKDLDWESTFFLRHLPVSNMSEIPDLGDDYRKVMKEFAAELE  124

Query  453  klaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            KLAE+LLDLLCENLGLEKGY+K  F GSKGPNFGTKVSNYPPCPK
Sbjct  125  KLAEHLLDLLCENLGLEKGYIKSVFYGSKGPNFGTKVSNYPPCPK  169



>ref|NP_001280183.1| 1-aminocyclopropane-1-carboxylate oxidase [Prunus mume]
 sp|Q9MB94.1|ACCO_PRUMU RecName: Full=1-aminocyclopropane-1-carboxylate oxidase; Short=ACC 
oxidase; AltName: Full=Ethylene-forming enzyme; Short=EFE 
[Prunus mume]
 dbj|BAA90550.1| ACC oxidase [Prunus mume]
Length=319

 Score =   241 bits (614),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 128/166 (77%), Positives = 148/166 (89%), Gaps = 0/166 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M +FPIINL  LN E R A ME+IKDACENWGFFELV HGI  E +DTVE+LTK+HY++C
Sbjct  1    MENFPIINLEGLNGEGRKATMEKIKDACENWGFFELVSHGIPTEFLDTVERLTKEHYRQC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            +EQRFKE+VA+KGL+AV+TE+ND+DWESTF+L+HLP SNISE+PDLED YR VMKEFA++
Sbjct  61   LEQRFKELVASKGLEAVKTEVNDMDWESTFYLRHLPKSNISEVPDLEDQYRNVMKEFALK  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCP  584
            LEKLAE LLDLLCENLGLEKGYLKKAF G+ GP FGTKVSNYPPCP
Sbjct  121  LEKLAEQLLDLLCENLGLEKGYLKKAFYGTNGPTFGTKVSNYPPCP  166



>gb|AGM48542.1| 1-aminocyclopropane-1-carboxylate oxidase [Coffea arabica]
Length=318

 Score =   241 bits (614),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 131/167 (78%), Positives = 153/167 (92%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            MA+FP+I++ +L+ EER A M  IKDACE+WGFFE+++HGIS ELMDTVE+LTK+HYKKC
Sbjct  1    MATFPVIDMEKLDGEERAATMGVIKDACESWGFFEVLNHGISNELMDTVERLTKEHYKKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            ME +FKEMV +K L+AVQTEINDLDWESTFFL+HLPVSNISE+PDL+D YRKVMKEFA++
Sbjct  61   MELKFKEMVESKELEAVQTEINDLDWESTFFLRHLPVSNISEVPDLDDEYRKVMKEFALQ  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LEKLAE LLDLLCENLGLEKGYLKKAF G+KGP FGTKVSNYPPCP+
Sbjct  121  LEKLAELLLDLLCENLGLEKGYLKKAFYGTKGPTFGTKVSNYPPCPR  167



>gb|ADR73045.1| ACC oxidase 2 isoform A [Nicotiana tabacum]
Length=308

 Score =   240 bits (613),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 132/156 (85%), Positives = 144/156 (92%), Gaps = 0/156 (0%)
 Frame = +3

Query  120  LNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKCMEQRFKEMVAA  299
            LNTE+R A ME IKDACENWGFFE+V+HGIS EL+DTVEKLTK HYKKCME+RFKEMVA+
Sbjct  4    LNTEQRAATMETIKDACENWGFFEVVNHGISHELLDTVEKLTKGHYKKCMEERFKEMVAS  63

Query  300  KGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMeleklaenlldl  479
            KGL+AVQTEI D DWESTFFLKHLP+SNISE+PDLED YRK+MKEFA +LEKLAE LLDL
Sbjct  64   KGLEAVQTEIKDFDWESTFFLKHLPISNISEVPDLEDEYRKIMKEFAEKLEKLAEQLLDL  123

Query  480  lcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LCENLGLE+GYLKKAF GSKGP FGTKVSNYPPCPK
Sbjct  124  LCENLGLEQGYLKKAFYGSKGPTFGTKVSNYPPCPK  159



>gb|AFK42210.1| unknown [Medicago truncatula]
Length=313

 Score =   240 bits (613),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 130/167 (78%), Positives = 148/167 (89%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M +FPIINL  LN +ER A ME+IKDACENWGFFELV+HGI  +LMDTVE+LTK+HY+KC
Sbjct  1    MDNFPIINLENLNGDERKATMEKIKDACENWGFFELVNHGIPHDLMDTVERLTKEHYRKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRFKE+V++KGL+AVQTE+ D+DWESTF L+HLP SNISEIPDL D YRK MKEFA++
Sbjct  61   MEQRFKELVSSKGLEAVQTEVKDMDWESTFHLRHLPESNISEIPDLSDEYRKSMKEFALK  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LE LAE LLDLLCENLGLEKGYLKKA  GSKGP FGTKV+NYPPCPK
Sbjct  121  LETLAEELLDLLCENLGLEKGYLKKALYGSKGPTFGTKVTNYPPCPK  167



>emb|CDP05673.1| unnamed protein product [Coffea canephora]
Length=319

 Score =   241 bits (614),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 129/167 (77%), Positives = 148/167 (89%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M +FPIIN+  L+ ++R + ME IKDACENWGFFELV+HGI  E+MDTVE+LTK HYKKC
Sbjct  1    MENFPIINMKNLHGDKRASTMEHIKDACENWGFFELVNHGIPHEMMDTVERLTKGHYKKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRFKE+VA+K L+ VQ EI D+DWESTFFL+HLPVSNIS++PDL+D YR +MKEFA+ 
Sbjct  61   MEQRFKELVASKALEGVQVEITDMDWESTFFLRHLPVSNISQVPDLDDEYRTIMKEFAVR  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LEKLAE LLDLLCENLGLEKGYLKKAF GSKGPNFGTKVSNYPPCPK
Sbjct  121  LEKLAEELLDLLCENLGLEKGYLKKAFYGSKGPNFGTKVSNYPPCPK  167



>ref|XP_003601593.1| 1-aminocyclopropane-1-carboxylate oxidase [Medicago truncatula]
 gb|AES71844.1| 1-aminocyclopropane-1-carboxylate oxidase [Medicago truncatula]
Length=313

 Score =   240 bits (613),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 130/167 (78%), Positives = 148/167 (89%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M +FPIINL  LN +ER A ME+IKDACENWGFFELV+HGI  +LMDTVE+LTK+HY+KC
Sbjct  1    MDNFPIINLENLNGDERKATMEKIKDACENWGFFELVNHGIPHDLMDTVERLTKEHYRKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRFKE+V++KGL+AVQTE+ D+DWESTF L+HLP SNISEIPDL D YRK MKEFA++
Sbjct  61   MEQRFKELVSSKGLEAVQTEVKDMDWESTFHLRHLPESNISEIPDLSDEYRKSMKEFALK  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LE LAE LLDLLCENLGLEKGYLKKA  GSKGP FGTKV+NYPPCPK
Sbjct  121  LETLAEELLDLLCENLGLEKGYLKKALYGSKGPTFGTKVANYPPCPK  167



>sp|P54847.1|ACCO3_CUCME RecName: Full=1-aminocyclopropane-1-carboxylate oxidase 3; Short=ACC 
oxidase 3; AltName: Full=Ethylene-forming enzyme; Short=EFE 
[Cucumis melo]
 emb|CAA64799.1| ACC oxidase [Cucumis melo]
Length=320

 Score =   240 bits (613),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 131/164 (80%), Positives = 148/164 (90%), Gaps = 0/164 (0%)
 Frame = +3

Query  96   FPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKCMEQ  275
            FP+IN+  LN E R +++ QI DACENWGFFELV+HGIS ELMD VEKLTK+HY+KCMEQ
Sbjct  5    FPVINMNNLNGESRVSVLNQINDACENWGFFELVNHGISHELMDKVEKLTKEHYRKCMEQ  64

Query  276  RFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMelek  455
            RFKEMVA+KGLD+V+TEIND DWESTFFL+HLPVSN+SEI DL++ Y+KVMKEFA ELEK
Sbjct  65   RFKEMVASKGLDSVETEINDTDWESTFFLRHLPVSNMSEIGDLDEEYKKVMKEFADELEK  124

Query  456  laenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LAE +LDLLCENLGLEKGYLKK F GSKGPNFGTKVSNYPPCPK
Sbjct  125  LAEEVLDLLCENLGLEKGYLKKVFYGSKGPNFGTKVSNYPPCPK  168



>ref|XP_008440054.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase 3 [Cucumis 
melo]
Length=320

 Score =   240 bits (613),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 131/164 (80%), Positives = 148/164 (90%), Gaps = 0/164 (0%)
 Frame = +3

Query  96   FPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKCMEQ  275
            FP+IN+  LN E R +++ QI DACENWGFFELV+HGIS ELMD VEKLTK+HY+KCMEQ
Sbjct  5    FPVINMNNLNGESRVSVLNQINDACENWGFFELVNHGISHELMDKVEKLTKEHYRKCMEQ  64

Query  276  RFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMelek  455
            RFKEMVA+KGLD+V+TEIND DWESTFFL+HLPVSN+SEI DL++ Y+KVMKEFA ELEK
Sbjct  65   RFKEMVASKGLDSVETEINDTDWESTFFLRHLPVSNMSEIGDLDEEYKKVMKEFADELEK  124

Query  456  laenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LAE +LDLLCENLGLEKGYLKK F GSKGPNFGTKVSNYPPCPK
Sbjct  125  LAEEVLDLLCENLGLEKGYLKKVFYGSKGPNFGTKVSNYPPCPK  168



>gb|AEK70335.1| 1-aminocyclopropane-1-carboxylate oxidase [Paeonia lactiflora]
 gb|AFA51947.1| 1-aminocyclopropane-1-carboxylate oxidase [Paeonia lactiflora]
 gb|AIE48275.1| ACC oxidase [Paeonia lactiflora]
Length=312

 Score =   240 bits (612),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 132/167 (79%), Positives = 150/167 (90%), Gaps = 3/167 (2%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            MA+FP+INL +LN EER A ME I DACENWGFFE+V+HGIS E MDTVEKLTK+HYKKC
Sbjct  1    MANFPVINLEKLNGEERAATMEIINDACENWGFFEIVNHGISPEFMDTVEKLTKEHYKKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQ+FKE+VA+K   A++TEIND+DWESTF L+HLP+SN++EIPDL+D YRKVMKEFA +
Sbjct  61   MEQKFKELVASK---ALETEINDMDWESTFHLRHLPISNMAEIPDLDDEYRKVMKEFASK  117

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LE LAE LLDLLCENLGLEKGYLKKAF GSKGPNFGTKVSNYPPCPK
Sbjct  118  LETLAEELLDLLCENLGLEKGYLKKAFYGSKGPNFGTKVSNYPPCPK  164



>sp|Q43792.1|ACCO_TOBAC RecName: Full=1-aminocyclopropane-1-carboxylate oxidase; Short=ACC 
oxidase; AltName: Full=Ethylene-forming enzyme; Short=EFE 
[Nicotiana tabacum]
 emb|CAA86468.1| 1-aminocyclopropane-1-carboxylate deaminase [Nicotiana tabacum]
Length=319

 Score =   240 bits (612),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 130/167 (78%), Positives = 147/167 (88%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M +FPIINL +LN  ER   ME IKDACENWGFFELV+HGI  E+MDTVEK+TK HYKKC
Sbjct  1    MENFPIINLEKLNGSERADTMEMIKDACENWGFFELVNHGIPHEVMDTVEKMTKGHYKKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRFKE+VA+KGL+AVQ E+ DLDWESTFFL+HLPVSNI E+PDL+D YR+VM++FA  
Sbjct  61   MEQRFKELVASKGLEAVQAEVTDLDWESTFFLRHLPVSNICEVPDLDDQYREVMRDFAKR  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LEKLAE LLDLLCENLGLEKGYLKK F G+KGPNFG+KVSNYPPCPK
Sbjct  121  LEKLAEELLDLLCENLGLEKGYLKKIFYGTKGPNFGSKVSNYPPCPK  167



>emb|CAA71738.1| 1-aminocyclopropane-1-carboxylate oxidase [Betula pendula]
Length=318

 Score =   240 bits (612),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 128/167 (77%), Positives = 151/167 (90%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            MA+FP+I++ +LN EER A ME I+DACENWGFFELV+HGIS +L+DTVEKL K+HY+KC
Sbjct  1    MATFPVIDMEKLNGEERGATMELIEDACENWGFFELVNHGISHDLLDTVEKLNKEHYRKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            ME+RFK+MVA+KGL+A Q+E+ D+DWESTFFL+HLP SN+SEIPDL++ YRK MKEFA  
Sbjct  61   MEERFKDMVASKGLEAAQSEVRDMDWESTFFLRHLPASNMSEIPDLDEDYRKAMKEFAGN  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LEKLAE LLDLLCENLGLEKGYLKK+F GSKGPNFGTKVSNYPPCPK
Sbjct  121  LEKLAEQLLDLLCENLGLEKGYLKKSFYGSKGPNFGTKVSNYPPCPK  167



>dbj|BAH66891.1| 1-aminocyclopropane-1-carboxylate oxidase [Prunus mume]
Length=305

 Score =   239 bits (611),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 127/166 (77%), Positives = 148/166 (89%), Gaps = 0/166 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M +FPIINL  LN E R A ME+IKDACENWGFFELV HGI  E +DTVE+LTK+HY++C
Sbjct  1    MENFPIINLEGLNGEGRKATMEKIKDACENWGFFELVSHGIPTEFLDTVERLTKEHYRQC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            +EQRFKE+VA+KGL+AV+TE+ND+DWESTF+L+HLP SNISE+PDLED YR VMKEFA++
Sbjct  61   LEQRFKELVASKGLEAVKTEVNDMDWESTFYLRHLPKSNISEVPDLEDQYRNVMKEFALK  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCP  584
            LEKLAE LLDLLCENLGLE+GYLKKAF G+ GP FGTKVSNYPPCP
Sbjct  121  LEKLAEQLLDLLCENLGLEQGYLKKAFYGTNGPTFGTKVSNYPPCP  166



>emb|CAN85569.1| ACC oxidase 1 [Hevea brasiliensis]
Length=312

 Score =   239 bits (611),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 132/167 (79%), Positives = 149/167 (89%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M +FP+I+L++L+ EER   ME I DACENWGFFELV+HG+S ELMDTVE LTK+HY+KC
Sbjct  1    METFPVIDLSKLSDEERKPTMEMIHDACENWGFFELVNHGMSPELMDTVEILTKEHYRKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRFKEMVA KGL+AVQ+EINDLDWEST FL HLPVSN++EIPDL++ YRK M EFA+E
Sbjct  61   MEQRFKEMVARKGLEAVQSEINDLDWESTLFLSHLPVSNMAEIPDLDEEYRKTMNEFAVE  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LEKLAE LLDLLCENLGLEKGYLKKAF GSKGP FGTKVSNYPPCPK
Sbjct  121  LEKLAEQLLDLLCENLGLEKGYLKKAFCGSKGPTFGTKVSNYPPCPK  167



