BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001P03

Length=638
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_007147409.1|  hypothetical protein PHAVU_006G122000g             300   5e-100   Phaseolus vulgaris [French bean]
ref|XP_007153070.1|  hypothetical protein PHAVU_003G004100g             298   8e-100   Phaseolus vulgaris [French bean]
ref|XP_010112537.1|  Thioredoxin-like protein 4A                        297   1e-99    Morus notabilis
ref|XP_010918377.1|  PREDICTED: thioredoxin-like protein YLS8           296   2e-99    Elaeis guineensis
ref|XP_007223714.1|  hypothetical protein PRUPE_ppa013047mg             296   2e-99    Prunus persica
ref|XP_009386081.1|  PREDICTED: thioredoxin-like protein YLS8           296   2e-99    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007221211.1|  hypothetical protein PRUPE_ppa013055mg             296   2e-99    Prunus persica
gb|EYU20327.1|  hypothetical protein MIMGU_mgv1a015867mg                296   2e-99    Erythranthe guttata [common monkey flower]
ref|XP_002310072.1|  hypothetical protein POPTR_0007s07660g             296   3e-99    Populus trichocarpa [western balsam poplar]
ref|XP_010688677.1|  PREDICTED: thioredoxin-like protein YLS8           296   3e-99    Beta vulgaris subsp. vulgaris [field beet]
gb|EYU40757.1|  hypothetical protein MIMGU_mgv1a015888mg                296   4e-99    Erythranthe guttata [common monkey flower]
ref|XP_004231501.1|  PREDICTED: thioredoxin-like protein YLS8           296   5e-99    Solanum lycopersicum
ref|XP_008361905.1|  PREDICTED: thioredoxin-like protein YLS8 iso...    296   5e-99    Malus domestica [apple tree]
emb|CDP12287.1|  unnamed protein product                                296   5e-99    Coffea canephora [robusta coffee]
ref|XP_004148041.1|  PREDICTED: thioredoxin-like protein 4A-like        296   5e-99    Cucumis sativus [cucumbers]
ref|NP_001064903.1|  Os10g0486600                                       295   6e-99    
emb|CDP19065.1|  unnamed protein product                                295   7e-99    Coffea canephora [robusta coffee]
ref|XP_009797554.1|  PREDICTED: thioredoxin-like protein YLS8 iso...    295   7e-99    Nicotiana sylvestris
ref|XP_004293898.1|  PREDICTED: thioredoxin-like protein YLS8           295   8e-99    Fragaria vesca subsp. vesca
gb|KJB77370.1|  hypothetical protein B456_012G134400                    298   8e-99    Gossypium raimondii
ref|XP_004973430.1|  PREDICTED: thioredoxin-like protein 4A-like ...    295   8e-99    Setaria italica
ref|NP_196446.1|  thioredoxin-like protein YLS8                         295   1e-98    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002871315.1|  hypothetical protein ARALYDRAFT_908777             295   1e-98    Arabidopsis lyrata subsp. lyrata
ref|XP_010522102.1|  PREDICTED: thioredoxin-like protein YLS8           295   1e-98    Tarenaya hassleriana [spider flower]
ref|XP_007223713.1|  hypothetical protein PRUPE_ppa013047mg             295   1e-98    Prunus persica
ref|XP_004163626.1|  PREDICTED: thioredoxin-like protein 4A-like        294   2e-98    
ref|XP_010423115.1|  PREDICTED: thioredoxin-like protein YLS8           294   2e-98    Camelina sativa [gold-of-pleasure]
ref|XP_008361907.1|  PREDICTED: thioredoxin-like protein YLS8 iso...    294   2e-98    Malus domestica [apple tree]
ref|XP_006437597.1|  hypothetical protein CICLE_v10033145mg             294   2e-98    Citrus clementina [clementine]
ref|XP_003590204.1|  Thioredoxin-like 4A                                294   3e-98    Medicago truncatula
ref|XP_004143618.1|  PREDICTED: thioredoxin-like protein 4A-like        293   3e-98    Cucumis sativus [cucumbers]
ref|XP_009122442.1|  PREDICTED: thioredoxin-like protein YLS8           293   3e-98    Brassica rapa
ref|XP_006359304.1|  PREDICTED: thioredoxin-like protein 4A-like        293   4e-98    Solanum tuberosum [potatoes]
gb|EEC67208.1|  hypothetical protein OsI_34094                          298   5e-98    Oryza sativa Indica Group [Indian rice]
gb|KCW65068.1|  hypothetical protein EUGRSUZ_G02580                     300   5e-98    Eucalyptus grandis [rose gum]
ref|XP_003603529.1|  Thioredoxin-like 4A                                293   5e-98    Medicago truncatula
ref|XP_004236839.1|  PREDICTED: thioredoxin-like protein YLS8           293   7e-98    Solanum lycopersicum
gb|AAM61612.1|  putative thioredoxin-like U5 small ribonucleoprot...    293   8e-98    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009612361.1|  PREDICTED: thioredoxin-like protein YLS8           293   8e-98    Nicotiana tomentosiformis
emb|CDX81091.1|  BnaC03g03450D                                          292   9e-98    
ref|XP_003568138.1|  PREDICTED: thioredoxin-like protein YLS8           292   1e-97    Brachypodium distachyon [annual false brome]
gb|AFK35471.1|  unknown                                                 291   2e-97    Lotus japonicus
dbj|BAJ90446.1|  predicted protein                                      291   3e-97    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ACJ85953.1|  unknown                                                 291   4e-97    Medicago truncatula
gb|KDP39006.1|  hypothetical protein JCGZ_00763                         290   5e-97    Jatropha curcas
dbj|BAJ90457.1|  predicted protein                                      290   6e-97    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006484527.1|  PREDICTED: thioredoxin-like protein YLS8-lik...    290   6e-97    Citrus sinensis [apfelsine]
gb|EMS68243.1|  Thioredoxin-like protein 4A                             289   1e-96    Triticum urartu
ref|XP_001771732.1|  predicted protein                                  289   2e-96    
dbj|BAJ88120.1|  predicted protein                                      288   3e-96    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004297732.1|  PREDICTED: thioredoxin-like protein YLS8           288   4e-96    Fragaria vesca subsp. vesca
ref|XP_006437596.1|  hypothetical protein CICLE_v10033145mg             287   1e-95    
ref|XP_003607261.1|  Thioredoxin-like 4A                                285   6e-95    Medicago truncatula
ref|XP_010680626.1|  PREDICTED: thioredoxin-like protein YLS8           284   2e-94    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003580868.1|  PREDICTED: thioredoxin-like protein YLS8           281   2e-93    Brachypodium distachyon [annual false brome]
ref|XP_007043275.1|  MRNA splicing factor isoform 1                     282   2e-93    
ref|XP_002961771.1|  hypothetical protein SELMODRAFT_76404              281   3e-93    Selaginella moellendorffii
gb|AAP85544.1|  putative DIM-like protein                               280   6e-93    Glycine max [soybeans]
ref|XP_003565097.1|  PREDICTED: thioredoxin-like protein YLS8           280   8e-93    Brachypodium distachyon [annual false brome]
gb|EMT25324.1|  Thioredoxin-like protein 4A                             280   2e-92    
ref|XP_010232871.1|  PREDICTED: thioredoxin-like protein YLS8           276   3e-91    Brachypodium distachyon [annual false brome]
ref|XP_010240648.1|  PREDICTED: thioredoxin-like protein YLS8           275   6e-91    Brachypodium distachyon [annual false brome]
ref|XP_002948591.1|  hypothetical protein VOLCADRAFT_80220              272   8e-90    Volvox carteri f. nagariensis
ref|XP_005612997.1|  PREDICTED: thioredoxin-like 4A isoform X1          272   6e-89    
gb|EMT17006.1|  Thioredoxin-like protein 4A                             273   7e-89    
ref|XP_005421012.1|  PREDICTED: thioredoxin-like protein 4A             270   7e-89    Geospiza fortis
ref|XP_005644134.1|  4A/4B type thioredoxin-like protein                269   1e-88    Coccomyxa subellipsoidea C-169
ref|NP_001240770.1|  thioredoxin-like protein 4A                        268   5e-88    Equus caballus [domestic horse]
ref|XP_005843152.1|  thioredoxin domain 2                               268   5e-88    Chlorella variabilis
ref|NP_006692.1|  thioredoxin-like protein 4A isoform 1                 267   8e-88    Homo sapiens [man]
ref|NP_001016646.1|  thioredoxin-like 4A                                267   1e-87    Xenopus tropicalis [western clawed frog]
ref|NP_001069528.1|  thioredoxin-like protein 4A                        266   1e-87    Bos taurus [bovine]
ref|XP_006635928.1|  PREDICTED: thioredoxin-like protein 4A-like        266   1e-87    Lepisosteus oculatus
ref|XP_002723903.1|  PREDICTED: thioredoxin-like protein 4A             266   2e-87    Oryctolagus cuniculus [domestic rabbit]
ref|NP_001279255.1|  thioredoxin-like 4A                                266   2e-87    Callorhinchus milii [Australian ghost shark]
ref|XP_005968242.1|  PREDICTED: thioredoxin-like protein 4A isofo...    266   2e-87    Pantholops hodgsonii [Tibetan antelope]
ref|XP_003969009.1|  PREDICTED: thioredoxin-like protein 4A-like        266   2e-87    Takifugu rubripes [tiger puffer]
ref|XP_002757397.2|  PREDICTED: thioredoxin-like protein 4A             268   3e-87    
gb|KFO37224.1|  Thioredoxin-like protein 4A                             272   3e-87    Fukomys damarensis [Damara mole rat]
ref|NP_001089208.1|  thioredoxin-like 4A                                265   5e-87    Xenopus laevis [clawed frog]
ref|NP_001005953.1|  thioredoxin-like protein 4A                        265   5e-87    Danio rerio [leopard danio]
ref|XP_002424719.1|  mitosis protein dim1, putative                     265   6e-87    Pediculus humanus corporis [human body lice]
ref|XP_005183488.1|  PREDICTED: thioredoxin-like protein 4A             265   6e-87    Musca domestica
ref|XP_004073925.1|  PREDICTED: thioredoxin-like protein 4A             265   6e-87    
ref|XP_003219784.1|  PREDICTED: thioredoxin-like protein 4A             265   7e-87    Anolis carolinensis [Carolina anole]
ref|XP_003458541.1|  PREDICTED: thioredoxin-like protein 4A-like        265   8e-87    Oreochromis niloticus
ref|XP_007084792.1|  PREDICTED: thioredoxin-like protein 4A             265   8e-87    Panthera tigris altaica
ref|XP_003744183.1|  PREDICTED: thioredoxin-like protein 4A-like        265   8e-87    Galendromus occidentalis
ref|XP_007559818.1|  PREDICTED: thioredoxin-like protein 4A             265   9e-87    Poecilia formosa
ref|NP_001233254.1|  Thioredoxin-like protein 4A                        264   1e-86    Oncorhynchus mykiss
ref|NP_608830.3|  Dim1                                                  264   1e-86    Drosophila melanogaster
ref|XP_005812248.1|  PREDICTED: thioredoxin-like protein 4A-like        264   1e-86    Xiphophorus maculatus
ref|XP_008158524.1|  PREDICTED: thioredoxin-like protein 4A             264   2e-86    Eptesicus fuscus
gb|ACI69123.1|  Thioredoxin-like protein 4A                             264   2e-86    Salmo salar
ref|NP_001290582.1|  thioredoxin-like 4A                                264   2e-86    Esox lucius
ref|XP_002736167.1|  PREDICTED: thioredoxin-like protein 4A-like        263   2e-86    Saccoglossus kowalevskii
ref|XP_001657795.1|  AAEL006401-PA                                      263   3e-86    Aedes aegypti
ref|XP_008419697.1|  PREDICTED: thioredoxin-like protein 4A             263   3e-86    Poecilia reticulata
gb|ACM09089.1|  Thioredoxin-like protein 4A                             263   4e-86    Salmo salar
ref|XP_001700180.1|  predicted protein                                  263   5e-86    Chlamydomonas reinhardtii
emb|CCA25990.1|  hypothetical protein ARALYDRAFT_908777                 262   6e-86    Albugo laibachii Nc14
ref|XP_004923827.1|  PREDICTED: thioredoxin-like protein 4A-like ...    262   7e-86    
ref|XP_005822914.1|  component of the U4/U6.U5 snRNP/mitosis prot...    262   8e-86    Guillardia theta CCMP2712
emb|CCI41984.1|  unnamed protein product                                262   1e-85    Albugo candida
ref|XP_001848597.1|  mitosis protein dim1                               261   1e-85    Culex quinquefasciatus
gb|ENN82581.1|  hypothetical protein YQE_01050                          261   1e-85    Dendroctonus ponderosae
ref|XP_975428.1|  PREDICTED: thioredoxin-like protein 4A                261   2e-85    Tribolium castaneum [rust-red flour beetle]
ref|XP_010126012.1|  PREDICTED: thioredoxin-like protein 4A             261   2e-85    Chlamydotis macqueenii
ref|XP_004518565.1|  PREDICTED: thioredoxin-like protein 4A-like        261   2e-85    Ceratitis capitata [medfly]
ref|XP_008635342.1|  PREDICTED: thioredoxin-like protein 4A             261   2e-85    Corvus brachyrhynchos
gb|KDR22966.1|  Thioredoxin-like protein 4A                             261   2e-85    Zootermopsis nevadensis
emb|CDQ74845.1|  unnamed protein product                                261   2e-85    Oncorhynchus mykiss
ref|XP_002434548.1|  component of the U4/U6.U5 snRNP/mitosis prot...    261   2e-85    Ixodes scapularis [blacklegged tick]
gb|KFB42843.1|  AGAP008298-PA-like protein                              261   3e-85    Anopheles sinensis
gb|ACO51575.1|  Thioredoxin-like protein 4A                             261   3e-85    Rana catesbeiana [bullfrog]
emb|CDW55882.1|  Thioredoxin-like protein 4A                            260   3e-85    Trichuris trichiura
ref|XP_317168.1|  AGAP008298-PA                                         260   5e-85    Anopheles gambiae str. PEST
ref|XP_001605455.1|  PREDICTED: thioredoxin-like protein 4A             260   5e-85    Nasonia vitripennis
ref|XP_003389306.1|  PREDICTED: thioredoxin-like protein 4A             260   5e-85    Amphimedon queenslandica
gb|ESA24249.1|  hypothetical protein GLOINDRAFT_100571                  259   7e-85    
ref|XP_003511949.1|  PREDICTED: thioredoxin-like protein 4A isofo...    259   9e-85    Cricetulus griseus [Chinese hamsters]
ref|XP_006677007.1|  hypothetical protein BATDEDRAFT_86140              259   1e-84    Batrachochytrium dendrobatidis JAM81
ref|XP_624360.1|  PREDICTED: thioredoxin-like protein 4A-like iso...    259   1e-84    Apis mellifera [bee]
gb|ERE90894.1|  thioredoxin-like protein 4A-like protein                258   2e-84    Cricetulus griseus [Chinese hamsters]
ref|XP_004035804.1|  mitosis protein DIM1, putative                     258   2e-84    Ichthyophthirius multifiliis
gb|KFZ52327.1|  Thioredoxin-like 4A                                     258   3e-84    Podiceps cristatus
ref|XP_003537766.1|  PREDICTED: thioredoxin-like protein YLS8-lik...    258   3e-84    Glycine max [soybeans]
ref|XP_008557868.1|  PREDICTED: thioredoxin-like protein 4A             258   3e-84    Microplitis demolitor
gb|ELU05133.1|  hypothetical protein CAPTEDRAFT_164052                  258   4e-84    Capitella teleta
emb|CDX78332.1|  BnaA03g02440D                                          271   5e-84    
ref|XP_008894283.1|  thioredoxin-like protein 4A                        257   6e-84    Phytophthora parasitica INRA-310
ref|XP_001020947.1|  Mitosis protein DIM1 containing protein            257   9e-84    Tetrahymena thermophila SB210
gb|EFX72748.1|  hypothetical protein DAPPUDRAFT_308067                  257   1e-83    Daphnia pulex
gb|KFH68986.1|  thioredoxin-like protein 4A                             256   1e-83    Mortierella verticillata NRRL 6337
emb|CEG74081.1|  Putative Thioredoxin-like protein 4A                   256   1e-83    Rhizopus microsporus
ref|XP_001458031.1|  hypothetical protein                               256   2e-83    Paramecium tetraurelia strain d4-2
ref|XP_005704366.1|  U5 snRNP protein, DIM1 family                      256   2e-83    Galdieria sulphuraria
gb|EMS48495.1|  Thioredoxin-like protein 4A                             258   2e-83    Triticum urartu
ref|XP_002078122.1|  GD23285                                            256   2e-83    
ref|XP_001633372.1|  predicted protein                                  256   3e-83    Nematostella vectensis
ref|XP_002634991.1|  Hypothetical protein CBG13531                      255   4e-83    Caenorhabditis briggsae
ref|XP_003054835.1|  mitosis protein DIM1/U5snRNP-specific component    255   5e-83    Micromonas pusilla CCMP1545
ref|XP_001420660.1|  predicted protein                                  255   5e-83    Ostreococcus lucimarinus CCE9901
ref|NP_001280276.1|  thioredoxin-like protein 4A                        255   5e-83    Acyrthosiphon pisum
ref|XP_001347166.1|  Mitosis protein DIM1                               255   6e-83    Paramecium tetraurelia strain d4-2
gb|EGT53874.1|  hypothetical protein CAEBREN_24976                      255   6e-83    Caenorhabditis brenneri
gb|EPB84308.1|  thioredoxin-like protein 4A                             255   7e-83    Mucor circinelloides f. circinelloides 1006PhL
emb|CDS25812.1|  mitosis protein dim1                                   254   1e-82    Hymenolepis microstoma
ref|XP_002507532.1|  mitosis protein DIM1/U5snRNP-specific component    254   1e-82    Micromonas commoda
gb|EKC34447.1|  Thioredoxin-like protein 4A                             256   1e-82    Crassostrea gigas
ref|XP_009012816.1|  hypothetical protein HELRODRAFT_74374              254   1e-82    Helobdella robusta
ref|XP_002107985.1|  conserved hypothetical protein                     254   1e-82    Trichoplax adhaerens
gb|EUB58699.1|  Thioredoxin-like protein 4A                             254   1e-82    Echinococcus granulosus
ref|NP_001263740.1|  Protein Y54G2A.75                                  254   2e-82    Caenorhabditis elegans [roundworm]
ref|XP_011337692.1|  PREDICTED: thioredoxin-like protein 4A             253   2e-82    
ref|XP_008879700.1|  thioredoxin-like protein 4A                        253   2e-82    Aphanomyces invadans
ref|XP_011054098.1|  PREDICTED: thioredoxin-like protein 4A             253   3e-82    Acromyrmex echinatior
ref|XP_011331718.1|  PREDICTED: thioredoxin-like protein 4A             253   3e-82    Ooceraea biroi
ref|XP_011136508.1|  PREDICTED: thioredoxin-like protein 4A             253   4e-82    Harpegnathos saltator
emb|CEF99908.1|  FACT complex subunit Spt16p/Cdc68p                     253   4e-82    Ostreococcus tauri
gb|KDQ20851.1|  hypothetical protein BOTBODRAFT_26872                   253   5e-82    Botryobasidium botryosum FD-172 SS1
ref|XP_011454625.1|  PREDICTED: thioredoxin-like protein 4A             252   5e-82    Crassostrea gigas
ref|XP_002768301.1|  mitosis protein dim1, putative                     252   5e-82    Perkinsus marinus ATCC 50983
ref|XP_007458363.1|  PREDICTED: thioredoxin-like protein 4A-like        252   6e-82    Lipotes vexillifer [baiji]
ref|XP_008620792.1|  thioredoxin-like protein 4A                        251   1e-81    Saprolegnia diclina VS20
gb|KJA14370.1|  hypothetical protein HYPSUDRAFT_446751                  251   1e-81    Hypholoma sublateritium FD-334 SS-4
ref|XP_009840033.1|  thioredoxin-like protein 4A                        251   1e-81    Aphanomyces astaci
ref|XP_004225834.1|  PREDICTED: thioredoxin-like protein 4A             251   2e-81    
gb|AAW24918.1|  SJCHGC05540 protein                                     251   2e-81    Schistosoma japonicum
gb|EIE88112.1|  thioredoxin-like protein 4A                             251   2e-81    Rhizopus delemar RA 99-880
emb|CEL57191.1|  Thioredoxin-like protein 4A OS=Mus musculus GN=T...    251   2e-81    Rhizoctonia solani AG-1 IB
emb|CBY18596.1|  unnamed protein product                                251   2e-81    Oikopleura dioica
ref|XP_005509862.1|  PREDICTED: LOW QUALITY PROTEIN: thioredoxin-...    250   3e-81    
gb|ADP02972.1|  thioredoxin-like protein                                250   3e-81    Aplysia dactylomela
emb|CDS14378.1|  Putative Thioredoxin-like protein 4A                   250   3e-81    Lichtheimia ramosa
emb|CDJ93524.1|  mRNA splicing factor domain containing protein         250   3e-81    Haemonchus contortus [red stomach worm]
ref|XP_627261.1|  mitosis protein DIM1                                  250   4e-81    Cryptosporidium parvum Iowa II
gb|KIM19828.1|  hypothetical protein M408DRAFT_334247                   250   4e-81    Serendipita vermifera MAFF 305830
ref|XP_001898146.1|  Chain A, Human Spliceosomal Protein U5-15kd        249   7e-81    Brugia malayi [agent of lymphatic filariasis]
ref|XP_009046396.1|  hypothetical protein LOTGIDRAFT_185700             249   8e-81    Lottia gigantea
gb|ACO13026.1|  Thioredoxin-like protein 4A                             249   8e-81    Lepeophtheirus salmonis
emb|CCD78396.1|  putative mitosis protein dim1                          249   8e-81    Schistosoma mansoni
gb|KJA16773.1|  hypothetical protein HYPSUDRAFT_47042                   249   8e-81    Hypholoma sublateritium FD-334 SS-4
ref|XP_798053.1|  PREDICTED: thioredoxin-like protein 4A-like           249   1e-80    
ref|XP_006455351.1|  hypothetical protein AGABI2DRAFT_226816            249   1e-80    Agaricus bisporus var. bisporus H97
ref|XP_002591053.1|  hypothetical protein BRAFLDRAFT_119072             249   1e-80    Branchiostoma floridae
ref|XP_004998165.1|  mitosis protein dim1                               249   1e-80    Salpingoeca rosetta
ref|XP_002365691.1|  mitosis protein, putative                          249   1e-80    Toxoplasma gondii ME49
ref|XP_002472973.1|  predicted protein                                  249   1e-80    
gb|ETW17434.1|  thioredoxin-like protein 4A                             249   1e-80    Plasmodium falciparum Vietnam Oak-Knoll (FVO)
ref|XP_003883900.1|  hypothetical protein NCLIV_036500                  249   1e-80    Neospora caninum Liverpool
ref|XP_008882390.1|  splicing factor DIM1, putative                     249   1e-80    
ref|XP_009689428.1|  Dim1 protein                                       249   1e-80    Theileria orientalis strain Shintoku
ref|XP_007511883.1|  predicted protein                                  249   1e-80    Bathycoccus prasinos
ref|XP_003325301.2|  hypothetical protein PGTG_07134                    251   2e-80    Puccinia graminis f. sp. tritici CRL 75-36-700-3
ref|XP_001886799.1|  predicted protein                                  248   2e-80    Laccaria bicolor S238N-H82
emb|CCM00553.1|  predicted protein                                      248   2e-80    Fibroporia radiculosa
gb|KIO26978.1|  hypothetical protein M407DRAFT_243526                   248   2e-80    Tulasnella calospora MUT 4182
ref|XP_001606810.1|  PREDICTED: thioredoxin-like protein 4A             248   2e-80    Nasonia vitripennis
gb|KFO88676.1|  Thioredoxin-like 4A                                     248   2e-80    Buceros rhinoceros silvestris
ref|XP_002677289.1|  predicted protein                                  248   3e-80    Naegleria gruberi strain NEG-M
ref|XP_007365140.1|  4A/4B type thioredoxin-like protein                248   3e-80    Dichomitus squalens LYAD-421 SS1
gb|KIK38408.1|  hypothetical protein CY34DRAFT_809371                   248   3e-80    Suillus luteus UH-Slu-Lm8-n1
gb|EMD31170.1|  hypothetical protein CERSUDRAFT_119982                  248   3e-80    Gelatoporia subvermispora B
emb|CBJ27126.1|  conserved unknown protein                              248   4e-80    Ectocarpus siliculosus
gb|EUC55875.1|  snRNP mitosis protein Dim1, putative                    247   5e-80    Rhizoctonia solani AG-3 Rhs1AP
ref|XP_002175341.1|  U4/U6 X U5 tri-snRNP complex subunit Dim1          247   5e-80    Schizosaccharomyces japonicus yFS275
ref|XP_010546438.1|  PREDICTED: thioredoxin-like protein YLS8           248   5e-80    
emb|CDI78434.1|  mitosis protein, putative                              247   5e-80    Eimeria acervulina
ref|XP_007306028.1|  4A/4B type thioredoxin-like protein                247   6e-80    Stereum hirsutum FP-91666 SS1
ref|XP_005775974.1|  hypothetical protein EMIHUDRAFT_74383              248   7e-80    Emiliania huxleyi CCMP1516
gb|KIY49658.1|  4A/4B type thioredoxin-like protein                     247   7e-80    Fistulina hepatica ATCC 64428
ref|XP_007386351.1|  4A/4B type thioredoxin-like protein                247   8e-80    Punctularia strigosozonata HHB-11173 SS5
gb|KIJ06810.1|  hypothetical protein PAXINDRAFT_103223                  247   9e-80    Paxillus involutus ATCC 200175
emb|CDH56838.1|  thioredoxin-like protein 4a                            246   9e-80    Lichtheimia corymbifera JMRC:FSU:9682
ref|XP_001613851.1|  hypothetical protein                               246   1e-79    Plasmodium vivax
gb|EPS96979.1|  hypothetical protein FOMPIDRAFT_1129402                 246   1e-79    Fomitopsis pinicola FP-58527 SS1
dbj|GAM16867.1|  hypothetical protein SAMD00019534_000420               246   1e-79    Acytostelium subglobosum LB1
ref|XP_007846877.1|  thioredoxin-like protein 4a                        246   1e-79    
gb|KIM87909.1|  hypothetical protein PILCRDRAFT_265038                  246   1e-79    Piloderma croceum F 1598
ref|XP_007772300.1|  4A 4B type thioredoxin-like protein                246   1e-79    Coniophora puteana RWD-64-598 SS2
gb|KIK97816.1|  hypothetical protein PAXRUDRAFT_824538                  246   2e-79    Paxillus rubicundulus Ve08.2h10
ref|XP_009551647.1|  hypothetical protein HETIRDRAFT_480925             246   2e-79    Heterobasidion irregulare TC 32-1
gb|EJU00533.1|  4A/4B type thioredoxin-like protein                     246   2e-79    Dacryopinax primogenitus
ref|XP_009583558.1|  PREDICTED: thioredoxin-like protein 4A             245   2e-79    Fulmarus glacialis
gb|KIM69609.1|  hypothetical protein SCLCIDRAFT_1208074                 246   2e-79    Scleroderma citrinum Foug A
gb|KIJ62414.1|  hypothetical protein HYDPIDRAFT_114514                  246   3e-79    Hydnomerulius pinastri MD-312
ref|XP_008044177.1|  Txnl4a protein                                     245   3e-79    Trametes versicolor FP-101664 SS1
ref|XP_728199.1|  hypothetical protein                                  245   3e-79    Plasmodium yoelii
ref|XP_003030947.1|  hypothetical protein SCHCODRAFT_16105              245   3e-79    Schizophyllum commune H4-8
gb|ADD38623.1|  Thioredoxin-like protein 4A                             245   3e-79    Lepeophtheirus salmonis
ref|XP_001838225.2|  Txnl4a protein                                     245   4e-79    Coprinopsis cinerea okayama7#130
gb|KDQ22912.1|  hypothetical protein PLEOSDRAFT_1095121                 245   4e-79    Pleurotus ostreatus PC15
gb|EJY79946.1|  Thioredoxin-like protein 4A                             245   4e-79    Oxytricha trifallax
gb|KIL59987.1|  hypothetical protein M378DRAFT_84351                    245   4e-79    Amanita muscaria Koide BX008
ref|XP_007400208.1|  hypothetical protein PHACADRAFT_263005             245   4e-79    Phanerochaete carnosa HHB-10118-sp
gb|KIM43951.1|  hypothetical protein M413DRAFT_371899                   245   5e-79    Hebeloma cylindrosporum h7
dbj|GAA55172.1|  U5 snRNP protein DIM1 family                           247   5e-79    Clonorchis sinensis [oriental liver fluke]
gb|EWM21942.1|  thioredoxin-like protein 4a                             246   5e-79    Nannochloropsis gaditana
gb|KIK18903.1|  hypothetical protein PISMIDRAFT_683760                  244   6e-79    Pisolithus microcarpus 441
emb|CDO76842.1|  hypothetical protein BN946_scf185033.g39               244   6e-79    Trametes cinnabarina
gb|KIP02616.1|  hypothetical protein PHLGIDRAFT_130648                  244   7e-79    Phlebiopsis gigantea 11061_1 CR5-6
gb|KIH46527.1|  mitosis protein DIM1                                    244   8e-79    Ancylostoma duodenale
gb|EUD74542.1|  thioredoxin-like protein 4A                             244   1e-78    Plasmodium vinckei petteri
ref|XP_007263637.1|  4A/4B type thioredoxin-like protein                244   1e-78    Fomitiporia mediterranea MF3/22
gb|KIJ40226.1|  hypothetical protein M422DRAFT_173930                   243   2e-78    Sphaerobolus stellatus SS14
gb|KDQ52504.1|  hypothetical protein JAAARDRAFT_40105                   243   2e-78    Jaapia argillacea MUCL 33604
ref|XP_001350710.1|  DIM1 protein homolog, putative                     243   3e-78    Plasmodium falciparum 3D7
ref|XP_010290296.1|  PREDICTED: thioredoxin-like protein 4A             242   3e-78    Phaethon lepturus
ref|XP_008500727.1|  PREDICTED: thioredoxin-like protein 4A             243   4e-78    Calypte anna
ref|XP_001611037.1|  dim1 protein-like protein                          243   4e-78    Babesia bovis T2Bo
emb|CCA67559.1|  probable DIB1-17-kDa component of the U4/U6aU5 t...    243   4e-78    Serendipita indica DSM 11827
gb|KFP15147.1|  Thioredoxin-like 4A                                     242   4e-78    Egretta garzetta
dbj|GAA98888.1|  hypothetical protein E5Q_05576                         242   5e-78    Mixia osmundae IAM 14324
pdb|2AV4|A  Chain A, Crystal Structure Of Plasmodium Yoelii Thior...    243   5e-78    Plasmodium yoelii
ref|XP_009164467.1|  hypothetical protein T265_02055                    243   5e-78    Opisthorchis viverrini [Southeast Asian liver fluke]
ref|XP_766163.1|  mitosis protein Dim1                                  242   5e-78    Theileria parva strain Muguga
ref|XP_002186391.1|  predicted protein                                  242   5e-78    Phaeodactylum tricornutum CCAP 1055/1
emb|CCF72795.1|  unnamed protein product                                242   7e-78    Babesia microti strain RI
gb|KII84859.1|  hypothetical protein PLICRDRAFT_45684                   241   9e-78    Plicaturopsis crispa FD-325 SS-3
gb|KDE07523.1|  thioredoxin-like protein 4A                             241   1e-77    Microbotryum lychnidis-dioicae p1A1 Lamole
gb|KII73784.1|  Thioredoxin-like protein 4A                             241   1e-77    Thelohanellus kitauei
ref|XP_002293797.1|  pre-mrna splicing protein                          241   1e-77    Thalassiosira pseudonana CCMP1335
ref|XP_004350161.1|  thioredoxin-like U5 small nuclear ribonucleo...    241   1e-77    Cavenderia fasciculata
gb|KIJ96119.1|  hypothetical protein K443DRAFT_635952                   241   2e-77    Laccaria amethystina LaAM-08-1
gb|KFP07539.1|  Thioredoxin-like 4A                                     240   2e-77    Calypte anna
gb|KIY71822.1|  4A/4B type thioredoxin-like protein                     241   2e-77    Cylindrobasidium torrendii FP15055 ss-10
ref|XP_007000817.1|  hypothetical protein TREMEDRAFT_36330              241   2e-77    Tremella mesenterica DSM 1558
ref|XP_572796.1|  pre-mRNA splicing factor                              240   3e-77    Cryptococcus neoformans var. neoformans JEC21
ref|XP_678923.1|  dim1 protein                                          240   3e-77    
ref|XP_007877779.1|  hypothetical protein PFL1_02077                    240   4e-77    Anthracocystis flocculosa PF-1
gb|EPY49797.1|  U4/U6 X U5 tri-snRNP complex subunit Dim1               239   5e-77    Schizosaccharomyces cryophilus OY26
emb|CEF63094.1|  Dim1                                                   239   5e-77    Strongyloides ratti
ref|XP_003380222.1|  mitosis protein Dim1                               240   6e-77    Trichinella spiralis
gb|ELU39072.1|  Txnl4a protein                                          240   7e-77    Rhizoctonia solani AG-1 IA
gb|EPX72034.1|  U4/U6 X U5 tri-snRNP complex subunit Dim1               239   1e-76    Schizosaccharomyces octosporus yFS286
gb|ERG83348.1|  thioredoxin-like protein 4a                             253   1e-76    
ref|XP_007404844.1|  hypothetical protein MELLADRAFT_32802              239   1e-76    Melampsora larici-populina 98AG31
ref|XP_002142021.1|  mitosis protein DIM1                               239   1e-76    Cryptosporidium muris RN66
pdb|4CDO|A  Chain A, Crystal Structure Of Pqbp1 Bound To Spliceos...    239   2e-76    
ref|XP_004365865.1|  thioredoxin-like protein 4A                        238   2e-76    
pdb|1PQN|A  Chain A, Dominant Negative Human Hdim1 (Hdim1 1-128)        238   2e-76    
gb|ADD24125.1|  Thioredoxin-like protein 4A                             238   2e-76    
gb|KIR59256.1|  thioredoxin-like protein 4A                             238   2e-76    
ref|XP_007353534.1|  4A/4B type thioredoxin-like protein                238   3e-76    
emb|CDR94616.1|  dim1 protein-like protein, putative                    238   5e-76    
gb|EFA83054.1|  thioredoxin-like U5 small nuclear ribonucleoprotein     237   5e-76    
pdb|4BWQ|A  Chain A, Crystal Structure Of U5-15kd In A Complex Wi...    237   6e-76    
gb|KFP47879.1|  Thioredoxin-like 4A                                     236   8e-76    
ref|XP_011131498.1|  mitosis protein Dim1                               236   8e-76    
ref|NP_587992.1|  U4/U6 x U5 tri-snRNP complex subunit Dim1             236   1e-75    
ref|XP_007107686.1|  PREDICTED: thioredoxin-like protein 4A-like        236   2e-75    
emb|CDH56839.1|  thioredoxin-like protein 4a                            235   2e-75    
emb|CDS26711.1|  thioredoxin protein 4a                                 252   4e-75    
ref|XP_009923435.1|  PREDICTED: thioredoxin-like protein 4A             234   4e-75    
gb|EJY88496.1|  Thioredoxin-like protein 4A                             242   5e-75    
ref|XP_001875861.1|  predicted protein                                  234   8e-75    
ref|XP_003294500.1|  mitosis protein dim1                               233   2e-74    
gb|KDN70199.1|  putative mitosis protein DIM1                           233   2e-74    
gb|KFP25288.1|  Thioredoxin-like 4A                                     232   2e-74    
gb|KEQ63453.1|  mitosis protein dim1                                    233   2e-74    
ref|XP_008597518.1|  mitosis protein DIM1                               233   2e-74    
gb|KEQ97838.1|  hypothetical protein AUEXF2481DRAFT_46228               233   3e-74    
gb|KEQ81146.1|  mitosis protein dim1                                    233   3e-74    
emb|CCX32529.1|  Similar to Thioredoxin-like protein 4A; acc. no....    232   4e-74    
gb|EPZ33917.1|  Thioredoxin-like protein 4A                             232   5e-74    
gb|KHG04565.1|  Thioredoxin-like protein 4A                             232   5e-74    
emb|CCF52866.1|  probable DIB1-17-kDa component of the U4/U6aU5 t...    232   5e-74    
emb|CCG82418.1|  U4/U6 X U5 tri-snRNP complex subunit Dim15 / FY1...    232   7e-74    
gb|EST05546.1|  putative DIB1-17-kDa component of the U4/U6aU5 tr...    231   9e-74    
gb|KDN47741.1|  putative DIB1-17-kDa component of the U4/U6aU5 tr...    231   9e-74    
ref|XP_010198230.1|  PREDICTED: thioredoxin-like protein 4A             231   1e-73    
ref|XP_007868185.1|  hypothetical protein GLOTRDRAFT_45707              232   1e-73    
gb|KEQ75749.1|  mitosis protein dim1                                    231   1e-73    
ref|XP_002837307.1|  hypothetical protein                               231   1e-73    
gb|EFQ30592.1|  mitosis protein DIM1                                    231   1e-73    
ref|XP_011389037.1|  putative U4/U6aU5 tri-snRNP component              231   1e-73    
gb|EQL01334.1|  mRNA splicing factor, thioredoxin-like U5 snRNP         230   2e-73    
gb|KFH44045.1|  Thioredoxin-like protein 4A-like protein                230   2e-73    
gb|ENN72285.1|  hypothetical protein YQE_11067                          230   2e-73    
emb|CDI53504.1|  probable DIB1-17-kDa component of the U4/U6aU5 t...    230   2e-73    
gb|EYE97433.1|  pre-mRNA splicing factor Dim1                           230   3e-73    
emb|CAF99472.1|  unnamed protein product                                230   3e-73    
emb|CBQ73027.1|  probable DIB1-17-kDa component of the U4/U6aU5 t...    230   4e-73    
ref|XP_002627169.1|  mitosis protein dim1                               230   4e-73    
ref|XP_001904152.1|  hypothetical protein                               230   4e-73    
gb|EMP35202.1|  Thioredoxin-like protein 4A                             236   4e-73    
ref|XP_003655517.1|  hypothetical protein THITE_2054846                 230   4e-73    
ref|XP_006693194.1|  hypothetical protein CTHT_0027370                  229   4e-73    
ref|XP_009254191.1|  hypothetical protein FPSE_02797                    229   4e-73    
ref|XP_660452.1|  hypothetical protein AN2848.2                         229   5e-73    
ref|XP_002796868.1|  mitosis protein dim1                               229   5e-73    
ref|XP_001229514.1|  conserved hypothetical protein                     229   6e-73    
ref|XP_007278115.1|  mitosis protein dim1                               229   7e-73    
gb|KIL90829.1|  thioredoxin-like protein 4a                             229   8e-73    
ref|XP_003663070.1|  hypothetical protein MYCTH_2304495                 229   8e-73    
ref|XP_007581202.1|  putative mitosis protein dim1 protein              229   9e-73    
emb|CEJ87016.1|  Putative mRNA splicing factor, thioredoxin-like ...    229   1e-72    
ref|XP_007722041.1|  thioredoxin-like protein 4A                        229   1e-72    
ref|XP_007776466.1|  thioredoxin-like protein 4A                        228   1e-72    
ref|XP_007692998.1|  hypothetical protein COCMIDRAFT_9655               228   1e-72    
ref|XP_007289938.1|  mitosis protein dim1                               228   1e-72    
ref|XP_007590678.1|  mitosis protein DIM1                               228   1e-72    
ref|XP_003001256.1|  mitosis protein dim1                               228   2e-72    
ref|XP_003051647.1|  predicted protein                                  228   2e-72    
ref|XP_003066990.1|  Thioredoxin-like protein 4 , putative              228   2e-72    
gb|KEY74239.1|  hypothetical protein S7711_00397                        228   2e-72    
ref|XP_001932845.1|  mitosis protein dim1                               228   2e-72    
gb|ACY01406.1|  thioredoxin-like protein                                228   2e-72    
ref|XP_007916280.1|  putative mitosis protein dim1 protein              228   3e-72    
ref|XP_007733408.1|  thioredoxin-like protein 4A                        228   3e-72    
gb|EMS25651.1|  U5 snRNP protein, DIM1 family                           228   3e-72    
gb|KIW21202.1|  mitosis protein dim1                                    227   4e-72    
gb|KIW60148.1|  mitosis protein dim1                                    227   4e-72    
emb|CCD53725.1|  similar to mitosis protein dim1                        227   4e-72    
emb|CDP96037.1|  Protein Bm14465                                        226   5e-72    
ref|XP_007791937.1|  putative mitosis protein dim1 protein              227   5e-72    
ref|XP_006962515.1|  predicted protein                                  227   5e-72    
gb|KIW86067.1|  mitosis protein dim1                                    227   7e-72    
ref|XP_009153172.1|  thioredoxin-like protein 4A                        227   7e-72    
ref|XP_001817770.1|  mitosis protein dim1                               226   7e-72    
dbj|GAM90178.1|  hypothetical protein ANO11243_082180                   226   7e-72    
ref|XP_002848259.1|  mitosis protein dim1                               226   7e-72    
ref|XP_009265822.1|  Thioredoxin-like protein 4A                        226   7e-72    
gb|EHK49849.1|  hypothetical protein TRIATDRAFT_51231                   226   8e-72    
gb|EGU81843.1|  hypothetical protein FOXB_07638                         227   8e-72    
ref|XP_011117949.1|  hypothetical protein AOL_s00006g338                226   8e-72    
gb|KFV45347.1|  Thioredoxin-like 4A                                     226   8e-72    
gb|KJF61301.1|  thioredoxin-like protein 4A                             226   9e-72    
ref|XP_007740217.1|  thioredoxin-like protein 4A                        226   1e-71    
dbj|GAD94592.1|  pre-mRNA splicing factor Dim1                          226   1e-71    
gb|ELR05917.1|  mitosis protein dim1                                    226   1e-71    
ref|XP_008081887.1|  Thioredoxin-like protein                           228   1e-71    
gb|KFY37491.1|  hypothetical protein V495_07141                         226   1e-71    
gb|KIW33706.1|  mitosis protein dim1                                    226   2e-71    
gb|KIW08319.1|  mitosis protein dim1                                    226   2e-71    
ref|XP_007760836.1|  thioredoxin-like protein 4A                        225   2e-71    
ref|XP_001399942.1|  mitosis protein dim1                               225   2e-71    
ref|XP_007930495.1|  hypothetical protein MYCFIDRAFT_36745              225   3e-71    
gb|KIX08321.1|  mitosis protein dim1                                    227   4e-71    
ref|XP_009816471.1|  PREDICTED: thioredoxin-like protein 4A             224   5e-71    
gb|KIV87373.1|  mitosis protein dim1                                    224   5e-71    
ref|XP_008713006.1|  thioredoxin-like protein 4A                        224   5e-71    
gb|EPQ67287.1|  component of the U4-U6aU5 tri-snRNP                     224   5e-71    
ref|XP_001263233.1|  pre-mRNA splicing factor Dim1                      224   6e-71    
gb|EPS29967.1|  hypothetical protein PDE_04917                          224   6e-71    
ref|XP_009974906.1|  PREDICTED: thioredoxin-like protein 4A             223   8e-71    
ref|XP_001795918.1|  hypothetical protein SNOG_05513                    224   9e-71    
gb|KHN79968.1|  Thioredoxin-like protein 4A                             228   1e-70    
ref|XP_003715304.1|  thioredoxin-like protein 4A                        223   1e-70    
gb|EKD00782.1|  pre-mRNA splicing factor                                239   2e-70    
gb|EJT49971.1|  pre-mRNA splicing factor                                239   2e-70    
ref|XP_004196639.1|  Piso0_003862                                       223   2e-70    
ref|XP_002151224.1|  pre-mRNA splicing factor Dim1                      223   2e-70    
ref|XP_001213337.1|  mitosis protein dim1                               223   2e-70    
gb|KDD73938.1|  DIM1 mitosis protein                                    222   3e-70    
ref|XP_007681180.1|  hypothetical protein BAUCODRAFT_152095             223   3e-70    
ref|XP_458932.1|  DEHA2D10758p                                          222   4e-70    
gb|KFY23334.1|  hypothetical protein V493_05915                         224   4e-70    
ref|XP_643678.5|  thioredoxin-like U5 small nuclear ribonucleopro...    222   5e-70    
gb|KGG50047.1|  Dim1p-like protein                                      222   5e-70    
ref|XP_009218892.1|  thioredoxin-like protein 4A                        222   6e-70    
gb|KIM95954.1|  hypothetical protein OIDMADRAFT_20898                   222   6e-70    
gb|EME40539.1|  hypothetical protein DOTSEDRAFT_74187                   221   7e-70    
ref|XP_007630273.1|  PREDICTED: thioredoxin-like protein 4A             223   8e-70    
ref|XP_003348596.1|  hypothetical protein SMAC_05691                    221   9e-70    
gb|KJB79628.1|  hypothetical protein B456_013G069500                    220   1e-69    
ref|XP_006667765.1|  mitosis protein dim1                               222   1e-69    
ref|XP_003849846.1|  hypothetical protein MYCGRDRAFT_47771              221   1e-69    
ref|XP_009492449.1|  thioredoxin-like protein 4A                        221   2e-69    
ref|XP_002562020.1|  Pc18g01760                                         221   2e-69    
ref|XP_003844704.1|  hypothetical protein LEMA_P000120.1                229   2e-69    
emb|CCF34415.1|  thioredoxin-like protein 4A                            221   2e-69    
ref|XP_007800003.1|  Mitosis protein dim1                               220   3e-69    
gb|EWC45370.1|  mitosis protein dim1                                    220   3e-69    
gb|KGO71831.1|  mRNA splicing factor, thioredoxin-like U5 snRNP         220   3e-69    
gb|KEZ41269.1|  hypothetical protein SAPIO_CDS7359                      219   4e-69    
ref|XP_503948.1|  YALI0E14619p                                          219   5e-69    
gb|KEF53125.1|  mitosis protein dim1                                    219   5e-69    
gb|KIV93960.1|  mitosis protein dim1                                    219   7e-69    
ref|XP_006957048.1|  4A/4B type thioredoxin-like protein                218   1e-68    
ref|XP_002554704.1|  KLTH0F11638p                                       218   3e-68    
emb|CDM33841.1|  Mitosis protein dim1                                   218   3e-68    
gb|KFW96251.1|  Thioredoxin-like 4A                                     216   3e-68    
emb|CDW76458.1|  thioredoxin-like protein 4a                            227   5e-68    
gb|EJK66417.1|  hypothetical protein THAOC_12668                        218   6e-68    
emb|CDJ68616.1|  mitosis protein, putative                              216   6e-68    
ref|XP_006684304.1|  hypothetical protein CANTEDRAFT_118315             216   6e-68    
emb|CDJ37038.1|  mitosis protein, putative                              216   6e-68    
gb|KFM77321.1|  Thioredoxin-like protein 4A                             216   8e-68    
ref|XP_004323406.1|  PREDICTED: thioredoxin-like protein 4A-like        216   8e-68    
ref|XP_004258094.1|  mitosis protein dim1, putative                     216   8e-68    
ref|XP_001487325.1|  conserved hypothetical protein                     218   8e-68    
ref|XP_008777082.1|  PREDICTED: thioredoxin-like protein YLS8           215   9e-68    
ref|XP_002543867.1|  mitosis protein dim1                               216   1e-67    
gb|KHJ32940.1|  putative mitosis protein dim1                           226   1e-67    
ref|XP_009500236.1|  PREDICTED: thioredoxin-like protein 4A             214   2e-67    
gb|ACL52911.1|  unknown                                                 214   3e-67    
emb|CBK24389.2|  unnamed protein product                                214   4e-67    
gb|KFX87052.1|  hypothetical protein V490_08601                         224   8e-67    
ref|XP_006437598.1|  hypothetical protein CICLE_v10033145mg             212   8e-67    
dbj|GAC93580.1|  hypothetical protein PHSY_001145                       227   1e-66    
gb|ETS64785.1|  hypothetical protein PaG_00748                          231   2e-66    
gb|ENH85422.1|  mitosis protein dim1                                    213   2e-66    
gb|KFY90363.1|  hypothetical protein V498_06010                         223   4e-66    
gb|ABF70077.1|  spliceosomal U5 snRNP-specific 15 kDa protein, pu...    214   4e-66    
emb|CEP61571.1|  LALA0S03e05842g1_1                                     211   5e-66    
gb|KFZ13571.1|  hypothetical protein V501_03651                         224   5e-66    
gb|KFY81054.1|  hypothetical protein V499_00167                         225   6e-66    
ref|XP_001646155.1|  hypothetical protein Kpol_1039p48                  211   7e-66    
emb|CCJ30716.1|  unnamed protein product                                211   7e-66    
ref|XP_003674066.1|  hypothetical protein NCAS_0A11270                  211   9e-66    
ref|XP_007875594.1|  hypothetical protein PNEG_03502                    212   9e-66    
ref|XP_004831580.1|  mitosis protein dim1, putative                     211   1e-65    
gb|KGN50448.1|  hypothetical protein Csa_5G175720                       209   1e-65    
ref|XP_003010446.1|  hypothetical protein ARB_03147                     210   1e-65    
gb|KHJ87478.1|  mitosis protein DIM1                                    213   1e-65    
gb|ESZ97751.1|  mitosis protein dim1                                    210   2e-65    
ref|XP_002617854.1|  conserved hypothetical protein                     210   2e-65    
ref|XP_006484528.1|  PREDICTED: thioredoxin-like protein YLS8-lik...    209   2e-65    
ref|XP_002492891.1|  17-kDa component of the U4/U6aU5 tri-snRNP, ...    210   2e-65    
gb|KHJ80354.1|  mitosis protein DIM1                                    214   2e-65    
ref|XP_006661881.1|  PREDICTED: thioredoxin-like protein YLS8-like      209   2e-65    
ref|XP_009797553.1|  PREDICTED: thioredoxin-like protein YLS8 iso...    211   2e-65    
ref|XP_954144.1|  U5 snRNP-specific component (DIM1 )                   211   3e-65    
gb|EGD97679.1|  pre-mRNA splicing factor Dim1                           210   3e-65    
ref|XP_003234609.1|  pre-mRNA splicing factor Dim1                      210   3e-65    
dbj|BAO42624.1|  spliceosomal protein DIB1                              209   3e-65    
dbj|GAK64439.1|  LUC7-domain-containing protein                         228   4e-65    
dbj|GAC71814.1|  hypothetical protein PANT_5d00081                      226   4e-65    
gb|KDO52731.1|  hypothetical protein CISIN_1g032338mg                   208   5e-65    
ref|XP_003667900.1|  hypothetical protein NDAI_0A05020                  209   5e-65    
ref|XP_451925.1|  hypothetical protein                                  209   6e-65    
ref|XP_004973431.1|  PREDICTED: thioredoxin-like protein 4A-like ...    208   6e-65    
ref|XP_001590469.1|  conserved hypothetical protein                     209   7e-65    
gb|EER44716.1|  pre-mRNA splicing factor Dim1                           208   9e-65    
emb|CDK29974.1|  unnamed protein product                                208   1e-64    
gb|KIH53959.1|  mitosis protein DIM1                                    213   2e-64    
gb|EDP52521.1|  pre-mRNA splicing factor Dim1                           208   3e-64    
gb|KEY78153.1|  pre mRNA splicing factor Dim1                           208   3e-64    
gb|EZF53199.1|  mitosis protein dim1                                    212   3e-64    
ref|XP_754392.1|  pre-mRNA splicing factor Dim1                         208   3e-64    
ref|XP_001540386.1|  mitosis protein dim1                               207   3e-64    
ref|XP_001271226.1|  pre-mRNA splicing factor Dim1                      207   4e-64    
gb|ESX00884.1|  Spliceosomal protein DIB1                               206   6e-64    
emb|CDO92446.1|  unnamed protein product                                206   8e-64    
ref|XP_003682046.1|  hypothetical protein TDEL_0F00240                  206   8e-64    
gb|EFX04646.1|  pre-mRNA splicing factor dim1                           206   1e-63    
gb|EPE09547.1|  mitosis protein dim1                                    205   2e-63    
ref|XP_004179550.1|  hypothetical protein TBLA_0C02190                  205   2e-63    
ref|XP_006590793.1|  PREDICTED: thioredoxin-like protein YLS8-lik...    204   2e-63    
gb|KGO44248.1|  mRNA splicing factor, thioredoxin-like U5 snRNP         205   2e-63    
ref|XP_003645748.1|  hypothetical protein Ecym_3446                     204   3e-63    
gb|EKG12136.1|  mRNA splicing factor thioredoxin-like U5 snRNP          204   3e-63    
ref|XP_002530910.1|  mitosis protein dim1, putative                     207   4e-63    
gb|ABB03719.1|  putative thioredoxin                                    202   5e-63    
gb|EHB01175.1|  Thioredoxin-like protein 4A                             203   6e-63    
gb|KFG54417.1|  TXNL4A/DIM1                                             204   6e-63    
ref|NP_983722.1|  ADL374Wp                                              204   6e-63    
emb|CDF89662.1|  ZYBA0S04-09670g1_1                                     204   7e-63    



>ref|XP_007147409.1| hypothetical protein PHAVU_006G122000g [Phaseolus vulgaris]
 gb|ESW19403.1| hypothetical protein PHAVU_006G122000g [Phaseolus vulgaris]
Length=180

 Score =   300 bits (767),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 141/142 (99%), Positives = 142/142 (100%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAV+YL
Sbjct  39   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVIYL  98

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY
Sbjct  99   VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  158

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLVIAPKDYSTKYRY
Sbjct  159  RGARKGRGLVIAPKDYSTKYRY  180



>ref|XP_007153070.1| hypothetical protein PHAVU_003G004100g [Phaseolus vulgaris]
 gb|ESW25064.1| hypothetical protein PHAVU_003G004100g [Phaseolus vulgaris]
Length=142

 Score =   298 bits (762),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 141/142 (99%), Positives = 142/142 (100%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAV+YL
Sbjct  1    MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY
Sbjct  61   VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLVIAPKDYSTKYRY
Sbjct  121  RGARKGRGLVIAPKDYSTKYRY  142



>ref|XP_010112537.1| Thioredoxin-like protein 4A [Morus notabilis]
 gb|EXC33990.1| Thioredoxin-like protein 4A [Morus notabilis]
Length=142

 Score =   297 bits (761),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 140/142 (99%), Positives = 142/142 (100%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSYLLPHLHSGWAVDQAILAEEERLV+IRFGHDWDETCMQMDEVLASVAET+KNFAVLYL
Sbjct  1    MSYLLPHLHSGWAVDQAILAEEERLVVIRFGHDWDETCMQMDEVLASVAETIKNFAVLYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY
Sbjct  61   VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLVIAPKDYSTKYRY
Sbjct  121  RGARKGRGLVIAPKDYSTKYRY  142



>ref|XP_010918377.1| PREDICTED: thioredoxin-like protein YLS8 [Elaeis guineensis]
 ref|XP_011081649.1| PREDICTED: thioredoxin-like protein YLS8 [Sesamum indicum]
Length=142

 Score =   296 bits (759),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 140/142 (99%), Positives = 142/142 (100%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAET+KNFAV+YL
Sbjct  1    MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETIKNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY
Sbjct  61   VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLVIAPKDYSTKYRY
Sbjct  121  RGARKGRGLVIAPKDYSTKYRY  142



>ref|XP_007223714.1| hypothetical protein PRUPE_ppa013047mg [Prunus persica]
 ref|XP_008221069.1| PREDICTED: thioredoxin-like protein YLS8 [Prunus mume]
 ref|XP_008360010.1| PREDICTED: thioredoxin-like protein YLS8 [Malus domestica]
 gb|EMJ24913.1| hypothetical protein PRUPE_ppa013047mg [Prunus persica]
Length=142

 Score =   296 bits (759),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 140/142 (99%), Positives = 142/142 (100%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSYLLPHLHSGWAVDQAILAEEERLV+IRFGHDWDETCMQMDEVLASVAETLKNFAV+YL
Sbjct  1    MSYLLPHLHSGWAVDQAILAEEERLVLIRFGHDWDETCMQMDEVLASVAETLKNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY
Sbjct  61   VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLVIAPKDYSTKYRY
Sbjct  121  RGARKGRGLVIAPKDYSTKYRY  142



>ref|XP_009386081.1| PREDICTED: thioredoxin-like protein YLS8 [Musa acuminata subsp. 
malaccensis]
Length=142

 Score =   296 bits (759),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 139/142 (98%), Positives = 142/142 (100%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSYLLPHLHSGWAVDQAILAEEERLV+IRFGHDWDETCMQMDEVLASVAET+KNFAVLYL
Sbjct  1    MSYLLPHLHSGWAVDQAILAEEERLVVIRFGHDWDETCMQMDEVLASVAETIKNFAVLYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVET+Y
Sbjct  61   VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETIY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLVIAPKDYSTKYRY
Sbjct  121  RGARKGRGLVIAPKDYSTKYRY  142



>ref|XP_007221211.1| hypothetical protein PRUPE_ppa013055mg [Prunus persica]
 ref|XP_008231994.1| PREDICTED: thioredoxin-like protein YLS8 [Prunus mume]
 gb|EMJ22410.1| hypothetical protein PRUPE_ppa013055mg [Prunus persica]
Length=142

 Score =   296 bits (759),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 140/142 (99%), Positives = 142/142 (100%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLA+VAETLKNFAV+YL
Sbjct  1    MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLAAVAETLKNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY
Sbjct  61   VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLVIAPKDYSTKYRY
Sbjct  121  RGARKGRGLVIAPKDYSTKYRY  142



>gb|EYU20327.1| hypothetical protein MIMGU_mgv1a015867mg [Erythranthe guttata]
Length=142

 Score =   296 bits (759),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 140/142 (99%), Positives = 142/142 (100%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAV+YL
Sbjct  1    MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDI+EVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY
Sbjct  61   VDISEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLVIAPKDYSTKYRY
Sbjct  121  RGARKGRGLVIAPKDYSTKYRY  142



>ref|XP_002310072.1| hypothetical protein POPTR_0007s07660g [Populus trichocarpa]
 ref|XP_002283622.1| PREDICTED: thioredoxin-like protein YLS8 [Vitis vinifera]
 ref|XP_002529724.1| mitosis protein dim1, putative [Ricinus communis]
 ref|XP_003534681.1| PREDICTED: DIM protein [Glycine max]
 ref|XP_003554015.1| PREDICTED: thioredoxin-like protein YLS8-like [Glycine max]
 ref|XP_006847846.1| hypothetical protein AMTR_s00029p00063040 [Amborella trichopoda]
 ref|XP_007043276.1| MRNA splicing factor, thioredoxin-like U5 snRNP isoform 2 [Theobroma 
cacao]
 ref|XP_009407394.1| PREDICTED: thioredoxin-like protein YLS8 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009413118.1| PREDICTED: thioredoxin-like protein YLS8 [Musa acuminata subsp. 
malaccensis]
 ref|XP_010067004.1| PREDICTED: thioredoxin-like protein YLS8 isoform X1 [Eucalyptus 
grandis]
 ref|XP_010274887.1| PREDICTED: thioredoxin-like protein YLS8 [Nelumbo nucifera]
 ref|XP_011002244.1| PREDICTED: thioredoxin-like protein YLS8 isoform X1 [Populus 
euphratica]
 ref|XP_011002246.1| PREDICTED: thioredoxin-like protein YLS8 isoform X1 [Populus 
euphratica]
 gb|ABK94150.1| unknown [Populus trichocarpa]
 gb|EEE90522.1| hypothetical protein POPTR_0007s07660g [Populus trichocarpa]
 gb|EEF32653.1| mitosis protein dim1, putative [Ricinus communis]
 gb|ACU14946.1| unknown [Glycine max]
 emb|CBI26324.3| unnamed protein product [Vitis vinifera]
 gb|EOX99107.1| MRNA splicing factor, thioredoxin-like U5 snRNP isoform 2 [Theobroma 
cacao]
 gb|ERN09427.1| hypothetical protein AMTR_s00029p00063040 [Amborella trichopoda]
 gb|KDP42594.1| hypothetical protein JCGZ_24368 [Jatropha curcas]
 gb|KHN29583.1| Thioredoxin-like protein 4A [Glycine soja]
 gb|KHN34702.1| Thioredoxin-like protein 4A [Glycine soja]
Length=142

 Score =   296 bits (758),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 139/142 (98%), Positives = 142/142 (100%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSYLLPHLHSGWAVDQAILAEEERLV+IRFGHDWDETCMQMDEVLASVAET+KNFAV+YL
Sbjct  1    MSYLLPHLHSGWAVDQAILAEEERLVVIRFGHDWDETCMQMDEVLASVAETIKNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY
Sbjct  61   VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLVIAPKDYSTKYRY
Sbjct  121  RGARKGRGLVIAPKDYSTKYRY  142



>ref|XP_010688677.1| PREDICTED: thioredoxin-like protein YLS8 [Beta vulgaris subsp. 
vulgaris]
 ref|XP_011100757.1| PREDICTED: thioredoxin-like protein YLS8 [Sesamum indicum]
Length=142

 Score =   296 bits (758),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 139/142 (98%), Positives = 142/142 (100%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAET+KNFAV+YL
Sbjct  1    MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETIKNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDITEVPDFNTMYELYDPST+MFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY
Sbjct  61   VDITEVPDFNTMYELYDPSTIMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLVIAPKDYSTKYRY
Sbjct  121  RGARKGRGLVIAPKDYSTKYRY  142



>gb|EYU40757.1| hypothetical protein MIMGU_mgv1a015888mg [Erythranthe guttata]
Length=142

 Score =   296 bits (757),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 140/142 (99%), Positives = 141/142 (99%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAV+YL
Sbjct  1    MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDI EVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY
Sbjct  61   VDIAEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLVIAPKDYSTKYRY
Sbjct  121  RGARKGRGLVIAPKDYSTKYRY  142



>ref|XP_004231501.1| PREDICTED: thioredoxin-like protein YLS8 [Solanum lycopersicum]
 ref|XP_006350358.1| PREDICTED: thioredoxin-like protein 4A-like [Solanum tuberosum]
 ref|XP_009602428.1| PREDICTED: thioredoxin-like protein YLS8 [Nicotiana tomentosiformis]
 ref|XP_009779298.1| PREDICTED: thioredoxin-like protein YLS8 [Nicotiana sylvestris]
Length=142

 Score =   296 bits (757),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 139/142 (98%), Positives = 142/142 (100%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVA+TLKNFAV+YL
Sbjct  1    MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVADTLKNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDITEVPDFNTMYELYDPST+MFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY
Sbjct  61   VDITEVPDFNTMYELYDPSTIMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLVIAPKDYSTKYRY
Sbjct  121  RGARKGRGLVIAPKDYSTKYRY  142



>ref|XP_008361905.1| PREDICTED: thioredoxin-like protein YLS8 isoform X1 [Malus domestica]
 ref|XP_009351743.1| PREDICTED: thioredoxin-like protein YLS8 isoform X1 [Pyrus x 
bretschneideri]
Length=142

 Score =   296 bits (757),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 139/142 (98%), Positives = 142/142 (100%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSYLLPHLHSGWAVDQAILAEEERLV+IRFGHDWDETCMQMDEVLASVAET+KNFAV+YL
Sbjct  1    MSYLLPHLHSGWAVDQAILAEEERLVLIRFGHDWDETCMQMDEVLASVAETIKNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY
Sbjct  61   VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLVIAPKDYSTKYRY
Sbjct  121  RGARKGRGLVIAPKDYSTKYRY  142



>emb|CDP12287.1| unnamed protein product [Coffea canephora]
 emb|CDP07750.1| unnamed protein product [Coffea canephora]
Length=142

 Score =   296 bits (757),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 138/142 (97%), Positives = 142/142 (100%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAET+KNFAV+YL
Sbjct  1    MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETIKNFAVMYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDITEVPDFNTMYELYDPST+MFFFRNKHIMIDLGTGNNNKINWA+KDKQEFIDIVETVY
Sbjct  61   VDITEVPDFNTMYELYDPSTIMFFFRNKHIMIDLGTGNNNKINWAMKDKQEFIDIVETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLVIAPKDYSTKYRY
Sbjct  121  RGARKGRGLVIAPKDYSTKYRY  142



>ref|XP_004148041.1| PREDICTED: thioredoxin-like protein 4A-like [Cucumis sativus]
 ref|XP_004497782.1| PREDICTED: thioredoxin-like protein 4A-like [Cicer arietinum]
 ref|XP_006288859.1| hypothetical protein CARUB_v10002214mg [Capsella rubella]
 ref|XP_006399318.1| hypothetical protein EUTSA_v10014963mg [Eutrema salsugineum]
 ref|XP_008457801.1| PREDICTED: thioredoxin-like protein YLS8 [Cucumis melo]
 ref|XP_010452811.1| PREDICTED: thioredoxin-like protein YLS8 [Camelina sativa]
 ref|XP_010491455.1| PREDICTED: thioredoxin-like protein YLS8 [Camelina sativa]
 gb|ADV04065.1| mitosis protein YLS8 [Hevea brasiliensis]
 gb|AGH25793.1| YLS8 [Gossypium hirsutum]
 gb|EOA21757.1| hypothetical protein CARUB_v10002214mg [Capsella rubella]
 gb|ESQ40771.1| hypothetical protein EUTSA_v10014963mg [Eutrema salsugineum]
 gb|KGN62024.1| hypothetical protein Csa_2G287060 [Cucumis sativus]
 gb|KHG03038.1| Thioredoxin-like protein 4A [Gossypium arboreum]
Length=142

 Score =   296 bits (757),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 138/142 (97%), Positives = 142/142 (100%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSYLLPHLHSGWAVDQAILAEEERLV+IRFGHDWDETCMQMDEVLASVAET+KNFAV+YL
Sbjct  1    MSYLLPHLHSGWAVDQAILAEEERLVVIRFGHDWDETCMQMDEVLASVAETIKNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDI+ETVY
Sbjct  61   VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIIETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLVIAPKDYSTKYRY
Sbjct  121  RGARKGRGLVIAPKDYSTKYRY  142



>ref|NP_001064903.1| Os10g0486600 [Oryza sativa Japonica Group]
 ref|NP_001148867.1| LOC100282486 [Zea mays]
 ref|NP_001175097.1| Os07g0202450 [Oryza sativa Japonica Group]
 ref|XP_002444330.1| hypothetical protein SORBIDRAFT_07g020280 [Sorghum bicolor]
 ref|XP_002436726.1| hypothetical protein SORBIDRAFT_10g007680 [Sorghum bicolor]
 ref|XP_004982785.1| PREDICTED: thioredoxin-like protein 4A-like [Setaria italica]
 ref|XP_006657540.1| PREDICTED: thioredoxin-like protein YLS8-like [Oryza brachyantha]
 gb|AAL59040.1|AC087182_23 putative thioredoxin-like U5 small ribonucleoprotein particle 
protein [Oryza sativa Japonica Group]
 gb|AAP54355.1| Thioredoxin-like protein 4A, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAC79773.1| putative dim1p [Oryza sativa Japonica Group]
 dbj|BAD31005.1| putative dim1p [Oryza sativa Japonica Group]
 dbj|BAF26817.1| Os10g0486600 [Oryza sativa Japonica Group]
 gb|ACG31959.1| mitosis protein dim1 [Zea mays]
 gb|ACG33200.1| mitosis protein dim1 [Zea mays]
 dbj|BAG88864.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH00788.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC81699.1| hypothetical protein OsI_25296 [Oryza sativa Indica Group]
 gb|EEE51171.1| hypothetical protein OsJ_31953 [Oryza sativa Japonica Group]
 gb|EEE66764.1| hypothetical protein OsJ_23479 [Oryza sativa Japonica Group]
 gb|EER88093.1| hypothetical protein SORBIDRAFT_10g007680 [Sorghum bicolor]
 gb|EES13825.1| hypothetical protein SORBIDRAFT_07g020280 [Sorghum bicolor]
 dbj|BAH93825.1| Os07g0202450 [Oryza sativa Japonica Group]
 tpg|DAA49124.1| TPA: mitosis protein dim1 [Zea mays]
Length=142