>gb|AFU90135.1| 1-aminocyclopropane-1-carboxylate oxidase [Paeonia lactiflora]
Length=312

 Score =   239 bits (611),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 132/167 (79%), Positives = 150/167 (90%), Gaps = 3/167 (2%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            MA+FP+INL +LN EER A ME I DACENWGFFE+V+HGIS E MDTVEKLTK+HYKKC
Sbjct  1    MANFPVINLEKLNGEERAATMEIINDACENWGFFEIVNHGISPEFMDTVEKLTKEHYKKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQ+FKE+VA+K   A++TEIND+DWESTF L+HLP+SN++EIPDL+D YRKVMKEFA +
Sbjct  61   MEQKFKELVASK---ALETEINDMDWESTFQLRHLPISNMAEIPDLDDEYRKVMKEFASK  117

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LE LAE LLDLLCENLGLEKGYLKKAF GSKGPNFGTKVSNYPPCPK
Sbjct  118  LETLAEELLDLLCENLGLEKGYLKKAFYGSKGPNFGTKVSNYPPCPK  164



>emb|CDP05674.1| unnamed protein product [Coffea canephora]
Length=319

 Score =   239 bits (611),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 128/167 (77%), Positives = 148/167 (89%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M +FP+IN+  LN ++R + M+ IKDACENWGFFELV+HGI  E+MDTVE+LTK HYKKC
Sbjct  1    MENFPVINMKNLNGDKRASTMDIIKDACENWGFFELVNHGIPHEMMDTVERLTKGHYKKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRFKE+VA+K L+ VQ EI D+DWESTFFL+HLPVSNIS++PDL+D YR +MKEFA+ 
Sbjct  61   MEQRFKELVASKALEGVQAEITDMDWESTFFLRHLPVSNISQVPDLDDEYRTIMKEFAVR  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LEKLAE LLDLLCENLGLEKGYLKKAF GSKGPNFGTKVSNYPPCPK
Sbjct  121  LEKLAEELLDLLCENLGLEKGYLKKAFYGSKGPNFGTKVSNYPPCPK  167



>ref|XP_007215698.1| hypothetical protein PRUPE_ppa008791mg [Prunus persica]
 gb|AAF36483.1|AF129073_1 1-aminocyclopropane-1-carboxylate oxidase [Prunus persica]
 gb|AAL26910.1|AF319166_1 1-aminocyclopropane 1-carboxylic acid oxidase [Prunus persica]
 emb|CAA54449.1| 1-aminocyclopropane-1-carboxylate oxidase [Prunus persica]
 gb|AAC33524.1| 1-aminocyclopropane-1-carboxylate oxidase [Prunus armeniaca]
 gb|AAQ10260.1| 1-aminocyclopropane-1-carboxylate oxidase [Prunus persica]
 gb|EMJ16897.1| hypothetical protein PRUPE_ppa008791mg [Prunus persica]
Length=319

 Score =   239 bits (611),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 127/166 (77%), Positives = 148/166 (89%), Gaps = 0/166 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M +FPIINL  LN E R A ME+IKDACENWGFFELV HGI  E +DTVE+LTK+HY++C
Sbjct  1    MENFPIINLEGLNGEGRKATMEKIKDACENWGFFELVSHGIPTEFLDTVERLTKEHYRQC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            +EQRFKE+VA+KGL+AV+TE+ND+DWESTF+L+HLP SNISE+PDLED YR VMKEFA++
Sbjct  61   LEQRFKELVASKGLEAVKTEVNDMDWESTFYLRHLPKSNISEVPDLEDQYRNVMKEFALK  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCP  584
            LEKLAE LLDLLCENLGLE+GYLKKAF G+ GP FGTKVSNYPPCP
Sbjct  121  LEKLAEQLLDLLCENLGLEQGYLKKAFYGTNGPTFGTKVSNYPPCP  166



>ref|XP_009613638.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase-like [Nicotiana 
tomentosiformis]
Length=320

 Score =   239 bits (610),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 128/166 (77%), Positives = 153/166 (92%), Gaps = 0/166 (0%)
 Frame = +3

Query  90   ASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKCM  269
            ++FP+++L  L TE+R   M++IKDACENWGFFELV+HGIS E++DT+EKLTK+HYKKCM
Sbjct  3    STFPVVDLWLLQTEKRAETMDKIKDACENWGFFELVNHGISHEVLDTIEKLTKEHYKKCM  62

Query  270  EQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMel  449
            EQRFKEMVA+KGL+AVQTEI+DLDWESTF+LKHLPVSN+ E+P+LED YR VMK+FA++L
Sbjct  63   EQRFKEMVASKGLEAVQTEIDDLDWESTFYLKHLPVSNLYEVPELEDKYRNVMKDFALKL  122

Query  450  eklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            EKLAE+LLDLLCENLGLE+GYLKKAF GS GP FGTKVSNYPPCPK
Sbjct  123  EKLAEHLLDLLCENLGLEQGYLKKAFYGSNGPTFGTKVSNYPPCPK  168



>ref|XP_008342143.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase [Malus domestica]
Length=322

 Score =   239 bits (610),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 125/166 (75%), Positives = 145/166 (87%), Gaps = 0/166 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M +FP+INL  LN E R A ME+IKDACENWGFFELV HGI  E +DTVE+LTK+HY++C
Sbjct  1    MENFPVINLESLNGEGRKATMEKIKDACENWGFFELVSHGIPTEFLDTVERLTKEHYRQC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRFKE+VA+KGLDAVQTE+ND+DWESTF+L+HLP SNISE+PDL+D YR VMKEFA++
Sbjct  61   MEQRFKELVASKGLDAVQTEVNDMDWESTFYLRHLPQSNISEVPDLKDEYRNVMKEFALK  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCP  584
            LEKLAE LL LLCENLGLE+GYL KAF G+ GP FGTKV NYPPCP
Sbjct  121  LEKLAEQLLGLLCENLGLEQGYLTKAFYGTNGPTFGTKVXNYPPCP  166



>gb|AHN13883.1| 1-aminocyclopropane-1-carboxylate oxidase 1 [Coffea arabica]
Length=319

 Score =   239 bits (610),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 128/167 (77%), Positives = 148/167 (89%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M +FP+IN+  LN ++R + M+ IKDACENWGFFELV+HGI  E+MDTVE+LTK HYKKC
Sbjct  1    MENFPVINMKNLNGDKRASTMDIIKDACENWGFFELVNHGIPHEMMDTVERLTKGHYKKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRFKE+VA+K L+ VQ EI D+DWESTFFL+HLPVSNIS++PDL+D YR +MKEFA+ 
Sbjct  61   MEQRFKELVASKALEGVQAEITDMDWESTFFLRHLPVSNISQVPDLDDEYRTLMKEFAVR  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LEKLAE LLDLLCENLGLEKGYLKKAF GSKGPNFGTKVSNYPPCPK
Sbjct  121  LEKLAEELLDLLCENLGLEKGYLKKAFYGSKGPNFGTKVSNYPPCPK  167



>gb|ACU18811.1| unknown [Glycine max]
Length=235

 Score =   236 bits (602),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 128/166 (77%), Positives = 148/166 (89%), Gaps = 0/166 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M +FP+INL +LN EER   ME+IKDACENWGFFELV+HGI  +L+DTVE+LTK+HY+KC
Sbjct  1    MTNFPVINLEKLNGEERNDTMEKIKDACENWGFFELVNHGIPHDLLDTVERLTKEHYRKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            ME+RFKE +A+KGLDAVQTE+ D+DWESTF L+HLP SNISEIPDL D YRKVMK+FA+ 
Sbjct  61   MEERFKEFMASKGLDAVQTEVKDMDWESTFHLRHLPESNISEIPDLIDEYRKVMKDFALR  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCP  584
            LEKLAE LLDLLCENLGLEKGYLKKAF GS+GP FGTKV+NYPPCP
Sbjct  121  LEKLAEQLLDLLCENLGLEKGYLKKAFYGSRGPTFGTKVANYPPCP  166



>ref|XP_009629716.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase-like [Nicotiana 
tomentosiformis]
Length=320

 Score =   239 bits (609),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 129/167 (77%), Positives = 147/167 (88%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M +FPIINL +LN  ER A M+ IKDACENWGFFELV+HGI  E+MDTVEK+TK HYKKC
Sbjct  1    MENFPIINLEKLNGSERAATMDMIKDACENWGFFELVNHGIPHEVMDTVEKMTKGHYKKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRFKE+VA+KGL+AVQ E+ DLDWESTFFL+HLP+SNIS++PDL+D YR+VM++FA  
Sbjct  61   MEQRFKELVASKGLEAVQAEVTDLDWESTFFLRHLPLSNISQVPDLDDEYREVMRDFAKR  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LEKLAE LLDLLCENLGLE GYLKK F G KGPNFGTKVSNYPPCPK
Sbjct  121  LEKLAEELLDLLCENLGLENGYLKKVFYGLKGPNFGTKVSNYPPCPK  167



>ref|NP_001275482.1| 1-aminocyclopropane-1-carboxylate oxidase [Solanum tuberosum]
 gb|AAK68075.1|AF384820_1 1-aminocyclopropane-1-carboxylate oxidase [Solanum tuberosum]
Length=315

 Score =   238 bits (608),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 129/167 (77%), Positives = 147/167 (88%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M +FPIINL +LN +ER   ME IKDACENWGFFELV+HGI  E+MDTV+K+TK HYKKC
Sbjct  1    MENFPIINLEKLNGDERANTMEMIKDACENWGFFELVNHGIPHEVMDTVDKMTKGHYKKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRFKE+VA+KGL+AVQ E+ DLDWESTFFL+HLP SNIS++PDL+  YR+VM++FA  
Sbjct  61   MEQRFKELVASKGLEAVQAEVTDLDWESTFFLRHLPTSNISQVPDLDGEYREVMRDFAKR  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LEKLAE LLDLLCENLGLEKGYLK AF GSKGPNFGTKVSNYPPCPK
Sbjct  121  LEKLAEELLDLLCENLGLEKGYLKNAFFGSKGPNFGTKVSNYPPCPK  167



>emb|CAN85572.1| ACC oxidase 1 [Hevea brasiliensis]
Length=312

 Score =   238 bits (608),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 132/167 (79%), Positives = 147/167 (88%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M +FP+I+L++L+ EER   ME I DACENWGFFELV+HG+S ELMDTVE LTK+HY+KC
Sbjct  1    METFPVIDLSKLSDEERKPTMEMIHDACENWGFFELVNHGMSPELMDTVEILTKEHYRKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRFKEMVA KGL+AVQ+EINDLDWEST FL HLPVSN +EIPDL++ YRK M EFA E
Sbjct  61   MEQRFKEMVARKGLEAVQSEINDLDWESTLFLSHLPVSNTAEIPDLDEEYRKTMNEFAAE  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LEKLAE LLDLLCENLGLEKGYLKKAF GSKGP FGTKVSNYPPCPK
Sbjct  121  LEKLAEQLLDLLCENLGLEKGYLKKAFCGSKGPTFGTKVSNYPPCPK  167



>ref|XP_006383841.1| aminocyclopropane carboxylate oxidase family protein [Populus 
trichocarpa]
 gb|ERP61638.1| aminocyclopropane carboxylate oxidase family protein [Populus 
trichocarpa]
Length=318

 Score =   238 bits (608),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 128/167 (77%), Positives = 149/167 (89%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M +FP+I+L++LN EER   ME I DACENWGFFELV+HGIS +L+D VE+LTK+HY+KC
Sbjct  1    METFPVIDLSKLNGEERKPTMEVINDACENWGFFELVNHGISHDLLDAVERLTKEHYRKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRFKEMVA+KGL+AVQ+EI+DLDWESTFFL+HLP SN++EIPDL + YRK MKEFA+E
Sbjct  61   MEQRFKEMVASKGLEAVQSEIDDLDWESTFFLRHLPESNLAEIPDLGEDYRKTMKEFALE  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LE LAE LLDLLCENLGLEKGYL+K F GSKGP FGTKVSNYPPCPK
Sbjct  121  LEGLAEQLLDLLCENLGLEKGYLRKVFCGSKGPTFGTKVSNYPPCPK  167



>gb|KDP20691.1| hypothetical protein JCGZ_21162 [Jatropha curcas]
Length=320

 Score =   238 bits (608),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 128/167 (77%), Positives = 150/167 (90%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M +FP+I+L++L+ E R   M+ IKDACENWGFFELV+HGIS ELMDTVE+LTK+HY+KC
Sbjct  1    MENFPVIDLSKLSGEGRKETMDMIKDACENWGFFELVNHGISHELMDTVERLTKEHYRKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            ME+RFKEMVA+KGL+AV++EINDLDWESTFFL+HLPVSN++EIP+L   YRK MKEFA E
Sbjct  61   MEERFKEMVASKGLEAVESEINDLDWESTFFLRHLPVSNLAEIPNLHQDYRKTMKEFAAE  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LEK+AE LL+LLCENLGLEKGYLKK F GSKGP FGTKVSNYPPCPK
Sbjct  121  LEKMAELLLELLCENLGLEKGYLKKVFYGSKGPTFGTKVSNYPPCPK  167



>gb|AFZ76981.1| ACC oxidase [Boehmeria nivea]
Length=326

 Score =   238 bits (608),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 127/165 (77%), Positives = 147/165 (89%), Gaps = 0/165 (0%)
 Frame = +3

Query  93   SFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKCME  272
            +FP+I++++LN EER + ME I DACENWGFFEL++HGIS ELMD VE+LTK+HY+KCME
Sbjct  6    TFPVIDMSKLNGEERASTMEMINDACENWGFFELMNHGISHELMDIVERLTKEHYRKCME  65

Query  273  QRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMele  452
            QRFKEMVA KGL+AVQ+EI DLDWESTFFL+HLP SNI+EIPDL D YR  M+EFA ELE
Sbjct  66   QRFKEMVATKGLEAVQSEITDLDWESTFFLRHLPFSNIAEIPDLGDDYRSAMREFAAELE  125

Query  453  klaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            KLAE LL+LLCENLGLEKGY+K+ F GSKGPNFGTKVSNYPPCPK
Sbjct  126  KLAEQLLELLCENLGLEKGYIKEVFYGSKGPNFGTKVSNYPPCPK  170



>ref|XP_004134785.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase 3-like [Cucumis 
sativus]
 gb|KGN49070.1| ACC oxidase 2 [Cucumis sativus]
Length=320