 Score =   295 bits (756),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 139/142 (98%), Positives = 142/142 (100%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLA+VAET+KNFAV+YL
Sbjct  1    MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLAAVAETIKNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY
Sbjct  61   VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLVIAPKDYSTKYRY
Sbjct  121  RGARKGRGLVIAPKDYSTKYRY  142



>emb|CDP19065.1| unnamed protein product [Coffea canephora]
Length=142

 Score =   295 bits (756),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 138/142 (97%), Positives = 142/142 (100%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSYLLPHLHSGWAVDQAILAEEERLV+IRFGHDWDETCMQMDEVLASVAET+KNFAVLYL
Sbjct  1    MSYLLPHLHSGWAVDQAILAEEERLVLIRFGHDWDETCMQMDEVLASVAETIKNFAVLYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDITEVPDFNTMYELYDPST+MFFFRNKHIMIDLGTGNNNKINWA+KDKQEFIDIVETVY
Sbjct  61   VDITEVPDFNTMYELYDPSTIMFFFRNKHIMIDLGTGNNNKINWAMKDKQEFIDIVETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLVIAPKDYSTKYRY
Sbjct  121  RGARKGRGLVIAPKDYSTKYRY  142



>ref|XP_009797554.1| PREDICTED: thioredoxin-like protein YLS8 isoform X2 [Nicotiana 
sylvestris]
Length=142

 Score =   295 bits (756),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 139/142 (98%), Positives = 142/142 (100%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWD+TCMQMDEVLASVAET+KNFAV+YL
Sbjct  1    MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDDTCMQMDEVLASVAETIKNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY
Sbjct  61   VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLVIAPKDYSTKYRY
Sbjct  121  RGARKGRGLVIAPKDYSTKYRY  142



>ref|XP_004293898.1| PREDICTED: thioredoxin-like protein YLS8 [Fragaria vesca subsp. 
vesca]
Length=142

 Score =   295 bits (755),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 138/142 (97%), Positives = 142/142 (100%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSYLLPHLHSGWAVDQAILAEEERLV+IRFGHDWDETCMQMDEVLA+VAETLKNFAV+YL
Sbjct  1    MSYLLPHLHSGWAVDQAILAEEERLVVIRFGHDWDETCMQMDEVLANVAETLKNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFID+VETVY
Sbjct  61   VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDVVETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLVIAPKDYSTKYRY
Sbjct  121  RGARKGRGLVIAPKDYSTKYRY  142



>gb|KJB77370.1| hypothetical protein B456_012G134400 [Gossypium raimondii]
Length=207

 Score =   298 bits (762),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 138/145 (95%), Positives = 143/145 (99%), Gaps = 0/145 (0%)
 Frame = +2

Query  17   EERMSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAV  196
            +  MSYLLPHLHSGWAVDQAILAEEERLV+IRFGHDWDETCMQMDEVLASVAET+KNFAV
Sbjct  63   DRTMSYLLPHLHSGWAVDQAILAEEERLVVIRFGHDWDETCMQMDEVLASVAETIKNFAV  122

Query  197  LYLVDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVE  376
            +YLVDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDI+E
Sbjct  123  IYLVDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIIE  182

Query  377  TVYRGARKGRGLVIAPKDYSTKYRY  451
            TVYRGARKGRGLVIAPKDYSTKYRY
Sbjct  183  TVYRGARKGRGLVIAPKDYSTKYRY  207



>ref|XP_004973430.1| PREDICTED: thioredoxin-like protein 4A-like isoform X1 [Setaria 
italica]
Length=142

 Score =   295 bits (755),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 138/142 (97%), Positives = 142/142 (100%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLA+VAET+KNFAV+YL
Sbjct  1    MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLAAVAETIKNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEF+DIVETVY
Sbjct  61   VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFVDIVETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLVIAPKDYSTKYRY
Sbjct  121  RGARKGRGLVIAPKDYSTKYRY  142



>ref|NP_196446.1| thioredoxin-like protein YLS8 [Arabidopsis thaliana]
 sp|Q9FE62.1|YLS8_ARATH RecName: Full=Thioredoxin-like protein YLS8; AltName: Full=Protein 
YELLOW-LEAF-SPECIFIC GENE 8 [Arabidopsis thaliana]
 gb|AAG40036.1|AF324685_1 AT5g08290 [Arabidopsis thaliana]
 gb|AAG41439.1|AF326857_1 unknown protein [Arabidopsis thaliana]
 gb|AAK00362.1|AF339680_1 unknown protein [Arabidopsis thaliana]
 gb|AAK52991.1|AF375407_1 AT5g08290/F8L15_20 [Arabidopsis thaliana]
 emb|CAC08329.1| putative protein [Arabidopsis thaliana]
 dbj|BAB32888.1| Dim1 homolog [Arabidopsis thaliana]
 gb|AAL47418.1| AT5g08290/F8L15_20 [Arabidopsis thaliana]
 gb|AED91278.1| mRNA splicing factor, thioredoxin-like U5 snRNP [Arabidopsis 
thaliana]
Length=142

 Score =   295 bits (754),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 137/142 (96%), Positives = 142/142 (100%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSYLLPHLHSGWAVDQ+ILAEEERLV+IRFGHDWDETCMQMDEVLASVAET+KNFAV+YL
Sbjct  1    MSYLLPHLHSGWAVDQSILAEEERLVVIRFGHDWDETCMQMDEVLASVAETIKNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDI+ETVY
Sbjct  61   VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIIETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLVIAPKDYSTKYRY
Sbjct  121  RGARKGRGLVIAPKDYSTKYRY  142



>ref|XP_002871315.1| hypothetical protein ARALYDRAFT_908777 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47574.1| hypothetical protein ARALYDRAFT_908777 [Arabidopsis lyrata subsp. 
lyrata]
Length=142

 Score =   295 bits (754),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 137/142 (96%), Positives = 142/142 (100%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSYLLPHLHSGWAVDQAILAEEERLV+IRFGHDWDETCMQMDEVL+SVAET+KNFAV+YL
Sbjct  1    MSYLLPHLHSGWAVDQAILAEEERLVVIRFGHDWDETCMQMDEVLSSVAETIKNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDI+ETVY
Sbjct  61   VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIIETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLVIAPKDYSTKYRY
Sbjct  121  RGARKGRGLVIAPKDYSTKYRY  142



>ref|XP_010522102.1| PREDICTED: thioredoxin-like protein YLS8 [Tarenaya hassleriana]
Length=142

 Score =   295 bits (754),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 138/142 (97%), Positives = 141/142 (99%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSYLLPHLHSGWAVDQAILAEE RLV+IRFGHDWDETCMQMDEVLASVAETLKNFAV+YL
Sbjct  1    MSYLLPHLHSGWAVDQAILAEEARLVVIRFGHDWDETCMQMDEVLASVAETLKNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDITEVPDFNTMYELYDPST+MFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY
Sbjct  61   VDITEVPDFNTMYELYDPSTIMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLVIAPKDYSTKYRY
Sbjct  121  RGARKGRGLVIAPKDYSTKYRY  142



>ref|XP_007223713.1| hypothetical protein PRUPE_ppa013047mg [Prunus persica]
 gb|EMJ24912.1| hypothetical protein PRUPE_ppa013047mg [Prunus persica]
Length=142

 Score =   295 bits (754),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 138/142 (97%), Positives = 142/142 (100%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSYLLPHLHSGWAVDQAILAEEER+V+IRFGHDWD+TCMQMDEVLASVAETLKNFAV+YL
Sbjct  1    MSYLLPHLHSGWAVDQAILAEEERVVVIRFGHDWDDTCMQMDEVLASVAETLKNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY
Sbjct  61   VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLVIAPKDYSTKYRY
Sbjct  121  RGARKGRGLVIAPKDYSTKYRY  142



>ref|XP_004163626.1| PREDICTED: thioredoxin-like protein 4A-like [Cucumis sativus]
Length=142

 Score =   294 bits (753),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 137/142 (96%), Positives = 141/142 (99%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSYLLPHLHSGWAVDQAILAEEERLV+IRFGHDWDETCMQMDEVLASVAET+KNFAV+YL
Sbjct  1    MSYLLPHLHSGWAVDQAILAEEERLVVIRFGHDWDETCMQMDEVLASVAETIKNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDITEVPDFNTMYELYDPST MFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDI+ETVY
Sbjct  61   VDITEVPDFNTMYELYDPSTAMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIIETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLVIAPKDYSTKYRY
Sbjct  121  RGARKGRGLVIAPKDYSTKYRY  142



>ref|XP_010423115.1| PREDICTED: thioredoxin-like protein YLS8 [Camelina sativa]
Length=142

 Score =   294 bits (753),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 137/142 (96%), Positives = 142/142 (100%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSYLLPHLHSGWAVDQAILAEEERLV+IRFGHDWDETCMQMDEVLA+VAET+KNFAV+YL
Sbjct  1    MSYLLPHLHSGWAVDQAILAEEERLVVIRFGHDWDETCMQMDEVLANVAETIKNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDI+ETVY
Sbjct  61   VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIIETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLVIAPKDYSTKYRY
Sbjct  121  RGARKGRGLVIAPKDYSTKYRY  142



>ref|XP_008361907.1| PREDICTED: thioredoxin-like protein YLS8 isoform X2 [Malus domestica]
 ref|XP_008445881.1| PREDICTED: thioredoxin-like protein YLS8 [Cucumis melo]
 ref|XP_009351744.1| PREDICTED: thioredoxin-like protein YLS8 isoform X2 [Pyrus x 
bretschneideri]
 ref|XP_010067005.1| PREDICTED: thioredoxin-like protein YLS8 isoform X2 [Eucalyptus 
grandis]
 ref|XP_011002245.1| PREDICTED: thioredoxin-like protein YLS8 isoform X2 [Populus 
euphratica]
Length=142

 Score =   294 bits (753),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 138/142 (97%), Positives = 142/142 (100%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSYLLPHLHSGWAVDQAILAEEER+VIIRFGHDWD+TCMQMDEVLASVAET+KNFAV+YL
Sbjct  1    MSYLLPHLHSGWAVDQAILAEEERVVIIRFGHDWDDTCMQMDEVLASVAETIKNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY
Sbjct  61   VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLVIAPKDYSTKYRY
Sbjct  121  RGARKGRGLVIAPKDYSTKYRY  142



>ref|XP_006437597.1| hypothetical protein CICLE_v10033145mg [Citrus clementina]
 ref|XP_006484526.1| PREDICTED: thioredoxin-like protein YLS8-like isoform X1 [Citrus 
sinensis]
 gb|ESR50837.1| hypothetical protein CICLE_v10033145mg [Citrus clementina]
 gb|KDO52729.1| hypothetical protein CISIN_1g032338mg [Citrus sinensis]
Length=142

 Score =   294 bits (752),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 137/142 (96%), Positives = 142/142 (100%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSYLLPHLHSGWAVDQAILAEEERLV+IRFGHDWDETCMQMDEVL+SVAET+KNFAV+YL
Sbjct  1    MSYLLPHLHSGWAVDQAILAEEERLVVIRFGHDWDETCMQMDEVLSSVAETIKNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDI+EVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY
Sbjct  61   VDISEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLVIAPKDYSTKYRY
Sbjct  121  RGARKGRGLVIAPKDYSTKYRY  142



>ref|XP_003590204.1| Thioredoxin-like 4A [Medicago truncatula]
 gb|ABK22569.1| unknown [Picea sitchensis]
 gb|ABK22751.1| unknown [Picea sitchensis]
 gb|AES60455.1| mRNA splicing factor, thioredoxin-like U5 snRNP protein [Medicago 
truncatula]
Length=142

 Score =   294 bits (752),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 136/142 (96%), Positives = 142/142 (100%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSYLLPHLHSGWAVDQAILAEEERLV+IRFGHDWDETCMQMDEVL+SVAET+KNFAV+YL
Sbjct  1    MSYLLPHLHSGWAVDQAILAEEERLVVIRFGHDWDETCMQMDEVLSSVAETIKNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWA+KDKQEFIDI+ETVY
Sbjct  61   VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWAMKDKQEFIDIIETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLVIAPKDYSTKYRY
Sbjct  121  RGARKGRGLVIAPKDYSTKYRY  142



>ref|XP_004143618.1| PREDICTED: thioredoxin-like protein 4A-like [Cucumis sativus]
 ref|XP_004165267.1| PREDICTED: thioredoxin-like protein 4A-like [Cucumis sativus]
Length=142

 Score =   293 bits (751),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 137/142 (96%), Positives = 142/142 (100%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSYLLPHLHSGWAVDQAILAEEER+VIIRFGHDWD+TCMQMDEVLASVAET+KNFAV+YL
Sbjct  1    MSYLLPHLHSGWAVDQAILAEEERVVIIRFGHDWDDTCMQMDEVLASVAETIKNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDI+ETVY
Sbjct  61   VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIIETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLVIAPKDYSTKYRY
Sbjct  121  RGARKGRGLVIAPKDYSTKYRY  142



>ref|XP_009122442.1| PREDICTED: thioredoxin-like protein YLS8 [Brassica rapa]
 emb|CDY21530.1| BnaC09g47620D [Brassica napus]
 emb|CDX69958.1| BnaA10g23070D [Brassica napus]
Length=142

 Score =   293 bits (751),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 136/142 (96%), Positives = 142/142 (100%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSYLLPHLHSGWAVDQAILAEEERLV+IRFGHDWDETCMQMDEVLASVAET+KNFAV+YL
Sbjct  1    MSYLLPHLHSGWAVDQAILAEEERLVVIRFGHDWDETCMQMDEVLASVAETIKNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWA+KDKQEFIDI+ETV+
Sbjct  61   VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWAMKDKQEFIDIIETVF  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLVIAPKDYSTKYRY
Sbjct  121  RGARKGRGLVIAPKDYSTKYRY  142



>ref|XP_006359304.1| PREDICTED: thioredoxin-like protein 4A-like [Solanum tuberosum]
Length=142

 Score =   293 bits (750),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 136/142 (96%), Positives = 142/142 (100%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWD+TCMQMDEVL+SVAET+KNFAV+YL
Sbjct  1    MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDDTCMQMDEVLSSVAETIKNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDITEVPDFNTMYELYDPST+MFFFRNKHIMIDLGTGNNNKINWALKDKQEF+DIVETVY
Sbjct  61   VDITEVPDFNTMYELYDPSTIMFFFRNKHIMIDLGTGNNNKINWALKDKQEFVDIVETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLVIAPKDYSTKYRY
Sbjct  121  RGARKGRGLVIAPKDYSTKYRY  142



>gb|EEC67208.1| hypothetical protein OsI_34094 [Oryza sativa Indica Group]
Length=274

 Score =   298 bits (763),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 139/142 (98%), Positives = 142/142 (100%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLA+VAET+KNFAV+YL
Sbjct  133  MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLAAVAETIKNFAVIYL  192

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY
Sbjct  193  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  252

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLVIAPKDYSTKYRY
Sbjct  253  RGARKGRGLVIAPKDYSTKYRY  274



>gb|KCW65068.1| hypothetical protein EUGRSUZ_G02580 [Eucalyptus grandis]
Length=317

 Score =   300 bits (767),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 139/142 (98%), Positives = 142/142 (100%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSYLLPHLHSGWAVDQAILAEEERLV+IRFGHDWDETCMQMDEVLASVAET+KNFAV+YL
Sbjct  176  MSYLLPHLHSGWAVDQAILAEEERLVVIRFGHDWDETCMQMDEVLASVAETIKNFAVIYL  235

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY
Sbjct  236  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  295

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLVIAPKDYSTKYRY
Sbjct  296  RGARKGRGLVIAPKDYSTKYRY  317


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = +1

Query  16   RRKDVVLAAPSSLRLGGRPSHPRRGGAPSHYPLRPRLGRDLHA  144
            R +DVVL A  +L +GG   HPRRGGA  H+PLRPRLGR LHA
Sbjct  90   RERDVVLVAAPALGMGGGSGHPRRGGARRHHPLRPRLGRHLHA  132



>ref|XP_003603529.1| Thioredoxin-like 4A [Medicago truncatula]
 gb|ACJ83266.1| unknown [Medicago truncatula]
 gb|AES73780.1| mRNA splicing factor, thioredoxin-like U5 snRNP protein [Medicago 
truncatula]
 gb|AFK46424.1| unknown [Medicago truncatula]
Length=142

 Score =   293 bits (750),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 135/142 (95%), Positives = 142/142 (100%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSY+LPHLHSGWAVDQAILAEEERLV+IRFGHDWDETCMQMDEVL+SVAET+KNFAV+YL
Sbjct  1    MSYMLPHLHSGWAVDQAILAEEERLVVIRFGHDWDETCMQMDEVLSSVAETIKNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWA+KDKQEFIDI+ETVY
Sbjct  61   VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWAMKDKQEFIDIIETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLVIAPKDYSTKYRY
Sbjct  121  RGARKGRGLVIAPKDYSTKYRY  142



>ref|XP_004236839.1| PREDICTED: thioredoxin-like protein YLS8 [Solanum lycopersicum]
Length=142

 Score =   293 bits (749),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 136/142 (96%), Positives = 142/142 (100%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSYLLPHLHSGWAVDQAILAEEERLV+IRFGHDWD+TCMQMDEVL+SVAET+KNFAV+YL
Sbjct  1    MSYLLPHLHSGWAVDQAILAEEERLVLIRFGHDWDDTCMQMDEVLSSVAETIKNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDITEVPDFNTMYELYDPST+MFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY
Sbjct  61   VDITEVPDFNTMYELYDPSTIMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLVIAPKDYSTKYRY
Sbjct  121  RGARKGRGLVIAPKDYSTKYRY  142



>gb|AAM61612.1| putative thioredoxin-like U5 small ribonucleoprotein particle 
protein [Arabidopsis thaliana]
Length=142

 Score =   293 bits (749),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 136/142 (96%), Positives = 141/142 (99%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSYLLPHLHSGWAVDQ+ILAEEERLV+IRFGHDWDETCMQMDEVLAS AET+KNFAV+YL
Sbjct  1    MSYLLPHLHSGWAVDQSILAEEERLVVIRFGHDWDETCMQMDEVLASFAETIKNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDI+ETVY
Sbjct  61   VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIIETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLVIAPKDYSTKYRY
Sbjct  121  RGARKGRGLVIAPKDYSTKYRY  142



>ref|XP_009612361.1| PREDICTED: thioredoxin-like protein YLS8 [Nicotiana tomentosiformis]
Length=142

 Score =   293 bits (749),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 137/142 (96%), Positives = 141/142 (99%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWD+ CMQMDEVLASVAET+KNFAV+YL
Sbjct  1    MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDDNCMQMDEVLASVAETIKNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDITEVPDFNTMYELYDPST+MFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY
Sbjct  61   VDITEVPDFNTMYELYDPSTIMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLVIAPKDYSTKYRY
Sbjct  121  RGARKGRGLVIAPKDYSTKYRY  142



>emb|CDX81091.1| BnaC03g03450D [Brassica napus]
Length=142

 Score =   292 bits (748),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 135/142 (95%), Positives = 142/142 (100%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSYLLPHLHSGWAVDQAILAEEERLV+IRFGHDWDETCMQMDEVLASVAET+KNFAV+YL
Sbjct  1    MSYLLPHLHSGWAVDQAILAEEERLVVIRFGHDWDETCMQMDEVLASVAETIKNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDI+EVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWA+KDKQEFIDI+ETV+
Sbjct  61   VDISEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWAMKDKQEFIDIIETVF  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLVIAPKDYSTKYRY
Sbjct  121  RGARKGRGLVIAPKDYSTKYRY  142



>ref|XP_003568138.1| PREDICTED: thioredoxin-like protein YLS8 [Brachypodium distachyon]
Length=142

 Score =   292 bits (748),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 136/142 (96%), Positives = 141/142 (99%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSYLLPHLHSGWAVDQAILAEEERLV+IRFGHDWDETCMQMDEVLA VAET+KNFAV+YL
Sbjct  1    MSYLLPHLHSGWAVDQAILAEEERLVMIRFGHDWDETCMQMDEVLAGVAETIKNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWA+KDKQEF+DIVETVY
Sbjct  61   VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWAMKDKQEFVDIVETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLVIAPKDYSTKYRY
Sbjct  121  RGARKGRGLVIAPKDYSTKYRY  142



>gb|AFK35471.1| unknown [Lotus japonicus]
Length=142

 Score =   291 bits (746),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 136/142 (96%), Positives = 141/142 (99%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSYLLPHLHSGWAVDQAILAEEERLV+I FGHDWDETCMQMDEVLASVAET+KNFAV+YL
Sbjct  1    MSYLLPHLHSGWAVDQAILAEEERLVVICFGHDWDETCMQMDEVLASVAETIKNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWA+KDKQEFIDIVET+Y
Sbjct  61   VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWAMKDKQEFIDIVETIY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLVIAPKDYSTKYRY
Sbjct  121  RGARKGRGLVIAPKDYSTKYRY  142



>dbj|BAJ90446.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=142

 Score =   291 bits (745),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 135/142 (95%), Positives = 141/142 (99%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSYLLPHLHSGWAVDQAILAEEERLV+IRFGHDWDETCMQMDEVL+ VAET+KNFAV+YL
Sbjct  1    MSYLLPHLHSGWAVDQAILAEEERLVMIRFGHDWDETCMQMDEVLSGVAETIKNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWA+KDKQEF+DIVETVY
Sbjct  61   VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWAMKDKQEFVDIVETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLVIAPKDYSTKYRY
Sbjct  121  RGARKGRGLVIAPKDYSTKYRY  142



>gb|ACJ85953.1| unknown [Medicago truncatula]
 gb|AFK49180.1| unknown [Medicago truncatula]
Length=142

 Score =   291 bits (744),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 135/142 (95%), Positives = 141/142 (99%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSYLLPHLHSGWAVDQAILAEEERLV+IRFGHDWDETCMQMDEVL+SVAET+KNFAV+YL
Sbjct  1    MSYLLPHLHSGWAVDQAILAEEERLVVIRFGHDWDETCMQMDEVLSSVAETIKNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDITEVPDFNTMYELYDPSTVM FFRNKHIMIDLGTGNNNKINWA+KDKQEFIDI+ETVY
Sbjct  61   VDITEVPDFNTMYELYDPSTVMSFFRNKHIMIDLGTGNNNKINWAMKDKQEFIDIIETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLVIAPKDYSTKYRY
Sbjct  121  RGARKGRGLVIAPKDYSTKYRY  142



>gb|KDP39006.1| hypothetical protein JCGZ_00763 [Jatropha curcas]
Length=142

 Score =   290 bits (743),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 137/142 (96%), Positives = 140/142 (99%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSYLLPHLHSGWAVDQAILAEEER+VIIRFGHDWDETCMQMDEVLASVAE +KNFAV+YL
Sbjct  1    MSYLLPHLHSGWAVDQAILAEEERVVIIRFGHDWDETCMQMDEVLASVAEKIKNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDITEV DFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY
Sbjct  61   VDITEVADFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLVIAPKDYSTKYRY
Sbjct  121  RGARKGRGLVIAPKDYSTKYRY  142



>dbj|BAJ90457.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ89482.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=142

 Score =   290 bits (743),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 135/142 (95%), Positives = 140/142 (99%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDE CMQMDEVL+ VAET+KNFAV+YL
Sbjct  1    MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDENCMQMDEVLSGVAETIKNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWA+KDKQEF+DIVETVY
Sbjct  61   VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWAMKDKQEFVDIVETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLVIAPKDYSTKYRY
Sbjct  121  RGARKGRGLVIAPKDYSTKYRY  142



>ref|XP_006484527.1| PREDICTED: thioredoxin-like protein YLS8-like isoform X2 [Citrus 
sinensis]
 gb|KDO52727.1| hypothetical protein CISIN_1g032338mg [Citrus sinensis]
Length=142

 Score =   290 bits (743),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 135/142 (95%), Positives = 141/142 (99%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSYLLPHLHSGWAVDQAIL EEER+VIIRFGHDWD+TCMQMDEVL+SVAET+KNFAV+YL
Sbjct  1    MSYLLPHLHSGWAVDQAILTEEERVVIIRFGHDWDDTCMQMDEVLSSVAETIKNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDI+EVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY
Sbjct  61   VDISEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLVIAPKDYSTKYRY
Sbjct  121  RGARKGRGLVIAPKDYSTKYRY  142



>gb|EMS68243.1| Thioredoxin-like protein 4A [Triticum urartu]
Length=142

 Score =   289 bits (740),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 135/142 (95%), Positives = 140/142 (99%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSYLLPHLHSGWAVDQAILAEEERL IIRFGHDWDETCMQMDEVL+ VAET+KNFAV+YL
Sbjct  1    MSYLLPHLHSGWAVDQAILAEEERLGIIRFGHDWDETCMQMDEVLSGVAETIKNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWA+KDKQEF+DIVETVY
Sbjct  61   VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWAMKDKQEFVDIVETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLVIAPKDYSTKYRY
Sbjct  121  RGARKGRGLVIAPKDYSTKYRY  142



>ref|XP_001771732.1| predicted protein [Physcomitrella patens]
 gb|EDQ63515.1| predicted protein [Physcomitrella patens]
Length=142

 Score =   289 bits (740),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 133/142 (94%), Positives = 140/142 (99%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSYLLPHLHSGWAVDQAILAEEER V+IRFGHDWDETCMQMDEVLASVAET+KNFAV+YL
Sbjct  1    MSYLLPHLHSGWAVDQAILAEEERAVVIRFGHDWDETCMQMDEVLASVAETIKNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDI+EVPDFNTMYELYDP T+MFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY
Sbjct  61   VDISEVPDFNTMYELYDPCTIMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLV++PKDYSTKYRY
Sbjct  121  RGARKGRGLVVSPKDYSTKYRY  142



>dbj|BAJ88120.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=142

 Score =   288 bits (738),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 134/142 (94%), Positives = 140/142 (99%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDE CMQMDEVL+ VAET+KNFAV+YL
Sbjct  1    MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDENCMQMDEVLSGVAETIKNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDITEVPDF+TMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWA+KDKQEF+DIVETVY
Sbjct  61   VDITEVPDFSTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWAMKDKQEFVDIVETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLVIAPKDYSTKYRY
Sbjct  121  RGARKGRGLVIAPKDYSTKYRY  142



>ref|XP_004297732.1| PREDICTED: thioredoxin-like protein YLS8 [Fragaria vesca subsp. 
vesca]
Length=142

 Score =   288 bits (737),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 134/142 (94%), Positives = 141/142 (99%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSYLLPHLHSGWAVDQAILAEEER+VIIRFGHDWD+TCMQMDEVLA+VA+ +KNFAV+YL
Sbjct  1    MSYLLPHLHSGWAVDQAILAEEERVVIIRFGHDWDDTCMQMDEVLAAVADKIKNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDI+EVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY
Sbjct  61   VDISEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLVIAPKDYSTKYRY
Sbjct  121  RGARKGRGLVIAPKDYSTKYRY  142



>ref|XP_006437596.1| hypothetical protein CICLE_v10033145mg [Citrus clementina]
 gb|ESR50836.1| hypothetical protein CICLE_v10033145mg [Citrus clementina]
Length=142

 Score =   287 bits (735),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 134/142 (94%), Positives = 140/142 (99%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSYLLPHLHSGWAVDQAIL EEE +VIIRFGHDWD+TCMQMDEVL+SVAET+KNFAV+YL
Sbjct  1    MSYLLPHLHSGWAVDQAILTEEECVVIIRFGHDWDDTCMQMDEVLSSVAETIKNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDI+EVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY
Sbjct  61   VDISEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLVIAPKDYSTKYRY
Sbjct  121  RGARKGRGLVIAPKDYSTKYRY  142



>ref|XP_003607261.1| Thioredoxin-like 4A [Medicago truncatula]
 gb|AES89458.1| mRNA splicing factor, thioredoxin-like U5 snRNP protein [Medicago 
truncatula]
Length=142

 Score =   285 bits (730),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 132/142 (93%), Positives = 139/142 (98%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSYLLPHLHSGWAVDQAIL EEERLV+IRFGHDWD+TCMQMDEVLASVAET+KNFAV+YL
Sbjct  1    MSYLLPHLHSGWAVDQAILCEEERLVVIRFGHDWDDTCMQMDEVLASVAETIKNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDITEVPDFNTMYELYDP TVMFFFRNKHIMIDLGTGNNNKINWAL+DKQEFIDIVETV+
Sbjct  61   VDITEVPDFNTMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWALRDKQEFIDIVETVF  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
             GARKGRGLVI+PKDYSTKYRY
Sbjct  121  HGARKGRGLVISPKDYSTKYRY  142



>ref|XP_010680626.1| PREDICTED: thioredoxin-like protein YLS8 [Beta vulgaris subsp. 
vulgaris]
Length=142

 Score =   284 bits (726),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 131/142 (92%), Positives = 139/142 (98%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSYLLPHLHSGWAVDQAIL+EE+R+VIIRFGHDWD+TCMQMDEVLA+VAET+KNFAV+Y 
Sbjct  1    MSYLLPHLHSGWAVDQAILSEEQRVVIIRFGHDWDDTCMQMDEVLAAVAETIKNFAVIYT  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDITEVPDFNTMYELYDP TVMFFFRNKHIMIDLGTGNNNKINWALK KQEFIDIVETVY
Sbjct  61   VDITEVPDFNTMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWALKSKQEFIDIVETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLVI+PKDYSTKYRY
Sbjct  121  RGARKGRGLVISPKDYSTKYRY  142



>ref|XP_003580868.1| PREDICTED: thioredoxin-like protein YLS8 [Brachypodium distachyon]
Length=142

 Score =   281 bits (720),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 130/142 (92%), Positives = 136/142 (96%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSYLLPHLHSGWAVDQAI+AE ERLV+IRFGHDWDETCMQMDEVLA VAE +KNFAV YL
Sbjct  1    MSYLLPHLHSGWAVDQAIMAENERLVMIRFGHDWDETCMQMDEVLAGVAEKIKNFAVTYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDITEVPDFNT+YELYDPSTVMFFFRNKHIMIDLGTGNNNKINWA+KDK EF+DIVETVY
Sbjct  61   VDITEVPDFNTLYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWAMKDKHEFVDIVETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGL IAPKDYSTKYRY
Sbjct  121  RGARKGRGLAIAPKDYSTKYRY  142



>ref|XP_007043275.1| MRNA splicing factor isoform 1 [Theobroma cacao]
 gb|EOX99106.1| MRNA splicing factor isoform 1 [Theobroma cacao]
Length=166

 Score =   282 bits (722),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 139/166 (84%), Positives = 142/166 (86%), Gaps = 24/166 (14%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEER------------------------LVIIRFGHDWDE  133
            MSYLLPHLHSGWAVDQAILAEEER                        LV+IRFGHDWDE
Sbjct  1    MSYLLPHLHSGWAVDQAILAEEERVVIIRFGHDWDDTCMQAILAEEERLVVIRFGHDWDE  60

Query  134  TCMQMDEVLASVAETLKNFAVLYLVDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGT  313
            TCMQMDEVLASVAET+KNFAV+YLVDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGT
Sbjct  61   TCMQMDEVLASVAETIKNFAVIYLVDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGT  120

Query  314  GNNNKINWALKDKQEFIDIVETVYRGARKGRGLVIAPKDYSTKYRY  451
            GNNNKINWALKDKQEFIDIVETVYRGARKGRGLVIAPKDYSTKYRY
Sbjct  121  GNNNKINWALKDKQEFIDIVETVYRGARKGRGLVIAPKDYSTKYRY  166



>ref|XP_002961771.1| hypothetical protein SELMODRAFT_76404 [Selaginella moellendorffii]
 ref|XP_002964841.1| hypothetical protein SELMODRAFT_230526 [Selaginella moellendorffii]
 gb|EFJ33679.1| hypothetical protein SELMODRAFT_230526 [Selaginella moellendorffii]
 gb|EFJ37031.1| hypothetical protein SELMODRAFT_76404 [Selaginella moellendorffii]
Length=142

 Score =   281 bits (719),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 130/142 (92%), Positives = 138/142 (97%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSYLLPHLHSG+ VDQAIL E+ER+V+IRFGHDWDETCMQMDEVLA+VAE LKNFAV+YL
Sbjct  1    MSYLLPHLHSGYVVDQAILTEDERVVVIRFGHDWDETCMQMDEVLANVAEPLKNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDITEVPDFNTMYELYDP TVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY
Sbjct  61   VDITEVPDFNTMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLV++PKDYSTKYRY
Sbjct  121  RGARKGRGLVVSPKDYSTKYRY  142



>gb|AAP85544.1| putative DIM-like protein [Glycine max]
Length=137

 Score =   280 bits (716),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 131/137 (96%), Positives = 136/137 (99%), Gaps = 0/137 (0%)
 Frame = +2

Query  41   PHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYLVDITE  220
            P L++GWAVDQAILAEEERLV+IRFGHDWDETCMQMDEVLASVAET+KNFAV+YLVDITE
Sbjct  1    PSLNAGWAVDQAILAEEERLVVIRFGHDWDETCMQMDEVLASVAETIKNFAVIYLVDITE  60

Query  221  VPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVYRGARK  400
            VPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVYRGARK
Sbjct  61   VPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVYRGARK  120

Query  401  GRGLVIAPKDYSTKYRY  451
            GRGLVIAPKDYSTKYRY
Sbjct  121  GRGLVIAPKDYSTKYRY  137



>ref|XP_003565097.1| PREDICTED: thioredoxin-like protein YLS8 [Brachypodium distachyon]
Length=142