 Score =   238 bits (607),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 128/164 (78%), Positives = 147/164 (90%), Gaps = 0/164 (0%)
 Frame = +3

Query  96   FPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKCMEQ  275
            FP+IN+  LN E R +++ QI DACENWGFFELV+HGI  ELMD VEK+TK+HY+KCMEQ
Sbjct  5    FPVINMNNLNGESRVSVLNQINDACENWGFFELVNHGIPHELMDKVEKMTKEHYRKCMEQ  64

Query  276  RFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMelek  455
            RFKEMVA+KGLD+V+TEIND DWESTFFL+HLPVSN+SEI DL++ Y+KVMKEFA ELEK
Sbjct  65   RFKEMVASKGLDSVETEINDTDWESTFFLRHLPVSNMSEIGDLDEEYKKVMKEFAAELEK  124

Query  456  laenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LAE +L+LLCENLGLEKGYLKK F GSKGPNFGTKVSNYPPCPK
Sbjct  125  LAEEILNLLCENLGLEKGYLKKVFYGSKGPNFGTKVSNYPPCPK  168



>emb|CAN85571.1| ACC oxidase 3 [Hevea brasiliensis]
Length=318

 Score =   238 bits (607),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 127/164 (77%), Positives = 146/164 (89%), Gaps = 0/164 (0%)
 Frame = +3

Query  96   FPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKCMEQ  275
            FP+INL +LN EER + M +IKDACENWGFFEL+DHGI  E +DTVE++TK HY+KCMEQ
Sbjct  3    FPVINLEKLNGEERASTMAKIKDACENWGFFELLDHGIEPEFLDTVERMTKGHYRKCMEQ  62

Query  276  RFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMelek  455
            RFKEM+A KGL+ VQTEI DLDWESTF+L+HLP SNI+++PDL+D YRKVMKEFA +LEK
Sbjct  63   RFKEMMAGKGLENVQTEIKDLDWESTFYLRHLPESNIAQVPDLDDEYRKVMKEFAAKLEK  122

Query  456  laenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LAE LLDLLCENLGLEKGYLKKAF GS+GP FGTKVSNYPPCPK
Sbjct  123  LAEELLDLLCENLGLEKGYLKKAFYGSRGPTFGTKVSNYPPCPK  166



>ref|XP_011047191.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase [Populus 
euphratica]
Length=319

 Score =   238 bits (607),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 129/165 (78%), Positives = 150/165 (91%), Gaps = 1/165 (1%)
 Frame = +3

Query  96   FPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKCMEQ  275
            FP+I++ +LN EER A ME+IKDACENWGFFEL++HGIS EL+DTVE++TK+HYKKCMEQ
Sbjct  3    FPVISMEKLNGEERAATMEKIKDACENWGFFELLNHGISHELLDTVERMTKEHYKKCMEQ  62

Query  276  RFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMelek  455
            RFKE+VA+K LD VQTEI D+DWESTF+L+HLP SNI+EIPDL+D YRKVMKEFA++LEK
Sbjct  63   RFKELVASKALDGVQTEIKDMDWESTFYLRHLPKSNIAEIPDLDDEYRKVMKEFALKLEK  122

Query  456  laenlldllcenlgleKGYLKKAFSGSKG-PNFGTKVSNYPPCPK  587
            LAE LLDLLCENLGLEKGYLK+AF GS G P FGTKVSNYPPCPK
Sbjct  123  LAEELLDLLCENLGLEKGYLKRAFYGSNGSPTFGTKVSNYPPCPK  167



>ref|XP_010035512.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase 3-like [Eucalyptus 
grandis]
 gb|KCW46934.1| hypothetical protein EUGRSUZ_K00749 [Eucalyptus grandis]
Length=320

 Score =   238 bits (607),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 126/167 (75%), Positives = 148/167 (89%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M SFP+IN+  LN E+R   M++I D CENWGFFELV+HGI  E MDTVE++TK HY+KC
Sbjct  1    MESFPVINMENLNGEKRAITMDKINDVCENWGFFELVNHGIPPEFMDTVERMTKGHYRKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            M+QRF+E+VA+KGL+ VQTE++DLDWESTF LKHLP+SNIS++PDLED YRKVMKEFA++
Sbjct  61   MDQRFRELVASKGLENVQTEVHDLDWESTFHLKHLPLSNISQVPDLEDDYRKVMKEFAVK  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LEKLAE L+DLLCENLGLEKGYLKKAF GS GPNFGTKVSNYPPCPK
Sbjct  121  LEKLAEELMDLLCENLGLEKGYLKKAFHGSNGPNFGTKVSNYPPCPK  167



>gb|ABK96379.1| unknown [Populus trichocarpa x Populus deltoides]
Length=318

 Score =   238 bits (607),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 128/167 (77%), Positives = 149/167 (89%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M +FP+I+L++LN EER   ME I DACENWGFFELV+HGIS +L+D VE+LTK+HY+KC
Sbjct  1    METFPVIDLSKLNGEERKPTMEVINDACENWGFFELVNHGISHDLLDAVERLTKEHYRKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRFKEMVA+KGL+AVQ+EI+DLDWESTFFL+HLP SN++EIPDL + YRK MKEFA+E
Sbjct  61   MEQRFKEMVASKGLEAVQSEIDDLDWESTFFLRHLPESNLAEIPDLGEDYRKTMKEFALE  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LE LAE LLDLLCENLGLEKGYL+K F GSKGP FGTKVSNYPPCPK
Sbjct  121  LEGLAEQLLDLLCENLGLEKGYLRKVFCGSKGPTFGTKVSNYPPCPK  167



>gb|ABI95858.1| 1-aminocyclopropane-1-carboxylate oxidase [Nicotiana suaveolens]
Length=308

 Score =   238 bits (606),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 130/156 (83%), Positives = 144/156 (92%), Gaps = 0/156 (0%)
 Frame = +3

Query  120  LNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKCMEQRFKEMVAA  299
            LNTE+R A ME+IKDACENWGFFE+V+HGI  EL+DTVEKLTK HYKKCMEQRFKEMVA+
Sbjct  4    LNTEQRAATMEKIKDACENWGFFEVVNHGICHELLDTVEKLTKGHYKKCMEQRFKEMVAS  63

Query  300  KGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMeleklaenlldl  479
            KGL+AV+TEI DLDWESTFFLKHLP+SNISE+PDLED YRK+MKEFA +LEKLAE LLDL
Sbjct  64   KGLEAVETEIKDLDWESTFFLKHLPISNISEVPDLEDEYRKIMKEFAEKLEKLAEQLLDL  123

Query  480  lcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LCENLGLE+GY+KKAF GS GP FGTKVSNYPPCPK
Sbjct  124  LCENLGLEQGYIKKAFYGSNGPTFGTKVSNYPPCPK  159



>gb|ACO91560.1| 1-aminocyclopropane-1-carboxylate oxidase [Paeonia suffruticosa]
Length=312

 Score =   238 bits (606),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 129/167 (77%), Positives = 149/167 (89%), Gaps = 3/167 (2%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            MA+FP+INL +LN EER A ME I DACENWGFFE+V+HGIS E MDTVEKLTK+HYKKC
Sbjct  1    MANFPVINLEKLNGEERAATMEIINDACENWGFFEIVNHGISPEFMDTVEKLTKEHYKKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQ+FKE+VA+K   A++TEIND+DWESTF L+HLP+SN++EIPDL+D YRKVMKEFA +
Sbjct  61   MEQKFKELVASK---ALETEINDMDWESTFHLRHLPISNMAEIPDLDDEYRKVMKEFASK  117

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            +E LAE LLDL+CENLGLEKGYLKKAF GSKGP FGTKVSNYPPCPK
Sbjct  118  IETLAEELLDLICENLGLEKGYLKKAFYGSKGPTFGTKVSNYPPCPK  164



>ref|XP_009365121.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase [Pyrus x 
bretschneideri]
 ref|XP_009365122.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase [Pyrus x 
bretschneideri]
 dbj|BAD61000.1| 1-aminocyclopropane-1-carboxylate oxidase [Pyrus pyrifolia]
Length=322

 Score =   238 bits (607),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 127/166 (77%), Positives = 147/166 (89%), Gaps = 0/166 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M +FP+INL  LN E R A ME+IKDACENWGFFELV HGI  EL+DTVE+LTK+HYK+C
Sbjct  1    MENFPVINLESLNGEGRKATMEKIKDACENWGFFELVSHGIPTELLDTVERLTKEHYKQC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            +EQRFKE+VA+KGL+ VQTE+ D+DWESTF L+HLP SNISE+PDL+D YR VMKEFA++
Sbjct  61   LEQRFKELVASKGLEGVQTEVKDMDWESTFHLRHLPQSNISEVPDLKDEYRNVMKEFALK  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCP  584
            LEKLAE LLDLLCENLGLE+GYLKKAF G+KGP FGTKVSNYPPCP
Sbjct  121  LEKLAEQLLDLLCENLGLEQGYLKKAFYGTKGPTFGTKVSNYPPCP  166



>gb|AFJ75135.1| ACC oxidase, partial [Malus domestica]
Length=300

 Score =   237 bits (605),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 132/160 (83%), Positives = 146/160 (91%), Gaps = 0/160 (0%)
 Frame = +3

Query  108  NLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKCMEQRFKE  287
            +L+ +N EER A +E+I DACENWGFFELV+HG+S EL+DTVEK+TKDHYKK MEQRFKE
Sbjct  1    DLSLVNGEERAATLEKINDACENWGFFELVNHGMSTELLDTVEKMTKDHYKKTMEQRFKE  60

Query  288  MVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMeleklaen  467
            MVAAKGLD VQ+EI+DLDWESTFFL+HLP SNISEIPDLE+ YRK MKEFA+ELEKLAE 
Sbjct  61   MVAAKGLDDVQSEIHDLDWESTFFLRHLPSSNISEIPDLEEDYRKTMKEFAVELEKLAEK  120

Query  468  lldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LLDLLCENLGLEKGYLKK F GSKGPNFGTKVSNYPPCPK
Sbjct  121  LLDLLCENLGLEKGYLKKVFYGSKGPNFGTKVSNYPPCPK  160



>dbj|BAA83466.1| ACC oxidase [Nicotiana tabacum]
Length=319

 Score =   238 bits (606),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 128/167 (77%), Positives = 146/167 (87%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M +FPIINL +LN  ER   ME IKDACENWGFFELV+HGI  E+MDTVEK+TK HYKKC
Sbjct  1    MENFPIINLEKLNGSERADTMEMIKDACENWGFFELVNHGIPHEVMDTVEKMTKGHYKKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRFKE+VA+KGL+AVQ E+ DLDWESTFFL+HLPVSNI E+PDL+D YR+VM++FA  
Sbjct  61   MEQRFKELVASKGLEAVQAEVTDLDWESTFFLRHLPVSNICEVPDLDDQYREVMRDFAQR  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LEKLAE LLDLLCENLGLEKGYLKK F G++GPNFG KVSNYPPCP+
Sbjct  121  LEKLAEELLDLLCENLGLEKGYLKKIFYGTQGPNFGAKVSNYPPCPQ  167



>emb|CAI64499.1| 1-aminocyclopropane-1-carboxylate oxidase 1 [Prunus domestica 
subsp. syriaca]
Length=319

 Score =   238 bits (606),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 127/166 (77%), Positives = 147/166 (89%), Gaps = 0/166 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M +FPIINL  LN E R A ME+IKDACENWGFFELV HGI  E +DTVE+LTK+HY++C
Sbjct  1    MENFPIINLLGLNGEGRKATMEKIKDACENWGFFELVSHGIPTEFLDTVERLTKEHYRQC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            +EQRFKE+VA+KGL+AV+TE+ND+DWESTF L+HLP SNISE+PDLED YR VMKEFA++
Sbjct  61   LEQRFKELVASKGLEAVKTEVNDMDWESTFHLRHLPKSNISEVPDLEDQYRNVMKEFALK  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCP  584
            LEKLAE LLDLLCENLGLE+GYLKKAF G+ GP FGTKVSNYPPCP
Sbjct  121  LEKLAEQLLDLLCENLGLEQGYLKKAFYGTNGPTFGTKVSNYPPCP  166



>gb|AIR72293.1| 1-amino-cyclopropane-1-carboxylic acid oxidase [Prunus salicina]
Length=319

 Score =   238 bits (606),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 126/166 (76%), Positives = 148/166 (89%), Gaps = 0/166 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M +FPIINL  L+ E R A ME+IKDACENWGFFELV HGI  E +DTVE+LTK+HY++C
Sbjct  1    MENFPIINLEGLDGEGRKATMEKIKDACENWGFFELVSHGIPTEFLDTVERLTKEHYRQC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            +EQRFKE+VA+KGL+AV+TE+ND+DWESTF+L+HLP SNISE+PDLED YR VMKEFA++
Sbjct  61   LEQRFKELVASKGLEAVKTEVNDMDWESTFYLRHLPKSNISEVPDLEDQYRNVMKEFALK  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCP  584
            LEKLAE LLDLLCENLGLE+GYLKKAF G+ GP FGTKVSNYPPCP
Sbjct  121  LEKLAEQLLDLLCENLGLEQGYLKKAFYGTNGPTFGTKVSNYPPCP  166



>gb|ACX71872.1| ACC oxidase 1 [Lithospermum erythrorhizon]
Length=317

 Score =   238 bits (606),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 133/167 (80%), Positives = 147/167 (88%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M +FPIINL +LN +ER A ME IKDACE WGFFELV+HGIS +LMDTVE+LTK HYKK 
Sbjct  1    MEAFPIINLEKLNGDERGATMEMIKDACEKWGFFELVNHGISHDLMDTVERLTKGHYKKS  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            ME RFKEMVA+KGLDAVQ EINDLDWESTFFLKHLP+ NISE+PDL+D YR+ M++FA E
Sbjct  61   MEHRFKEMVASKGLDAVQAEINDLDWESTFFLKHLPLPNISEVPDLDDEYRETMRQFAKE  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LEKLAE+LLDLLCENLGLEKGYLK AF GSKGP FGTKVSNYP CPK
Sbjct  121  LEKLAEDLLDLLCENLGLEKGYLKNAFYGSKGPTFGTKVSNYPECPK  167



>gb|AFJ75134.1| ACC oxidase, partial [Malus domestica]
Length=301

 Score =   237 bits (604),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 132/160 (83%), Positives = 146/160 (91%), Gaps = 0/160 (0%)
 Frame = +3

Query  108  NLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKCMEQRFKE  287
            +L+ +N EER A +E+I DACENWGFFELV+HG+S EL+DTVEK+TKDHYKK MEQRFKE
Sbjct  1    DLSLVNGEERAATLEKINDACENWGFFELVNHGMSTELLDTVEKMTKDHYKKTMEQRFKE  60