 Score =   280 bits (716),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 129/142 (91%), Positives = 136/142 (96%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSYLLPHLHSGWAVDQAI+AE ERLV+IRFGHDWDETCMQMDEVLA VAE +KNFAV YL
Sbjct  1    MSYLLPHLHSGWAVDQAIMAENERLVMIRFGHDWDETCMQMDEVLAGVAEKIKNFAVTYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDITEVPDFNT+YELYDPSTVMFFFRNKHIMIDLGTGNNNKINWA+KDK +F+DIVETVY
Sbjct  61   VDITEVPDFNTLYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWAMKDKHDFVDIVETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGL IAPKDYSTKYRY
Sbjct  121  RGARKGRGLAIAPKDYSTKYRY  142



>gb|EMT25324.1| Thioredoxin-like protein 4A [Aegilops tauschii]
Length=163

 Score =   280 bits (715),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 136/163 (83%), Positives = 141/163 (87%), Gaps = 21/163 (13%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQ--------------------  145
            MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQ                    
Sbjct  1    MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQGSWIREISPIGFTDKRQYQF  60

Query  146  -MDEVLASVAETLKNFAVLYLVDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNN  322
             MDEVL+ VAET+KNFAV+YLVDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNN
Sbjct  61   LMDEVLSGVAETIKNFAVIYLVDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNN  120

Query  323  NKINWALKDKQEFIDIVETVYRGARKGRGLVIAPKDYSTKYRY  451
            NKINWA+KDKQEF+DIVETVYRGARKGRGLVIAPKDYSTKYRY
Sbjct  121  NKINWAMKDKQEFVDIVETVYRGARKGRGLVIAPKDYSTKYRY  163



>ref|XP_010232871.1| PREDICTED: thioredoxin-like protein YLS8 [Brachypodium distachyon]
Length=142

 Score =   276 bits (705),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 127/142 (89%), Positives = 135/142 (95%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSYLLPHLHSGWAVDQAI+AE ERLV+IRFGHDWDETCMQMDEVLA VA+ + NFAV YL
Sbjct  1    MSYLLPHLHSGWAVDQAIMAENERLVMIRFGHDWDETCMQMDEVLAGVADKINNFAVTYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDITEVPDFNT+YELYDPSTVMFFFRNKHIMIDLGTGNNNKINWA+KDK EF+DIVETVY
Sbjct  61   VDITEVPDFNTLYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWAMKDKHEFLDIVETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGL IAPKD+STKYRY
Sbjct  121  RGARKGRGLAIAPKDHSTKYRY  142



>ref|XP_010240648.1| PREDICTED: thioredoxin-like protein YLS8 [Brachypodium distachyon]
Length=142

 Score =   275 bits (703),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 128/142 (90%), Positives = 134/142 (94%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSYLLPHLHSGWAVDQAI+AE ERLV+IRFGHDWDET MQMDEVLA VAE +KNFAV YL
Sbjct  1    MSYLLPHLHSGWAVDQAIMAENERLVMIRFGHDWDETSMQMDEVLAGVAEKIKNFAVTYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDITEVPDFNT+YELYDPSTVMFFFRNKHIMIDLGTGNNNKINWA+KDK EF+DIVETVY
Sbjct  61   VDITEVPDFNTLYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWAMKDKHEFVDIVETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGL IA KDYSTKYRY
Sbjct  121  RGARKGRGLAIASKDYSTKYRY  142



>ref|XP_002948591.1| hypothetical protein VOLCADRAFT_80220 [Volvox carteri f. nagariensis]
 gb|EFJ50466.1| hypothetical protein VOLCADRAFT_80220 [Volvox carteri f. nagariensis]
Length=142

 Score =   272 bits (696),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 124/142 (87%), Positives = 136/142 (96%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSYLLPHLHSG+AVDQAILAEE+R+VIIRFGHDW+  CMQMDEVLASV++ +KNFAV+YL
Sbjct  1    MSYLLPHLHSGYAVDQAILAEEDRVVIIRFGHDWEPNCMQMDEVLASVSDQIKNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDITEVPDFNTMYELYDP T+MFFFRNKHIMIDLGTGNNNKINWA+ DKQEFIDIVE VY
Sbjct  61   VDITEVPDFNTMYELYDPCTIMFFFRNKHIMIDLGTGNNNKINWAMTDKQEFIDIVEVVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLV++PKDYSTKYRY
Sbjct  121  RGARKGRGLVVSPKDYSTKYRY  142



>ref|XP_005612997.1| PREDICTED: thioredoxin-like 4A isoform X1 [Equus caballus]
Length=196

 Score =   272 bits (695),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 123/150 (82%), Positives = 138/150 (92%), Gaps = 0/150 (0%)
 Frame = +2

Query  2    ISGEREERMSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETL  181
            I G    RMSY+LPHLH+GW VDQAIL+EE+R+V+IRFGHDWD TCM+MDEVL S+AE +
Sbjct  47   IRGAVALRMSYMLPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYSIAEKV  106

Query  182  KNFAVLYLVDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEF  361
            KNFAV+YLVDITEVPDFN MYELYDP TVMFFFRNKHIMIDLGTGNNNKINWA++DKQE 
Sbjct  107  KNFAVIYLVDITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWAMEDKQEM  166

Query  362  IDIVETVYRGARKGRGLVIAPKDYSTKYRY  451
            IDI+ETVYRGARKGRGLV++PKDYSTKYRY
Sbjct  167  IDIIETVYRGARKGRGLVVSPKDYSTKYRY  196



>gb|EMT17006.1| Thioredoxin-like protein 4A [Aegilops tauschii]
Length=241

 Score =   273 bits (699),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 134/178 (75%), Positives = 140/178 (79%), Gaps = 36/178 (20%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCM---------------------  142
            MSYLLPHLHSGWAVDQAILAE ERLV+IRFGHDWDETCM                     
Sbjct  64   MSYLLPHLHSGWAVDQAILAEGERLVMIRFGHDWDETCMQISELGLEESQRSTAAWMVHI  123

Query  143  ---------------QMDEVLASVAETLKNFAVLYLVDITEVPDFNTMYELYDPSTVMFF  277
                           QMDEVL+ VAET+KNFAV+YLVDITEVPDFNTMYELYDPSTVMFF
Sbjct  124  VFSQVLLVLRNFAAPQMDEVLSGVAETIKNFAVIYLVDITEVPDFNTMYELYDPSTVMFF  183

Query  278  FRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVYRGARKGRGLVIAPKDYSTKYRY  451
            FRNKHIMIDLGTGNNNKINWA+KDKQEF+DIVETVYRGARKGRGLVIAPKDYSTKYRY
Sbjct  184  FRNKHIMIDLGTGNNNKINWAMKDKQEFVDIVETVYRGARKGRGLVIAPKDYSTKYRY  241



>ref|XP_005421012.1| PREDICTED: thioredoxin-like protein 4A [Geospiza fortis]
Length=157

 Score =   270 bits (691),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 121/143 (85%), Positives = 136/143 (95%), Gaps = 0/143 (0%)
 Frame = +2

Query  23   RMSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLY  202
            RMSY+LPHLH+GW VDQAIL+EE+R+V+IRFGHDWD TCM+MDEVL S+AE +KNFAV+Y
Sbjct  15   RMSYMLPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIY  74

Query  203  LVDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETV  382
            LVDITEVPDFN MYELYDP TVMFFFRNKHIMIDLGTGNNNKINWA++DKQE IDI+ETV
Sbjct  75   LVDITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWAMEDKQEMIDIIETV  134

Query  383  YRGARKGRGLVIAPKDYSTKYRY  451
            YRGARKGRGLV++PKDYSTKYRY
Sbjct  135  YRGARKGRGLVVSPKDYSTKYRY  157



>ref|XP_005644134.1| 4A/4B type thioredoxin-like protein [Coccomyxa subellipsoidea 
C-169]
 gb|EIE19590.1| 4A/4B type thioredoxin-like protein [Coccomyxa subellipsoidea 
C-169]
Length=142

 Score =   269 bits (688),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 120/142 (85%), Positives = 133/142 (94%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSYLLPHLH+G+AVDQAIL+EE R+VIIRFGHDWD+ CMQMDE+LAS A+ LKNFAV+YL
Sbjct  1    MSYLLPHLHTGFAVDQAILSEESRVVIIRFGHDWDQVCMQMDEILASCADQLKNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDI+E PDFNTMYELYDP T MFFFRNKHIMIDLGTGNNNKINWA+ DKQEFIDIVE +Y
Sbjct  61   VDISECPDFNTMYELYDPCTCMFFFRNKHIMIDLGTGNNNKINWAMTDKQEFIDIVEVIY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLV++PKDYSTKYRY
Sbjct  121  RGARKGRGLVVSPKDYSTKYRY  142



>ref|NP_001240770.1| thioredoxin-like protein 4A [Equus caballus]
 ref|XP_418903.1| PREDICTED: thioredoxin-like 4A isoform 2 [Gallus gallus]
 ref|XP_533363.2| PREDICTED: thioredoxin-like 4A isoformX1 [Canis lupus familiaris]
 ref|XP_001366433.1| PREDICTED: thioredoxin-like protein 4A [Monodelphis domestica]
 ref|XP_001507748.1| PREDICTED: thioredoxin-like protein 4A [Ornithorhynchus anatinus]
 ref|XP_001924886.1| PREDICTED: thioredoxin-like 4A [Sus scrofa]
 ref|XP_002920414.1| PREDICTED: thioredoxin-like protein 4A [Ailuropoda melanoleuca]
 ref|XP_003204738.1| PREDICTED: thioredoxin-like protein 4A [Meleagris gallopavo]
 ref|XP_003406286.1| PREDICTED: thioredoxin-like protein 4A [Loxodonta africana]
 ref|XP_003995329.1| PREDICTED: thioredoxin-like protein 4A [Felis catus]
 ref|XP_004020444.1| PREDICTED: thioredoxin-like protein 4A [Ovis aries]
 ref|XP_004280072.1| PREDICTED: thioredoxin-like protein 4A [Orcinus orca]
 ref|XP_004314608.1| PREDICTED: thioredoxin-like protein 4A [Tursiops truncatus]
 ref|XP_004386966.1| PREDICTED: thioredoxin-like protein 4A [Trichechus manatus latirostris]
 ref|XP_004416642.1| PREDICTED: thioredoxin-like protein 4A [Odobenus rosmarus divergens]
 ref|XP_004422712.1| PREDICTED: thioredoxin-like protein 4A [Ceratotherium simum simum]
 ref|XP_004456598.1| PREDICTED: thioredoxin-like protein 4A-like isoform 1 [Dasypus 
novemcinctus]
 ref|XP_004604288.1| PREDICTED: thioredoxin-like protein 4A [Sorex araneus]
 ref|XP_004745733.1| PREDICTED: thioredoxin-like protein 4A [Mustela putorius furo]
 ref|XP_004798087.1| PREDICTED: thioredoxin-like protein 4A [Mustela putorius furo]
 ref|XP_005041498.1| PREDICTED: thioredoxin-like protein 4A [Ficedula albicollis]
 ref|XP_005149911.1| PREDICTED: thioredoxin-like protein 4A [Melopsittacus undulatus]
 ref|XP_005281489.1| PREDICTED: thioredoxin-like protein 4A [Chrysemys picta bellii]
 ref|XP_005441861.1| PREDICTED: thioredoxin-like protein 4A [Falco cherrug]
 ref|XP_005481845.1| PREDICTED: thioredoxin-like protein 4A [Zonotrichia albicollis]
 ref|XP_005525292.1| PREDICTED: thioredoxin-like protein 4A [Pseudopodoces humilis]
 ref|XP_005615333.1| PREDICTED: thioredoxin-like 4A isoform X2 [Canis lupus familiaris]
 ref|XP_005696998.1| PREDICTED: thioredoxin-like 4A [Capra hircus]
 ref|XP_005861655.1| PREDICTED: thioredoxin-like protein 4A [Myotis brandtii]
 ref|XP_005906903.1| PREDICTED: thioredoxin-like protein 4A [Bos mutus]
 ref|XP_006031161.1| PREDICTED: thioredoxin-like protein 4A [Alligator sinensis]
 ref|XP_006097463.1| PREDICTED: thioredoxin-like protein 4A [Myotis lucifugus]
 ref|XP_006134078.1| PREDICTED: thioredoxin-like protein 4A [Pelodiscus sinensis]
 ref|XP_006185744.1| PREDICTED: thioredoxin-like protein 4A [Camelus ferus]
 ref|XP_006213261.1| PREDICTED: thioredoxin-like protein 4A [Vicugna pacos]
 ref|XP_006258308.1| PREDICTED: thioredoxin-like protein 4A [Alligator mississippiensis]
 ref|XP_006761956.1| PREDICTED: thioredoxin-like protein 4A [Myotis davidii]
 ref|XP_006897285.1| PREDICTED: thioredoxin-like protein 4A [Elephantulus edwardii]
 ref|XP_006875955.1| PREDICTED: thioredoxin-like protein 4A [Chrysochloris asiatica]
 ref|XP_006913807.1| PREDICTED: thioredoxin-like protein 4A isoform X1 [Pteropus alecto]
 ref|XP_006913808.1| PREDICTED: thioredoxin-like protein 4A isoform X2 [Pteropus alecto]
 ref|XP_007060457.1| PREDICTED: thioredoxin-like protein 4A [Chelonia mydas]
 ref|XP_007112304.1| PREDICTED: thioredoxin-like protein 4A isoform X1 [Physeter catodon]
 ref|XP_007112305.1| PREDICTED: thioredoxin-like protein 4A isoform X2 [Physeter catodon]
 ref|XP_006079640.1| PREDICTED: thioredoxin-like protein 4A [Bubalus bubalis]
 ref|XP_007172827.1| PREDICTED: thioredoxin-like protein 4A [Balaenoptera acutorostrata 
scammoni]
 ref|XP_007426501.1| PREDICTED: thioredoxin-like protein 4A isoform X1 [Python bivittatus]
 ref|XP_007426502.1| PREDICTED: thioredoxin-like protein 4A isoform X2 [Python bivittatus]
 ref|XP_007426503.1| PREDICTED: thioredoxin-like protein 4A isoform X3 [Python bivittatus]
 ref|XP_007426504.1| PREDICTED: thioredoxin-like protein 4A isoform X4 [Python bivittatus]
 ref|XP_007450019.1| PREDICTED: thioredoxin-like protein 4A [Lipotes vexillifer]
 ref|XP_007537148.1| PREDICTED: thioredoxin-like protein 4A [Erinaceus europaeus]
 ref|XP_008162669.1| PREDICTED: thioredoxin-like protein 4A [Chrysemys picta bellii]
 ref|XP_008684129.1| PREDICTED: thioredoxin-like protein 4A isoform X1 [Ursus maritimus]
 ref|XP_008918938.1| PREDICTED: thioredoxin-like protein 4A [Manacus vitellinus]
 ref|XP_009078910.1| PREDICTED: thioredoxin-like protein 4A [Acanthisitta chloris]
 ref|XP_009092128.1| PREDICTED: thioredoxin-like protein 4A [Serinus canaria]
 ref|XP_009275467.1| PREDICTED: thioredoxin-like protein 4A [Aptenodytes forsteri]
 ref|XP_009473661.1| PREDICTED: thioredoxin-like protein 4A [Nipponia nippon]
 ref|XP_009555224.1| PREDICTED: thioredoxin-like protein 4A [Cuculus canorus]
 ref|XP_009693583.1| PREDICTED: thioredoxin-like protein 4A [Cariama cristata]
 ref|XP_009893250.1| PREDICTED: thioredoxin-like protein 4A [Charadrius vociferus]
 ref|XP_010018122.1| PREDICTED: thioredoxin-like protein 4A [Nestor notabilis]
 ref|XP_010575276.1| PREDICTED: thioredoxin-like protein 4A [Haliaeetus leucocephalus]
 ref|XP_010584979.1| PREDICTED: thioredoxin-like protein 4A [Loxodonta africana]
 ref|XP_010853373.1| PREDICTED: thioredoxin-like protein 4A [Bison bison bison]
 ref|XP_010853374.1| PREDICTED: thioredoxin-like protein 4A [Bison bison bison]
 ref|XP_010959851.1| PREDICTED: thioredoxin-like protein 4A [Camelus bactrianus]
 ref|XP_010995816.1| PREDICTED: thioredoxin-like protein 4A [Camelus dromedarius]
 ref|XP_011224704.1| PREDICTED: thioredoxin-like protein 4A [Ailuropoda melanoleuca]
 ref|XP_011384280.1| PREDICTED: thioredoxin-like protein 4A isoform X2 [Pteropus vampyrus]
 gb|EFB24821.1| hypothetical protein PANDA_009153 [Ailuropoda melanoleuca]
 tpg|DAA16027.1| TPA: thioredoxin-like 4A [Bos taurus]
 gb|AEB61208.1| thioredoxin-like protein 4A-like protein [Equus caballus]
 gb|ELK11152.1| Thioredoxin-like protein 4A [Pteropus alecto]
 gb|ELK31656.1| Thioredoxin-like protein 4A [Myotis davidii]
 gb|ELR48269.1| Thioredoxin-like protein 4A [Bos mutus]
 gb|EPQ04871.1| Thioredoxin-like protein 4A [Myotis brandtii]
 gb|EPY80435.1| thioredoxin-like protein 4A [Camelus ferus]
 gb|KFM06098.1| Thioredoxin-like 4A [Aptenodytes forsteri]
 gb|KFO73240.1| Thioredoxin-like 4A [Cuculus canorus]
 gb|KFP55268.1| Thioredoxin-like 4A [Cariama cristata]
 gb|KFP86450.1| Thioredoxin-like 4A [Acanthisitta chloris]
 gb|KFQ43340.1| Thioredoxin-like 4A [Nestor notabilis]
 gb|KFR09147.1| Thioredoxin-like 4A [Nipponia nippon]
 gb|KFW78269.1| Thioredoxin-like 4A [Manacus vitellinus]
 gb|KGL87897.1| Thioredoxin-like 4A [Charadrius vociferus]
Length=142

 Score =   268 bits (684),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 120/142 (85%), Positives = 135/142 (95%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSY+LPHLH+GW VDQAIL+EE+R+V+IRFGHDWD TCM+MDEVL S+AE +KNFAV+YL
Sbjct  1    MSYMLPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDITEVPDFN MYELYDP TVMFFFRNKHIMIDLGTGNNNKINWA++DKQE IDI+ETVY
Sbjct  61   VDITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWAMEDKQEMIDIIETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLV++PKDYSTKYRY
Sbjct  121  RGARKGRGLVVSPKDYSTKYRY  142



>ref|XP_005843152.1| thioredoxin domain 2 [Chlorella variabilis]
 gb|EFN51050.1| thioredoxin domain 2 [Chlorella variabilis]
Length=142

 Score =   268 bits (684),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 120/142 (85%), Positives = 135/142 (95%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSYLLPHLHSG+AVDQAIL+EE+R+VIIRFGHD+D+TCMQMDE+LA   E +KNFAV+YL
Sbjct  1    MSYLLPHLHSGFAVDQAILSEEDRVVIIRFGHDYDDTCMQMDEILAGTVERMKNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDI+EVPDFN MYELYDP TVMFFFRNKHIMIDLGTGNNNKINWA+ DKQEF+DIVETV+
Sbjct  61   VDISEVPDFNAMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWAMNDKQEFVDIVETVF  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLV++PKDYSTKYRY
Sbjct  121  RGARKGRGLVVSPKDYSTKYRY  142



>ref|NP_006692.1| thioredoxin-like protein 4A isoform 1 [Homo sapiens]
 ref|NP_079575.1| thioredoxin-like protein 4A isoform a [Mus musculus]
 ref|NP_001247795.1| thioredoxin-like protein 4A [Macaca mulatta]
 ref|XP_003280237.1| PREDICTED: thioredoxin-like protein 4A [Nomascus leucogenys]
 ref|XP_003463363.1| PREDICTED: thioredoxin-like protein 4A [Cavia porcellus]
 ref|XP_003501886.1| PREDICTED: N-alpha-acetyltransferase 11, NatA catalytic subunit-like 
isoform 3 [Cricetulus griseus]
 ref|XP_003788435.1| PREDICTED: thioredoxin-like protein 4A [Otolemur garnettii]
 ref|XP_003805244.1| PREDICTED: thioredoxin-like protein 4A [Pan paniscus]
 ref|XP_004059627.1| PREDICTED: thioredoxin-like protein 4A [Gorilla gorilla gorilla]
 ref|XP_004579468.1| PREDICTED: thioredoxin-like protein 4A [Ochotona princeps]
 ref|XP_004662685.1| PREDICTED: thioredoxin-like protein 4A isoform X1 [Jaculus jaculus]
 ref|XP_004640264.1| PREDICTED: thioredoxin-like protein 4A [Octodon degus]
 ref|XP_004861962.1| PREDICTED: thioredoxin-like protein 4A-like isoform X1 [Heterocephalus 
glaber]
 ref|XP_004861963.1| PREDICTED: thioredoxin-like protein 4A-like isoform X2 [Heterocephalus 
glaber]
 ref|XP_005065471.1| PREDICTED: thioredoxin-like protein 4A isoform X1 [Mesocricetus 
auratus]
 ref|XP_005356357.1| PREDICTED: thioredoxin-like protein 4A isoform X1 [Microtus ochrogaster]
 ref|XP_005356358.1| PREDICTED: thioredoxin-like protein 4A isoform X2 [Microtus ochrogaster]
 ref|XP_005334421.1| PREDICTED: thioredoxin-like protein 4A [Ictidomys tridecemlineatus]
 ref|XP_005373178.1| PREDICTED: thioredoxin-like protein 4A-like isoform X1 [Chinchilla 
lanigera]
 ref|XP_005373179.1| PREDICTED: thioredoxin-like protein 4A-like isoform X2 [Chinchilla 
lanigera]
 ref|XP_005586417.1| PREDICTED: thioredoxin-like protein 4A [Macaca fascicularis]
 ref|XP_006165832.1| PREDICTED: thioredoxin-like protein 4A [Tupaia chinensis]
 ref|XP_006255022.1| PREDICTED: thioredoxin-like protein 4A [Rattus norvegicus]
 ref|XP_006526550.1| PREDICTED: thioredoxin-like protein 4A isoform X1 [Mus musculus]
 ref|XP_006973929.1| PREDICTED: thioredoxin-like protein 4A isoform X1 [Peromyscus 
maniculatus bairdii]
 ref|XP_006973930.1| PREDICTED: thioredoxin-like protein 4A isoform X2 [Peromyscus 
maniculatus bairdii]
 ref|XP_008011891.1| PREDICTED: thioredoxin-like protein 4A isoform X2 [Chlorocebus 
sabaeus]
 ref|XP_008062432.1| PREDICTED: thioredoxin-like protein 4A [Tarsius syrichta]
 ref|XP_008581854.1| PREDICTED: thioredoxin-like protein 4A [Galeopterus variegatus]
 ref|XP_008847473.1| PREDICTED: thioredoxin-like protein 4A [Nannospalax galili]
 ref|XP_009191227.1| PREDICTED: thioredoxin-like protein 4A [Papio anubis]
 ref|XP_010360317.1| PREDICTED: thioredoxin-like protein 4A [Rhinopithecus roxellana]
 ref|XP_010642482.1| PREDICTED: thioredoxin-like protein 4A [Fukomys damarensis]
 ref|XP_010642487.1| PREDICTED: thioredoxin-like protein 4A [Fukomys damarensis]
 ref|XP_010642494.1| PREDICTED: thioredoxin-like protein 4A [Fukomys damarensis]
 sp|P83876.1|TXN4A_HUMAN RecName: Full=Thioredoxin-like protein 4A; AltName: Full=DIM1 
protein homolog; AltName: Full=Spliceosomal U5 snRNP-specific 
15 kDa protein; AltName: Full=Thioredoxin-like U5 snRNP protein 
U5-15kD [Homo sapiens]
 sp|P83877.1|TXN4A_MOUSE RecName: Full=Thioredoxin-like protein 4A; AltName: Full=DIM1 
protein homolog; AltName: Full=Spliceosomal U5 snRNP-specific 
15 kDa protein; AltName: Full=Thioredoxin-like U5 snRNP protein 
U5-15kD [Mus musculus]
 pdb|1QGV|A Chain A, Human Spliceosomal Protein U5-15kd
 pdb|1SYX|A Chain A, The Crystal Structure Of A Binary U5 Snrnp Complex
 pdb|1SYX|C Chain C, The Crystal Structure Of A Binary U5 Snrnp Complex
 pdb|1SYX|E Chain E, The Crystal Structure Of A Binary U5 Snrnp Complex
 gb|AAF17332.1|AF146373_1 thioredoxin-like U5 snRNP protein U5-15kD [Homo sapiens]
 gb|AAB81950.1| Dim1p homolog [Homo sapiens]
 gb|AAH01046.1| Thioredoxin-like 4A [Homo sapiens]
 dbj|BAB23137.1| unnamed protein product [Mus musculus]
 dbj|BAB24966.1| unnamed protein product [Mus musculus]
 gb|AAH19272.1| Thioredoxin-like 4A [Homo sapiens]
 gb|AAH31634.1| Txnl4a protein [Mus musculus]
 dbj|BAE38809.1| unnamed protein product [Mus musculus]
 dbj|BAE28459.1| unnamed protein product [Mus musculus]
 gb|EAW66640.1| thioredoxin-like 4A, isoform CRA_b [Homo sapiens]
 gb|EDL09416.1| mCG18172, isoform CRA_c [Mus musculus]
 gb|EDL75232.1| similar to DNA segment, Chr 18, Wayne State University 98, expressed 
(predicted), isoform CRA_b [Rattus norvegicus]
 dbj|BAG37415.1| unnamed protein product [Homo sapiens]
 dbj|BAI46823.1| thioredoxin-like protein 4A [synthetic construct]
 gb|ADZ15703.1| thioredoxin-like 4A [synthetic construct]
 gb|AIC50746.1| TXNL4A, partial [synthetic construct]
Length=142

 Score =   267 bits (683),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 119/142 (84%), Positives = 135/142 (95%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSY+LPHLH+GW VDQAIL+EE+R+V+IRFGHDWD TCM+MDEVL S+AE +KNFAV+YL
Sbjct  1    MSYMLPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDITEVPDFN MYELYDP TVMFFFRNKHIMIDLGTGNNNKINWA++DKQE +DI+ETVY
Sbjct  61   VDITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWAMEDKQEMVDIIETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLV++PKDYSTKYRY
Sbjct  121  RGARKGRGLVVSPKDYSTKYRY  142



>ref|NP_001016646.1| thioredoxin-like 4A [Xenopus (Silurana) tropicalis]
 emb|CAJ82675.1| thioredoxin-like 4A [Xenopus (Silurana) tropicalis]
 gb|AAI57182.1| thioredoxin-like 4A [Xenopus (Silurana) tropicalis]
Length=142

 Score =   267 bits (682),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 120/142 (85%), Positives = 135/142 (95%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSY+LPHLH+GW VDQAIL+EE+R+++IRFGHDWD TCM+MDEVL S+AE +KNFAV+YL
Sbjct  1    MSYMLPHLHNGWQVDQAILSEEDRVLVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDITEVPDFN MYELYDP TVMFFFRNKHIMIDLGTGNNNKINWA++DKQE IDIVETVY
Sbjct  61   VDITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWAMEDKQEMIDIVETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLV++PKDYSTKYRY
Sbjct  121  RGARKGRGLVVSPKDYSTKYRY  142



>ref|NP_001069528.1| thioredoxin-like protein 4A [Bos taurus]
 gb|AAI09893.1| Thioredoxin-like 4A [Bos taurus]
Length=142

 Score =   266 bits (681),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 119/142 (84%), Positives = 135/142 (95%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSY+LPHLH+GW VDQAIL+EE+R+V+IRFGHDWD TCM+MDEVL S+AE +KNFAV+Y+
Sbjct  1    MSYMLPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYI  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDITEVPDFN MYELYDP TVMFFFRNKHIMIDLGTGNNNKINWA++DKQE IDI+ETVY
Sbjct  61   VDITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWAMEDKQEMIDIIETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLV++PKDYSTKYRY
Sbjct  121  RGARKGRGLVVSPKDYSTKYRY  142



>ref|XP_006635928.1| PREDICTED: thioredoxin-like protein 4A-like [Lepisosteus oculatus]
Length=142

 Score =   266 bits (681),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 120/142 (85%), Positives = 134/142 (94%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSY+LPHLH+GW VDQAIL+EE+R+V+IRFGHDWD TCM+MDEVL S+AE +KNFAV+YL
Sbjct  1    MSYMLPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDITEVPDFN MYELYDP TVMFFFRNKHIMIDLGTGNNNKINW ++DKQE IDIVETVY
Sbjct  61   VDITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWTMEDKQEMIDIVETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLV++PKDYSTKYRY
Sbjct  121  RGARKGRGLVVSPKDYSTKYRY  142



>ref|XP_002723903.1| PREDICTED: thioredoxin-like protein 4A [Oryctolagus cuniculus]
Length=142

 Score =   266 bits (680),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 119/142 (84%), Positives = 134/142 (94%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSY+LPHLH+GW VDQAIL+EE+R+V+IRFGHDWD TCM+MDEVL S+AE +KNFAV+YL
Sbjct  1    MSYMLPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDITEVPDFN MYELYDP TVMFFFRNKHIMIDLGTGNNNKINWA++DKQE +DI ETVY
Sbjct  61   VDITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWAMEDKQEMVDITETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLV++PKDYSTKYRY
Sbjct  121  RGARKGRGLVVSPKDYSTKYRY  142



>ref|NP_001279255.1| thioredoxin-like 4A [Callorhinchus milii]
 gb|AFK10945.1| Dim1p-like protein isoform 2 [Callorhinchus milii]
Length=142

 Score =   266 bits (680),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 120/142 (85%), Positives = 134/142 (94%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSY+LPHLH+GW VDQAIL+EE+R+V+IRFGHDWD TCM+MDEVL S+AE +KNFAV+YL
Sbjct  1    MSYMLPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDITEVPDFN MYELYDP TVMFFFRNKHIMIDLGTGNNNKINW ++DKQE IDIVETVY
Sbjct  61   VDITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWPMEDKQEMIDIVETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLV++PKDYSTKYRY
Sbjct  121  RGARKGRGLVVSPKDYSTKYRY  142



>ref|XP_005968242.1| PREDICTED: thioredoxin-like protein 4A isoform X1 [Pantholops 
hodgsonii]
 ref|XP_005968243.1| PREDICTED: thioredoxin-like protein 4A isoform X2 [Pantholops 
hodgsonii]
Length=142

 Score =   266 bits (680),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 119/142 (84%), Positives = 135/142 (95%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSY+LPHLH+GW VDQAIL+EE+R+V+IRFGHDWD TCM+MDEVL S+AE +KNFAV+YL
Sbjct  1    MSYMLPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDITEVPDFN MYELYDP TVMFFFRNKHIMIDLGTGNNNKINWA++DKQE IDI+ETVY
Sbjct  61   VDITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWAMEDKQEMIDIIETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            +GARKGRGLV++PKDYSTKYRY
Sbjct  121  QGARKGRGLVVSPKDYSTKYRY  142



>ref|XP_003969009.1| PREDICTED: thioredoxin-like protein 4A-like [Takifugu rubripes]
Length=142

 Score =   266 bits (680),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 119/142 (84%), Positives = 134/142 (94%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSY+LPHLH+GW VDQAIL+EE+R+++IRFGHDWD TCM+MDEVL S+AE +KNFAV+YL
Sbjct  1    MSYMLPHLHNGWQVDQAILSEEDRVIVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDITEVPDFN MYELYDP TVMFFFRNKHIMIDLGTGNNNKINW ++DKQE IDIVETVY
Sbjct  61   VDITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWTMEDKQEMIDIVETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLV++PKDYSTKYRY
Sbjct  121  RGARKGRGLVVSPKDYSTKYRY  142



>ref|XP_002757397.2| PREDICTED: thioredoxin-like protein 4A [Callithrix jacchus]
Length=211

 Score =   268 bits (686),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 119/142 (84%), Positives = 135/142 (95%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSY+LPHLH+GW VDQAIL+EE+R+V+IRFGHDWD TCM+MDEVL S+AE +KNFAV+YL
Sbjct  70   MSYMLPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYL  129

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDITEVPDFN MYELYDP TVMFFFRNKHIMIDLGTGNNNKINWA++DKQE +DI+ETVY
Sbjct  130  VDITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWAMEDKQEMVDIIETVY  189

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLV++PKDYSTKYRY
Sbjct  190  RGARKGRGLVVSPKDYSTKYRY  211



>gb|KFO37224.1| Thioredoxin-like protein 4A [Fukomys damarensis]
Length=334

 Score =   272 bits (696),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 120/143 (84%), Positives = 136/143 (95%), Gaps = 0/143 (0%)
 Frame = +2

Query  23   RMSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLY  202
            RMSY+LPHLH+GW VDQAIL+EE+R+V+IRFGHDWD TCM+MDEVL S+AE +KNFAV+Y
Sbjct  192  RMSYMLPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIY  251

Query  203  LVDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETV  382
            LVDITEVPDFN MYELYDP TVMFFFRNKHIMIDLGTGNNNKINWA++DKQE +DI+ETV
Sbjct  252  LVDITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWAMEDKQEMVDIIETV  311

Query  383  YRGARKGRGLVIAPKDYSTKYRY  451
            YRGARKGRGLV++PKDYSTKYRY
Sbjct  312  YRGARKGRGLVVSPKDYSTKYRY  334



>ref|NP_001089208.1| thioredoxin-like 4A [Xenopus laevis]
 ref|XP_008330304.1| PREDICTED: thioredoxin-like protein 4A [Cynoglossus semilaevis]
 ref|XP_010748670.1| PREDICTED: thioredoxin-like protein 4A [Larimichthys crocea]
 ref|XP_010791832.1| PREDICTED: thioredoxin-like protein 4A [Notothenia coriiceps]
 gb|AAH89128.1| MGC85128 protein [Xenopus laevis]
 gb|ACO08904.1| Thioredoxin-like protein 4A [Osmerus mordax]
 gb|AFO64926.1| thioredoxin-like protein 4A [Oplegnathus fasciatus]
Length=142