Query  288  MVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMeleklaen  467
            MVAAKGLD VQ+EI+DLDWESTFFL+HLP SNISEIPDLE+ YRK MKEFA+ELEKLAE 
Sbjct  61   MVAAKGLDDVQSEIHDLDWESTFFLRHLPSSNISEIPDLEEDYRKTMKEFAVELEKLAEK  120

Query  468  lldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LLDLLCENLGLEKGYLKK F GSKGPNFGTKVSNYPPCPK
Sbjct  121  LLDLLCENLGLEKGYLKKVFYGSKGPNFGTKVSNYPPCPK  160



>gb|KDP30812.1| hypothetical protein JCGZ_13755 [Jatropha curcas]
Length=319

 Score =   237 bits (605),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 130/165 (79%), Positives = 147/165 (89%), Gaps = 1/165 (1%)
 Frame = +3

Query  96   FPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKCMEQ  275
            FP+IN+ +LN +ER A M +IKDACENWGFFEL++HGI+ E +DTVE+LTK HY+KCMEQ
Sbjct  3    FPVINMEKLNGDERAATMAKIKDACENWGFFELLNHGIAPEFLDTVERLTKAHYRKCMEQ  62

Query  276  RFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMelek  455
            RFKEMVA+KGLDA QTEI D+DWESTFFL+HLP SNI+EIPDL+D YRKVMKEFA +LEK
Sbjct  63   RFKEMVASKGLDATQTEIKDMDWESTFFLRHLPQSNIAEIPDLDDEYRKVMKEFAAQLEK  122

Query  456  laenlldllcenlgleKGYLKKAFSGSKG-PNFGTKVSNYPPCPK  587
            LAE LLDLLCENLGLEKGYLKKAF GS G P FGTKVSNYPPCPK
Sbjct  123  LAEELLDLLCENLGLEKGYLKKAFYGSSGSPTFGTKVSNYPPCPK  167



>gb|ADK39027.1| 1-aminocyclopropane-1-carboxylic acid oxidase [Betula luminifera]
Length=318

 Score =   237 bits (605),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 127/167 (76%), Positives = 152/167 (91%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            MA+FP+I++ +LN EER   ME I+DACENWGFFELV+HGIS +L+DTVEKL K+HY+KC
Sbjct  1    MATFPVIDMEKLNGEERGETMELIEDACENWGFFELVNHGISHDLLDTVEKLNKEHYRKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            ME+RFK+MVA+KGL+A Q+E++D+DWESTFFL+HLP SNISEIPDL++ YRK MKEFA +
Sbjct  61   MEERFKDMVASKGLEAAQSEVSDMDWESTFFLRHLPASNISEIPDLDEDYRKAMKEFAED  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LEKLAE LLDLLCENLGLEKGYLKK+F GSKGPNFGTKVS+YPPCPK
Sbjct  121  LEKLAEQLLDLLCENLGLEKGYLKKSFYGSKGPNFGTKVSSYPPCPK  167



>gb|ACU20024.1| unknown [Glycine max]
Length=235

 Score =   234 bits (597),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 127/166 (77%), Positives = 147/166 (89%), Gaps = 0/166 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M +FP+INL +LN EER   ME+IKDACENWGFFELV+HGI  +L+DTVE+LTK+HY+KC
Sbjct  1    MTNFPVINLEKLNGEERNDTMEKIKDACENWGFFELVNHGIPHDLLDTVERLTKEHYRKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            ME+RFKE +A+KGLDAVQTE+ D+DWESTF L+HLP  NISEIPDL D YRKVMK+FA+ 
Sbjct  61   MEERFKEFMASKGLDAVQTEVKDMDWESTFHLRHLPEPNISEIPDLIDEYRKVMKDFALR  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCP  584
            LEKLAE LLDLLCENLGLEKGYLKKAF GS+GP FGTKV+NYPPCP
Sbjct  121  LEKLAEQLLDLLCENLGLEKGYLKKAFYGSRGPTFGTKVANYPPCP  166



>ref|XP_002535327.1| 1-aminocyclopropane-1-carboxylate oxidase, putative [Ricinus 
communis]
 gb|EEF27056.1| 1-aminocyclopropane-1-carboxylate oxidase, putative [Ricinus 
communis]
Length=315

 Score =   237 bits (604),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 130/167 (78%), Positives = 150/167 (90%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M  FP+++L++LN EE+   ME IKDACENWGFFELV+HGIS EL+D VE+LTK+HYKK 
Sbjct  1    MECFPVVDLSKLNGEEKKPTMELIKDACENWGFFELVNHGISHELLDIVERLTKEHYKKF  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRFKEMVA+KGL+AVQ+EINDLDWESTFFL+HLP+SN++EIPDL++ YR  MKEFA E
Sbjct  61   MEQRFKEMVASKGLEAVQSEINDLDWESTFFLRHLPISNMAEIPDLDEEYRNTMKEFAKE  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LEKLAE LLDLLCENLGLE+GYLKKAF GSKGP FGTKVSNYPPCPK
Sbjct  121  LEKLAEKLLDLLCENLGLEQGYLKKAFYGSKGPTFGTKVSNYPPCPK  167



>dbj|BAB89352.1| 1-aminocyclopropane-1-carboxylate oxidase [Diospyros kaki]
Length=320

 Score =   237 bits (604),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 128/167 (77%), Positives = 149/167 (89%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M +FP+IN+  LN E R A ME++++ACENWGFFE+V+HGIS ELMD+VE+LTK+HYKK 
Sbjct  1    MEAFPVINMEILNGEGREAAMEKLRNACENWGFFEVVNHGISHELMDSVERLTKEHYKKF  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRFKEMVA+KGL+ VQ+EINDLDWESTFFL+HLP SN+SE+PDLED Y+K MKEFA +
Sbjct  61   MEQRFKEMVASKGLEVVQSEINDLDWESTFFLRHLPSSNLSELPDLEDDYKKAMKEFAED  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LEKLAE LLD LCENLGLEKGYLKKAF GSKGP FGTKVSNYPPCP+
Sbjct  121  LEKLAEQLLDYLCENLGLEKGYLKKAFYGSKGPTFGTKVSNYPPCPR  167



>ref|XP_006595831.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase-like [Glycine 
max]
Length=315

 Score =   236 bits (603),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 128/166 (77%), Positives = 148/166 (89%), Gaps = 0/166 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M +FP+INL +LN EER   ME+IKDACENWGFFELV+HGI  +L+DTVE+LTK+HY+KC
Sbjct  1    MTNFPVINLEKLNGEERNDTMEKIKDACENWGFFELVNHGIPHDLLDTVERLTKEHYRKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            ME+RFKE +A+KGLDAVQTE+ D+DWESTF L+HLP SNISEIPDL D YRKVMK+FA+ 
Sbjct  61   MEERFKEFMASKGLDAVQTEVKDMDWESTFHLRHLPESNISEIPDLIDEYRKVMKDFALR  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCP  584
            LEKLAE LLDLLCENLGLEKGYLKKAF GS+GP FGTKV+NYPPCP
Sbjct  121  LEKLAEQLLDLLCENLGLEKGYLKKAFYGSRGPTFGTKVANYPPCP  166



>gb|AAB02051.1| 1-aminocyclopropane-1-carboxylate oxidase [Carica papaya]
Length=310

 Score =   236 bits (602),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 126/167 (75%), Positives = 149/167 (89%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M +FP+IN+  LN EER A M++I+DACENWGFFELV+HGI IEL+DTVE+LTK HY+KC
Sbjct  1    MENFPVINMEGLNGEERAATMKKIEDACENWGFFELVNHGIPIELLDTVERLTKGHYRKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRFKE++A+KGLD +QTE+ D+DWESTFF  HLP  NI+EIPDL+D YRKVMKEFA++
Sbjct  61   MEQRFKEIMASKGLDGIQTEVTDMDWESTFFNCHLPEPNIAEIPDLDDEYRKVMKEFALK  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LEK+AE LLDLLCENLGLEKGYLKKAF+ S+GP FGTKVSNYPPCPK
Sbjct  121  LEKIAEELLDLLCENLGLEKGYLKKAFTWSRGPTFGTKVSNYPPCPK  167



>gb|KHN44756.1| 1-aminocyclopropane-1-carboxylate oxidase [Glycine soja]
Length=315

 Score =   236 bits (603),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 128/166 (77%), Positives = 148/166 (89%), Gaps = 0/166 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M +FP+INL +LN EER   ME+IKDACENWGFFELV+HGI  +L+DTVE+LTK+HY+KC
Sbjct  1    MTNFPVINLEKLNGEERNDTMEKIKDACENWGFFELVNHGIPHDLLDTVERLTKEHYRKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            ME+RFKE +A+KGLDAVQTE+ D+DWESTF L+HLP SNISEIPDL D YRKVMK+FA+ 
Sbjct  61   MEERFKEFMASKGLDAVQTEVKDMDWESTFHLRHLPESNISEIPDLIDEYRKVMKDFALR  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCP  584
            LEKLAE LLDLLCENLGLEKGYLKKAF GS+GP FGTKV+NYPPCP
Sbjct  121  LEKLAEQLLDLLCENLGLEKGYLKKAFYGSRGPTFGTKVANYPPCP  166



>sp|Q08506.1|ACCO1_PETHY RecName: Full=1-aminocyclopropane-1-carboxylate oxidase 1; Short=ACC 
oxidase 1; Short=ACCO; AltName: Full=Ethylene-forming 
enzyme; Short=EFE [Petunia x hybrida]
 gb|AAC37381.1| 1-aminocyclopropane-1-carboxylate oxidase [Petunia x hybrida]
Length=319

 Score =   236 bits (603),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 128/167 (77%), Positives = 147/167 (88%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M +FPII+L ++N  ER A ME IKDACENWGFFELV+HGI  E+MDTVEK+TK HYKKC
Sbjct  1    MENFPIISLDKVNGVERAATMEMIKDACENWGFFELVNHGIPREVMDTVEKMTKGHYKKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRFKE+VA+K L+ VQ E+ D+DWESTFFLKHLP+SNISE+PDL++ YR+VM++FA  
Sbjct  61   MEQRFKELVASKALEGVQAEVTDMDWESTFFLKHLPISNISEVPDLDEEYREVMRDFAKR  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LEKLAE LLDLLCENLGLEKGYLK AF GSKGPNFGTKVSNYPPCPK
Sbjct  121  LEKLAEELLDLLCENLGLEKGYLKNAFYGSKGPNFGTKVSNYPPCPK  167



>ref|XP_007049183.1| Ethylene-forming enzyme [Theobroma cacao]
 gb|EOX93340.1| Ethylene-forming enzyme [Theobroma cacao]
Length=316

 Score =   236 bits (603),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 124/166 (75%), Positives = 149/166 (90%), Gaps = 0/166 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            MA+FP+INLA+LN EER A ME+IKDACENWGFFEL++HGI  + +D+VE+LTK+HYKK 
Sbjct  1    MATFPVINLAKLNGEERAATMEKIKDACENWGFFELLNHGIPHDFLDSVERLTKEHYKKS  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRF+E+VA+K L+ +Q E+ D+DWESTFFL+HLP SN++EIPDL D YRKVMKEFA++
Sbjct  61   MEQRFQELVASKALEGLQAEVTDMDWESTFFLRHLPESNMAEIPDLADEYRKVMKEFALK  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCP  584
            LEKLAE LLDLLCENLG+EKGYLKKAF GS+GP FGTKVSNYPPCP
Sbjct  121  LEKLAEELLDLLCENLGVEKGYLKKAFYGSRGPTFGTKVSNYPPCP  166



>ref|XP_004507658.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase-like [Cicer 
arietinum]
Length=315

 Score =   236 bits (603),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 127/167 (76%), Positives = 147/167 (88%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M  FP++++ +LNTEE+ + ME IKDACENW FFELV+HGIS ELMDTVE+LTK++YK+C
Sbjct  1    MEKFPVVDMGKLNTEEKTSTMEMIKDACENWSFFELVNHGISTELMDTVERLTKENYKQC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRF++MVA+KGL+  Q EIN LDWESTFFL HLP+SNISEIPDL   YRK MKEFA+E
Sbjct  61   MEQRFRKMVASKGLETAQYEINYLDWESTFFLSHLPLSNISEIPDLHHDYRKAMKEFAVE  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LEK+AE LL+LLCENLGLEKGYLKK F GSKGPNFGTKVSNYPPCPK
Sbjct  121  LEKVAELLLNLLCENLGLEKGYLKKVFYGSKGPNFGTKVSNYPPCPK  167



>gb|AFJ75133.1| ACC oxidase, partial [Malus domestica]
Length=301

 Score =   236 bits (601),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 131/160 (82%), Positives = 146/160 (91%), Gaps = 0/160 (0%)
 Frame = +3

Query  108  NLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKCMEQRFKE  287
            +L+ +N EER A +E+I DACENWGFFELV+HG+S EL+DTVEK+TKDHYKK MEQRFKE
Sbjct  1    DLSLVNGEERAATLEKINDACENWGFFELVNHGMSTELLDTVEKMTKDHYKKTMEQRFKE  60

Query  288  MVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMeleklaen  467
            MVAAKGLD VQ+EI+DLDWESTFFL+HLP SNISEIPDLE+ YRK MKEFA+ELEKLAE 
Sbjct  61   MVAAKGLDDVQSEIHDLDWESTFFLRHLPSSNISEIPDLEEEYRKTMKEFAVELEKLAEK  120

Query  468  lldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LLDLLCENLGLEKGYL+K F GSKGPNFGTKVSNYPPCPK
Sbjct  121  LLDLLCENLGLEKGYLEKVFYGSKGPNFGTKVSNYPPCPK  160



>dbj|BAC53656.1| 1-aminocyclopropene-1-carboxylate oxidase [Malus domestica]
Length=322

 Score =   236 bits (603),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 126/166 (76%), Positives = 146/166 (88%), Gaps = 0/166 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M +FP+INL  LN E R A ME+IKDACENWGFFELV HGI  E +DTVE+LTK+HYK+C
Sbjct  1    MENFPVINLESLNGEGRKATMEKIKDACENWGFFELVSHGIPTEFLDTVERLTKEHYKQC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            +EQRFKE+VA+KGL+ VQTE+ D+DWESTF L+HLP SNISE+PDL+D YR VMKEFA++
Sbjct  61   LEQRFKELVASKGLEGVQTEVKDMDWESTFHLRHLPQSNISEVPDLKDEYRNVMKEFALK  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCP  584
            LEKLAE LLDLLCENLGLE+GYLKKAF G+KGP FGTKVSNYPPCP
Sbjct  121  LEKLAEQLLDLLCENLGLEQGYLKKAFYGTKGPTFGTKVSNYPPCP  166



>ref|XP_010057880.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase [Eucalyptus 
grandis]
 gb|KCW75225.1| hypothetical protein EUGRSUZ_E03977 [Eucalyptus grandis]
Length=317

 Score =   236 bits (602),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 128/167 (77%), Positives = 150/167 (90%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M SFP+I+L +LN EER A M +IKDACENWGFFELV+HGIS +LMD VE+LTK+HY KC
Sbjct  1    MESFPVIDLEKLNGEERGATMAKIKDACENWGFFELVNHGISHQLMDGVERLTKEHYAKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            ME +FK+MVA+KGL+A Q+E++D+DWESTF L+HLPVSNISE+PDLED +RK MK+FA+E
Sbjct  61   MEHKFKQMVASKGLEAAQSEVDDIDWESTFHLRHLPVSNISEVPDLEDDHRKAMKQFALE  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LEKLAE LLDLLCENLGLEKGYLK+AF GSKGP FGTKVSNYPPCPK
Sbjct  121  LEKLAELLLDLLCENLGLEKGYLKRAFYGSKGPTFGTKVSNYPPCPK  167



>gb|ACU24333.1| unknown [Glycine max]
Length=217

 Score =   233 bits (593),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 126/166 (76%), Positives = 148/166 (89%), Gaps = 0/166 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M +FP+INL +L+ EER   ME+IKDACENWGFFELV+HGI  +++D VE+LTK+HY+KC
Sbjct  1    MTNFPLINLEKLSGEERNDTMEKIKDACENWGFFELVNHGIPHDILDIVERLTKEHYRKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            ME+RFKE+VA+KGLDAVQTE+ D+DWESTF L+HLP SNISEIPDL D YRKVMK+FA+ 
Sbjct  61   MEERFKELVASKGLDAVQTEVKDMDWESTFHLRHLPESNISEIPDLIDEYRKVMKDFALR  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCP  584
            LEKLAE LLDLLCENLGLEKGYLKKAF GS+GP FGTKV+NYPPCP
Sbjct  121  LEKLAEQLLDLLCENLGLEKGYLKKAFYGSRGPTFGTKVANYPPCP  166



>ref|XP_008348143.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase [Malus domestica]
 ref|XP_008348145.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase [Malus domestica]
Length=322

 Score =   236 bits (603),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 126/166 (76%), Positives = 146/166 (88%), Gaps = 0/166 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M +FP+INL  LN E R A ME+IKDACENWGFFELV HGI  E +DTVE+LTK+HYK+C
Sbjct  1    MENFPVINLESLNGEGRKATMEKIKDACENWGFFELVSHGIPTEFLDTVERLTKEHYKQC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            +EQRFKE+VA+KGL+ VQTE+ D+DWESTF L+HLP SNISE+PDL+D YR VMKEFA++
Sbjct  61   LEQRFKELVASKGLEGVQTEVKDMDWESTFHLRHLPQSNISEVPDLKDEYRNVMKEFALK  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCP  584
            LEKLAE LLDLLCENLGLE+GYLKKAF G+KGP FGTKVSNYPPCP
Sbjct  121  LEKLAEQLLDLLCENLGLEQGYLKKAFYGTKGPTFGTKVSNYPPCP  166



>gb|ABW91147.1| ACC oxidase 2 [Ziziphus jujuba]
Length=321

 Score =   236 bits (602),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 127/167 (76%), Positives = 147/167 (88%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M +FP+I++ +LN EER A ME+I DACENWGFFELV+HGI+ E MDTVE+ TK+HY+KC
Sbjct  1    MENFPVIDMEKLNGEERAATMEKINDACENWGFFELVNHGIAPEFMDTVERQTKEHYRKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRFKEMV +KGL+ VQ+EI+DLDWESTFF++HLPV NISEIPDL + YRK MKEFA +
Sbjct  61   MEQRFKEMVESKGLEVVQSEIDDLDWESTFFVRHLPVPNISEIPDLHEGYRKAMKEFAAQ  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            +EKLAE LLDLLCENLGLEKGYLKKAF GS GP FGTKVSNYPPCPK
Sbjct  121  IEKLAEQLLDLLCENLGLEKGYLKKAFYGSNGPTFGTKVSNYPPCPK  167



>gb|KHG21578.1| 1-aminocyclopropane-1-carboxylate oxidase 3 [Gossypium arboreum]
Length=317

 Score =   236 bits (602),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 123/166 (74%), Positives = 148/166 (89%), Gaps = 0/166 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            MA+FP+INL +LN +ER  IMEQIKDACENWGFFE+++HGI  + MDTVE+LTK+HYKKC
Sbjct  1    MATFPVINLEKLNGDERSRIMEQIKDACENWGFFEVMNHGIPHDFMDTVERLTKEHYKKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRFKE+VA+K L+ ++ E+ D+DWESTF+L+HLP SN++EIPDL D YRKVMKEFA++
Sbjct  61   MEQRFKELVASKALEGLEAEVTDMDWESTFYLRHLPESNMAEIPDLSDEYRKVMKEFAVK  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCP  584
            LEKLAE LLDL CEN+GLEKGYLKKAF G+KGP FGTKVSNYPPCP
Sbjct  121  LEKLAEELLDLFCENIGLEKGYLKKAFYGAKGPTFGTKVSNYPPCP  166



>ref|XP_010522369.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase 4 [Tarenaya 
hassleriana]
Length=318

 Score =   236 bits (602),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 127/167 (76%), Positives = 147/167 (88%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M +FPIINL +LN +ER A M+ IKDACENWGFFE V+HGI  EL+D VEK+TK+HY+KC
Sbjct  1    MENFPIINLEKLNGDERAATMDLIKDACENWGFFECVNHGIPHELLDRVEKMTKEHYRKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            ME+RFKE++  +GLDAVQ+E+ND+DWESTFFLKHLP+SNIS+IPDL D YR VMKEFA +
Sbjct  61   MEERFKELMKERGLDAVQSEVNDVDWESTFFLKHLPISNISDIPDLHDDYRAVMKEFAAK  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LEKLAE LLDLLC+NLGLEKGYLKK F GSKGP FGTKVSNYPPCPK
Sbjct  121  LEKLAEELLDLLCQNLGLEKGYLKKMFYGSKGPTFGTKVSNYPPCPK  167



>gb|AGV54270.1| 1-aminocyclopropane-1-carboxylic acid oxidase [Phaseolus vulgaris]
Length=315

 Score =   236 bits (601),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 126/166 (76%), Positives = 149/166 (90%), Gaps = 0/166 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M++FP+IN  +LN EER  IME+IKDACENWGFFELVDHGI  +L+DTVE+LTK+HY+KC
Sbjct  1    MSNFPVINFEKLNGEERKDIMEKIKDACENWGFFELVDHGIPHDLLDTVERLTKEHYEKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            ME+RFKE +A+KGL+A+QTE+ D+DWESTF L+HLP SNISE+PDL D YRKVMK+FA+ 
Sbjct  61   MEERFKESMASKGLEAIQTEVKDMDWESTFHLRHLPESNISEVPDLVDEYRKVMKDFALR  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCP  584
            LEKLAE LLDLLCENLGLEKGYLKKAF GS+GP FGTKV+NYPPCP
Sbjct  121  LEKLAEQLLDLLCENLGLEKGYLKKAFYGSRGPTFGTKVANYPPCP  166



>ref|XP_007141655.1| hypothetical protein PHAVU_008G214200g [Phaseolus vulgaris]
 gb|ESW13649.1| hypothetical protein PHAVU_008G214200g [Phaseolus vulgaris]
Length=315

 Score =   236 bits (601),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 126/166 (76%), Positives = 149/166 (90%), Gaps = 0/166 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M++FP+IN  +LN EER  IME+IKDACENWGFFELVDHGI  +L+DTVE+LTK+HY+KC
Sbjct  1    MSNFPVINFEKLNGEERKDIMEKIKDACENWGFFELVDHGIPHDLLDTVERLTKEHYEKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            ME+RFKE +A+KGL+A+QTE+ D+DWESTF L+HLP SNISE+PDL D YRKVMK+FA+ 
Sbjct  61   MEERFKESMASKGLEAIQTEVKDMDWESTFHLRHLPESNISEVPDLVDEYRKVMKDFALR  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCP  584
            LEKLAE LLDLLCENLGLEKGYLKKAF GS+GP FGTKV+NYPPCP
Sbjct  121  LEKLAEQLLDLLCENLGLEKGYLKKAFYGSRGPTFGTKVANYPPCP  166



>ref|XP_006584893.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase-like [Glycine 
max]
Length=310

 Score =   235 bits (600),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 126/166 (76%), Positives = 146/166 (88%), Gaps = 0/166 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M +FP+INL  LN EER  I+EQI+DACENWGFFELV+HGI  EL+D VE+LTK+HY+KC
Sbjct  1    MENFPVINLENLNGEERKTILEQIEDACENWGFFELVNHGIPHELLDIVERLTKEHYRKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRFKE VA+KGL+ +Q E+ D++WESTFFL+HLP SNIS+IPDL + YRKVMKEFA +
Sbjct  61   MEQRFKEAVASKGLEGIQAEVKDMNWESTFFLRHLPDSNISQIPDLSEEYRKVMKEFAQK  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCP  584
            LEKLAE LLDLLCENLGLEKGYLKK F GSKGPNFGTKV+NYPPCP
Sbjct  121  LEKLAEKLLDLLCENLGLEKGYLKKVFYGSKGPNFGTKVANYPPCP  166



>ref|XP_003519448.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase [Glycine 
max]
 gb|KHN38495.1| 1-aminocyclopropane-1-carboxylate oxidase [Glycine soja]
Length=315

 Score =   235 bits (600),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 127/166 (77%), Positives = 149/166 (90%), Gaps = 0/166 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M +FP+INL +L+ EER   ME+IKDACENWGFFELV+HGI  +++DTVE+LTK+HY+KC
Sbjct  1    MTNFPLINLEKLSGEERNDTMEKIKDACENWGFFELVNHGIPHDILDTVERLTKEHYRKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            ME+RFKE+VA+KGLDAVQTE+ D+DWESTF L+HLP SNISEIPDL D YRKVMK+FA+ 
Sbjct  61   MEERFKELVASKGLDAVQTEVKDMDWESTFHLRHLPESNISEIPDLIDEYRKVMKDFALR  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCP  584
            LEKLAE LLDLLCENLGLEKGYLKKAF GS+GP FGTKV+NYPPCP
Sbjct  121  LEKLAEQLLDLLCENLGLEKGYLKKAFYGSRGPTFGTKVANYPPCP  166



>gb|ABC69167.2| 1-aminocyclopropane-1-carboxylate oxidase [Paeonia suffruticosa]
Length=312

 Score =   235 bits (600),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 128/167 (77%), Positives = 148/167 (89%), Gaps = 3/167 (2%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            MA+FP+INL +LN  ER A ME I DACENWGFFE+V+HGIS E MDTVEKLTK+HYKKC
Sbjct  1    MANFPVINLEKLNGGERAATMEIINDACENWGFFEIVNHGISPEFMDTVEKLTKEHYKKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQ+FKE+VA+K   A++TEIND+DWESTF L+HLP+SN++EIPDL+D YRKVMKEFA +
Sbjct  61   MEQKFKELVASK---ALETEINDMDWESTFHLRHLPISNMAEIPDLDDEYRKVMKEFASK  117

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            +E LAE LLDL+CENLGLEKGYLKKAF GSKGP FGTKVSNYPPCPK
Sbjct  118  IETLAEELLDLICENLGLEKGYLKKAFYGSKGPTFGTKVSNYPPCPK  164



>gb|AAC67233.1| ACC oxidase 2 [Cucumis sativus]
Length=318

 Score =   235 bits (600),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 126/164 (77%), Positives = 144/164 (88%), Gaps = 0/164 (0%)
 Frame = +3

Query  96   FPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKCMEQ  275
            FP+IN+  LN E R + + QI D CENWGFFELV+HGI  ELMD VEK+TK+HY+KCMEQ
Sbjct  3    FPVINMNNLNGESRVSFLNQINDVCENWGFFELVNHGIPHELMDKVEKMTKEHYRKCMEQ  62

Query  276  RFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMelek  455
            RFKEMVA+KGLD+V+TEIND DWESTFFL+HLPVSN+SEI DL++ Y+KVMKEFA ELEK
Sbjct  63   RFKEMVASKGLDSVETEINDTDWESTFFLRHLPVSNMSEIGDLDEEYKKVMKEFAAELEK  122

Query  456  laenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LA  +L+LLCENLGLEKGYLKK F GSKGPNFGTKVSNYPPCPK
Sbjct  123  LAXEILNLLCENLGLEKGYLKKVFYGSKGPNFGTKVSNYPPCPK  166



>dbj|BAD60998.1| 1-aminocyclopropane-1-carboxylate oxidase [Pyrus pyrifolia]
 gb|AFA46528.1| ACC oxidase [Pyrus pyrifolia]
Length=322

 Score =   235 bits (600),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 123/166 (74%), Positives = 148/166 (89%), Gaps = 0/166 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M +FP+INL  LN E R A ME+IKDACENWGFFELV HGI  E +DTVE+LTK+HY++C
Sbjct  1    MENFPVINLESLNGEGRKATMEKIKDACENWGFFELVSHGIPTEFLDTVERLTKEHYRQC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            +EQ+FKE+VA+KGL+AV+TE+ND+DWESTF+L+HLP SNIS++PDL+D YR VMKEFA++
Sbjct  61   LEQKFKELVASKGLEAVKTEVNDMDWESTFYLRHLPQSNISQVPDLKDEYRNVMKEFALK  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCP  584
            LEKLAE LLDLLCENLGLE+GYLKKAF G+ GP FGTKVSNYPPCP
Sbjct  121  LEKLAEQLLDLLCENLGLEQGYLKKAFYGTNGPTFGTKVSNYPPCP  166



>gb|KDP30813.1| hypothetical protein JCGZ_13756 [Jatropha curcas]
Length=319

 Score =   235 bits (600),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 130/165 (79%), Positives = 145/165 (88%), Gaps = 1/165 (1%)
 Frame = +3

Query  96   FPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKCMEQ  275
            FP+INL +LN  ER   M +IKDACENWGFFEL++HGI+ E +DTVE+LTK HY+KCMEQ
Sbjct  3    FPVINLEKLNGGERAVTMAKIKDACENWGFFELLNHGIAPEFLDTVERLTKAHYRKCMEQ  62

Query  276  RFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMelek  455
            RFKEMVA+KGLDA QTEI D+DWESTFFL+HLP SNI+EIPDL+D YRKVMKEFA +LEK
Sbjct  63   RFKEMVASKGLDATQTEIKDMDWESTFFLRHLPQSNIAEIPDLDDEYRKVMKEFAAQLEK  122