 Score =   265 bits (678),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 119/142 (84%), Positives = 134/142 (94%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSY+LPHLH+GW VDQAIL+EE+R+++IRFGHDWD TCM+MDEVL S+AE +KNFAV+YL
Sbjct  1    MSYMLPHLHNGWQVDQAILSEEDRVLVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDITEVPDFN MYELYDP TVMFFFRNKHIMIDLGTGNNNKINW ++DKQE IDIVETVY
Sbjct  61   VDITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWTMEDKQEMIDIVETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLV++PKDYSTKYRY
Sbjct  121  RGARKGRGLVVSPKDYSTKYRY  142



>ref|NP_001005953.1| thioredoxin-like protein 4A [Danio rerio]
 gb|AAH83448.1| Zgc:103632 [Danio rerio]
 gb|AAI64224.1| Zgc:103632 protein [Danio rerio]
Length=142

 Score =   265 bits (677),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 119/142 (84%), Positives = 133/142 (94%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSY+LPHLH+GW VDQAIL+EE+R ++IRFGHDWD TCM+MDEVL S+AE +KNFAV+YL
Sbjct  1    MSYMLPHLHNGWQVDQAILSEEDRAIVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDITEVPDFN MYELYDP TVMFFFRNKHIMIDLGTGNNNKINW ++DKQE IDIVETVY
Sbjct  61   VDITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWTMEDKQEMIDIVETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLV++PKDYSTKYRY
Sbjct  121  RGARKGRGLVVSPKDYSTKYRY  142



>ref|XP_002424719.1| mitosis protein dim1, putative [Pediculus humanus corporis]
 gb|EEB11981.1| mitosis protein dim1, putative [Pediculus humanus corporis]
Length=142

 Score =   265 bits (677),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 121/142 (85%), Positives = 134/142 (94%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSY+L HLH+GW VDQAIL+EE+R+V+IRFGHDWD TCM+MDEVL S+AE +KNFAV+YL
Sbjct  1    MSYMLGHLHNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDITEVPDFN MYELYDP TVMFFFRNKHIMIDLGTGNNNKINWAL+DKQE IDIVETVY
Sbjct  61   VDITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWALEDKQEMIDIVETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLV++PKDYSTKYRY
Sbjct  121  RGARKGRGLVVSPKDYSTKYRY  142



>ref|XP_005183488.1| PREDICTED: thioredoxin-like protein 4A [Musca domestica]
Length=142

 Score =   265 bits (677),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 120/142 (85%), Positives = 133/142 (94%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSY+LPHLH+GW VDQAIL+EE+R+V+IRFGHDWD  CM+MDEVL S+AE +KNFAV+YL
Sbjct  1    MSYMLPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPACMKMDEVLYSIAEKVKNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDITEVPDFN MYELYDP TVMFFFRNKHIMIDLGTGNNNKINW L+DKQE IDIVETVY
Sbjct  61   VDITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWPLEDKQEMIDIVETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLV++PKDYSTKYRY
Sbjct  121  RGARKGRGLVVSPKDYSTKYRY  142



>ref|XP_004073925.1| PREDICTED: thioredoxin-like protein 4A [Oryzias latipes]
 ref|XP_011479199.1| PREDICTED: thioredoxin-like protein 4A [Oryzias latipes]
Length=142

 Score =   265 bits (677),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 119/142 (84%), Positives = 134/142 (94%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSY+LPHLH+GW VDQAIL+EE+R+++IRFGHDWD TCM+MDEVL S+AE +KNFAV+YL
Sbjct  1    MSYMLPHLHNGWQVDQAILSEEDRVLVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDITEVPDFN MYELYDP TVMFFFRNKHIMIDLGTGNNNKINW ++DKQE IDIVETVY
Sbjct  61   VDITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWPMEDKQEMIDIVETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLV++PKDYSTKYRY
Sbjct  121  RGARKGRGLVVSPKDYSTKYRY  142



>ref|XP_003219784.1| PREDICTED: thioredoxin-like protein 4A [Anolis carolinensis]
 ref|XP_003230259.1| PREDICTED: thioredoxin-like protein 4A [Anolis carolinensis]
 ref|XP_004715984.1| PREDICTED: thioredoxin-like protein 4A [Echinops telfairi]
 ref|XP_008106977.1| PREDICTED: thioredoxin-like protein 4A [Anolis carolinensis]
 ref|XP_008122819.1| PREDICTED: thioredoxin-like protein 4A [Anolis carolinensis]
Length=142

 Score =   265 bits (676),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 119/142 (84%), Positives = 134/142 (94%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSY+LPHLH+GW VDQAIL+EE+R+V+ RFGHDWD TCM+MDEVL S+AE +KNFAV+YL
Sbjct  1    MSYMLPHLHNGWQVDQAILSEEDRVVVNRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDITEVPDFN MYELYDP TVMFFFRNKHIMIDLGTGNNNKINWA++DKQE IDI+ETVY
Sbjct  61   VDITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWAMEDKQEMIDIIETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLV++PKDYSTKYRY
Sbjct  121  RGARKGRGLVVSPKDYSTKYRY  142



>ref|XP_003458541.1| PREDICTED: thioredoxin-like protein 4A-like [Oreochromis niloticus]
 ref|XP_004574404.1| PREDICTED: thioredoxin-like protein 4A-like [Maylandia zebra]
 ref|XP_005728955.1| PREDICTED: thioredoxin-like protein 4A-like [Pundamilia nyererei]
 ref|XP_005940930.1| PREDICTED: thioredoxin-like protein 4A-like [Haplochromis burtoni]
 ref|XP_006795272.1| PREDICTED: thioredoxin-like protein 4A-like [Neolamprologus brichardi]
Length=142

 Score =   265 bits (676),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 118/142 (83%), Positives = 134/142 (94%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSY+LPHLH+GW VDQAIL+EE+R+++IRFGHDWD TCM+MDEVL S+AE +KNFAV+YL
Sbjct  1    MSYMLPHLHNGWQVDQAILSEEDRVLVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDITEVPDFN MYELYDP TVMFFFRNKHIMIDLGTGNNNKINW ++DKQE IDI+ETVY
Sbjct  61   VDITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWTMEDKQEMIDIIETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLV++PKDYSTKYRY
Sbjct  121  RGARKGRGLVVSPKDYSTKYRY  142



>ref|XP_007084792.1| PREDICTED: thioredoxin-like protein 4A [Panthera tigris altaica]
 ref|XP_009322755.1| PREDICTED: thioredoxin-like protein 4A [Pygoscelis adeliae]
 ref|XP_010170117.1| PREDICTED: thioredoxin-like protein 4A [Caprimulgus carolinensis]
 ref|XP_010178486.1| PREDICTED: thioredoxin-like protein 4A [Mesitornis unicolor]
 gb|KFQ21217.1| Thioredoxin-like 4A [Mesitornis unicolor]
 gb|KFW67415.1| Thioredoxin-like 4A [Pygoscelis adeliae]
 gb|KFZ62056.1| Thioredoxin-like 4A [Caprimulgus carolinensis]
Length=142

 Score =   265 bits (676),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 119/142 (84%), Positives = 134/142 (94%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSY+LPHLH+GW  DQAIL+EE+R+V+IRFGHDWD TCM+MDEVL S+AE +KNFAV+YL
Sbjct  1    MSYMLPHLHNGWQGDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDITEVPDFN MYELYDP TVMFFFRNKHIMIDLGTGNNNKINWA++DKQE IDI+ETVY
Sbjct  61   VDITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWAMEDKQEMIDIIETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLV++PKDYSTKYRY
Sbjct  121  RGARKGRGLVVSPKDYSTKYRY  142



>ref|XP_003744183.1| PREDICTED: thioredoxin-like protein 4A-like [Metaseiulus occidentalis]
Length=142

 Score =   265 bits (676),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 120/142 (85%), Positives = 134/142 (94%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSY+L HLH+GW VDQAIL+EE+R+V+IRFGHDWD TCM+MDEVL S+AE +KNFAV+YL
Sbjct  1    MSYMLQHLHNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVMYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDITEVPDFN MYELYDP TVMFFFRNKHIMIDLGTGNNNKINWAL+DKQE IDIVETV+
Sbjct  61   VDITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWALEDKQEMIDIVETVF  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLV++PKDYSTKYRY
Sbjct  121  RGARKGRGLVVSPKDYSTKYRY  142



>ref|XP_007559818.1| PREDICTED: thioredoxin-like protein 4A [Poecilia formosa]
Length=142

 Score =   265 bits (676),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 119/142 (84%), Positives = 134/142 (94%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSY+LPHLH+GW VDQAIL+EE+R+++IRFGHDWD TCM+MDEVL S+AE +KNFAV+YL
Sbjct  1    MSYMLPHLHNGWQVDQAILSEEDRVLVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDITEVPDFN MYELYDP TVMFFFRNKHIMIDLGTGNNNKINW ++DKQE IDIVETVY
Sbjct  61   VDITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWIIEDKQEMIDIVETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLV++PKDYSTKYRY
Sbjct  121  RGARKGRGLVVSPKDYSTKYRY  142



>ref|NP_001233254.1| Thioredoxin-like protein 4A [Oncorhynchus mykiss]
 gb|ACI67662.1| Thioredoxin-like protein 4A [Salmo salar]
 gb|ACM08785.1| Thioredoxin-like protein 4A [Salmo salar]
 gb|ACM09245.1| Thioredoxin-like protein 4A [Salmo salar]
 gb|ACO07719.1| Thioredoxin-like protein 4A [Oncorhynchus mykiss]
 gb|ACO07784.1| Thioredoxin-like protein 4A [Oncorhynchus mykiss]
 gb|ACO07971.1| Thioredoxin-like protein 4A [Oncorhynchus mykiss]
 gb|ACO08095.1| Thioredoxin-like protein 4A [Oncorhynchus mykiss]
 gb|ACO08741.1| Thioredoxin-like protein 4A [Oncorhynchus mykiss]
 gb|ADM16191.1| Thioredoxin-like protein 4A [Salmo salar]
 emb|CDQ75219.1| unnamed protein product [Oncorhynchus mykiss]
 emb|CDQ74844.1| unnamed protein product [Oncorhynchus mykiss]
Length=142

 Score =   264 bits (675),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 119/142 (84%), Positives = 133/142 (94%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSY+LPHLH+GW VDQAIL+EE+R ++IRFGHDWD TCM+MDEVL S+AE +KNFAV+YL
Sbjct  1    MSYMLPHLHNGWQVDQAILSEEDRALVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDITEVPDFN MYELYDP TVMFFFRNKHIMIDLGTGNNNKINW ++DKQE IDIVETVY
Sbjct  61   VDITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWTMEDKQEMIDIVETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLV++PKDYSTKYRY
Sbjct  121  RGARKGRGLVVSPKDYSTKYRY  142



>ref|NP_608830.3| Dim1 [Drosophila melanogaster]
 ref|XP_001356984.1| GA15896 [Drosophila pseudoobscura pseudoobscura]
 ref|XP_001965232.1| GF21189 [Drosophila ananassae]
 ref|XP_001968668.1| GG25001 [Drosophila erecta]
 ref|XP_001989319.1| GH10125 [Drosophila grimshawi]
 ref|XP_002003528.1| GI22095 [Drosophila mojavensis]
 ref|XP_002020633.1| GL15133 [Drosophila persimilis]
 ref|XP_002037814.1| GM18471 [Drosophila sechellia]
 ref|XP_002052763.1| GJ19964 [Drosophila virilis]
 ref|XP_002066821.1| GK24348 [Drosophila willistoni]
 ref|XP_002087921.1| GE18287 [Drosophila yakuba]
 ref|XP_011187144.1| PREDICTED: thioredoxin-like protein 4A [Bactrocera cucurbitae]
 ref|XP_011214085.1| PREDICTED: thioredoxin-like protein 4A [Bactrocera dorsalis]
 gb|AAL48670.1| RE13747p [Drosophila melanogaster]
 gb|AAF51017.2| Dim1 [Drosophila melanogaster]
 gb|EAL34050.1| GA15896 [Drosophila pseudoobscura pseudoobscura]
 gb|EDV33366.1| GF21189 [Drosophila ananassae]
 gb|EDV57727.1| GG25001 [Drosophila erecta]
 gb|EDW04186.1| GH10125 [Drosophila grimshawi]
 gb|EDW12970.1| GI22095 [Drosophila mojavensis]
 gb|EDW39626.1| GL15133 [Drosophila persimilis]
 gb|EDW54232.1| GM18471 [Drosophila sechellia]
 gb|EDW64918.1| GJ19964 [Drosophila virilis]
 gb|EDW77807.1| GK24348 [Drosophila willistoni]
 gb|EDW87633.1| GE18287 [Drosophila yakuba]
 gb|ACL86487.1| Dim1-PA, partial [synthetic construct]
 gb|ACL91143.1| Dim1-PA [synthetic construct]
Length=142

 Score =   264 bits (675),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 119/142 (84%), Positives = 133/142 (94%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSY+LPHLH+GW VDQAIL+EE+R+V+IRFGHDWD  CM+MDEV+ S+AE +KNFAV+YL
Sbjct  1    MSYMLPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPACMKMDEVMYSIAEKVKNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDITEVPDFN MYELYDP TVMFFFRNKHIMIDLGTGNNNKINW L+DKQE IDIVETVY
Sbjct  61   VDITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWPLEDKQEMIDIVETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLV++PKDYSTKYRY
Sbjct  121  RGARKGRGLVVSPKDYSTKYRY  142



>ref|XP_005812248.1| PREDICTED: thioredoxin-like protein 4A-like [Xiphophorus maculatus]
Length=142

 Score =   264 bits (675),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 118/142 (83%), Positives = 134/142 (94%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSY+LPHLH+GW VDQAIL+EE+R+++IRFGHDWD TCM+MDEVL S+AE +KNFAV+YL
Sbjct  1    MSYMLPHLHNGWQVDQAILSEEDRVLVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDITEVPDFN MYELYDP T+MFFFRNKHIMIDLGTGNNNKINW ++DKQE IDIVETVY
Sbjct  61   VDITEVPDFNKMYELYDPCTIMFFFRNKHIMIDLGTGNNNKINWIIEDKQEMIDIVETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLV++PKDYSTKYRY
Sbjct  121  RGARKGRGLVVSPKDYSTKYRY  142



>ref|XP_008158524.1| PREDICTED: thioredoxin-like protein 4A [Eptesicus fuscus]
Length=142

 Score =   264 bits (674),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 119/142 (84%), Positives = 133/142 (94%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSY+LPHLH+GW VDQAIL+EE+R+V+IRFGHDWD TCM+MDEVL  +AE +KNFAV YL
Sbjct  1    MSYMLPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYCIAEKVKNFAVNYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDITEVPDFN MYELYDP TVMFFFRNKHIMIDLGTGNNNKINWA++DKQE IDI+ETVY
Sbjct  61   VDITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWAMEDKQEMIDIIETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLV++PKDYSTKYRY
Sbjct  121  RGARKGRGLVVSPKDYSTKYRY  142



>gb|ACI69123.1| Thioredoxin-like protein 4A [Salmo salar]
Length=142

 Score =   264 bits (674),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 119/142 (84%), Positives = 133/142 (94%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSY+LPHLH+GW VDQAIL+EE+R+++IRFGHDWD TCM+MDEVL SVAE +KNFAV+YL
Sbjct  1    MSYMLPHLHNGWQVDQAILSEEDRVLVIRFGHDWDPTCMKMDEVLYSVAEKVKNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDIT VPDFN MYELYDP TVMFFFRNKHIMIDLGTGNNNKINW ++DKQE IDIVETVY
Sbjct  61   VDITAVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWTMEDKQEMIDIVETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLV++PKDYSTKYRY
Sbjct  121  RGARKGRGLVVSPKDYSTKYRY  142



>ref|NP_001290582.1| thioredoxin-like 4A [Esox lucius]
 gb|ACO14001.1| Thioredoxin-like protein 4A [Esox lucius]
Length=142

 Score =   264 bits (674),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 118/142 (83%), Positives = 134/142 (94%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSY+LPHLH+GW VDQAIL+EE+R+++IRFGHDWD TCM+MDEVL S+AE +KNFAV+YL
Sbjct  1    MSYMLPHLHNGWQVDQAILSEEDRVLVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDITEVP+FN MYELYDP TVMFFFRNKHIMIDLGTGNNNKINW ++DKQE IDIVETVY
Sbjct  61   VDITEVPNFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWTMEDKQEMIDIVETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLV++PKDYSTKYRY
Sbjct  121  RGARKGRGLVVSPKDYSTKYRY  142



>ref|XP_002736167.1| PREDICTED: thioredoxin-like protein 4A-like [Saccoglossus kowalevskii]
Length=142

 Score =   263 bits (673),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 117/142 (82%), Positives = 134/142 (94%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSY+LPHLH+GW VDQAIL+EE+R+++IRFGHDWD TCM+MDEVL S+A+ +KNFAV++L
Sbjct  1    MSYMLPHLHNGWQVDQAILSEEDRVIVIRFGHDWDPTCMKMDEVLYSIADKVKNFAVMFL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDITEVPDFN MYELYDP TVMFFFRNKHIMIDLGTGNNNKINW L+DKQE +DIVETVY
Sbjct  61   VDITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWTLEDKQEMVDIVETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLV++PKDYSTKYRY
Sbjct  121  RGARKGRGLVVSPKDYSTKYRY  142



>ref|XP_001657795.1| AAEL006401-PA [Aedes aegypti]
 gb|ABF18401.1| U4/U6.U5 snRNP/mitosis protein DIM1 component [Aedes aegypti]
 gb|EAT42010.1| AAEL006401-PA [Aedes aegypti]
Length=142

 Score =   263 bits (672),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 119/142 (84%), Positives = 133/142 (94%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSY+L HLH+GW VDQAIL+EE+R+V+IRFGHDWD TCM+MDEVL S+AE +KNFAV+YL
Sbjct  1    MSYMLAHLHNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDITEVPDFN MYELYDP TVMFFFRNKHIMIDLGTGNNNKINW L+DKQE IDI+ETVY
Sbjct  61   VDITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWPLEDKQEMIDIIETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLV++PKDYSTKYRY
Sbjct  121  RGARKGRGLVVSPKDYSTKYRY  142



>ref|XP_008419697.1| PREDICTED: thioredoxin-like protein 4A [Poecilia reticulata]
Length=142

 Score =   263 bits (672),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 118/142 (83%), Positives = 133/142 (94%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSY+LPHLH+GW VDQAIL+EE+R+++IRFGHDWD TCM+MDEVL S+AE +KNFAV+YL
Sbjct  1    MSYMLPHLHNGWQVDQAILSEEDRVLVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDITEVPDFN MYELYDP T MFFFRNKHIMIDLGTGNNNKINW ++DKQE IDIVETVY
Sbjct  61   VDITEVPDFNKMYELYDPCTAMFFFRNKHIMIDLGTGNNNKINWIIEDKQEMIDIVETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLV++PKDYSTKYRY
Sbjct  121  RGARKGRGLVVSPKDYSTKYRY  142



>gb|ACM09089.1| Thioredoxin-like protein 4A [Salmo salar]
Length=142

 Score =   263 bits (672),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 118/142 (83%), Positives = 133/142 (94%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSY+LPHLH+GW VDQAIL+EE+R ++IRFGHDWD TCM+MDEVL S+AE +KNFAV+YL
Sbjct  1    MSYMLPHLHNGWQVDQAILSEEDRALVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDITEVPDFN MYELYDP TVMFFFRNKHIMIDLGTGNNNKINW ++DKQE IDIVETVY
Sbjct  61   VDITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWTMEDKQEMIDIVETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            +GARKGRGLV++PKDYSTKYRY
Sbjct  121  QGARKGRGLVVSPKDYSTKYRY  142



>ref|XP_001700180.1| predicted protein [Chlamydomonas reinhardtii]
 gb|EDO98295.1| predicted protein [Chlamydomonas reinhardtii]
Length=142

 Score =   263 bits (671),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 120/142 (85%), Positives = 131/142 (92%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSYLLPHL SG+AVDQAILAEE+R+VIIRFGHDW+  CMQMDEVLA VA+ +KNFA  YL
Sbjct  1    MSYLLPHLRSGYAVDQAILAEEDRVVIIRFGHDWEPNCMQMDEVLAGVADQIKNFACTYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDI+EVPDFNTMYELYDP T+MFFFRNKHIMIDLGTGNNNKINW + DKQEFIDIVE VY
Sbjct  61   VDISEVPDFNTMYELYDPCTIMFFFRNKHIMIDLGTGNNNKINWPMTDKQEFIDIVEVVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLV++PKDYSTKYRY
Sbjct  121  RGARKGRGLVVSPKDYSTKYRY  142



>emb|CCA25990.1| hypothetical protein ARALYDRAFT_908777 [Albugo laibachii Nc14]
Length=142

 Score =   262 bits (670),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 120/142 (85%), Positives = 132/142 (93%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSYLLPHL +GWAVDQAIL+E  R+V+IRFGHD D TCMQMDEVL+ +AE +KNFAV+Y+
Sbjct  1    MSYLLPHLSTGWAVDQAILSESGRVVVIRFGHDHDSTCMQMDEVLSGIAEDVKNFAVIYV  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWA  +KQE IDI+ETVY
Sbjct  61   VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWAFNNKQEMIDILETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLVI+PKDYSTKYRY
Sbjct  121  RGARKGRGLVISPKDYSTKYRY  142



>ref|XP_004923827.1| PREDICTED: thioredoxin-like protein 4A-like isoform X1 [Bombyx 
mori]
 ref|XP_004923828.1| PREDICTED: thioredoxin-like protein 4A-like isoform X2 [Bombyx 
mori]
 ref|XP_004923829.1| PREDICTED: thioredoxin-like protein 4A-like isoform X3 [Bombyx 
mori]
 ref|XP_004923830.1| PREDICTED: thioredoxin-like protein 4A-like isoform X4 [Bombyx 
mori]
 gb|EHJ76331.1| mitosis protein dim1 [Danaus plexippus]
 gb|AGC94855.1| Dim1-like protein [Spodoptera frugiperda]
Length=142

 Score =   262 bits (670),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 119/142 (84%), Positives = 133/142 (94%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSY+L HLH+GW VDQAIL+EE+R+V+IRFGHDWD TCM+MDEVL S+AE +KNFAV+YL
Sbjct  1    MSYMLGHLHNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDITEVPDFN MYELYDP TVMFFFRNKHIMIDLGTGNNNKINW L+DKQE IDI+ETVY
Sbjct  61   VDITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWPLEDKQEMIDIIETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLV++PKDYSTKYRY
Sbjct  121  RGARKGRGLVVSPKDYSTKYRY  142



>ref|XP_005822914.1| component of the U4/U6.U5 snRNP/mitosis protein DIM1 [Guillardia 
theta CCMP2712]
 gb|EKX35934.1| component of the U4/U6.U5 snRNP/mitosis protein DIM1 [Guillardia 
theta CCMP2712]
Length=142

 Score =   262 bits (669),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 120/142 (85%), Positives = 133/142 (94%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSY+LPHL SG+AVDQAIL+EE+R+VIIRFGHDWD  CM+MDE L  VA+ +KNFAV+YL
Sbjct  1    MSYMLPHLDSGYAVDQAILSEEDRVVIIRFGHDWDPACMKMDETLYHVADKIKNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDITEVPDFNTMYELYDP TVMFFFRNKHIMIDLGTGNNNKINWAL+DKQEFIDIVE VY
Sbjct  61   VDITEVPDFNTMYELYDPVTVMFFFRNKHIMIDLGTGNNNKINWALQDKQEFIDIVEVVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLV++PKDYSTKY+Y
Sbjct  121  RGARKGRGLVVSPKDYSTKYKY  142



>emb|CCI41984.1| unnamed protein product [Albugo candida]
Length=142

 Score =   262 bits (669),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 120/142 (85%), Positives = 131/142 (92%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSYLLPHL SGWAVDQAIL+E  R+V+IRFGHD D TCMQMDEVL+ +AE +KNFAV+Y+
Sbjct  1    MSYLLPHLSSGWAVDQAILSESGRVVVIRFGHDHDSTCMQMDEVLSGIAEDVKNFAVIYV  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDITEVPDFNTMYELYDP TVMFFFRNKHIMIDLGTGNNNKINWA  +KQE IDI+ETVY
Sbjct  61   VDITEVPDFNTMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWAFNNKQEMIDILETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLVI+PKDYSTKYRY
Sbjct  121  RGARKGRGLVISPKDYSTKYRY  142



>ref|XP_001848597.1| mitosis protein dim1 [Culex quinquefasciatus]
 gb|EDS28640.1| mitosis protein dim1 [Culex quinquefasciatus]
Length=142

 Score =   261 bits (668),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 119/142 (84%), Positives = 132/142 (93%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSY+L HLH+GW VDQAIL+EE+R+V+IRFGHDWD TCM+MDEVL S+AE +KNFAV+YL
Sbjct  1    MSYMLAHLHNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDIT VPDFN MYELYDP TVMFFFRNKHIMIDLGTGNNNKINW L+DKQE IDIVETVY
Sbjct  61   VDITAVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWPLEDKQEMIDIVETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLV++PKDYSTKYRY
Sbjct  121  RGARKGRGLVVSPKDYSTKYRY  142



>gb|ENN82581.1| hypothetical protein YQE_01050, partial [Dendroctonus ponderosae]
 gb|ERL89396.1| hypothetical protein D910_06765 [Dendroctonus ponderosae]
Length=142

 Score =   261 bits (668),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 118/142 (83%), Positives = 133/142 (94%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSY+L HLH+GW VDQAIL+EE+R+V+IRFGHDWD +CM+MDEV+ S+AE +KNFAV+YL
Sbjct  1    MSYMLAHLHNGWQVDQAILSEEDRVVVIRFGHDWDPSCMKMDEVVYSIAEKVKNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDITEVPDFN MYELYDP TVMFFFRNKHIMIDLGTGNNNKINW L+DKQE IDIVETVY
Sbjct  61   VDITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWPLEDKQEMIDIVETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLV++PKDYSTKYRY
Sbjct  121  RGARKGRGLVVSPKDYSTKYRY  142



>ref|XP_975428.1| PREDICTED: thioredoxin-like protein 4A [Tribolium castaneum]
 gb|EFA02875.1| thioredoxin-like 4A [Tribolium castaneum]
Length=142

 Score =   261 bits (668),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 117/142 (82%), Positives = 133/142 (94%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSY+L HLH+GW VDQAIL+EE+R+V+IRFGHDWD +CM+MDEV+ S+AE +KNFAV+YL
Sbjct  1    MSYMLAHLHNGWQVDQAILSEEDRVVVIRFGHDWDPSCMKMDEVMYSIAEKVKNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDITEVPDFN MYELYDP TVMFFFRNKHIMIDLGTGNNNKINW L+DKQE IDI+ETVY
Sbjct  61   VDITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWPLEDKQEMIDIIETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLV++PKDYSTKYRY
Sbjct  121  RGARKGRGLVVSPKDYSTKYRY  142



>ref|XP_010126012.1| PREDICTED: thioredoxin-like protein 4A [Chlamydotis macqueenii]
 gb|KFP37389.1| Thioredoxin-like 4A [Chlamydotis macqueenii]
Length=142

 Score =   261 bits (667),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 118/142 (83%), Positives = 133/142 (94%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSY+L HL +GW VDQAIL+EE+R+V+IRFGHDWD TCM+MDEVL S+AE +KNFAV+YL
Sbjct  1    MSYILRHLQNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDITEVPDFN MYELYDP TVMFFFRNKHIMIDLGTGNNNKINWA++DKQE IDI+ETVY
Sbjct  61   VDITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWAMEDKQEMIDIIETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLV++PKDYSTKYRY
Sbjct  121  RGARKGRGLVVSPKDYSTKYRY  142



>ref|XP_004518565.1| PREDICTED: thioredoxin-like protein 4A-like [Ceratitis capitata]
Length=142

 Score =   261 bits (667),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 118/142 (83%), Positives = 131/142 (92%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSY+LPHLH+GW VDQAI  EE+R+V+IRFGHDWD  CM+MDEV+ S+AE +KNFAV+YL
Sbjct  1    MSYMLPHLHNGWQVDQAITNEEDRVVVIRFGHDWDPACMKMDEVMYSIAEKVKNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDITEVPDFN MYELYDP TVMFFFRNKHIMIDLGTGNNNKINW L+DKQE IDIVETVY
Sbjct  61   VDITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWPLEDKQEMIDIVETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLV++PKDYSTKYRY
Sbjct  121  RGARKGRGLVVSPKDYSTKYRY  142



>ref|XP_008635342.1| PREDICTED: thioredoxin-like protein 4A [Corvus brachyrhynchos]
 ref|XP_010396857.1| PREDICTED: thioredoxin-like protein 4A [Corvus cornix cornix]
 gb|KFO61762.1| Thioredoxin-like 4A [Corvus brachyrhynchos]
Length=139

 Score =   261 bits (667),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 117/139 (84%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +2

Query  35   LLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYLVDI  214
            +LPHLH+GW VDQAIL+EE+R+V+IRFGHDWD TCM+MDEVL S+AE +KNFAV+YLVDI
Sbjct  1    MLPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYLVDI  60

Query  215  TEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVYRGA  394
            TEVPDFN MYELYDP TVMFFFRNKHIMIDLGTGNNNKINWA++DKQE IDI+ETVYRGA
Sbjct  61   TEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWAMEDKQEMIDIIETVYRGA  120

Query  395  RKGRGLVIAPKDYSTKYRY  451
            RKGRGLV++PKDYSTKYRY
Sbjct  121  RKGRGLVVSPKDYSTKYRY  139



>gb|KDR22966.1| Thioredoxin-like protein 4A [Zootermopsis nevadensis]
Length=142

 Score =   261 bits (667),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 118/142 (83%), Positives = 133/142 (94%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSY+L HLH+GW VDQAIL+EE+R+V+IRFGHDWD +CM+MDEVL S+AE +KNFAVLYL
Sbjct  1    MSYMLGHLHNGWQVDQAILSEEDRVVVIRFGHDWDPSCMKMDEVLYSIAEKVKNFAVLYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDIT+VPDFN MYELYDP TVMFFFRNKHIMIDLGTGNNNKINW L+DKQE IDI+ETVY
Sbjct  61   VDITKVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWPLEDKQEMIDIIETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLV++PKDYSTKYRY
Sbjct  121  RGARKGRGLVVSPKDYSTKYRY  142



>emb|CDQ74845.1| unnamed protein product [Oncorhynchus mykiss]
Length=142

 Score =   261 bits (666),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 118/142 (83%), Positives = 131/142 (92%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSY+LPHLH+GW VDQAIL+EE+R ++IRFGHDWD TCM+MDEVL SVAE +KNFAV+YL
Sbjct  1    MSYMLPHLHNGWQVDQAILSEEDRALVIRFGHDWDPTCMKMDEVLYSVAEKVKNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDIT VPDFN MYELYDP TVMFFFRNKHIMIDLGTGNNNKINW ++DKQE IDI ETVY
Sbjct  61   VDITAVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWTMEDKQEMIDIFETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLV++PKDYSTKYRY
Sbjct  121  RGARKGRGLVVSPKDYSTKYRY  142



>ref|XP_002434548.1| component of the U4/U6.U5 snRNP/mitosis protein DIM1, putative 
[Ixodes scapularis]
 gb|EEC07372.1| component of the U4/U6.U5 snRNP/mitosis protein DIM1, putative 
[Ixodes scapularis]
Length=142

 Score =   261 bits (666),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 117/142 (82%), Positives = 132/142 (93%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSY+L HLH+GW VDQAIL+EE+R+V+IRFGHDWD TCM+MDEVL S+ E +KNFA +YL
Sbjct  1    MSYMLQHLHNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYSIVEKVKNFAAIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDI+EVPDFN MYELYDP TVMFFFRNKHIMIDLGTGNNNKINWAL+DKQE +DIVETVY
Sbjct  61   VDISEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWALEDKQEMVDIVETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLV++PKDYSTKYRY
Sbjct  121  RGARKGRGLVVSPKDYSTKYRY  142



>gb|KFB42843.1| AGAP008298-PA-like protein [Anopheles sinensis]
Length=142

 Score =   261 bits (666),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 118/142 (83%), Positives = 133/142 (94%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSY+L HLH+GW VDQAIL+EE+R+V+IRFGHDWD TCM+MDEVL ++AE +KNFAV+YL
Sbjct  1    MSYMLAHLHNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYNIAEKVKNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDIT+VPDFN MYELYDP TVMFFFRNKHIMIDLGTGNNNKINW L+DKQE IDIVETVY
Sbjct  61   VDITKVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWPLEDKQEMIDIVETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLV++PKDYSTKYRY
Sbjct  121  RGARKGRGLVVSPKDYSTKYRY  142



>gb|ACO51575.1| Thioredoxin-like protein 4A [Rana catesbeiana]
Length=142

 Score =   261 bits (666),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 116/142 (82%), Positives = 132/142 (93%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSY+LPHLH+GW VDQAIL+EE+R+++IRFGHDWD TCM+MDEVL S+AE +KNF V+YL
Sbjct  1    MSYMLPHLHNGWQVDQAILSEEDRVLVIRFGHDWDPTCMKMDEVLYSIAEKVKNFTVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDITEVPDFN MYELYDP TVM FFRNKHIMIDLGTGNNNKINW ++DKQE ID+VETVY
Sbjct  61   VDITEVPDFNKMYELYDPCTVMLFFRNKHIMIDLGTGNNNKINWPMEDKQEMIDVVETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLV++PKDYSTKYRY
Sbjct  121  RGARKGRGLVVSPKDYSTKYRY  142



>emb|CDW55882.1| Thioredoxin-like protein 4A [Trichuris trichiura]
 gb|KFD58903.1| hypothetical protein M513_00066 [Trichuris suis]
 gb|KFD72930.1| hypothetical protein M514_00066 [Trichuris suis]
 gb|KHJ43294.1| mitosis protein DIM1 [Trichuris suis]
Length=142