Query  456  laenlldllcenlgleKGYLKKAFSGSKG-PNFGTKVSNYPPCPK  587
            LAE LLDLLCENLGLEKGYLKKAF GS G P FGTKVSNYPPCPK
Sbjct  123  LAEELLDLLCENLGLEKGYLKKAFYGSSGSPTFGTKVSNYPPCPK  167



>gb|AFF19571.1| 1-aminocyclopropane-1-carboxylate oxidase [Momordica charantia]
Length=317

 Score =   235 bits (599),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 126/167 (75%), Positives = 146/167 (87%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            MA FP+INL  +N + RP I+EQI+DAC NWGFFE+V+HGI  E +D VEK+T+DHYKKC
Sbjct  1    MAIFPVINLDSINGDARPKILEQIEDACRNWGFFEVVNHGIPHEFLDRVEKMTRDHYKKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            ME+RFKE VA+KGL+A Q E+ND+DWESTFFL+HLP SNISEIPDL+D YRKVMKEFA  
Sbjct  61   MEERFKETVASKGLEAAQAEVNDMDWESTFFLRHLPQSNISEIPDLDDEYRKVMKEFAKL  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LEKLAE LLD+LCENLGLE+GYLKKAF GS+GP FGTKVSNYPPCPK
Sbjct  121  LEKLAEELLDMLCENLGLEEGYLKKAFYGSQGPTFGTKVSNYPPCPK  167



>gb|AEM65196.1| ACC oxidase [Garcinia mangostana]
Length=320

 Score =   235 bits (599),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 129/167 (77%), Positives = 151/167 (90%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M SFP+++L++LN EER   ME IKDACENWGFFEL++HGIS ELMDT+E+LTK+HYKK 
Sbjct  1    MESFPVVDLSKLNGEERKPTMEIIKDACENWGFFELMNHGISHELMDTLERLTKEHYKKS  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            +E++FKE+VAAKGL+AVQ+EI DLDWESTFFL+HLPVSN+ EIPDL   YRKVMKEFA+E
Sbjct  61   LEEKFKELVAAKGLEAVQSEITDLDWESTFFLRHLPVSNMDEIPDLSLDYRKVMKEFALE  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LEKLAE LLDLLCENLGLEKGYLK+AF+G+KGP FGTKVS YPPCPK
Sbjct  121  LEKLAEKLLDLLCENLGLEKGYLKRAFNGTKGPTFGTKVSKYPPCPK  167



>ref|XP_002320487.1| 1-aminocyclopropane-1-carboxylate oxidase family protein [Populus 
trichocarpa]
 gb|ABK96069.1| unknown [Populus trichocarpa]
 gb|EEE98802.1| 1-aminocyclopropane-1-carboxylate oxidase family protein [Populus 
trichocarpa]
Length=319

 Score =   235 bits (599),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 129/165 (78%), Positives = 148/165 (90%), Gaps = 1/165 (1%)
 Frame = +3

Query  96   FPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKCMEQ  275
            FP+I++ +LN EER A ME+IKDACENWGFFEL++HGIS E +DTVE++TK+HYKKCMEQ
Sbjct  3    FPVISMEKLNGEERAATMEKIKDACENWGFFELLNHGISHEFLDTVERMTKEHYKKCMEQ  62

Query  276  RFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMelek  455
            RFKE+VA+K LD VQTEI DLDWESTF L+HLP SNI+EIPDL+D YRKVMKEFA++LEK
Sbjct  63   RFKELVASKALDGVQTEIKDLDWESTFQLRHLPKSNIAEIPDLDDEYRKVMKEFALKLEK  122

Query  456  laenlldllcenlgleKGYLKKAFSGSKG-PNFGTKVSNYPPCPK  587
            LAE LLDLLCENLGLEKGYLK+AF GS G P FGTKVSNYPPCPK
Sbjct  123  LAEELLDLLCENLGLEKGYLKRAFYGSNGSPTFGTKVSNYPPCPK  167



>emb|CAA82646.1| ethylene forming enzyme (EFE) [Nicotiana tabacum]
Length=319

 Score =   235 bits (599),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 126/167 (75%), Positives = 142/167 (85%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M +FPIINL +LN  E+ A ME IKDACENWGFFELV+HGI  E+MDTVEKLTK HYKKC
Sbjct  1    MENFPIINLEKLNGSEKAATMEMIKDACENWGFFELVNHGIPHEVMDTVEKLTKGHYKKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRFKE+VA+KGL+ VQ E+ D+DW  TFFL+HLPVSNISE+PDL+D YR+VM++FA  
Sbjct  61   MEQRFKELVASKGLEGVQAEVTDMDWVCTFFLRHLPVSNISEVPDLDDQYREVMRDFAKR  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LE LAE LL LLCENLGLEKGYLK  F GSKGPNFGTKVSNY PCPK
Sbjct  121  LENLAEELLYLLCENLGLEKGYLKNVFYGSKGPNFGTKVSNYSPCPK  167



>gb|KHG22879.1| 1-aminocyclopropane-1-carboxylate oxidase [Gossypium arboreum]
Length=319

 Score =   235 bits (599),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 128/166 (77%), Positives = 147/166 (89%), Gaps = 0/166 (0%)
 Frame = +3

Query  90   ASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKCM  269
             +FP+I+L+++N EER A M+ IKDACENWGFFEL +HGIS ELMDTVEKLTK+HYKKCM
Sbjct  3    VAFPVIDLSKINGEERGATMDMIKDACENWGFFELTNHGISHELMDTVEKLTKEHYKKCM  62

Query  270  EQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMel  449
            E RFKEMV +KGL+ VQ+EI D+DWESTFFL+HLP SN+ EIPDLE  YRKVMK+FA+EL
Sbjct  63   EDRFKEMVTSKGLEVVQSEITDMDWESTFFLRHLPESNLYEIPDLEYDYRKVMKQFAVEL  122

Query  450  eklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            EKLAE LLD+LCENLGLE+GYLKK F GSKGP FGTKVSNYPPCPK
Sbjct  123  EKLAEKLLDILCENLGLEQGYLKKVFYGSKGPTFGTKVSNYPPCPK  168



>gb|KHN00185.1| 1-aminocyclopropane-1-carboxylate oxidase [Glycine soja]
Length=310

 Score =   234 bits (598),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 126/166 (76%), Positives = 145/166 (87%), Gaps = 0/166 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M +FP+I L  LN EER  I+EQI+DACENWGFFELV+HGI  EL+D VE+LTK+HY+KC
Sbjct  1    MENFPVIKLENLNGEERKTILEQIEDACENWGFFELVNHGIPHELLDIVERLTKEHYRKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRFKE VA+KGL+ +Q E+ D+DWESTFFL+HLP SNIS+IPDL + YRKVMKEFA +
Sbjct  61   MEQRFKEAVASKGLEGIQAEVKDMDWESTFFLRHLPDSNISQIPDLSEEYRKVMKEFAQK  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCP  584
            LEKLAE LLDLLCENLGLEKGYLKK F GSKGPNFGTKV+NYPPCP
Sbjct  121  LEKLAEKLLDLLCENLGLEKGYLKKVFYGSKGPNFGTKVANYPPCP  166



>gb|KJB67282.1| hypothetical protein B456_010G184900 [Gossypium raimondii]
Length=328

 Score =   235 bits (599),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 127/173 (73%), Positives = 152/173 (88%), Gaps = 0/173 (0%)
 Frame = +3

Query  69   EERQRKMASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTK  248
            +E+ +   +FP+I+L+++N EER A M+ IKDACENWGFFEL++HGIS ELMDTVE+LTK
Sbjct  5    KEKTKMEVAFPVIDLSKINGEERGATMDMIKDACENWGFFELMNHGISHELMDTVERLTK  64

Query  249  DHYKKCMEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVM  428
            +HYKKCME+RFKEMV +KGL+ VQ+EI D+DWESTF L HLP SN+ EIPDLED YRKVM
Sbjct  65   EHYKKCMEERFKEMVTSKGLEVVQSEITDMDWESTFSLCHLPKSNLYEIPDLEDDYRKVM  124

Query  429  KEFAMeleklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            K+FA+EL+KLAE LLD+LCENLGLE+GYLKK F GSKGP FGTKVSNYPPCPK
Sbjct  125  KQFAVELKKLAEKLLDILCENLGLEQGYLKKVFYGSKGPTFGTKVSNYPPCPK  177



>ref|XP_007160495.1| hypothetical protein PHAVU_002G326600g [Phaseolus vulgaris]
 gb|ESW32489.1| hypothetical protein PHAVU_002G326600g [Phaseolus vulgaris]
Length=247

 Score =   232 bits (592),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 125/167 (75%), Positives = 148/167 (89%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            MA+FP+IN   +N E+R A +E+I+DACENWGFFELV+HGI +EL+D+VEKLTK+HY+K 
Sbjct  1    MANFPVINFENINGEKRKATLEKIEDACENWGFFELVNHGIPLELLDSVEKLTKEHYRKS  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRFKE VA+KGL+ ++ E+ D+DWESTFFL+HLP SNISEIPDL + YRK MKEFA +
Sbjct  61   MEQRFKEAVASKGLEGIKGEMKDMDWESTFFLRHLPDSNISEIPDLSEDYRKAMKEFAQK  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LEKLAE LLDLLCENLGLEKGYLKKAF GSKGPNFGTKV+NYPPCPK
Sbjct  121  LEKLAEELLDLLCENLGLEKGYLKKAFHGSKGPNFGTKVANYPPCPK  167



>dbj|BAA94601.1| 1-aminocyclopropane-1-carboxylate oxidase [Populus x canadensis]
Length=319

 Score =   234 bits (598),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 129/165 (78%), Positives = 148/165 (90%), Gaps = 1/165 (1%)
 Frame = +3

Query  96   FPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKCMEQ  275
            FP+I++ +LN EER A ME+IKDACENWGFFEL++HGIS E +DTVE++TK+HYKKCMEQ
Sbjct  3    FPVISMEKLNGEERAATMEKIKDACENWGFFELLNHGISHEFLDTVERMTKEHYKKCMEQ  62

Query  276  RFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMelek  455
            RFKE+VA+K LD VQTEI DLDWESTF L+HLP SNI+EIPDL+D YRKVMKEFA++LEK
Sbjct  63   RFKELVASKALDGVQTEIKDLDWESTFQLRHLPKSNIAEIPDLDDEYRKVMKEFALKLEK  122

Query  456  laenlldllcenlgleKGYLKKAFSGSKG-PNFGTKVSNYPPCPK  587
            LAE LLDLLCENLGLEKGYLK+AF GS G P FGTKVSNYPPCPK
Sbjct  123  LAEELLDLLCENLGLEKGYLKRAFYGSNGSPTFGTKVSNYPPCPK  167



>gb|AEM42994.1| ACC oxidase [Siraitia grosvenorii]
Length=317

 Score =   234 bits (598),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 127/167 (76%), Positives = 146/167 (87%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            MA+FP+INL  +N + R  IMEQ++DAC+NWGFFELV+HGI  E +DTVEK+T+ HYKKC
Sbjct  1    MANFPVINLENINGDGRAKIMEQLEDACQNWGFFELVNHGIPHEFLDTVEKMTRYHYKKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRFKE VA+KGL+A Q E+ D+DWESTFFL+HLP SNISEIPDL+D YRK+MKEFA +
Sbjct  61   MEQRFKETVASKGLEAAQAEVKDMDWESTFFLRHLPESNISEIPDLDDDYRKIMKEFAKK  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LEKLAE LLDLLCENLGLE GYLKKAF GSKGP FGTKVSNYPPCPK
Sbjct  121  LEKLAEELLDLLCENLGLENGYLKKAFYGSKGPTFGTKVSNYPPCPK  167



>ref|XP_006351971.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase 2-like [Solanum 
tuberosum]
Length=316

 Score =   234 bits (598),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 129/167 (77%), Positives = 144/167 (86%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M +FPIINL +LN  ER A ME+I DACENWGFFELV+HGI  E+MDTVEKLTK HYKKC
Sbjct  1    MENFPIINLEKLNGAERAATMEKINDACENWGFFELVNHGIPHEVMDTVEKLTKGHYKKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRFKE+VA KGL+ V+ E+ D+DWESTFFL+HLP SNISEIPDL+D YR+VM++FA  
Sbjct  61   MEQRFKELVAKKGLEGVEVEVTDMDWESTFFLRHLPSSNISEIPDLDDVYREVMRDFAKR  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LEKLAE LLDLLCENLGLEK YLK  F GSKGPNFGTKVSNYPPCPK
Sbjct  121  LEKLAEELLDLLCENLGLEKSYLKNTFYGSKGPNFGTKVSNYPPCPK  167



>dbj|BAD60999.1| 1-aminocyclopropane-1-carboxylate oxidase [Pyrus pyrifolia]
Length=322

 Score =   234 bits (598),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 123/166 (74%), Positives = 147/166 (89%), Gaps = 0/166 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M +FP+INL  LN E R A ME+IKDACENWGFFELV HGI  E +DTVE+LTK+HY++C
Sbjct  1    MENFPVINLESLNGEGRKATMEKIKDACENWGFFELVSHGIPTEFLDTVERLTKEHYRQC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            +EQ+FKE+VA+KGL+AVQTE+ D+DWESTF+L+HLP SNIS++PDL+D YR VMKEFA++
Sbjct  61   LEQKFKELVASKGLEAVQTEVKDMDWESTFYLRHLPQSNISQVPDLKDEYRNVMKEFALK  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCP  584
            LEKLAE LLDLLCENLGLE+GYLKKAF G+ GP FGTKVSNYPPCP
Sbjct  121  LEKLAEQLLDLLCENLGLEQGYLKKAFYGTNGPTFGTKVSNYPPCP  166



>gb|AHW85523.1| 1-aminocyclopropane-1-carboxylate oxidase, partial [Malus floribunda]
Length=301

 Score =   234 bits (596),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 130/160 (81%), Positives = 145/160 (91%), Gaps = 0/160 (0%)
 Frame = +3

Query  108  NLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKCMEQRFKE  287
            +L+ +N EER A +E+I DACENWGFFELV+HG+S EL+DTVE++TKDHYKK MEQRFKE
Sbjct  1    DLSLVNGEERAATLEKINDACENWGFFELVNHGMSTELLDTVERMTKDHYKKTMEQRFKE  60

Query  288  MVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMeleklaen  467
             VAAKGLD VQ+EI+DLDWESTFFL+HLP SNISEIPDLE+ YRK MKEFA+ELEKLAE 
Sbjct  61   TVAAKGLDDVQSEIHDLDWESTFFLRHLPSSNISEIPDLEEDYRKTMKEFAVELEKLAEK  120

Query  468  lldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LLDLLCENLGLEKGYLKK F GSKGPNFGTKVSNYPPCPK
Sbjct  121  LLDLLCENLGLEKGYLKKVFYGSKGPNFGTKVSNYPPCPK  160



>ref|XP_004172177.1| PREDICTED: LOW QUALITY PROTEIN: 1-aminocyclopropane-1-carboxylate 
oxidase 3-like [Cucumis sativus]
Length=320

 Score =   234 bits (597),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 126/164 (77%), Positives = 145/164 (88%), Gaps = 0/164 (0%)
 Frame = +3

Query  96   FPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKCMEQ  275
            FP+IN+  LN E R +++ QI DACE WGFFELV+HGI  ELMD VEK+TK+HY+KCMEQ
Sbjct  5    FPVINMNNLNGESRVSVLNQINDACETWGFFELVNHGIPHELMDKVEKMTKEHYRKCMEQ  64

Query  276  RFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMelek  455
            RF EMVA+KGLD+V+TEIND DWESTFFL+HLPVSN+SEI DL++ Y+KVMKEFA ELEK
Sbjct  65   RFXEMVASKGLDSVETEINDTDWESTFFLRHLPVSNMSEIGDLDEEYKKVMKEFAAELEK  124

Query  456  laenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LAE +L+LLCENLGLEKGYLKK F GSKGPNFGTKVSNYPPCPK
Sbjct  125  LAEEILNLLCENLGLEKGYLKKVFYGSKGPNFGTKVSNYPPCPK  168



>gb|KFK42831.1| hypothetical protein AALP_AA1G045000 [Arabis alpina]
Length=323

 Score =   234 bits (597),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 127/167 (76%), Positives = 148/167 (89%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M SFPIINL +LN EER  IME+IKDACENWGFFE V+HGIS EL+D VEK+TK+HYKKC
Sbjct  1    MESFPIINLEKLNGEERGIIMEKIKDACENWGFFECVNHGISHELLDKVEKMTKEHYKKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            ME+RFKE +  +GLD+V++E+ND+DWESTF+LKHLPVSNIS++PDLED YR +MKEFA E
Sbjct  61   MEERFKESIKNRGLDSVRSEVNDVDWESTFYLKHLPVSNISDVPDLEDDYRTLMKEFAGE  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            +EKL+E LLDLLCENLGLEKGYLKK F GSK P FGTKVSNYPPCP+
Sbjct  121  IEKLSEELLDLLCENLGLEKGYLKKVFYGSKKPTFGTKVSNYPPCPQ  167



>dbj|BAB83762.1| 1-aminocyclopropane-1-carboxylic acid oxidase [Phaseolus lunatus]
Length=315

 Score =   234 bits (596),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 124/166 (75%), Positives = 149/166 (90%), Gaps = 0/166 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M++FP+IN  +LN EER   ME+IKDACENWGFFELV+HGI  +L+DTVE+LTK+HY+KC
Sbjct  1    MSNFPVINFERLNGEERKDTMEKIKDACENWGFFELVNHGIPHDLLDTVERLTKEHYQKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            ME+RFKE++A+KGL+A+QTE+ D+DWESTF L+HLP SNISE+PDL D YRKVMK+FA+ 
Sbjct  61   MEERFKELMASKGLEAIQTEVKDMDWESTFHLRHLPESNISEVPDLVDEYRKVMKDFALR  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCP  584
            LEKLAE LLDLLCENLGLEKGYLKKAF GS+GP FGTKV+NYPPCP
Sbjct  121  LEKLAEQLLDLLCENLGLEKGYLKKAFYGSRGPTFGTKVANYPPCP  166



>gb|AAB05171.1| ACC oxidase [Nicotiana glutinosa]
Length=320

 Score =   234 bits (596),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 130/167 (78%), Positives = 147/167 (88%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M SFPI+++  LNTE+R  IME++KDACENWGF ELV+HGIS ELMDTVEKLTK+HY K 
Sbjct  1    MESFPIVDMEMLNTEQRAVIMEKLKDACENWGFLELVNHGISHELMDTVEKLTKEHYNKS  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRFKEMV  KGL+ VQTEI+DLDWES FFLKHLPVSNIS+IPDL+  YRKVMKEFA +
Sbjct  61   MEQRFKEMVTNKGLEVVQTEIDDLDWESAFFLKHLPVSNISDIPDLDHDYRKVMKEFAQK  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LEKLAE+LLDLLCENLGLE+GY KKAF G+ GP FGTKV+NYPPCPK
Sbjct  121  LEKLAEDLLDLLCENLGLEQGYQKKAFYGTFGPTFGTKVANYPPCPK  167



>gb|AAA33708.1| ethylene-forming enzyme [Petunia x hybrida]
 prf||1909343A ethylene-forming enzyme
Length=320

 Score =   234 bits (596),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 127/167 (76%), Positives = 146/167 (87%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M +FPII+L ++N  ER A ME IKDACENWGFFELV+HGI  E+MDTVEK+TK HYKKC
Sbjct  1    MENFPIISLDKVNGVERAATMEMIKDACENWGFFELVNHGIPREVMDTVEKMTKGHYKKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRFKE+VA+K L+ VQ E+ D+DWESTFFLKHLP+SNISE+PDL++ YR+VM++FA  
Sbjct  61   MEQRFKELVASKALEGVQAEVTDMDWESTFFLKHLPISNISEVPDLDEEYREVMRDFAKR  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LEKLAE LLDLLCENLGLEKGYLK AF GSKGPNFGTKVSN PPCPK
Sbjct  121  LEKLAEELLDLLCENLGLEKGYLKNAFYGSKGPNFGTKVSNLPPCPK  167



>dbj|BAH15312.1| ACC oxidase 2 [Lactuca sativa]
Length=311

 Score =   233 bits (595),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 129/159 (81%), Positives = 143/159 (90%), Gaps = 0/159 (0%)
 Frame = +3

Query  111  LAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKCMEQRFKEM  290
            + +LN EER A M  I DACENWGFFE+V HGIS EL+DTVEK+TK HYKKCME+RFKEM
Sbjct  1    MEKLNGEERSATMNLINDACENWGFFEIVHHGISTELLDTVEKMTKGHYKKCMEERFKEM  60

Query  291  VAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMeleklaenl  470
            VA+KGL+AVQ+EI DLDWESTF+L+HLP SNISEIPDLED YRKVMKEFA E+EKLAEN+
Sbjct  61   VASKGLEAVQSEIEDLDWESTFYLRHLPESNISEIPDLEDEYRKVMKEFAKEIEKLAENI  120

Query  471  ldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LD+LCENLGLEKGYLKKAF GSKGP FGTKVSNYPPCPK
Sbjct  121  LDILCENLGLEKGYLKKAFYGSKGPTFGTKVSNYPPCPK  159



>gb|AAB71421.1| 1-aminocyclopropapne-1-carboxylic acid oxidase [Helianthus annuus]
Length=307

 Score =   233 bits (594),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 127/166 (77%), Positives = 144/166 (87%), Gaps = 0/166 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            MA+FP+IN+  LN  ER   ME+I DACENWGFFELV+HGI  +L+D VEK+TKDHYKKC
Sbjct  1    MANFPVINMENLNGSERGVTMEKINDACENWGFFELVNHGIPHDLLDKVEKMTKDHYKKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRFKEMVAAK L+ V+ E+ D+DWESTFFL+H P SNISEIPDL D YR++MK+FA +
Sbjct  61   MEQRFKEMVAAKALEGVKAEVTDMDWESTFFLRHRPTSNISEIPDLVDEYRELMKDFAGK  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCP  584
            LEKLAE LLDLLCENLGLEKGYLKKAF GSKGPNFGTKVSNYPPCP
Sbjct  121  LEKLAEELLDLLCENLGLEKGYLKKAFYGSKGPNFGTKVSNYPPCP  166



>gb|ADR73046.1| ACC oxidase 2 isoform B [Nicotiana tabacum]
Length=308

 Score =   233 bits (594),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 128/156 (82%), Positives = 141/156 (90%), Gaps = 0/156 (0%)
 Frame = +3

Query  120  LNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKCMEQRFKEMVAA  299
            LNTE+R A ME IKDACENWGFFE+V HGI  EL+D VEKLTK HY KCME+RFKEMVA+
Sbjct  4    LNTEQRAATMETIKDACENWGFFEVVKHGICHELLDRVEKLTKGHYNKCMEERFKEMVAS  63

Query  300  KGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMeleklaenlldl  479
            KGL+AVQTEI DLDWESTFFLKHLP+SNIS++PDLED YRK+MKEFA +LEKLAE LL+L
Sbjct  64   KGLEAVQTEIKDLDWESTFFLKHLPLSNISQVPDLEDEYRKIMKEFADKLEKLAEQLLEL  123

Query  480  lcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LCENLGLE+GYLKKAF GSKGP FGTKVSNYPPCPK
Sbjct  124  LCENLGLEQGYLKKAFYGSKGPTFGTKVSNYPPCPK  159



>gb|AGN52989.1| ACC oxidase [Euphorbia esula]
Length=313

 Score =   233 bits (594),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 127/164 (77%), Positives = 142/164 (87%), Gaps = 0/164 (0%)
 Frame = +3

Query  96   FPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKCMEQ  275
            FP+IN+ +LN EER A M +IKDACENWGFFE+++HGI  E MD VE +TK HY+KCMEQ
Sbjct  3    FPVINMEKLNGEERAATMAKIKDACENWGFFEILNHGIETEFMDRVESMTKGHYQKCMEQ  62

Query  276  RFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMelek  455
            RFKEMVA+KGLD+VQTEI DLDWESTF ++HLP SNISEIPDL D YRK+MKEFA +LEK
Sbjct  63   RFKEMVASKGLDSVQTEIKDLDWESTFHIRHLPQSNISEIPDLADDYRKLMKEFAGKLEK  122

Query  456  laenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LAE LLDLLCENLGLEKGYLK  F GSKGP FGTKVSNYPPCPK
Sbjct  123  LAEELLDLLCENLGLEKGYLKNTFYGSKGPTFGTKVSNYPPCPK  166



>sp|Q8S932.1|ACCO_DIOKA RecName: Full=1-aminocyclopropane-1-carboxylate oxidase; Short=ACC 
oxidase; AltName: Full=Ethylene-forming enzyme; Short=EFE 
[Diospyros kaki]
 dbj|BAB89351.1| 1-aminocyclopropane-1-carboxylate oxidase [Diospyros kaki]
Length=318

 Score =   233 bits (594),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 124/167 (74%), Positives = 146/167 (87%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M SFP+IN+ ++N EER A M  I DACENWGFFELV+HGI  ELMDTVE++TK HYKKC
Sbjct  1    MESFPVINMEKMNGEERAATMGLINDACENWGFFELVNHGIPPELMDTVERVTKAHYKKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRFKE+VA+K L+ +Q E+ D+DWEST+FL+HLP SNISE+PDL++ YR+VMK+FA  
Sbjct  61   MEQRFKELVASKALEGIQAEVTDMDWESTYFLRHLPQSNISEVPDLDEEYRRVMKDFAER  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LEKLAE LLDLLCENLGLEKGYLKKAF G+KGPNFGTKV+NYPPCPK
Sbjct  121  LEKLAEYLLDLLCENLGLEKGYLKKAFYGTKGPNFGTKVANYPPCPK  167



>gb|AEC32838.1| 1-aminocyclopropane-1-carboxylate oxidase [Psidium guajava]
Length=320

 Score =   233 bits (595),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 127/167 (76%), Positives = 147/167 (88%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M SFP+IN+  LN E+R   M++IKDACENWGFFELV+HGI  E+MDT+E++TK HYKKC
Sbjct  1    MESFPVINMENLNGEKRAITMDKIKDACENWGFFELVNHGIPPEMMDTIERMTKGHYKKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRF+E+VA+KGL+ VQ E++DLDWESTF LKHLP SNIS+I DL+D YRKVMKEFA++
Sbjct  61   MEQRFRELVASKGLEYVQKEVHDLDWESTFHLKHLPESNISQISDLDDDYRKVMKEFAVK  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LEKLAE LLDLLCENLGLEKGYLKKAF GS GP FGTKVSNYPPCPK
Sbjct  121  LEKLAEQLLDLLCENLGLEKGYLKKAFYGSNGPTFGTKVSNYPPCPK  167



>emb|CBI28867.3| unnamed protein product [Vitis vinifera]
Length=310

 Score =   233 bits (594),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 128/156 (82%), Positives = 141/156 (90%), Gaps = 0/156 (0%)
 Frame = +3

Query  120  LNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKCMEQRFKEMVAA  299
            LN EER A ME IKDACENWGFFELV+HGIS E MD VEKLTK HY+KCMEQRFKE+VAA
Sbjct  4    LNGEERGATMEMIKDACENWGFFELVNHGISHEQMDAVEKLTKGHYRKCMEQRFKELVAA  63

Query  300  KGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMeleklaenlldl  479
            K L+ VQTEI D+DWESTFFL+HLPVSN+S+ PDL++ YRKVMK+FA++LEKLAE LLDL
Sbjct  64   KALEGVQTEIKDMDWESTFFLRHLPVSNVSDFPDLDEEYRKVMKDFALKLEKLAEELLDL  123

Query  480  lcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LCENLGLEKGYLKKAF GSKGPNFGTKVSNYPPCPK
Sbjct  124  LCENLGLEKGYLKKAFHGSKGPNFGTKVSNYPPCPK  159



>gb|AAB70883.1| 1-aminocyclopropane-1-carboxylate oxidase [Pelargonium x hortorum]
Length=323

 Score =   233 bits (594),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 131/167 (78%), Positives = 143/167 (86%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M +FP+I++  LN EER A M  IKDACENWGFFE+ +HGIS ELMD VE+LTK+HY K 
Sbjct  1    MENFPVIDMEMLNGEERSAAMNMIKDACENWGFFEIKNHGISHELMDKVERLTKEHYAKF  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRFKEMVA+KGLDA Q+EI+DLDWESTFFL+HLP SNISEIPDLE  YR  MKEFA  
Sbjct  61   MEQRFKEMVASKGLDATQSEIDDLDWESTFFLRHLPTSNISEIPDLEHDYRLAMKEFAER  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LEKLAE LLDLLCENLGLEKGYLKKAF GSKGP FGTKVSNYPPCPK
Sbjct  121  LEKLAEELLDLLCENLGLEKGYLKKAFYGSKGPTFGTKVSNYPPCPK  167



>gb|ACU82854.3| 1-aminocyclopropane-1-carboxylate oxidase [Eriobotrya japonica]
 gb|ADB10838.1| 1-aminocyclopropane-1-carboxylate oxidase [Eriobotrya japonica]
Length=322