 Score =   260 bits (665),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 117/142 (82%), Positives = 132/142 (93%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSY+LPHLH+GW VDQAIL+EE+R+V+IRFGHDWD TCM+MDEVL  +AE +KNFA +Y+
Sbjct  1    MSYMLPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLFKIAEKVKNFAAVYV  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDIT+VPDFN MYELYDP TVMFFFRNKHIMIDLGTGNNNKINWAL+D QE IDI+ETVY
Sbjct  61   VDITQVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWALEDPQECIDIIETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLVI+PKDYSTKYRY
Sbjct  121  RGARKGRGLVISPKDYSTKYRY  142



>ref|XP_317168.1| AGAP008298-PA [Anopheles gambiae str. PEST]
 gb|EAA12234.1| AGAP008298-PA [Anopheles gambiae str. PEST]
 gb|ETN59879.1| mitosis protein dim1 [Anopheles darlingi]
Length=142

 Score =   260 bits (665),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 118/142 (83%), Positives = 132/142 (93%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSY+L HLH+GW VDQAIL+EE+R+V+IRFGHDWD TCM+MDEVL ++AE +KNFAV+YL
Sbjct  1    MSYMLAHLHNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYNIAEKVKNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDIT VPDFN MYELYDP TVMFFFRNKHIMIDLGTGNNNKINW L+DKQE IDIVETVY
Sbjct  61   VDITAVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWPLEDKQEMIDIVETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLV++PKDYSTKYRY
Sbjct  121  RGARKGRGLVVSPKDYSTKYRY  142



>ref|XP_001605455.1| PREDICTED: thioredoxin-like protein 4A [Nasonia vitripennis]
 ref|XP_011298187.1| PREDICTED: thioredoxin-like protein 4A [Fopius arisanus]
 ref|XP_011502093.1| PREDICTED: thioredoxin-like protein 4A [Ceratosolen solmsi marchali]
Length=142

 Score =   260 bits (664),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 117/142 (82%), Positives = 132/142 (93%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSY+L HLH+GW VDQAIL+EE+R+V+IRFGHDWD  CM+MDEVL ++AE +KNFAV+YL
Sbjct  1    MSYMLSHLHNGWQVDQAILSEEDRVVVIRFGHDWDPMCMKMDEVLYNIAEKVKNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDITEVPDFN MYELYDP TVMFFFRNKHIMIDLGTGNNNKINW L+DKQE IDI+ETVY
Sbjct  61   VDITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWTLEDKQEMIDIIETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLV++PKDYSTKYRY
Sbjct  121  RGARKGRGLVVSPKDYSTKYRY  142



>ref|XP_003389306.1| PREDICTED: thioredoxin-like protein 4A [Amphimedon queenslandica]
Length=142

 Score =   260 bits (664),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 117/142 (82%), Positives = 129/142 (91%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSY+LPHLH+GW VDQAILAEEER+V+IRFGHDWD TCMQMDE+L  + E +KNF  +YL
Sbjct  1    MSYMLPHLHNGWQVDQAILAEEERVVVIRFGHDWDPTCMQMDEILYKITEKVKNFVAIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDITEVPDFN MYELYDP TVMFF+RNKHIMIDLGTGNNNKINWAL D+QE IDIVETVY
Sbjct  61   VDITEVPDFNKMYELYDPCTVMFFYRNKHIMIDLGTGNNNKINWALDDEQEMIDIVETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGA KGRGLV++PKDYSTKYRY
Sbjct  121  RGASKGRGLVVSPKDYSTKYRY  142



>gb|ESA24249.1| hypothetical protein GLOINDRAFT_100571 [Rhizophagus irregularis 
DAOM 181602]
 gb|EXX68643.1| Dib1p [Rhizophagus irregularis DAOM 197198w]
Length=142

 Score =   259 bits (663),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 117/142 (82%), Positives = 131/142 (92%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSY LPHL +GW VDQAIL+EE+R+V+IRFGHDWD TCM+MDE L  +AE +KNFAV+YL
Sbjct  1    MSYFLPHLTNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDETLYGIAEKVKNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDITEVPDFN MYELYDP TVMFFFRNKHIMIDLGTGNNNKINWAL+DKQE IDI+ETVY
Sbjct  61   VDITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWALEDKQELIDIIETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLV++PKDYSTKY+Y
Sbjct  121  RGARKGRGLVVSPKDYSTKYKY  142



>ref|XP_003511949.1| PREDICTED: thioredoxin-like protein 4A isoform X1 [Cricetulus 
griseus]
 ref|XP_007612048.1| PREDICTED: thioredoxin-like protein 4A isoform X2 [Cricetulus 
griseus]
 gb|EGW12058.1| Thioredoxin-like protein 4A [Cricetulus griseus]
Length=142

 Score =   259 bits (662),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 116/142 (82%), Positives = 133/142 (94%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSY+LPHLH+GW VDQAIL+EE+R+V+IRFGHDWD TCM+MDEVL S+AE +KNFAV+YL
Sbjct  1    MSYMLPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDITEV DFN MYELYDP TVMFFFRNKHIMIDLGTGNNNKI+WA++DKQE +DI+ETVY
Sbjct  61   VDITEVSDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKISWAMEDKQEMVDIIETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARK RGLV++PKDYSTKYRY
Sbjct  121  RGARKRRGLVVSPKDYSTKYRY  142



>ref|XP_006677007.1| hypothetical protein BATDEDRAFT_86140 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF82661.1| hypothetical protein BATDEDRAFT_86140 [Batrachochytrium dendrobatidis 
JAM81]
Length=142

 Score =   259 bits (662),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 118/142 (83%), Positives = 131/142 (92%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSY LPHL SGW VDQAIL EE+R+VIIRFGHDWD TCMQMDE+L S+AE +KNFAV+YL
Sbjct  1    MSYFLPHLPSGWHVDQAILNEEDRVVIIRFGHDWDPTCMQMDEILYSIAEKVKNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDIT+VPDFN MYE+YDP T MFFFRNKH+MIDLGTGNNNKINWAL+DKQE IDIVETV+
Sbjct  61   VDITDVPDFNKMYEIYDPCTTMFFFRNKHMMIDLGTGNNNKINWALEDKQEMIDIVETVF  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLV+APKDYSTKY+Y
Sbjct  121  RGARKGRGLVVAPKDYSTKYKY  142



>ref|XP_624360.1| PREDICTED: thioredoxin-like protein 4A-like isoform X2 [Apis 
mellifera]
 ref|XP_003396220.1| PREDICTED: thioredoxin-like protein 4A-like [Bombus terrestris]
 ref|XP_003490342.1| PREDICTED: thioredoxin-like protein 4A-like [Bombus impatiens]
 ref|XP_003690753.1| PREDICTED: thioredoxin-like protein 4A-like [Apis florea]
 ref|XP_003706461.1| PREDICTED: thioredoxin-like protein 4A-like [Megachile rotundata]
 ref|XP_006563277.1| PREDICTED: thioredoxin-like protein 4A-like isoform X1 [Apis 
mellifera]
 ref|XP_006610627.1| PREDICTED: thioredoxin-like protein 4A-like [Apis dorsata]
Length=142

 Score =   259 bits (662),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 116/142 (82%), Positives = 132/142 (93%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSY+L HLH+GW VDQAIL+EE+R+V+IRFGHDWD  CM+MDEVL ++AE +KNFAV+YL
Sbjct  1    MSYMLSHLHNGWQVDQAILSEEDRVVVIRFGHDWDPMCMKMDEVLYNIAEKVKNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDIT+VPDFN MYELYDP TVMFFFRNKHIMIDLGTGNNNKINW L+DKQE IDI+ETVY
Sbjct  61   VDITQVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWTLEDKQEMIDIIETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLV++PKDYSTKYRY
Sbjct  121  RGARKGRGLVVSPKDYSTKYRY  142



>gb|ERE90894.1| thioredoxin-like protein 4A-like protein [Cricetulus griseus]
Length=142

 Score =   258 bits (660),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 116/142 (82%), Positives = 132/142 (93%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSY+LPHLH+GW VDQAIL+EE+R+V+IRFGHDWD TCM+MDEVL S+AE +KNFAV+YL
Sbjct  1    MSYMLPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDITEV DFN MYELYDP TVMFFFRNKHIMIDLGTGNNNKI WA++DKQE +DI+ETVY
Sbjct  61   VDITEVSDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKIXWAMEDKQEMVDIIETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARK RGLV++PKDYSTKYRY
Sbjct  121  RGARKXRGLVVSPKDYSTKYRY  142



>ref|XP_004035804.1| mitosis protein DIM1, putative [Ichthyophthirius multifiliis]
 gb|EGR32318.1| mitosis protein DIM1, putative [Ichthyophthirius multifiliis]
Length=142

 Score =   258 bits (660),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 119/142 (84%), Positives = 130/142 (92%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSYLLPHL +GW VDQAIL EEERLVIIRFGHDWD  CM+MDE+L  VAE +KNFAV+YL
Sbjct  1    MSYLLPHLKNGWEVDQAILHEEERLVIIRFGHDWDPECMKMDEILYKVAEKIKNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDIT+VPDFNTMYELYDP TVMFFFRNKH+MIDLGTGNNNKINWA+ +KQEFIDI E VY
Sbjct  61   VDITKVPDFNTMYELYDPVTVMFFFRNKHMMIDLGTGNNNKINWAMNNKQEFIDICEIVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKG+GLVIAPKDYSTKY+Y
Sbjct  121  RGARKGKGLVIAPKDYSTKYKY  142



>gb|KFZ52327.1| Thioredoxin-like 4A [Podiceps cristatus]
Length=140

 Score =   258 bits (659),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 118/142 (83%), Positives = 133/142 (94%), Gaps = 2/142 (1%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSY+LPH  +GW VDQAIL+EE+R+V+IRFGHDWD TCM+MDEVL S+AE +KNFAV+YL
Sbjct  1    MSYMLPH--NGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYL  58

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDITEVPDFN MYELYDP TVMFFFRNKHIMIDLGTGNNNKINWA++DKQE IDI+ETVY
Sbjct  59   VDITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWAMEDKQEMIDIIETVY  118

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLV++PKDYSTKYRY
Sbjct  119  RGARKGRGLVVSPKDYSTKYRY  140



>ref|XP_003537766.1| PREDICTED: thioredoxin-like protein YLS8-like isoform X1 [Glycine 
max]
 gb|KHN32298.1| Thioredoxin-like protein 4A [Glycine soja]
Length=132

 Score =   258 bits (658),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 123/142 (87%), Positives = 130/142 (92%), Gaps = 10/142 (7%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSYLLPHLHS          EEER+V+IRFGHDWD+TCMQMDEVLASVAE +KNFAV+YL
Sbjct  1    MSYLLPHLHS----------EEERVVVIRFGHDWDDTCMQMDEVLASVAEKIKNFAVIYL  50

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDITEVPDFNTMYELY+P TVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY
Sbjct  51   VDITEVPDFNTMYELYEPCTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  110

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLVI+PKDYSTKYRY
Sbjct  111  RGARKGRGLVISPKDYSTKYRY  132



>ref|XP_008557868.1| PREDICTED: thioredoxin-like protein 4A [Microplitis demolitor]
Length=142

 Score =   258 bits (659),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 116/142 (82%), Positives = 131/142 (92%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSY+L HLH+GW VDQAIL+EE+R+V+IRFGHDWD  CM+MDEVL ++AE +KNFAV+YL
Sbjct  1    MSYMLSHLHNGWQVDQAILSEEDRVVVIRFGHDWDPMCMKMDEVLYNIAEKVKNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDIT VPDFN MYELYDP TVMFFFRNKHIMIDLGTGNNNKINW L+DKQE IDI+ETVY
Sbjct  61   VDITAVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWTLEDKQEMIDIIETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLV++PKDYSTKYRY
Sbjct  121  RGARKGRGLVVSPKDYSTKYRY  142



>gb|ELU05133.1| hypothetical protein CAPTEDRAFT_164052 [Capitella teleta]
 gb|ELU11364.1| hypothetical protein CAPTEDRAFT_97509 [Capitella teleta]
Length=142

 Score =   258 bits (659),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 117/142 (82%), Positives = 131/142 (92%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSY+L HLH+GW VDQAIL+EE+R+VIIRFGHDWD TCM MDE L SVAE +KNFAV YL
Sbjct  1    MSYMLQHLHNGWQVDQAILSEEDRVVIIRFGHDWDPTCMVMDETLYSVAEKVKNFAVCYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDITEVPDFN MYELYDP T MFF+RNKHIMIDLGTGNNNKINW+++D+QEFIDIVETV+
Sbjct  61   VDITEVPDFNKMYELYDPCTCMFFYRNKHIMIDLGTGNNNKINWSMEDEQEFIDIVETVF  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLV++PKDYSTKYRY
Sbjct  121  RGARKGRGLVVSPKDYSTKYRY  142



>emb|CDX78332.1| BnaA03g02440D [Brassica napus]
Length=580

 Score =   271 bits (694),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 124/136 (91%), Positives = 132/136 (97%), Gaps = 0/136 (0%)
 Frame = +2

Query  44   HLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYLVDITEV  223
            HLHSGWAVDQAIL EEERLV+IRFG DWDETCMQMDEVLASVAET+KNFAV+YLVDI+EV
Sbjct  445  HLHSGWAVDQAILTEEERLVVIRFGPDWDETCMQMDEVLASVAETIKNFAVIYLVDISEV  504

Query  224  PDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVYRGARKG  403
            PDFNTMYELYDP T+MFFFRNKHIMIDLGTGNNNKINWA+KDK EFIDI+ETV+RGARKG
Sbjct  505  PDFNTMYELYDPLTIMFFFRNKHIMIDLGTGNNNKINWAMKDKHEFIDIIETVFRGARKG  564

Query  404  RGLVIAPKDYSTKYRY  451
            RGLVIAPKDYSTKYRY
Sbjct  565  RGLVIAPKDYSTKYRY  580



>ref|XP_008894283.1| thioredoxin-like protein 4A [Phytophthora parasitica INRA-310]
 gb|ETI41422.1| thioredoxin-like protein 4A [Phytophthora parasitica P1569]
 gb|ETK81476.1| thioredoxin-like protein 4A [Phytophthora parasitica]
 gb|ETL34886.1| thioredoxin-like protein 4A [Phytophthora parasitica]
 gb|ETL88133.1| thioredoxin-like protein 4A [Phytophthora parasitica]
 gb|ETM41385.1| thioredoxin-like protein 4A [Phytophthora parasitica]
 gb|ETN20330.1| thioredoxin-like protein 4A [Phytophthora parasitica INRA-310]
 gb|ETO70077.1| thioredoxin-like protein 4A [Phytophthora parasitica P1976]
 gb|ETP11191.1| thioredoxin-like protein 4A [Phytophthora parasitica CJ01A1]
 gb|ETP39320.1| thioredoxin-like protein 4A [Phytophthora parasitica P10297]
Length=142

 Score =   257 bits (657),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 119/142 (84%), Positives = 129/142 (91%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSYLLPHL SGWAVDQAIL E +R+V+IRFGHD D TCMQMDEVL  +AE +KNFAV+Y+
Sbjct  1    MSYLLPHLESGWAVDQAILNEGDRVVVIRFGHDHDPTCMQMDEVLCGIAEDVKNFAVIYV  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDITEVPDFNTMYELYDP TVMFFFRNKHIMIDLGTGNNNKINWA  +K E IDI+ETVY
Sbjct  61   VDITEVPDFNTMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWAFNNKGEMIDIIETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLVI+PKDYSTKYRY
Sbjct  121  RGARKGRGLVISPKDYSTKYRY  142



>ref|XP_001020947.1| Mitosis protein DIM1 containing protein [Tetrahymena thermophila]
 gb|EAS00702.1| component of the U4/U6.U5 snRNP/mitosis protein DIM1 [Tetrahymena 
thermophila SB210]
Length=142

 Score =   257 bits (656),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 118/142 (83%), Positives = 130/142 (92%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSYLLPHL +GW VDQAIL EEERLVIIRFGHDWD  CM+MDE+L  VA+ +KNFAV+YL
Sbjct  1    MSYLLPHLKNGWEVDQAILHEEERLVIIRFGHDWDPECMKMDEILYKVADKIKNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDIT+VPDFNTMYELYDP TVMFFFRNKH+MIDLGTGNNNKINWA+ +KQEFIDI E VY
Sbjct  61   VDITKVPDFNTMYELYDPVTVMFFFRNKHMMIDLGTGNNNKINWAMNNKQEFIDICEIVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKG+GLVIAPKDYSTKY+Y
Sbjct  121  RGARKGKGLVIAPKDYSTKYKY  142



>gb|EFX72748.1| hypothetical protein DAPPUDRAFT_308067 [Daphnia pulex]
Length=142

 Score =   257 bits (656),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 117/142 (82%), Positives = 131/142 (92%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSY+L HL +GW VDQAIL+EE+RLV+IRFGHDWD TCM+MDEVL  +AE +KNFAV+YL
Sbjct  1    MSYMLQHLVNGWQVDQAILSEEDRLVVIRFGHDWDPTCMKMDEVLYQIAEKVKNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDIT+VPDFN MYELYDP T MFFFRNKHIMIDLGTGNNNKINWA++DKQE IDIVETVY
Sbjct  61   VDITQVPDFNKMYELYDPCTNMFFFRNKHIMIDLGTGNNNKINWAIEDKQEMIDIVETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLV++PKDYSTKYRY
Sbjct  121  RGARKGRGLVVSPKDYSTKYRY  142



>gb|KFH68986.1| thioredoxin-like protein 4A [Mortierella verticillata NRRL 6337]
Length=142

 Score =   256 bits (655),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 116/142 (82%), Positives = 130/142 (92%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSY LPHL +GW VDQAIL+EE+R+V++RFG DWD TCMQMDE+L SVAE LKNFAV+YL
Sbjct  1    MSYFLPHLTNGWQVDQAILSEEDRVVVLRFGTDWDPTCMQMDELLYSVAEKLKNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDITEVPDFN MYELYDP T MFFFRNKHIM+DLGTGNNNKINWAL+ KQE IDIVETV+
Sbjct  61   VDITEVPDFNKMYELYDPCTTMFFFRNKHIMVDLGTGNNNKINWALESKQELIDIVETVF  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLV++PKDYSTKY+Y
Sbjct  121  RGARKGRGLVVSPKDYSTKYKY  142



>emb|CEG74081.1| Putative Thioredoxin-like protein 4A [Rhizopus microsporus]
 emb|CEI90017.1| Putative Thioredoxin-like protein 4A [Rhizopus microsporus]
Length=142

 Score =   256 bits (655),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 116/142 (82%), Positives = 130/142 (92%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSY LPHL +GW VDQAIL+EE+R+V+IRFGHDWD TCMQMDE+L S+AE +KNFAV+YL
Sbjct  1    MSYFLPHLTNGWQVDQAILSEEDRVVVIRFGHDWDPTCMQMDEILYSIAEKVKNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDITEVPDFN MYELYDP TVMFFFRNKHIMIDLGTGNNNKINWAL DKQE ID++E VY
Sbjct  61   VDITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWALDDKQEMIDLIEIVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLV++ KDYSTKY+Y
Sbjct  121  RGARKGRGLVVSLKDYSTKYKY  142



>ref|XP_001458031.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 emb|CAK90634.1| unnamed protein product [Paramecium tetraurelia]
Length=142

 Score =   256 bits (654),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 116/142 (82%), Positives = 130/142 (92%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSYLLPHL++GW VDQAIL EEE+LVIIRFGHDWD  CMQMDE+L   AE +K FAV+YL
Sbjct  1    MSYLLPHLNNGWQVDQAILDEEEKLVIIRFGHDWDPQCMQMDEILYKSAEKIKKFAVVYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDIT+VPDFNTMYELYDP TVMFF+RNKH+MIDLGTGNNNKINWA+ DKQEFIDIVE +Y
Sbjct  61   VDITKVPDFNTMYELYDPVTVMFFYRNKHMMIDLGTGNNNKINWAMNDKQEFIDIVEIIY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKG+GLV+APKDYSTKY+Y
Sbjct  121  RGARKGKGLVVAPKDYSTKYKY  142



>ref|XP_005704366.1| U5 snRNP protein, DIM1 family [Galdieria sulphuraria]
 gb|EME27846.1| U5 snRNP protein, DIM1 family [Galdieria sulphuraria]
Length=142

 Score =   256 bits (654),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 116/142 (82%), Positives = 131/142 (92%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSYLLPHLHSG+AVDQAIL+EE+R+V+IRFG D+D TCM MDE L   AE +KNFAV+YL
Sbjct  1    MSYLLPHLHSGYAVDQAILSEEDRVVVIRFGQDFDPTCMLMDETLYKAAEKIKNFAVVYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDI EVPDFN++YELYDP TVMFFFRNKHIM+DLGTGNNNKINWA++D QEFIDIVETVY
Sbjct  61   VDIREVPDFNSLYELYDPCTVMFFFRNKHIMVDLGTGNNNKINWAMQDVQEFIDIVETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLV+APKDYSTKY+Y
Sbjct  121  RGARKGRGLVVAPKDYSTKYKY  142



>gb|EMS48495.1| Thioredoxin-like protein 4A [Triticum urartu]
Length=205

 Score =   258 bits (660),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 120/135 (89%), Positives = 128/135 (95%), Gaps = 0/135 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSYLLPHLHSGWAVDQAILAEEERLV+IRFGHDWDETCMQMDEVL+ VAET+KNFAV+YL
Sbjct  1    MSYLLPHLHSGWAVDQAILAEEERLVMIRFGHDWDETCMQMDEVLSGVAETIKNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWA+KDKQEF+DIVETVY
Sbjct  61   VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWAMKDKQEFVDIVETVY  120

Query  386  RGARKGRGLVIAPKD  430
            RGAR  + +  A KD
Sbjct  121  RGARNNKKIKWAMKD  135



>ref|XP_002078122.1| GD23285 [Drosophila simulans]
 gb|EDX03707.1| GD23285 [Drosophila simulans]
Length=147

 Score =   256 bits (654),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 115/138 (83%), Positives = 129/138 (93%), Gaps = 0/138 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSY+LPHLH+GW VDQAIL+EE+R+V+IRFGHDWD  CM+MDEV+ S+AE +KNFAV+YL
Sbjct  1    MSYMLPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPACMKMDEVMYSIAEKVKNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDITEVPDFN MYELYDP TVMFFFRNKHIMIDLGTGNNNKINW L+DKQE IDIVETVY
Sbjct  61   VDITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWPLEDKQEMIDIVETVY  120

Query  386  RGARKGRGLVIAPKDYST  439
            RGARKGRGLV++PKDYST
Sbjct  121  RGARKGRGLVVSPKDYST  138



>ref|XP_001633372.1| predicted protein [Nematostella vectensis]
 gb|EDO41309.1| predicted protein [Nematostella vectensis]
Length=142

 Score =   256 bits (653),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 112/142 (79%), Positives = 130/142 (92%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSY+LPHL +GW VDQAI++EE+++V+IRFGHDWD TCM+MDE+L S+A+  KNFAV YL
Sbjct  1    MSYMLPHLQNGWQVDQAIMSEEDKVVVIRFGHDWDPTCMKMDELLYSIADKCKNFAVFYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDIT+ PDFN MYELYDP T+MFF+RNKHIMIDLGTGNNNKINWAL DKQE +DIVETVY
Sbjct  61   VDITQCPDFNKMYELYDPCTIMFFYRNKHIMIDLGTGNNNKINWALDDKQEMVDIVETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLV++PKDYSTKYRY
Sbjct  121  RGARKGRGLVVSPKDYSTKYRY  142



>ref|XP_002634991.1| Hypothetical protein CBG13531 [Caenorhabditis briggsae]
 ref|XP_003091994.1| hypothetical protein CRE_02669 [Caenorhabditis remanei]
 emb|CAP32315.1| Protein CBG13531 [Caenorhabditis briggsae]
 gb|EFO98438.1| hypothetical protein CRE_02669 [Caenorhabditis remanei]
Length=142

 Score =   255 bits (652),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 114/142 (80%), Positives = 129/142 (91%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSY+LPHL +GW VDQAILAEE+R+V++RFGHDWD TCMQMDE L  +A  +KNFAV+YL
Sbjct  1    MSYMLPHLENGWQVDQAILAEEDRVVVVRFGHDWDPTCMQMDETLFKIAPKVKNFAVVYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDIT+VPDFN MYELYDP TVMFFFRNKHIM+DLGTGNNNKINWA+ D QE IDI+ETVY
Sbjct  61   VDITKVPDFNKMYELYDPCTVMFFFRNKHIMVDLGTGNNNKINWAVTDGQELIDIIETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLVI+PKDYSTKY+Y
Sbjct  121  RGARKGRGLVISPKDYSTKYKY  142



>ref|XP_003054835.1| mitosis protein DIM1/U5snRNP-specific component [Micromonas pusilla 
CCMP1545]
 gb|EEH60087.1| mitosis protein DIM1/U5snRNP-specific component [Micromonas pusilla 
CCMP1545]
Length=142

 Score =   255 bits (651),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 115/142 (81%), Positives = 128/142 (90%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSYLLPHL SGWAVDQAIL EEER+V +RFG D DETCMQMDE LASV++ +KNFAV+Y 
Sbjct  1    MSYLLPHLRSGWAVDQAILTEEERVVCLRFGRDGDETCMQMDETLASVSDKVKNFAVIYC  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDI EVPDFNTMYELYDP T MFFFRNKHIMIDLGTGNNNK+NWA+ DKQEFIDI+E ++
Sbjct  61   VDIDEVPDFNTMYELYDPCTCMFFFRNKHIMIDLGTGNNNKVNWAMDDKQEFIDILEVIF  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
             GARKGRGLV++PKDYSTKYRY
Sbjct  121  AGARKGRGLVVSPKDYSTKYRY  142



>ref|XP_001420660.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO98953.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=142

 Score =   255 bits (651),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 115/142 (81%), Positives = 131/142 (92%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSYLLPHL +GWAVDQAIL+EE+R+V+IRFG D D+TCM+MDE LA VA+ +KNFA++YL
Sbjct  1    MSYLLPHLRNGWAVDQAILSEEDRVVVIRFGSDADDTCMRMDETLAGVADKIKNFAIIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDI+EVPDFN MYELYDP TVMFFFRNKHI IDLGTGNNNK+NWA+ DKQEFIDIVETVY
Sbjct  61   VDISEVPDFNAMYELYDPCTVMFFFRNKHIQIDLGTGNNNKVNWAMDDKQEFIDIVETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
             GARKGRGLVI+P+DYSTKYRY
Sbjct  121  TGARKGRGLVISPRDYSTKYRY  142



>ref|NP_001280276.1| thioredoxin-like protein 4A [Acyrthosiphon pisum]
 dbj|BAH71288.1| ACYPI006109 [Acyrthosiphon pisum]
Length=142

 Score =   255 bits (651),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 116/142 (82%), Positives = 131/142 (92%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSY+L HL +GW VDQAIL+EE+R+V+IRFGHDWD TCM+MDEVL ++AE +KNFAV+YL
Sbjct  1    MSYMLAHLFNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYNIAEKVKNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDIT+VPDFN MYELYDP  VMFFFRNKHIMIDLGTGNNNKINWAL+DKQE IDIVETVY
Sbjct  61   VDITKVPDFNKMYELYDPCPVMFFFRNKHIMIDLGTGNNNKINWALEDKQEMIDIVETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGL ++PKDYSTKYRY
Sbjct  121  RGARKGRGLFVSPKDYSTKYRY  142



>ref|XP_001347166.1| Mitosis protein DIM1 [Paramecium tetraurelia strain d4-2]
 ref|XP_001423117.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 emb|CAH03539.1| Mitosis protein DIM1, putative [Paramecium tetraurelia]
 emb|CAK55719.1| unnamed protein product [Paramecium tetraurelia]
Length=142

 Score =   255 bits (651),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 115/142 (81%), Positives = 129/142 (91%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSYLLPHL++GW VDQAIL EEE+LVIIRFGHDWD  CMQMDE+L   AE +K FA +YL
Sbjct  1    MSYLLPHLNNGWQVDQAILDEEEKLVIIRFGHDWDPQCMQMDEILYKSAEKIKKFAAVYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDIT+VPDFNTMYELYDP TVMFF+RNKH+MIDLGTGNNNKINWA+ DKQEFIDIVE +Y
Sbjct  61   VDITKVPDFNTMYELYDPVTVMFFYRNKHMMIDLGTGNNNKINWAMNDKQEFIDIVEIIY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKG+GLV+APKDYSTKY+Y
Sbjct  121  RGARKGKGLVVAPKDYSTKYKY  142



>gb|EGT53874.1| hypothetical protein CAEBREN_24976 [Caenorhabditis brenneri]
Length=142

 Score =   255 bits (651),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 113/142 (80%), Positives = 129/142 (91%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSY+LPHL +GW VDQAILAEE+R+V++RFGHDWD TCMQMDE L  +A  +KNFAV+YL
Sbjct  1    MSYMLPHLENGWQVDQAILAEEDRVVVVRFGHDWDPTCMQMDETLFKIAPKVKNFAVVYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDIT+VPDFN MYELYDP TVMFFFRNKHIM+DLGTGNNNKINWA+ D QE IDI+ETVY
Sbjct  61   VDITKVPDFNKMYELYDPCTVMFFFRNKHIMVDLGTGNNNKINWAVTDGQELIDIIETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLV++PKDYSTKY+Y
Sbjct  121  RGARKGRGLVVSPKDYSTKYKY  142



>gb|EPB84308.1| thioredoxin-like protein 4A [Mucor circinelloides f. circinelloides 
1006PhL]
Length=160

 Score =   255 bits (652),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 117/149 (79%), Positives = 129/149 (87%), Gaps = 0/149 (0%)
 Frame = +2

Query  5    SGEREERMSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLK  184
            S       SY LPHL +GW VDQAIL+EE+R+VIIRFGHDWD TCMQMDEVL S+AE +K
Sbjct  12   SSNTNAFCSYFLPHLTNGWQVDQAILSEEDRVVIIRFGHDWDPTCMQMDEVLYSIAEKVK  71

Query  185  NFAVLYLVDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFI  364
            NFA +YLVDITEVPDFN MYELYDP T MFFFRNKHIM+DLGTGNNNKINWAL DKQE I
Sbjct  72   NFACIYLVDITEVPDFNKMYELYDPCTTMFFFRNKHIMVDLGTGNNNKINWALDDKQEMI  131

Query  365  DIVETVYRGARKGRGLVIAPKDYSTKYRY  451
            D+VETVYRGARKGRGLV++ KDYSTKY+Y
Sbjct  132  DLVETVYRGARKGRGLVVSLKDYSTKYQY  160



>emb|CDS25812.1| mitosis protein dim1 [Hymenolepis microstoma]
Length=142

 Score =   254 bits (649),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 116/142 (82%), Positives = 129/142 (91%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSY+L HL +GW VDQAIL+EE+R+VIIRFGHDWD  CM MDE L  VAE +KNFAV+YL
Sbjct  1    MSYMLSHLTNGWQVDQAILSEEDRVVIIRFGHDWDPQCMVMDETLFQVAEKIKNFAVVYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDI +VPDFN MYELYDP TVMFF+RNKHIMIDLGTGNNNKINWA++DKQEFIDIVETVY
Sbjct  61   VDIAQVPDFNKMYELYDPCTVMFFYRNKHIMIDLGTGNNNKINWAIEDKQEFIDIVETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLV++PKDYSTKYRY
Sbjct  121  RGARKGRGLVVSPKDYSTKYRY  142



>ref|XP_002507532.1| mitosis protein DIM1/U5snRNP-specific component [Micromonas sp. 
RCC299]
 gb|ACO68790.1| mitosis protein DIM1/U5snRNP-specific component [Micromonas sp. 
RCC299]
Length=142

 Score =   254 bits (649),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 115/142 (81%), Positives = 128/142 (90%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            M++LLPHL SGWAVDQAIL EEERLV++RFG D D+TCM MDE L+SVA+ +KNFAV+Y 
Sbjct  1    MAFLLPHLRSGWAVDQAILTEEERLVVLRFGRDADDTCMSMDETLSSVADKVKNFAVIYC  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDI EVPDFN MYELYDP TVMFFFRNKHIMIDLGTGNNNKINWA+ DKQEF+DIVE VY
Sbjct  61   VDIEEVPDFNAMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWAMDDKQEFVDIVEVVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
             GARKGRGLV++PKDYSTKYRY
Sbjct  121  AGARKGRGLVVSPKDYSTKYRY  142



>gb|EKC34447.1| Thioredoxin-like protein 4A [Crassostrea gigas]
Length=184

 Score =   256 bits (653),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 116/148 (78%), Positives = 131/148 (89%), Gaps = 0/148 (0%)
 Frame = +2

Query  8    GEREERMSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKN  187
            G+R   MSY+L HLH+GW VDQAILAEE+R+V+IRFGHDWD +CM MDE L   AE +KN
Sbjct  37   GKRFITMSYMLQHLHNGWQVDQAILAEEDRVVVIRFGHDWDPSCMVMDETLYKCAEKMKN  96

Query  188  FAVLYLVDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFID  367
            FAV+YLVD +EVPDFN MYELYDP TVMFF+RNKHIMIDLGTGNNNKINW++ D QEFID
Sbjct  97   FAVVYLVDTSEVPDFNKMYELYDPCTVMFFYRNKHIMIDLGTGNNNKINWSMADVQEFID  156

Query  368  IVETVYRGARKGRGLVIAPKDYSTKYRY  451
            IVETV+RGARKGRGLVI+PKDYSTKYRY
Sbjct  157  IVETVFRGARKGRGLVISPKDYSTKYRY  184



>ref|XP_009012816.1| hypothetical protein HELRODRAFT_74374 [Helobdella robusta]
 gb|ESO08794.1| hypothetical protein HELRODRAFT_74374 [Helobdella robusta]
Length=142

 Score =   254 bits (649),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 114/142 (80%), Positives = 131/142 (92%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSY+L HL +GW VDQAIL+EE+R+VIIRFGHDWD TCM MDE L +VAE +KNFA +YL
Sbjct  1    MSYMLQHLKNGWQVDQAILSEEDRVVIIRFGHDWDPTCMVMDETLYNVAERVKNFATIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDITEVPDFN MYELYDP TVMFF+RNKHIMIDLGTGNNNKINWA++D+QEFIDI+ET++
Sbjct  61   VDITEVPDFNKMYELYDPCTVMFFYRNKHIMIDLGTGNNNKINWAMEDQQEFIDIIETIF  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLV++PKDYSTKYRY
Sbjct  121  RGARKGRGLVVSPKDYSTKYRY  142



>ref|XP_002107985.1| conserved hypothetical protein [Trichoplax adhaerens]
 gb|EDV28783.1| conserved hypothetical protein [Trichoplax adhaerens]
Length=142

 Score =   254 bits (648),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 115/142 (81%), Positives = 128/142 (90%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSY+LPHLH+GW VDQAIL EE+R+VIIRFGHDWD TCM MDE+L  +A+ ++ FAV YL
Sbjct  1    MSYMLPHLHNGWQVDQAILGEEDRVVIIRFGHDWDPTCMHMDEILFKIADRVQKFAVTYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDIT VPDFN MYELYDP TVMFF+RNKHIMIDLGTGNNNKINW+L+D QE IDIVETVY
Sbjct  61   VDITAVPDFNKMYELYDPCTVMFFYRNKHIMIDLGTGNNNKINWSLQDPQEMIDIVETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLVI+PKDYSTKYRY
Sbjct  121  RGARKGRGLVISPKDYSTKYRY  142



>gb|EUB58699.1| Thioredoxin-like protein 4A [Echinococcus granulosus]
 emb|CDJ05462.1| mitosis protein dim1 [Echinococcus multilocularis]
 emb|CDS17695.1| mitosis protein dim1 [Echinococcus granulosus]
 emb|CDS42744.1| mitosis protein dim1 [Echinococcus multilocularis]
Length=142

 Score =   254 bits (648),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 115/142 (81%), Positives = 130/142 (92%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSY+L HL +GW VDQAIL+EE+R+VIIRFGHDWD +CM MDE L  VAE +KNFAV+YL
Sbjct  1    MSYMLAHLTNGWQVDQAILSEEDRVVIIRFGHDWDPSCMVMDETLFQVAEKIKNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDI++VPDFN MYELYDP TVMFF+RNKHIMIDLGTGNNNKINW ++DKQEFIDIVETVY
Sbjct  61   VDISQVPDFNKMYELYDPCTVMFFYRNKHIMIDLGTGNNNKINWPIEDKQEFIDIVETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLV++PKDYSTKYRY
Sbjct  121  RGARKGRGLVVSPKDYSTKYRY  142



>ref|NP_001263740.1| Protein Y54G2A.75 [Caenorhabditis elegans]
 emb|CCQ25653.1| Y54G2A.75 [Caenorhabditis elegans]
Length=142

 Score =   254 bits (648),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 113/142 (80%), Positives = 128/142 (90%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSY+LPHL +GW VDQAILAEE+R+V++RFGHDWD TCMQMDE L  +A  +KNFAV+YL
Sbjct  1    MSYMLPHLENGWQVDQAILAEEDRVVVVRFGHDWDPTCMQMDETLFKIAPKVKNFAVVYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDIT+VPDFN MYELYDP T MFFFRNKHIM+DLGTGNNNKINWA+ D QE IDI+ETVY
Sbjct  61   VDITKVPDFNKMYELYDPCTAMFFFRNKHIMVDLGTGNNNKINWAVTDGQELIDIIETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLVI+PKDYSTKY+Y
Sbjct  121  RGARKGRGLVISPKDYSTKYKY  142



>ref|XP_011337692.1| PREDICTED: thioredoxin-like protein 4A [Cerapachys biroi]
 gb|EZA55065.1| Thioredoxin-like protein 4A [Cerapachys biroi]
Length=142

 Score =   253 bits (647),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 114/142 (80%), Positives = 131/142 (92%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSY+L HL +G+ VDQAIL+EE+R+V+IRFGHDWD  CM+MDEVL ++AE +KNFAV+YL
Sbjct  1    MSYMLSHLQNGYQVDQAILSEEDRVVVIRFGHDWDPMCMKMDEVLYNIAEKVKNFAVVYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDIT+VPDFN MYELYDP TVMFFFRNKHIMIDLGTGNNNKINW L+DKQE IDI+ETVY
Sbjct  61   VDITKVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWTLEDKQEMIDIIETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLV++PKDYSTKYRY
Sbjct  121  RGARKGRGLVVSPKDYSTKYRY  142



>ref|XP_008879700.1| thioredoxin-like protein 4A [Aphanomyces invadans]
 gb|ETV91774.1| thioredoxin-like protein 4A [Aphanomyces invadans]
Length=142

 Score =   253 bits (647),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 114/142 (80%), Positives = 130/142 (92%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSY+LPHL +GWAVDQAI++E ER+V++RFGHD D  CMQMDEVL  +AE +KNFAV+Y+
Sbjct  1    MSYMLPHLCTGWAVDQAIMSEGERVVVMRFGHDHDPVCMQMDEVLCGIAEDVKNFAVVYV  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDITEVPDFNTMYELYDP TVMFF+RNKHIMIDLGTGNNNKINWA  +K+E IDI+ETVY
Sbjct  61   VDITEVPDFNTMYELYDPCTVMFFYRNKHIMIDLGTGNNNKINWAFNNKKEMIDIIETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLVI+PKDYSTKYRY
Sbjct  121  RGARKGRGLVISPKDYSTKYRY  142



>ref|XP_011054098.1| PREDICTED: thioredoxin-like protein 4A [Acromyrmex echinatior]
 ref|XP_011175577.1| PREDICTED: thioredoxin-like protein 4A [Solenopsis invicta]
 ref|XP_011263448.1| PREDICTED: thioredoxin-like protein 4A [Camponotus floridanus]
 gb|EFN63465.1| Thioredoxin-like protein 4A [Camponotus floridanus]
 gb|EFZ21438.1| hypothetical protein SINV_09484 [Solenopsis invicta]
 gb|EGI65742.1| Thioredoxin-like protein 4A [Acromyrmex echinatior]
Length=142

 Score =   253 bits (646),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 114/142 (80%), Positives = 131/142 (92%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSY+L HL +G+ VDQAIL+EE+R+V+IRFGHDWD  CM+MDEVL ++AE +KNFAV+YL
Sbjct  1    MSYMLSHLENGYQVDQAILSEEDRVVVIRFGHDWDPMCMKMDEVLYNIAEKVKNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDIT+VPDFN MYELYDP TVMFFFRNKHIMIDLGTGNNNKINW L+DKQE IDI+ETVY
Sbjct  61   VDITKVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWTLEDKQEMIDIIETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLV++PKDYSTKYRY
Sbjct  121  RGARKGRGLVVSPKDYSTKYRY  142



>ref|XP_011331718.1| PREDICTED: thioredoxin-like protein 4A [Cerapachys biroi]
 gb|EZA58637.1| Thioredoxin-like protein 4A [Cerapachys biroi]
Length=142

 Score =   253 bits (646),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 114/142 (80%), Positives = 131/142 (92%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSY+L HL +G+ VDQAIL+EE+R+V+IRFGHDWD  CM+MDEVL ++AE +KNFAV+YL
Sbjct  1    MSYMLSHLENGYQVDQAILSEEDRVVVIRFGHDWDPMCMKMDEVLYNIAEKVKNFAVVYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDIT+VPDFN MYELYDP TVMFFFRNKHIMIDLGTGNNNKINW L+DKQE IDI+ETVY
Sbjct  61   VDITKVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWTLEDKQEMIDIIETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLV++PKDYSTKYRY
Sbjct  121  RGARKGRGLVVSPKDYSTKYRY  142



>ref|XP_011136508.1| PREDICTED: thioredoxin-like protein 4A [Harpegnathos saltator]
 gb|EFN89815.1| Thioredoxin-like protein 4A [Harpegnathos saltator]
Length=142

 Score =   253 bits (645),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 114/142 (80%), Positives = 131/142 (92%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSY+L HL +G+ VDQAIL+EE+R+V+IRFGHDWD  CM+MDEVL ++AE +KNFAV+YL
Sbjct  1    MSYMLSHLENGFQVDQAILSEEDRVVVIRFGHDWDPMCMKMDEVLYNIAEKVKNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDIT+VPDFN MYELYDP TVMFFFRNKHIMIDLGTGNNNKINW L+DKQE IDI+ETVY
Sbjct  61   VDITKVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWTLEDKQEMIDIIETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLV++PKDYSTKYRY
Sbjct  121  RGARKGRGLVVSPKDYSTKYRY  142



>emb|CEF99908.1| FACT complex subunit Spt16p/Cdc68p [Ostreococcus tauri]
Length=142

 Score =   253 bits (645),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 113/142 (80%), Positives = 130/142 (92%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSYLLPHL +GWAVDQAIL+EE+R+V+IRFG D D+TCM+MDE LA  A+ +KNFA++Y+
Sbjct  1    MSYLLPHLRNGWAVDQAILSEEDRVVVIRFGSDADDTCMRMDETLAGCADKIKNFAIIYV  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDITEVPDFN MYELYDP TVMFFFRNKHI IDLGTGNNNK+NWA+ DKQEFIDIVETVY
Sbjct  61   VDITEVPDFNGMYELYDPCTVMFFFRNKHIQIDLGTGNNNKVNWAMDDKQEFIDIVETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
             GARKGRGLV++P+DYSTKYRY
Sbjct  121  TGARKGRGLVVSPRDYSTKYRY  142



>gb|KDQ20851.1| hypothetical protein BOTBODRAFT_26872 [Botryobasidium botryosum 
FD-172 SS1]
Length=142

 Score =   253 bits (645),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 114/142 (80%), Positives = 128/142 (90%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSY LPHL SGW VDQAIL+EE+R+V+IRFGHDWD  CM+MDE L  VAE ++NFAV+YL
Sbjct  1    MSYFLPHLPSGWHVDQAILSEEDRVVVIRFGHDWDTQCMKMDETLYGVAEKVQNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDIT+VPDFN MYELYDP TVMFF+RNKHIMIDLGTGNNNKINWA+ DKQE IDIVETVY
Sbjct  61   VDITQVPDFNKMYELYDPCTVMFFYRNKHIMIDLGTGNNNKINWAMDDKQEMIDIVETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGA KGRGLV++PKDYST+YRY
Sbjct  121  RGASKGRGLVVSPKDYSTRYRY  142



>ref|XP_011454625.1| PREDICTED: thioredoxin-like protein 4A [Crassostrea gigas]
Length=142

 Score =   252 bits (644),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 114/142 (80%), Positives = 128/142 (90%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSY+L HLH+GW VDQAILAEE+R+V+IRFGHDWD +CM MDE L   AE +KNFAV+YL
Sbjct  1    MSYMLQHLHNGWQVDQAILAEEDRVVVIRFGHDWDPSCMVMDETLYKCAEKMKNFAVVYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VD +EVPDFN MYELYDP TVMFF+RNKHIMIDLGTGNNNKINW++ D QEFIDIVETV+
Sbjct  61   VDTSEVPDFNKMYELYDPCTVMFFYRNKHIMIDLGTGNNNKINWSMADVQEFIDIVETVF  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLVI+PKDYSTKYRY
Sbjct  121  RGARKGRGLVISPKDYSTKYRY  142



>ref|XP_002768301.1| mitosis protein dim1, putative [Perkinsus marinus ATCC 50983]
 ref|XP_002783572.1| mitosis protein dim1, putative [Perkinsus marinus ATCC 50983]
 gb|EER01019.1| mitosis protein dim1, putative [Perkinsus marinus ATCC 50983]
 gb|EER15368.1| mitosis protein dim1, putative [Perkinsus marinus ATCC 50983]
Length=142

 Score =   252 bits (644),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 113/142 (80%), Positives = 128/142 (90%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            M+Y+LPHLHSGWAVDQAIL EEERLV IRFGHD+D  CMQMDEVL + AE +KNFA +YL
Sbjct  1    MAYMLPHLHSGWAVDQAILGEEERLVCIRFGHDYDPQCMQMDEVLYNCAEDVKNFAAIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VD  EVPDFNTMYELYDP TVMFF+RNKH+MIDLGTGNNNKINW + +KQEFIDI+E +Y
Sbjct  61   VDTREVPDFNTMYELYDPVTVMFFYRNKHMMIDLGTGNNNKINWPMNNKQEFIDILEVIY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLV++PKDYSTKY+Y
Sbjct  121  RGARKGRGLVVSPKDYSTKYKY  142



>ref|XP_007458363.1| PREDICTED: thioredoxin-like protein 4A-like [Lipotes vexillifer]
Length=141

 Score =   252 bits (644),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 115/142 (81%), Positives = 132/142 (93%), Gaps = 1/142 (1%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSY+LPHLH+GW VDQAIL+EE+R+V+IR GHDWD TCM+MDEVL S+A  +KNFAV+YL
Sbjct  1    MSYILPHLHNGWQVDQAILSEEDRVVVIRLGHDWDPTCMKMDEVLYSIAVKVKNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDITEVPDFN MYELYDP TVMFFFRNKHI+I+LGTG NNKINWA++DKQE IDI+ETVY
Sbjct  61   VDITEVPDFNKMYELYDPCTVMFFFRNKHIVIELGTG-NNKINWAMEDKQEMIDIIETVY  119

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLV++PKDYSTKYRY
Sbjct  120  RGARKGRGLVVSPKDYSTKYRY  141



>ref|XP_008620792.1| thioredoxin-like protein 4A [Saprolegnia diclina VS20]
 gb|EQC25767.1| thioredoxin-like protein 4A [Saprolegnia diclina VS20]
 gb|KDO18886.1| thioredoxin-like protein 4A [Saprolegnia parasitica CBS 223.65]
Length=142

 Score =   251 bits (642),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 113/142 (80%), Positives = 129/142 (91%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSY+LPHL SGWAVDQAI+ E +R+V++RFGHD D  CMQMD+VLA +AE +KNFA++Y+
Sbjct  1    MSYMLPHLCSGWAVDQAIMTEGDRVVVMRFGHDHDPVCMQMDQVLAGIAEDVKNFAIIYV  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDITEVPDFNTMYELYDP TVMFF+RNKHIMIDLGTGNNNKINWA  +K E IDI+ETVY
Sbjct  61   VDITEVPDFNTMYELYDPCTVMFFYRNKHIMIDLGTGNNNKINWAFNNKGEMIDIIETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLVI+PKDYSTKYRY
Sbjct  121  RGARKGRGLVISPKDYSTKYRY  142



>gb|KJA14370.1| hypothetical protein HYPSUDRAFT_446751 [Hypholoma sublateritium 
FD-334 SS-4]
Length=142

 Score =   251 bits (642),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 114/142 (80%), Positives = 128/142 (90%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSY LPHL SGW VD+AI +EE+R+V+IRFGHDWD  CM MDE L SVAE ++NFAV+YL
Sbjct  1    MSYFLPHLPSGWHVDEAIKSEEDRVVVIRFGHDWDSQCMTMDETLYSVAEKVQNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDITEVPDFN MYELYDP TVMFF+RNKHIMIDLGTGNNNKINWA+ +KQEFIDIVETVY
Sbjct  61   VDITEVPDFNKMYELYDPCTVMFFYRNKHIMIDLGTGNNNKINWAMDNKQEFIDIVETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGA KGRGLV++PKDYST+YRY
Sbjct  121  RGASKGRGLVVSPKDYSTRYRY  142



>ref|XP_009840033.1| thioredoxin-like protein 4A [Aphanomyces astaci]
 gb|ETV70321.1| thioredoxin-like protein 4A [Aphanomyces astaci]
Length=142

 Score =   251 bits (642),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 113/142 (80%), Positives = 129/142 (91%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSY+LPHL +GW+VDQAI+ E +R+V++RFGHD D  CMQMDEVL  VAE +KNFAV+Y+
Sbjct  1    MSYMLPHLCTGWSVDQAIMTEGDRVVVMRFGHDHDPVCMQMDEVLCGVAEDVKNFAVIYV  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDITEVPDFNTMYELYDP TVMFF+RNKHIMIDLGTGNNNKINWA  +K+E IDI+ETVY
Sbjct  61   VDITEVPDFNTMYELYDPCTVMFFYRNKHIMIDLGTGNNNKINWAFNNKKEMIDIIETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLVI+PKDYSTKYRY
Sbjct  121  RGARKGRGLVISPKDYSTKYRY  142



>ref|XP_004225834.1| PREDICTED: thioredoxin-like protein 4A [Ciona intestinalis]
Length=142

 Score =   251 bits (641),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 112/142 (79%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSY+LPHL +GW VDQAIL E+ER+V+IRFGHDWD  CM MDE L S+A+ +KNFAV YL
Sbjct  1    MSYMLPHLTNGWQVDQAILNEQERVVVIRFGHDWDPACMTMDETLYSIADKVKNFAVTYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDITEVPDFN MYELYDP T MFF+RNKHIMIDLGTGNNNKINW ++DKQE IDI+ET+Y
Sbjct  61   VDITEVPDFNKMYELYDPCTTMFFYRNKHIMIDLGTGNNNKINWPMEDKQEMIDILETIY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLV++PKDYSTKYRY
Sbjct  121  RGARKGRGLVVSPKDYSTKYRY  142



>gb|AAW24918.1| SJCHGC05540 protein [Schistosoma japonicum]
 emb|CAX82548.1| hypotheticial protein [Schistosoma japonicum]
 emb|CAX82663.1| hypotheticial protein [Schistosoma japonicum]
 emb|CAX82960.1| hypotheticial protein [Schistosoma japonicum]
Length=142

 Score =   251 bits (641),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 114/142 (80%), Positives = 128/142 (90%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSY+L HL +GW VDQAIL+EE+R+V+IRFGHDWD +CM MDE L  +AE +KNFAV YL
Sbjct  1    MSYMLSHLTNGWQVDQAILSEEDRVVVIRFGHDWDPSCMVMDETLFKIAERVKNFAVTYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDITEVPDFN MYELYDP TVMFF+RNKHIMIDLGTGNNNKINW ++D QEFIDIVETVY
Sbjct  61   VDITEVPDFNKMYELYDPCTVMFFYRNKHIMIDLGTGNNNKINWPIEDAQEFIDIVETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLV++PKDYSTKYRY
Sbjct  121  RGARKGRGLVVSPKDYSTKYRY  142



>gb|EIE88112.1| thioredoxin-like protein 4A [Rhizopus delemar RA 99-880]
Length=141

 Score =   251 bits (640),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 113/140 (81%), Positives = 127/140 (91%), Gaps = 0/140 (0%)
 Frame = +2

Query  32   YLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYLVD  211
            Y LPHL +GW VDQAIL+EE+R+V+IRFGHDWD TCMQMDE+L S+AE +KNFAV+YLVD
Sbjct  2    YFLPHLTNGWQVDQAILSEEDRVVVIRFGHDWDPTCMQMDEILYSIAEKVKNFAVIYLVD  61

Query  212  ITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVYRG  391
            ITEVPDFN MYELYDP T MFFFRNKHIMIDLGTGNNNKINWAL DKQE ID++E VYRG
Sbjct  62   ITEVPDFNKMYELYDPCTTMFFFRNKHIMIDLGTGNNNKINWALDDKQEMIDLIEIVYRG  121

Query  392  ARKGRGLVIAPKDYSTKYRY  451
            ARKGRGLV++ KDYSTKY+Y
Sbjct  122  ARKGRGLVVSLKDYSTKYKY  141



>emb|CEL57191.1| Thioredoxin-like protein 4A OS=Mus musculus GN=Txnl4a PE=2 SV=1 
[Rhizoctonia solani AG-1 IB]
Length=142

 Score =   251 bits (640),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 111/142 (78%), Positives = 129/142 (91%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSY LPHL SGW VDQAIL+E++R+V++RFGHDWD +CM+MDE L  VAE ++NFAV+YL
Sbjct  1    MSYFLPHLPSGWHVDQAILSEDDRVVVLRFGHDWDSSCMKMDETLYGVAEKVQNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDIT+VPDFN MYELYDP TVMFF+RNKHIMIDLGTGNNNKINWA+ DKQE IDI+ETVY
Sbjct  61   VDITQVPDFNKMYELYDPCTVMFFYRNKHIMIDLGTGNNNKINWAMDDKQEMIDIIETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGA KGRGLV++PKDYST+YRY
Sbjct  121  RGASKGRGLVVSPKDYSTRYRY  142



>emb|CBY18596.1| unnamed protein product [Oikopleura dioica]
Length=142

 Score =   251 bits (640),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 111/142 (78%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSY+LPHL +GW VDQAI  EE+++V +RFGHDWD TCM+MDE L SVAE  +NFA  YL
Sbjct  1    MSYMLPHLTNGWQVDQAIQHEEDKVVCVRFGHDWDPTCMKMDETLYSVAEKCRNFACFYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDI++VPDFN MYELYDP T MFFFRNKHIMIDLGTGNNNKINWA+ DKQEF+DIVETVY
Sbjct  61   VDISQVPDFNKMYELYDPCTCMFFFRNKHIMIDLGTGNNNKINWAIPDKQEFVDIVETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLV++PKDYSTKY+Y
Sbjct  121  RGARKGRGLVVSPKDYSTKYQY  142



>ref|XP_005509862.1| PREDICTED: LOW QUALITY PROTEIN: thioredoxin-like protein 4A [Columba 
livia]
Length=139

 Score =   250 bits (639),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 115/142 (81%), Positives = 129/142 (91%), Gaps = 3/142 (2%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSY+LPHLH+GW   Q    EE+R+V+IRFGHDWD TCM+MDEVL S+AE +KNFAV+YL
Sbjct  1    MSYMLPHLHNGW---QGDXREEDRVVVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYL  57

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDITEVPDFN MYELYDP TVMFFFRNKHIMIDLGTGNNNKINWA++DKQE IDI+ETVY
Sbjct  58   VDITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWAMEDKQEMIDIIETVY  117

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLV++PKDYSTKYRY
Sbjct  118  RGARKGRGLVVSPKDYSTKYRY  139



>gb|ADP02972.1| thioredoxin-like protein [Aplysia dactylomela]
Length=142

 Score =   250 bits (639),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 112/142 (79%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSY+L HLH+GW VDQAIL+EE+R+V++RFGHDWD TCM MDE L   A+ +KNFAV +L
Sbjct  1    MSYMLQHLHNGWQVDQAILSEEDRVVVVRFGHDWDPTCMVMDETLYKCADKMKNFAVCFL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDITEVPDFN MYELYDP T MFF+RNKHIMIDLGTGNNNKINWA++D QEFIDIVETVY
Sbjct  61   VDITEVPDFNKMYELYDPCTCMFFYRNKHIMIDLGTGNNNKINWAMEDVQEFIDIVETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLV++PKDYS KYRY
Sbjct  121  RGARKGRGLVVSPKDYSPKYRY  142



>emb|CDS14378.1| Putative Thioredoxin-like protein 4A [Absidia idahoensis var. 
thermophila]
Length=142

 Score =   250 bits (639),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 112/142 (79%), Positives = 128/142 (90%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSY LPHL +GW VDQAIL+EE+R+V+IRFGHDWD TCM+MDE+L S+AE +KNFAV+YL
Sbjct  1    MSYFLPHLTNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEILYSIAEKVKNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDITEVPDFN MYELYDP T MFFFRNKHIM+DLGTGNNNKINWAL DK E ID++E VY
Sbjct  61   VDITEVPDFNKMYELYDPCTTMFFFRNKHIMVDLGTGNNNKINWALDDKNEMIDLIEIVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLV++ KDYSTKY+Y
Sbjct  121  RGARKGRGLVVSLKDYSTKYKY  142



>emb|CDJ93524.1| mRNA splicing factor domain containing protein [Haemonchus contortus]
 emb|CDJ85828.1| mRNA splicing factor domain containing protein [Haemonchus contortus]
 gb|ETN80803.1| mitosis protein DIM1 [Necator americanus]
 gb|EYB94982.1| hypothetical protein Y032_0165g44 [Ancylostoma ceylanicum]
Length=142

 Score =   250 bits (639),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 110/142 (77%), Positives = 128/142 (90%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSY+LPHL +GW VDQAILAEE+R+V++RFGHDWD TCM+MDE L  +A  +KNF+V+YL
Sbjct  1    MSYMLPHLENGWQVDQAILAEEDRVVVVRFGHDWDPTCMRMDETLFKIAPKVKNFSVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDIT+VPDFN MYELYDP TVMFFFRNKHIM+DLGTGNNNKINW + D QE IDI+ETVY
Sbjct  61   VDITKVPDFNKMYELYDPCTVMFFFRNKHIMVDLGTGNNNKINWPITDGQELIDIIETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLV++PKDYSTKY+Y
Sbjct  121  RGARKGRGLVVSPKDYSTKYKY  142



>ref|XP_627261.1| mitosis protein DIM1 [Cryptosporidium parvum Iowa II]
 gb|EAK89526.1| mitosis protein DIM1 [Cryptosporidium parvum Iowa II]
Length=142

 Score =   250 bits (638),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 112/142 (79%), Positives = 129/142 (91%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSY+L HLH+GW+VDQAIL+EEER+V IRFGHD+D  CM MDEVL  VAE +KNF V+YL
Sbjct  1    MSYMLQHLHNGWSVDQAILSEEERIVCIRFGHDYDADCMLMDEVLYKVAEDVKNFCVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDITEVPDFNTMYELYDP +VMFFFRNKHIM+DLGTGNNNKINW L +KQEFIDIVET+Y
Sbjct  61   VDITEVPDFNTMYELYDPVSVMFFFRNKHIMVDLGTGNNNKINWPLNNKQEFIDIVETIY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RG +KG+GLV++PKDYSTKY+Y
Sbjct  121  RGVQKGKGLVVSPKDYSTKYKY  142



>gb|KIM19828.1| hypothetical protein M408DRAFT_334247 [Serendipita vermifera 
MAFF 305830]
Length=142

 Score =   250 bits (638),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 112/142 (79%), Positives = 128/142 (90%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSY LPHL SGW VDQAIL+EE+R+V+IRFGHD+D  CM+MDE L  V+E ++NFAV+YL
Sbjct  1    MSYFLPHLPSGWHVDQAILSEEDRVVVIRFGHDYDSQCMKMDETLNGVSEKVQNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDITEVPDFN MYELYDP TVMFF+RNKHIMIDLGTGNNNKINWA+ DKQE IDI+ETVY
Sbjct  61   VDITEVPDFNKMYELYDPCTVMFFYRNKHIMIDLGTGNNNKINWAMDDKQELIDIIETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGA KGRGLV++PKDYST+YRY
Sbjct  121  RGASKGRGLVVSPKDYSTRYRY  142



>ref|XP_001898146.1| Chain A, Human Spliceosomal Protein U5-15kd. [Brugia malayi]
 ref|XP_003138583.1| thioredoxin-like protein 4A [Loa loa]
 gb|EFO25485.1| thioredoxin-like protein 4A [Loa loa]
Length=142

 Score =   249 bits (637),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 111/142 (78%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSY+LPHL +GW VDQAILAEE+R+V+IRFGHDWD +CM+MDE L  +A  +KNFAV+YL
Sbjct  1    MSYMLPHLSNGWQVDQAILAEEDRVVLIRFGHDWDPSCMRMDETLYKIANKVKNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VD TEVPDFN MYELYDP TVMFFFRNKHIM+DLGTGNNNKINW + D QE IDI+ETVY
Sbjct  61   VDTTEVPDFNKMYELYDPCTVMFFFRNKHIMVDLGTGNNNKINWPITDGQELIDILETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLV++PKDYSTKY+Y
Sbjct  121  RGARKGRGLVVSPKDYSTKYKY  142



>ref|XP_009046396.1| hypothetical protein LOTGIDRAFT_185700 [Lottia gigantea]
 gb|ESP02926.1| hypothetical protein LOTGIDRAFT_185700 [Lottia gigantea]
Length=142

 Score =   249 bits (637),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 113/142 (80%), Positives = 125/142 (88%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSY+L HLH+GW VDQAIL+EE+R VIIRFGHDWD  CM MDE L   AE +KNFAV YL
Sbjct  1    MSYMLQHLHNGWQVDQAILSEEDRAVIIRFGHDWDPACMVMDETLYRCAEKMKNFAVTYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDI++VPDFN MYELYDP T MFF+RNKHIMIDLGTGNNNKINW ++D QEFIDIVETVY
Sbjct  61   VDISKVPDFNKMYELYDPCTTMFFYRNKHIMIDLGTGNNNKINWPMEDSQEFIDIVETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLV++PKDYSTKYRY
Sbjct  121  RGARKGRGLVVSPKDYSTKYRY  142



>gb|ACO13026.1| Thioredoxin-like protein 4A [Lepeophtheirus salmonis]
 gb|ADD24092.1| Thioredoxin-like protein 4A [Lepeophtheirus salmonis]
 gb|ADD24365.1| Thioredoxin-like protein 4A [Lepeophtheirus salmonis]
Length=142

 Score =   249 bits (637),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 110/142 (77%), Positives = 128/142 (90%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSY++ HL +GW VDQAIL+EE+R++ IRFGHDWD TCM+MDE L  +AE +KNF V+YL
Sbjct  1    MSYMISHLENGWQVDQAILSEEDRVICIRFGHDWDPTCMKMDETLFGIAERVKNFCVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDIT+VPDFN MYELYDP TVM+FFRNKHIMIDLGTGNNNKINW ++DKQE IDI+ETVY
Sbjct  61   VDITQVPDFNKMYELYDPCTVMYFFRNKHIMIDLGTGNNNKINWPMEDKQEMIDIIETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLV++PKDYSTKYRY
Sbjct  121  RGARKGRGLVVSPKDYSTKYRY  142



>emb|CCD78396.1| putative mitosis protein dim1 [Schistosoma mansoni]
 gb|KGB38435.1| Thioredoxin-like protein 4A, partial [Schistosoma haematobium]
Length=142

 Score =   249 bits (636),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 113/142 (80%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSY+L HL +GW VDQAIL+EE+R+VIIRFGHDWD +CM MDE L  +AE +KNFA+ YL
Sbjct  1    MSYMLSHLTNGWQVDQAILSEEDRVVIIRFGHDWDPSCMVMDETLFKIAERVKNFAITYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDIT+VPDFN MYELYDP TVMFF+RNKHIMIDLGTGNNNKINW + D QEFIDIVETVY
Sbjct  61   VDITQVPDFNKMYELYDPCTVMFFYRNKHIMIDLGTGNNNKINWPIADGQEFIDIVETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLV++PKDYSTKYRY
Sbjct  121  RGARKGRGLVVSPKDYSTKYRY  142



>gb|KJA16773.1| hypothetical protein HYPSUDRAFT_47042 [Hypholoma sublateritium 
FD-334 SS-4]
Length=142

 Score =   249 bits (636),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 113/142 (80%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSY LPHL SGW VD+AI +EE+R+V+IRFGHDWD  CM MDE L SVAE ++NFAV+YL
Sbjct  1    MSYFLPHLPSGWHVDEAIKSEEDRVVVIRFGHDWDSQCMTMDETLYSVAEKVQNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDITEVPDFN MYELYDP TVMFF+RNKHIMIDLGTGNNNKINWA+ +KQE IDIVETVY
Sbjct  61   VDITEVPDFNKMYELYDPCTVMFFYRNKHIMIDLGTGNNNKINWAMDNKQELIDIVETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGA KGRGLV++PKDYST+YRY
Sbjct  121  RGASKGRGLVVSPKDYSTRYRY  142



>ref|XP_798053.1| PREDICTED: thioredoxin-like protein 4A-like [Strongylocentrotus 
purpuratus]
 ref|XP_801799.1| PREDICTED: thioredoxin-like protein 4A-like isoform 2 [Strongylocentrotus 
purpuratus]
Length=142

 Score =   249 bits (636),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 111/142 (78%), Positives = 128/142 (90%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSY+L HLH+GW VDQAIL EE+R+V+IRFGHDWD TCM+MDE L  + + +KN+AV+YL
Sbjct  1    MSYMLSHLHNGWQVDQAILGEEDRVVVIRFGHDWDPTCMKMDETLYRICDKVKNYAVVYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDITEVPDFN MYELYDP T+M+FFRNKHIMIDLGTGNNNKINW + D+QE IDIVETVY
Sbjct  61   VDITEVPDFNKMYELYDPCTMMYFFRNKHIMIDLGTGNNNKINWPIDDEQEVIDIVETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLV++PKDYSTKYRY
Sbjct  121  RGARKGRGLVVSPKDYSTKYRY  142



>ref|XP_006455351.1| hypothetical protein AGABI2DRAFT_226816 [Agaricus bisporus var. 
bisporus H97]
 ref|XP_007331147.1| hypothetical protein AGABI1DRAFT_114762 [Agaricus bisporus var. 
burnettii JB137-S8]
 gb|EKM78518.1| hypothetical protein AGABI1DRAFT_114762 [Agaricus bisporus var. 
burnettii JB137-S8]
 gb|EKV44088.1| hypothetical protein AGABI2DRAFT_226816 [Agaricus bisporus var. 
bisporus H97]
Length=142

 Score =   249 bits (636),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 112/142 (79%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSY LPHL SGW VD+AI +EE+R+V+IRFGHDWD  CM MDE L SVAE ++NFAV+YL
Sbjct  1    MSYFLPHLPSGWHVDEAIKSEEDRIVVIRFGHDWDSQCMTMDETLYSVAEKVQNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDITEVPDFN MYELYDP TVMFF+RNKHIMIDLGTGNNNKINWA+ +KQE IDI+ETVY
Sbjct  61   VDITEVPDFNKMYELYDPCTVMFFYRNKHIMIDLGTGNNNKINWAMDNKQELIDIIETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGA KGRGLV++PKDYST+YRY
Sbjct  121  RGASKGRGLVVSPKDYSTRYRY  142



>ref|XP_002591053.1| hypothetical protein BRAFLDRAFT_119072 [Branchiostoma floridae]
 gb|EEN47064.1| hypothetical protein BRAFLDRAFT_119072 [Branchiostoma floridae]
Length=142