 Score =   233 bits (594),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 124/166 (75%), Positives = 145/166 (87%), Gaps = 0/166 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M +FP+INL  LN E R A ME+IKDACENWGFFELV HGI  E +DTVE+LTK+HYK+C
Sbjct  1    MENFPVINLQSLNGEGRKATMEKIKDACENWGFFELVSHGIPTEFLDTVERLTKEHYKQC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            +EQRFKE+VA+KGL+ V+TE+ D+DWESTF L+HLP SNISE+PDL+D YR VMKEFA++
Sbjct  61   LEQRFKELVASKGLEGVRTEVKDMDWESTFHLRHLPQSNISEVPDLKDEYRNVMKEFALK  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCP  584
            LEKLAE LLDLLCENLGLE+GYLKKAF G+ GP FGTKVSNYPPCP
Sbjct  121  LEKLAEQLLDLLCENLGLEQGYLKKAFYGTNGPTFGTKVSNYPPCP  166



>gb|AAR99394.1| ACC oxidase ACO1 [Nicotiana attenuata]
Length=319

 Score =   233 bits (593),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 125/167 (75%), Positives = 143/167 (86%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M +FPIINL +LN  E+ A ME IKDACENWGFFELV+HGI  E+MDTVEKLTK HYKKC
Sbjct  1    MENFPIINLEKLNGSEKAATMEMIKDACENWGFFELVNHGIPHEVMDTVEKLTKGHYKKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRFKE+VA+KGL+ V+ E+ D+DWESTFFL+HLPV+NISE+  L+D YR+VM++FA  
Sbjct  61   MEQRFKELVASKGLEGVEAEVTDMDWESTFFLRHLPVANISEVAGLDDQYREVMRDFAKR  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LE LAE LLDLLCENLGLE GYLK  F GSKGPNFGTKVSNYPPCPK
Sbjct  121  LENLAEELLDLLCENLGLENGYLKNVFYGSKGPNFGTKVSNYPPCPK  167



>ref|XP_007160496.1| hypothetical protein PHAVU_002G326600g [Phaseolus vulgaris]
 gb|ESW32490.1| hypothetical protein PHAVU_002G326600g [Phaseolus vulgaris]
Length=310

 Score =   232 bits (592),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 125/167 (75%), Positives = 148/167 (89%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            MA+FP+IN   +N E+R A +E+I+DACENWGFFELV+HGI +EL+D+VEKLTK+HY+K 
Sbjct  1    MANFPVINFENINGEKRKATLEKIEDACENWGFFELVNHGIPLELLDSVEKLTKEHYRKS  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRFKE VA+KGL+ ++ E+ D+DWESTFFL+HLP SNISEIPDL + YRK MKEFA +
Sbjct  61   MEQRFKEAVASKGLEGIKGEMKDMDWESTFFLRHLPDSNISEIPDLSEDYRKAMKEFAQK  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LEKLAE LLDLLCENLGLEKGYLKKAF GSKGPNFGTKV+NYPPCPK
Sbjct  121  LEKLAEELLDLLCENLGLEKGYLKKAFHGSKGPNFGTKVANYPPCPK  167



>gb|KJB22700.1| hypothetical protein B456_004G062100 [Gossypium raimondii]
Length=239

 Score =   229 bits (585),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 122/166 (73%), Positives = 146/166 (88%), Gaps = 0/166 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            MA+FP+INL +LN +ER  IMEQIKDACENWGFFE+++HGI  + MD+VE+LTK+HYKKC
Sbjct  1    MATFPVINLEKLNGDERSRIMEQIKDACENWGFFEVMNHGIPHDFMDSVERLTKEHYKKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRFKE+VA+K L+ ++ E+ D+DWESTF L HLP SN++EIPDL D YRKVMKEFA++
Sbjct  61   MEQRFKELVASKALEGLEAEVTDMDWESTFHLCHLPESNMAEIPDLSDEYRKVMKEFAVK  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCP  584
            LEKLAE LLDL CEN+GLEKGYLKKAF G+KGP FGTKVSNYPPCP
Sbjct  121  LEKLAEELLDLFCENIGLEKGYLKKAFYGAKGPTFGTKVSNYPPCP  166



>gb|KHG03155.1| 1-aminocyclopropane-1-carboxylate oxidase 1 [Gossypium arboreum]
Length=310

 Score =   232 bits (591),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 122/166 (73%), Positives = 144/166 (87%), Gaps = 0/166 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            MA FP+IN+ +LN EER A ME IKDACENWGFFE+++HGI  + MD +E LTK+HYKKC
Sbjct  1    MAKFPVINMEKLNGEERAATMELIKDACENWGFFEVLNHGIPYDFMDKIESLTKEHYKKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRFKE+VA+K L+ +Q E+ D+DWESTF+L+HLP SN++EIPDL D YRKVMKEFA++
Sbjct  61   MEQRFKELVASKALEGLQAEVTDMDWESTFYLRHLPESNMAEIPDLTDEYRKVMKEFALK  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCP  584
            LEKLAE LLDL CENLGLEKGYLKKAF G+KGP FGTKVSNYPPCP
Sbjct  121  LEKLAEELLDLFCENLGLEKGYLKKAFYGAKGPTFGTKVSNYPPCP  166



>gb|AAZ83344.1| ACC oxidase 3 [Gossypium hirsutum]
 gb|AFB18001.1| ACC oxidase [Gossypium anapoides]
 gb|AFB18002.1| ACC oxidase [Gossypium anapoides]
Length=317

 Score =   232 bits (591),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 123/166 (74%), Positives = 146/166 (88%), Gaps = 0/166 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            MA+FP+INL +LN +ER  IMEQIKDACENWGFFE+++HGI  + MDTVE+LTK+HYKKC
Sbjct  1    MATFPVINLEKLNGDERSRIMEQIKDACENWGFFEVMNHGIPHDFMDTVERLTKEHYKKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRFKE+VA+K L+ ++ E+ D+DWESTF L HLP SN++EIPDL D YRKVMKEFA++
Sbjct  61   MEQRFKELVASKALEGLEAEVTDMDWESTFHLCHLPESNMAEIPDLSDEYRKVMKEFAVK  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCP  584
            LEKLAE LLDL CEN+GLEKGYLKKAF G+KGP FGTKVSNYPPCP
Sbjct  121  LEKLAEELLDLFCENIGLEKGYLKKAFYGAKGPTFGTKVSNYPPCP  166



>gb|AFK41584.1| unknown [Lotus japonicus]
Length=310

 Score =   232 bits (591),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 124/167 (74%), Positives = 148/167 (89%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M +FP+INL  +N ++R AI+E+I+DACENWGFFELV+HGI  EL+DTVE+LTK+HY+KC
Sbjct  1    MENFPVINLENINGDKRKAILEKIEDACENWGFFELVNHGIPHELLDTVERLTKEHYRKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRFKE++A+KGLD VQ E+ ++DWE+TFFL+HLP SNISEIPDL + YR  MKEFA +
Sbjct  61   MEQRFKEVMASKGLDDVQAEVKEMDWETTFFLRHLPESNISEIPDLSEEYRNAMKEFAQK  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LEKLAE LLDLLCENLGLEKGYLKKAF GSKGPNFGTKV+NYP CPK
Sbjct  121  LEKLAEELLDLLCENLGLEKGYLKKAFHGSKGPNFGTKVANYPACPK  167



>ref|XP_010475176.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase 4-like [Camelina 
sativa]
Length=323

 Score =   232 bits (592),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 124/167 (74%), Positives = 146/167 (87%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M SFPIINL +LN E+R   MEQIKDACENWGFFE V+HGIS EL+D VEK+TK+HYKKC
Sbjct  1    MESFPIINLEKLNGEDRAITMEQIKDACENWGFFECVNHGISHELLDKVEKMTKEHYKKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            ME RFKE +  +GLD++++E+ND+DWESTF+LKHLPVSNIS++PDL+D YR +MKEFA +
Sbjct  61   MEARFKESIKNRGLDSLRSEVNDVDWESTFYLKHLPVSNISDVPDLDDDYRTLMKEFAGK  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            +EKL+E LLDLLCENLGLEKGYLKK F GSK P FGTKVSNYPPCPK
Sbjct  121  IEKLSEKLLDLLCENLGLEKGYLKKVFYGSKSPTFGTKVSNYPPCPK  167



>gb|AAU10090.1| 1-aminocyclopropane-1-carboxylate oxidase [Fragaria x ananassa]
Length=320

 Score =   232 bits (591),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 126/167 (75%), Positives = 147/167 (88%), Gaps = 1/167 (1%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M +FP+IN+ +LN EER A ME IKDACENWGFFELV+HGI    +DTVEK+TKDHYK C
Sbjct  1    MENFPVINMEKLNGEERNATMETIKDACENWGFFELVNHGIPTVFLDTVEKMTKDHYKNC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            +EQRFKE VA+KGL+AV TE+ND+DWESTF+LKHLP SNISE+PDL++ YRKVMK+FA++
Sbjct  61   LEQRFKEPVASKGLNAVNTEVNDMDWESTFYLKHLPRSNISEVPDLDEEYRKVMKDFALK  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKG-PNFGTKVSNYPPCP  584
            LEKLAE LLDL CENLGLE+GYLKKAF GS+G P FGTKVSNYPPCP
Sbjct  121  LEKLAEELLDLFCENLGLEEGYLKKAFYGSQGSPTFGTKVSNYPPCP  167



>ref|XP_004251527.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase 2 [Solanum 
lycopersicum]
Length=316

 Score =   232 bits (591),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 127/167 (76%), Positives = 144/167 (86%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M +FPIINL +LN  ER A ME+I DACENWGFFELV+HGI  E+MDTVEKLTK HYKKC
Sbjct  1    MENFPIINLEKLNGAERVATMEKINDACENWGFFELVNHGIPHEVMDTVEKLTKGHYKKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRFKE+VA KGL+ V+ E+ D+DWESTFFL+HLP SNIS++PDL+D YR+VM++FA  
Sbjct  61   MEQRFKELVAKKGLEGVEVEVTDMDWESTFFLRHLPSSNISQLPDLDDVYREVMRDFAKR  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LEKLAE LLDLLCENLGLEK YLK  F GSKGPNFGTKVSNYPPCPK
Sbjct  121  LEKLAEELLDLLCENLGLEKSYLKNTFYGSKGPNFGTKVSNYPPCPK  167



>gb|AEC32837.1| 1-aminocyclopropane-1-carboxylate oxidase [Psidium guajava]
Length=320

 Score =   232 bits (591),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 127/167 (76%), Positives = 146/167 (87%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M +FP+IN+  LN E+R   M++IKDACENWGFFELV+HGI  E+MDTVE+LTK HYKKC
Sbjct  1    MENFPVINMESLNGEKRAITMDKIKDACENWGFFELVNHGIPPEMMDTVERLTKGHYKKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRF+E+VA+KGL+ VQ E++DLDWESTF LKHLP SNI +IPDL+D YRKVMKEFA++
Sbjct  61   MEQRFRELVASKGLEYVQKEVHDLDWESTFHLKHLPESNIFQIPDLDDDYRKVMKEFAVK  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LEKLAE LLDLLCENLGLEKGYLK AF GS GP FGTKVSNYPPCPK
Sbjct  121  LEKLAEELLDLLCENLGLEKGYLKNAFHGSNGPTFGTKVSNYPPCPK  167



>gb|AAZ83343.1| ACC oxidase 2 [Gossypium hirsutum]
Length=319

 Score =   231 bits (590),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 127/166 (77%), Positives = 146/166 (88%), Gaps = 0/166 (0%)
 Frame = +3

Query  90   ASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKCM  269
             +FP+I+L+++N EER A M+ IKDACENWGFFEL +HGIS ELMDTVEKLTK+HYKKCM
Sbjct  3    VAFPVIDLSKINGEERGATMDMIKDACENWGFFELTNHGISHELMDTVEKLTKEHYKKCM  62

Query  270  EQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMel  449
            E RFKEMV +KGL+ VQ+EI D+DWESTFFL+HLP SN+ EIPDLE  YRKVMK+FA+EL
Sbjct  63   EDRFKEMVTSKGLEVVQSEITDMDWESTFFLRHLPESNLYEIPDLEYDYRKVMKQFAVEL  122

Query  450  eklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            EKLAE LLD+LCENLGLE+G LKK F GSKGP FGTKVSNYPPCPK
Sbjct  123  EKLAEKLLDILCENLGLEQGSLKKVFYGSKGPTFGTKVSNYPPCPK  168



>gb|ABI33224.1| ACC oxidase [Camellia sinensis]
Length=320

 Score =   231 bits (590),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 126/167 (75%), Positives = 146/167 (87%), Gaps = 0/167 (0%)
 Frame = +3

Query  87   MASFPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKC  266
            M +  +IN+ +LN EER A ME IKDACENWGFFEL++HGIS E+MDTVE++TK+HYKKC
Sbjct  1    METSQVINMEKLNGEERGATMELIKDACENWGFFELMNHGISHEMMDTVERMTKEHYKKC  60

Query  267  MEQRFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMe  446
            MEQRFKE+VA+K L+ VQ E+ ++DWESTF L+HLP SNISE+PDL D YRKVMKEFA +
Sbjct  61   MEQRFKEVVASKALEGVQAEVTNMDWESTFHLRHLPQSNISEVPDLNDEYRKVMKEFAAK  120

Query  447  leklaenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LEKLAE LLDLLCENLGLEKGYLKKAF G+KGP FGTKVSNYPPCPK
Sbjct  121  LEKLAEELLDLLCENLGLEKGYLKKAFYGTKGPTFGTKVSNYPPCPK  167



>gb|ABK58140.1| 1-amino-cyclopropane-1-carboxylic acid oxidase [Manihot esculenta]
Length=324

 Score =   231 bits (590),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 125/164 (76%), Positives = 145/164 (88%), Gaps = 0/164 (0%)
 Frame = +3

Query  96   FPIINLAQLNTEERPAIMEQIKDACENWGFFELVDHGISIELMDTVEKLTKDHYKKCMEQ  275
            FP+INL +LN EER A M +IKDACENWGFFEL++HGI  E +D VE +TK HY+KCMEQ
Sbjct  3    FPVINLEKLNGEERAATMAKIKDACENWGFFELLNHGIEPEFLDRVESMTKGHYRKCMEQ  62

Query  276  RFKEMVAAKGLDAVQTEINDLDWESTFFLKHLPVSNISEIPDLEDHYRKVMKEFAMelek  455
            RFKEMVA KGLDAVQTEI D+DWESTFF++HLP SN++++PDL+D +R VMKEFA +LEK
Sbjct  63   RFKEMVANKGLDAVQTEIKDMDWESTFFIRHLPDSNLAQLPDLDDEHRAVMKEFAAKLEK  122

Query  456  laenlldllcenlgleKGYLKKAFSGSKGPNFGTKVSNYPPCPK  587
            LAE+LLDLLCENLGLEKGYLKKAF GS+GP FGTKVSNYPPCPK
Sbjct  123  LAEDLLDLLCENLGLEKGYLKKAFYGSRGPTFGTKVSNYPPCPK  166



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 737611932690