 Score =   249 bits (636),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 110/142 (77%), Positives = 130/142 (92%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSY+LPHL +GW VDQAIL+EE+R+V+IRFGHDWD T M+MDE L S+A+ +KNFAV+YL
Sbjct  1    MSYMLPHLTNGWQVDQAILSEEDRVVVIRFGHDWDPTSMKMDETLYSIADKIKNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDI+E+PDF  MYELYDP TVMFF+RNKHIMIDLGTGNNNKINWA++DKQE +DI+E VY
Sbjct  61   VDISEIPDFCKMYELYDPCTVMFFYRNKHIMIDLGTGNNNKINWAIEDKQEMVDIIEVVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLV++PKDYSTKYRY
Sbjct  121  RGARKGRGLVVSPKDYSTKYRY  142



>ref|XP_004998165.1| mitosis protein dim1 [Salpingoeca rosetta]
 gb|EGD75990.1| mitosis protein dim1 [Salpingoeca rosetta]
Length=142

 Score =   249 bits (636),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 112/142 (79%), Positives = 128/142 (90%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSY+L HL +GW VDQAI+AEE+R+VIIRFGHDWD  CM+ DE L  ++E +KNFAV+YL
Sbjct  1    MSYMLTHLKNGWQVDQAIMAEEDRVVIIRFGHDWDPDCMKTDECLFKISEKVKNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDIT+VPDFN+MYELYDP T+MFFFRNKHIMIDLGTGNNNKINWA  D+QE IDIVETVY
Sbjct  61   VDITKVPDFNSMYELYDPCTLMFFFRNKHIMIDLGTGNNNKINWAFTDEQELIDIVETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLV++PKDYSTKYRY
Sbjct  121  RGARKGRGLVVSPKDYSTKYRY  142



>ref|XP_002365691.1| mitosis protein, putative [Toxoplasma gondii ME49]
 gb|EPR64732.1| putative splicing factor DIM1 [Toxoplasma gondii GT1]
 gb|EPT28394.1| splicing factor DIM1, putative [Toxoplasma gondii ME49]
 gb|ESS36279.1| putative splicing factor DIM1 [Toxoplasma gondii VEG]
 gb|KFH05986.1| TXNL4A/DIM1 [Toxoplasma gondii VAND]
Length=142

 Score =   249 bits (636),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 114/142 (80%), Positives = 125/142 (88%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSY+L HLHSGW VDQAIL EEERLV IRFGHD+D  CM+MDE L  VAE +KNF V+YL
Sbjct  1    MSYMLQHLHSGWQVDQAILTEEERLVCIRFGHDYDPECMKMDEQLYKVAEDVKNFCVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VD TEVPDF TMYELYDP TVMFF+RNKH+MIDLGTGNNNKINWAL +KQE IDI+E +Y
Sbjct  61   VDTTEVPDFTTMYELYDPVTVMFFYRNKHMMIDLGTGNNNKINWALNNKQELIDIIECIY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLVI+PKDYSTKYRY
Sbjct  121  RGARKGRGLVISPKDYSTKYRY  142



>ref|XP_002472973.1| predicted protein [Postia placenta Mad-698-R]
 ref|XP_007320543.1| hypothetical protein SERLADRAFT_472259 [Serpula lacrymans var. 
lacrymans S7.9]
 gb|EED81850.1| predicted protein [Postia placenta Mad-698-R]
 gb|EGN97712.1| hypothetical protein SERLA73DRAFT_161637 [Serpula lacrymans var. 
lacrymans S7.3]
 gb|EGO23303.1| hypothetical protein SERLADRAFT_472259 [Serpula lacrymans var. 
lacrymans S7.9]
 gb|KDR71615.1| hypothetical protein GALMADRAFT_127111 [Galerina marginata CBS 
339.88]
 gb|KDR71617.1| hypothetical protein GALMADRAFT_794020 [Galerina marginata CBS 
339.88]
Length=142

 Score =   249 bits (635),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 112/142 (79%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSY LPHL SGW VD+AI +EE+R+V+IRFGHDWD  CM MDE L SVAE ++NFAV+YL
Sbjct  1    MSYFLPHLPSGWHVDEAIKSEEDRVVVIRFGHDWDSQCMTMDETLYSVAEKVQNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDITEVPDFN MYELYDP TVMFF+RNKHIMIDLGTGNNNKINWA+ +KQE IDI+ETVY
Sbjct  61   VDITEVPDFNKMYELYDPCTVMFFYRNKHIMIDLGTGNNNKINWAMDNKQELIDIIETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGA KGRGLV++PKDYST+YRY
Sbjct  121  RGASKGRGLVVSPKDYSTRYRY  142



>gb|ETW17434.1| thioredoxin-like protein 4A [Plasmodium falciparum Vietnam Oak-Knoll 
(FVO)]
 gb|ETW29035.1| thioredoxin-like protein 4A [Plasmodium falciparum FCH/4]
 gb|ETW35369.1| thioredoxin-like protein 4A [Plasmodium falciparum Tanzania (2000708)]
 gb|ETW41486.1| thioredoxin-like protein 4A [Plasmodium falciparum NF135/5.C10]
 gb|ETW48163.1| thioredoxin-like protein 4A [Plasmodium falciparum MaliPS096_E11]
 gb|ETW56005.1| thioredoxin-like protein 4A [Plasmodium falciparum Palo Alto/Uganda]
 gb|ETW60127.1| thioredoxin-like protein 4A [Plasmodium falciparum CAMP/Malaysia]
 gb|EUR68054.1| thioredoxin-like protein 4A [Plasmodium falciparum 7G8]
 gb|EUT82600.1| thioredoxin-like protein 4A [Plasmodium falciparum Santa Lucia]
 gb|EWC75297.1| thioredoxin-like protein 4A [Plasmodium falciparum UGT5.1]
 gb|EWC89195.1| thioredoxin-like protein 4A [Plasmodium falciparum NF54]
Length=142

 Score =   249 bits (635),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 113/142 (80%), Positives = 129/142 (91%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSY+L HLHSGW VDQAIL+EEERLV IRFGHD+D  CM+MDE+L  V E +KNF V+YL
Sbjct  1    MSYMLYHLHSGWDVDQAILSEEERLVCIRFGHDYDPDCMKMDELLFKVVEDIKNFCVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDITEVPDFNTMYELYDP +VMFF+RNKH+MIDLGTGNNNKINW + +KQEFIDIVET++
Sbjct  61   VDITEVPDFNTMYELYDPVSVMFFYRNKHMMIDLGTGNNNKINWPMNNKQEFIDIVETIF  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLVI+PKDYSTKY+Y
Sbjct  121  RGARKGRGLVISPKDYSTKYKY  142



>ref|XP_003883900.1| hypothetical protein NCLIV_036500 [Neospora caninum Liverpool]
 emb|CBZ53868.1| hypothetical protein NCLIV_036500 [Neospora caninum Liverpool]
Length=142

 Score =   249 bits (635),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 114/142 (80%), Positives = 125/142 (88%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSY+L HLHSGW VDQAIL EEERLV IRFGHD+D  CM+MDE L  VAE +KNF V+YL
Sbjct  1    MSYMLQHLHSGWQVDQAILTEEERLVCIRFGHDYDPECMKMDEQLFKVAEDVKNFCVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VD TEVPDF TMYELYDP TVMFF+RNKH+MIDLGTGNNNKINWAL +KQE IDI+E +Y
Sbjct  61   VDTTEVPDFTTMYELYDPVTVMFFYRNKHMMIDLGTGNNNKINWALNNKQELIDIIECIY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLVI+PKDYSTKYRY
Sbjct  121  RGARKGRGLVISPKDYSTKYRY  142



>ref|XP_008882390.1| splicing factor DIM1, putative [Hammondia hammondi]
 gb|KEP66767.1| splicing factor DIM1, putative [Hammondia hammondi]
Length=142

 Score =   249 bits (635),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 114/142 (80%), Positives = 125/142 (88%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSY+L HLHSGW VDQAIL EEERLV IRFGHD+D  CM+MDE L  VAE +KNF V+YL
Sbjct  1    MSYMLQHLHSGWQVDQAILTEEERLVCIRFGHDYDPECMRMDEQLYKVAEDVKNFCVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VD TEVPDF TMYELYDP TVMFF+RNKH+MIDLGTGNNNKINWAL +KQE IDI+E +Y
Sbjct  61   VDTTEVPDFTTMYELYDPVTVMFFYRNKHMMIDLGTGNNNKINWALNNKQELIDIIECIY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLVI+PKDYSTKYRY
Sbjct  121  RGARKGRGLVISPKDYSTKYRY  142



>ref|XP_009689428.1| Dim1 protein [Theileria orientalis strain Shintoku]
 dbj|BAM39127.1| Dim1 protein [Theileria orientalis strain Shintoku]
Length=142

 Score =   249 bits (635),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 111/142 (78%), Positives = 129/142 (91%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSY+L HLHSGWAVDQAI+ EEER+V IRFGHD+D  C++MDE+L  +AE +KNF V+YL
Sbjct  1    MSYMLQHLHSGWAVDQAIVTEEERIVCIRFGHDYDPECIKMDELLYKIAEDVKNFCVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDITEVPDFN MYELYDP +VMFF+RNKH+M+DLGTGNNNKINWA+ DKQE IDI+ETV+
Sbjct  61   VDITEVPDFNGMYELYDPVSVMFFYRNKHMMVDLGTGNNNKINWAMNDKQELIDIIETVF  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLVI+PKDYSTKYRY
Sbjct  121  RGARKGRGLVISPKDYSTKYRY  142



>ref|XP_007511883.1| predicted protein [Bathycoccus prasinos]
 emb|CCO65971.1| predicted protein [Bathycoccus prasinos]
Length=142

 Score =   249 bits (635),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 113/142 (80%), Positives = 128/142 (90%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSYLLPHLH+GW VDQAIL+EE+R+VI+RFG D DETCM+ DE+L++VAE +KNFAV YL
Sbjct  1    MSYLLPHLHTGWHVDQAILSEEDRVVILRFGRDGDETCMRQDEILSNVAEKIKNFAVAYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDI EVPDFN MYELYDP T MFFFRNKHIMIDLGTGNNNKINWA+  KQEFIDIVE V+
Sbjct  61   VDIDEVPDFNEMYELYDPCTCMFFFRNKHIMIDLGTGNNNKINWAMDSKQEFIDIVECVF  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
             GAR+G+GLVI+PKDYSTKYRY
Sbjct  121  SGARRGKGLVISPKDYSTKYRY  142



>ref|XP_003325301.2| hypothetical protein PGTG_07134 [Puccinia graminis f. sp. tritici 
CRL 75-36-700-3]
 ref|XP_003338867.2| hypothetical protein PGTG_20404 [Puccinia graminis f. sp. tritici 
CRL 75-36-700-3]
 gb|EFP80882.2| hypothetical protein PGTG_07134 [Puccinia graminis f. sp. tritici 
CRL 75-36-700-3]
 gb|EFP94448.2| hypothetical protein PGTG_20404 [Puccinia graminis f. sp. tritici 
CRL 75-36-700-3]
Length=199

 Score =   251 bits (640),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 112/142 (79%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSY LPHL SGW VDQAILAEE R+VIIRFGHDWD  CM+MDE L  ++E +KNFAV+YL
Sbjct  1    MSYFLPHLPSGWHVDQAILAEENRVVIIRFGHDWDSECMRMDETLYGISEKVKNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDIT+VPDF  MYELYDP TVMFF+RNKHIMIDLGTGNNNKINWA+ DKQE IDIVET+Y
Sbjct  61   VDITKVPDFTKMYELYDPCTVMFFYRNKHIMIDLGTGNNNKINWAMDDKQELIDIVETIY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGA KGRGLV++PKDYST+Y+Y
Sbjct  121  RGASKGRGLVVSPKDYSTRYKY  142



>ref|XP_001886799.1| predicted protein [Laccaria bicolor S238N-H82]
 gb|EDR02436.1| predicted protein [Laccaria bicolor S238N-H82]
Length=142

 Score =   248 bits (634),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 112/142 (79%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSY LPHL SGW VD+AI +EE+R+V+IRFGHDWD  CM MDE L SVAE ++NFAV+YL
Sbjct  1    MSYFLPHLPSGWHVDEAIKSEEDRVVVIRFGHDWDSQCMMMDETLYSVAEKVQNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDITEVPDFN MYELYDP TVMFF+RNKHIMIDLGTGNNNKINWA+ +KQE IDI+ETVY
Sbjct  61   VDITEVPDFNKMYELYDPCTVMFFYRNKHIMIDLGTGNNNKINWAMDNKQEMIDIIETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGA KGRGLV++PKDYST+YRY
Sbjct  121  RGASKGRGLVVSPKDYSTRYRY  142



>emb|CCM00553.1| predicted protein [Fibroporia radiculosa]
Length=142

 Score =   248 bits (634),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 112/142 (79%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSY LPHL SGW VD+AI +EE+R+V++RFGHDWD  CM MDE L SVAE ++NFAV+YL
Sbjct  1    MSYFLPHLPSGWHVDEAIKSEEDRVVVLRFGHDWDSQCMTMDETLYSVAEKVQNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDITEVPDFN MYELYDP TVMFF+RNKHIMIDLGTGNNNKINWA+ +KQE IDIVETVY
Sbjct  61   VDITEVPDFNKMYELYDPCTVMFFYRNKHIMIDLGTGNNNKINWAMDNKQELIDIVETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGA KGRGLV++PKDYST+YRY
Sbjct  121  RGASKGRGLVVSPKDYSTRYRY  142



>gb|KIO26978.1| hypothetical protein M407DRAFT_243526 [Tulasnella calospora MUT 
4182]
Length=142

 Score =   248 bits (634),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 110/142 (77%), Positives = 128/142 (90%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSY LPHL +GW VDQAIL+E++R+VIIRFGHDWD  CM+MDE L  V+E ++NFAV+YL
Sbjct  1    MSYFLPHLQTGWHVDQAILSEDDRVVIIRFGHDWDPQCMKMDETLYGVSEKVQNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDIT+VPDFN MYELYDP TVMFF+RNKHIMIDLGTGNNNKINWA+ +KQE IDI+ETVY
Sbjct  61   VDITQVPDFNKMYELYDPCTVMFFYRNKHIMIDLGTGNNNKINWAMDNKQELIDIIETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGA KGRGLV++PKDYST+YRY
Sbjct  121  RGASKGRGLVVSPKDYSTRYRY  142



>ref|XP_001606810.1| PREDICTED: thioredoxin-like protein 4A [Nasonia vitripennis]
Length=142

 Score =   248 bits (634),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 112/142 (79%), Positives = 128/142 (90%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSY+L HL +GW VDQAIL+EE+R+V+IRFGHDWD  CM+MDEVL S+ E +KNFAV+YL
Sbjct  1    MSYMLCHLKNGWQVDQAILSEEDRVVVIRFGHDWDPMCMKMDEVLYSIVEKVKNFAVVYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VD +EV DFN MYELYDP TVMFFFRNKHIMIDLGTGNNNKINW ++DKQE IDI+ETVY
Sbjct  61   VDTSEVSDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWIIEDKQEMIDILETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLV++PKDYSTKYRY
Sbjct  121  RGARKGRGLVVSPKDYSTKYRY  142



>gb|KFO88676.1| Thioredoxin-like 4A, partial [Buceros rhinoceros silvestris]
 gb|KFU85967.1| Thioredoxin-like 4A, partial [Chaetura pelagica]
 gb|KFW11633.1| Thioredoxin-like 4A, partial [Fulmarus glacialis]
Length=132

 Score =   248 bits (632),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 112/132 (85%), Positives = 125/132 (95%), Gaps = 0/132 (0%)
 Frame = +2

Query  56   GWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYLVDITEVPDFN  235
            GW VDQAIL+EE+R+V+IRFGHDWD TCM+MDEVL S+AE +KNFAV+YLVDITEVPDFN
Sbjct  1    GWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYLVDITEVPDFN  60

Query  236  TMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVYRGARKGRGLV  415
             MYELYDP TVMFFFRNKHIMIDLGTGNNNKINWA++DKQE IDI+ETVYRGARKGRGLV
Sbjct  61   KMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWAMEDKQEMIDIIETVYRGARKGRGLV  120

Query  416  IAPKDYSTKYRY  451
            ++PKDYSTKYRY
Sbjct  121  VSPKDYSTKYRY  132



>ref|XP_002677289.1| predicted protein [Naegleria gruberi]
 gb|EFC44545.1| predicted protein [Naegleria gruberi]
Length=142

 Score =   248 bits (633),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 107/142 (75%), Positives = 130/142 (92%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            M+YLLPHL+SGWAVDQAI+ EE+R+++IRFGHDWD TCM+MDE L+ +AE +KN  ++YL
Sbjct  1    MAYLLPHLNSGWAVDQAIVTEEDRIIVIRFGHDWDATCMEMDETLSKIAEKVKNMCIIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDIT+VPDFN MYELYD  +VMFFFRNKHIMIDLGTG+NNKINWA+ DKQE IDI+ETVY
Sbjct  61   VDITKVPDFNKMYELYDACSVMFFFRNKHIMIDLGTGDNNKINWAITDKQEMIDIIETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGA+KGRGLVI+PKDYSTK+++
Sbjct  121  RGAKKGRGLVISPKDYSTKHKF  142



>ref|XP_007365140.1| 4A/4B type thioredoxin-like protein [Dichomitus squalens LYAD-421 
SS1]
 gb|EJF61885.1| 4A/4B type thioredoxin-like protein [Dichomitus squalens LYAD-421 
SS1]
Length=142

 Score =   248 bits (633),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 111/142 (78%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSY LPHL SGW VD+AI +EE+R+V+IRFGHDWD  CM MDE L +VAE ++NFAV+YL
Sbjct  1    MSYFLPHLPSGWHVDEAIKSEEDRVVVIRFGHDWDSQCMTMDETLHAVAEKVQNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDITEVPDFN MYELYDP TVMFF+RNKHIMIDLGTGNNNKINWA+ +KQE IDI+ETVY
Sbjct  61   VDITEVPDFNKMYELYDPCTVMFFYRNKHIMIDLGTGNNNKINWAMDNKQELIDIIETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGA KGRGLV++PKDYST+YRY
Sbjct  121  RGASKGRGLVVSPKDYSTRYRY  142



>gb|KIK38408.1| hypothetical protein CY34DRAFT_809371 [Suillus luteus UH-Slu-Lm8-n1]
Length=142

 Score =   248 bits (632),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 112/142 (79%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSY LPHL SGW VD+AI +EE+R+V+IRFGHDWD  CM MDE L SVAE ++NFAV+YL
Sbjct  1    MSYFLPHLPSGWHVDEAIKSEEDRVVVIRFGHDWDHQCMTMDETLYSVAEKVQNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDITEVPDFN MYELYDP TVMFF+RNKHIMIDLGTGNNNKINWA+  KQE IDI+ETVY
Sbjct  61   VDITEVPDFNKMYELYDPCTVMFFYRNKHIMIDLGTGNNNKINWAMNHKQELIDIIETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGA KGRGLV++PKDYST+YRY
Sbjct  121  RGASKGRGLVVSPKDYSTRYRY  142



>gb|EMD31170.1| hypothetical protein CERSUDRAFT_119982 [Ceriporiopsis subvermispora 
B]
Length=142

 Score =   248 bits (632),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 111/142 (78%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSY LPHL SGW VD+AI +EE+R+V++RFGHDWD  CM MDE L SVAE ++NFAV+YL
Sbjct  1    MSYFLPHLPSGWHVDEAIKSEEDRVVVLRFGHDWDSQCMTMDETLYSVAEKVQNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDITEVPDFN MYELYDP TVMFF+RNKHIMIDLGTGNNNKINWA+ +KQE IDI+ETVY
Sbjct  61   VDITEVPDFNKMYELYDPCTVMFFYRNKHIMIDLGTGNNNKINWAMDNKQELIDIIETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGA KGRGLV++PKDYST+YRY
Sbjct  121  RGASKGRGLVVSPKDYSTRYRY  142



>emb|CBJ27126.1| conserved unknown protein [Ectocarpus siliculosus]
Length=142

 Score =   248 bits (632),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 111/142 (78%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSYLLPHL +GWAVDQAI+ EEER+V +RFGHD D TCMQMDEVLA +AE +KNF  +Y+
Sbjct  1    MSYLLPHLRTGWAVDQAIINEEERVVCLRFGHDHDVTCMQMDEVLAGIAEDVKNFCAIYV  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VD++EVPDFN MYELYDP TVMFFFRNKHIMIDLGTGNNNKI+WA  +KQE IDI+E VY
Sbjct  61   VDVSEVPDFNDMYELYDPCTVMFFFRNKHIMIDLGTGNNNKISWAFNNKQEMIDIMEVVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLV++PKDYSTKY+Y
Sbjct  121  RGARKGRGLVVSPKDYSTKYKY  142



>gb|EUC55875.1| snRNP mitosis protein Dim1, putative [Rhizoctonia solani AG-3 
Rhs1AP]
 gb|KEP47988.1| putative snRNP mitosis protein Dim1 [Rhizoctonia solani 123E]
Length=142

 Score =   247 bits (631),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 109/142 (77%), Positives = 128/142 (90%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSY LPHL +GW VDQAIL+E++R+V++RFGHDWD +CM+MDE L  VAE ++NFAV+YL
Sbjct  1    MSYFLPHLPTGWHVDQAILSEDDRVVVLRFGHDWDSSCMKMDETLYGVAEKVQNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDIT+VPDF  MYELYDP TVMFF+RNKHIMIDLGTGNNNKINWA+ DKQE IDI+ETVY
Sbjct  61   VDITQVPDFTKMYELYDPCTVMFFYRNKHIMIDLGTGNNNKINWAMDDKQEMIDIIETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGA KGRGLV++PKDYST+YRY
Sbjct  121  RGASKGRGLVVSPKDYSTRYRY  142



>ref|XP_002175341.1| U4/U6 X U5 tri-snRNP complex subunit Dim1 [Schizosaccharomyces 
japonicus yFS275]
 gb|EEB09048.1| U4/U6 X U5 tri-snRNP complex subunit Dim1 [Schizosaccharomyces 
japonicus yFS275]
Length=142

 Score =   247 bits (631),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 112/142 (79%), Positives = 129/142 (91%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSYLLPHLHSGW VDQAIL+E+ERLV+IRFG D DE CM+ DEVL  VAE + NFAV+YL
Sbjct  1    MSYLLPHLHSGWHVDQAILSEQERLVVIRFGRDHDEECMKQDEVLYKVAEKVSNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDI EVPDFN MYELYD +T+MFF+RNKH+M+DLGTGNNNKINWAL+DKQE IDI+ETVY
Sbjct  61   VDIDEVPDFNKMYELYDRTTIMFFYRNKHMMVDLGTGNNNKINWALEDKQELIDIIETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKG+GLVI+PKDYST++RY
Sbjct  121  RGARKGKGLVISPKDYSTRHRY  142



>ref|XP_010546438.1| PREDICTED: thioredoxin-like protein YLS8 [Tarenaya hassleriana]
Length=164

 Score =   248 bits (633),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 115/119 (97%), Positives = 119/119 (100%), Gaps = 0/119 (0%)
 Frame = +2

Query  95   RLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYLVDITEVPDFNTMYELYDPSTVMF  274
            RLV+IRFGHDWDETCMQMDEVLASVAET+KNFAV+YLVDITEVPDFNTMYELYDPSTVMF
Sbjct  46   RLVVIRFGHDWDETCMQMDEVLASVAETIKNFAVIYLVDITEVPDFNTMYELYDPSTVMF  105

Query  275  FFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVYRGARKGRGLVIAPKDYSTKYRY  451
            FFRNKHIMIDLGTGNNNKINWALKDKQEFIDI+ETVYRGARKGRGLVIAPKDYSTKYRY
Sbjct  106  FFRNKHIMIDLGTGNNNKINWALKDKQEFIDIIETVYRGARKGRGLVIAPKDYSTKYRY  164



>emb|CDI78434.1| mitosis protein, putative [Eimeria acervulina]
 emb|CDI77728.1| mitosis protein, putative [Eimeria praecox]
Length=142

 Score =   247 bits (631),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 112/142 (79%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSY+L HLHSGW VDQAIL EEERLV IRFGHD+D  CM+MDE+L  VAE +KNF V+Y+
Sbjct  1    MSYMLQHLHSGWQVDQAILTEEERLVCIRFGHDFDPECMKMDELLFKVAEDVKNFCVIYV  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VD TEVPDF TMYELYDP TVMFF+RNKH+MIDLGTGNNNKINWA+ +KQE IDI+E +Y
Sbjct  61   VDTTEVPDFTTMYELYDPVTVMFFYRNKHMMIDLGTGNNNKINWAMNNKQELIDIIECIY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLVI+PKDYSTKYRY
Sbjct  121  RGARKGRGLVISPKDYSTKYRY  142



>ref|XP_007306028.1| 4A/4B type thioredoxin-like protein [Stereum hirsutum FP-91666 
SS1]
 gb|EIM84871.1| 4A/4B type thioredoxin-like protein [Stereum hirsutum FP-91666 
SS1]
Length=142

 Score =   247 bits (631),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 111/142 (78%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSY LPHL SGW VD+AI +EE+R+V++RFGHDWD  CM MDE L SVAE ++NFAV+YL
Sbjct  1    MSYFLPHLPSGWHVDEAIKSEEDRVVVLRFGHDWDTQCMTMDETLYSVAEKVQNFAVVYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDITEVPDFN MYELYDP TVMFF+RNKHIMIDLGTGNNNKINWA+ +KQE IDI+ETVY
Sbjct  61   VDITEVPDFNKMYELYDPCTVMFFYRNKHIMIDLGTGNNNKINWAMDNKQEMIDIIETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGA KGRGLV++PKDYST+YRY
Sbjct  121  RGASKGRGLVVSPKDYSTRYRY  142



>ref|XP_005775974.1| hypothetical protein EMIHUDRAFT_74383 [Emiliania huxleyi CCMP1516]
 ref|XP_005791142.1| hypothetical protein EMIHUDRAFT_77810 [Emiliania huxleyi CCMP1516]
 gb|EOD23545.1| hypothetical protein EMIHUDRAFT_74383 [Emiliania huxleyi CCMP1516]
 gb|EOD38713.1| hypothetical protein EMIHUDRAFT_77810 [Emiliania huxleyi CCMP1516]
Length=159

 Score =   248 bits (632),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 117/159 (74%), Positives = 130/159 (82%), Gaps = 17/159 (11%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSYLLPHL +GWAVDQAIL+EE R+V IRFGHD+D  CMQMDEVL S+AE +KN+ V+YL
Sbjct  1    MSYLLPHLTTGWAVDQAILSEEARVVCIRFGHDYDPVCMQMDEVLYSIAELVKNYCVVYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNK-----------------HIMIDLGTGNNNKIN  334
            VD TEVPDFNTMYELYDP TVMFF+RNK                 HIMIDLGTGNNNKIN
Sbjct  61   VDTTEVPDFNTMYELYDPCTVMFFYRNKARPARPLLTAAPPAAAQHIMIDLGTGNNNKIN  120

Query  335  WALKDKQEFIDIVETVYRGARKGRGLVIAPKDYSTKYRY  451
            WA+ DKQE IDI+ETVYRGARKGRGLV++PKDYSTKYRY
Sbjct  121  WAIHDKQEVIDIIETVYRGARKGRGLVVSPKDYSTKYRY  159



>gb|KIY49658.1| 4A/4B type thioredoxin-like protein [Fistulina hepatica ATCC 
64428]
Length=142

 Score =   247 bits (630),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 111/142 (78%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSY LPHL SGW VD+AI +E++R+V+IRFGHDWDE CM MDE L SVAE ++NFAV+YL
Sbjct  1    MSYFLPHLPSGWHVDEAIKSEDDRVVVIRFGHDWDEQCMTMDETLYSVAEKVQNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDIT VPDFN MYELYDP TVMFF+RNKHIMIDLGTGNNNKINWA+ +KQE IDI+ETVY
Sbjct  61   VDITAVPDFNKMYELYDPCTVMFFYRNKHIMIDLGTGNNNKINWAMDNKQELIDIIETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGA KGRGLV++PKDYST+YRY
Sbjct  121  RGASKGRGLVVSPKDYSTRYRY  142



>ref|XP_007386351.1| 4A/4B type thioredoxin-like protein [Punctularia strigosozonata 
HHB-11173 SS5]
 gb|EIN06870.1| 4A/4B type thioredoxin-like protein [Punctularia strigosozonata 
HHB-11173 SS5]
 gb|KIK69415.1| hypothetical protein GYMLUDRAFT_152618 [Gymnopus luxurians FD-317 
M1]
Length=142

 Score =   247 bits (630),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 111/142 (78%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSY LPHL SGW VD+AI +EE+R+V+IRFGHDWD  CM MDE L SVAE ++NFAV+YL
Sbjct  1    MSYFLPHLPSGWHVDEAIKSEEDRVVVIRFGHDWDPQCMTMDETLYSVAEKVQNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
             DITEVPDFN MYELYDP TVMFF+RNKHIMIDLGTGNNNKINWA+ +KQE IDI+ETVY
Sbjct  61   CDITEVPDFNKMYELYDPCTVMFFYRNKHIMIDLGTGNNNKINWAMDNKQELIDIIETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGA KGRGLV++PKDYST+YRY
Sbjct  121  RGASKGRGLVVSPKDYSTRYRY  142



>gb|KIJ06810.1| hypothetical protein PAXINDRAFT_103223 [Paxillus involutus ATCC 
200175]
 gb|KIJ19567.1| hypothetical protein PAXINDRAFT_166676 [Paxillus involutus ATCC 
200175]
Length=142

 Score =   247 bits (630),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 112/142 (79%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSY LPHL SGW VD+AI +EE+R+V+IRFGHDWD  CM MDE L SVAE ++NFAV+YL
Sbjct  1    MSYFLPHLPSGWHVDEAIKSEEDRVVVIRFGHDWDPQCMTMDETLYSVAEKVQNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDIT VPDFN MYELYDP TVMFF+RNKHIMIDLGTGNNNKINWA+ +KQE IDIVETVY
Sbjct  61   VDITAVPDFNKMYELYDPCTVMFFYRNKHIMIDLGTGNNNKINWAMDNKQEMIDIVETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGA KGRGLV++PKDYST+YRY
Sbjct  121  RGASKGRGLVVSPKDYSTRYRY  142



>emb|CDH56838.1| thioredoxin-like protein 4a [Lichtheimia corymbifera JMRC:FSU:9682]
Length=141

 Score =   246 bits (629),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 110/140 (79%), Positives = 126/140 (90%), Gaps = 0/140 (0%)
 Frame = +2

Query  32   YLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYLVD  211
            Y LPHL +GW VDQAIL+EE+R+V+IRFGHDWD TCM+MDE+L S+AE +KNFAV+YLVD
Sbjct  2    YFLPHLTNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEILYSIAEKVKNFAVIYLVD  61

Query  212  ITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVYRG  391
            ITEVPDFN MYELYDP T MFFFRNKHIM+DLGTGNNNKINWAL DK E ID++E VYRG
Sbjct  62   ITEVPDFNKMYELYDPCTTMFFFRNKHIMVDLGTGNNNKINWALDDKSEMIDLIEIVYRG  121

Query  392  ARKGRGLVIAPKDYSTKYRY  451
            ARKGRGLV++ KDYSTKY+Y
Sbjct  122  ARKGRGLVVSLKDYSTKYKY  141



>ref|XP_001613851.1| hypothetical protein [Plasmodium vivax Sal-1]
 ref|XP_002262387.1| DIM1 protein homolog [Plasmodium knowlesi strain H]
 ref|XP_004225090.1| DIM1 protein homolog [Plasmodium cynomolgi strain B]
 ref|XP_008817315.1| thioredoxin-like protein 4A [Plasmodium inui San Antonio 1]
 gb|EDL44124.1| hypothetical protein, conserved [Plasmodium vivax]
 emb|CAQ42265.1| DIM1 protein homolog, putative [Plasmodium knowlesi strain H]
 dbj|GAB69143.1| DIM1 protein homolog [Plasmodium cynomolgi strain B]
 gb|EUD66031.1| thioredoxin-like protein 4A [Plasmodium inui San Antonio 1]
Length=142

 Score =   246 bits (629),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 111/142 (78%), Positives = 130/142 (92%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MS++L HL+SGWAVDQAI+ EEERLV IRFGHD+D  CM+MDE+L  VAE +KNF V+YL
Sbjct  1    MSFMLQHLNSGWAVDQAIINEEERLVCIRFGHDYDPDCMKMDELLYKVAEDIKNFCVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDITEVP+FNTMYELYDP +VMFF+RNKH+MIDLGTGNNNKINW + +KQEFIDIVET++
Sbjct  61   VDITEVPEFNTMYELYDPVSVMFFYRNKHMMIDLGTGNNNKINWPMNNKQEFIDIVETIF  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLVI+PKDYSTKY+Y
Sbjct  121  RGARKGRGLVISPKDYSTKYKY  142



>gb|EPS96979.1| hypothetical protein FOMPIDRAFT_1129402 [Fomitopsis pinicola 
FP-58527 SS1]
Length=142

 Score =   246 bits (629),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 111/142 (78%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSY LPHL SGW VD+AI +EE+R+V+IRFGHDWD  CM MDE L SVAE ++NFAV+YL
Sbjct  1    MSYFLPHLPSGWHVDEAIKSEEDRVVVIRFGHDWDSQCMTMDETLYSVAEKVQNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDIT+VPDFN MYELYDP TVMFF+RNKHIMIDLGTGNNNKINWA+  KQE IDI+ETVY
Sbjct  61   VDITDVPDFNKMYELYDPCTVMFFYRNKHIMIDLGTGNNNKINWAMDHKQELIDIIETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGA KGRGLV++PKDYST+YRY
Sbjct  121  RGASKGRGLVVSPKDYSTRYRY  142



>dbj|GAM16867.1| hypothetical protein SAMD00019534_000420 [Acytostelium subglobosum 
LB1]
Length=142

 Score =   246 bits (629),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 108/142 (76%), Positives = 128/142 (90%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MS+LLPHL SGWAVDQ+I+ EEER+V+IRFGHDWD  C++ DE+L +VAE +KNFA +Y+
Sbjct  1    MSFLLPHLKSGWAVDQSIVTEEERVVVIRFGHDWDPDCIKQDEILFAVAEKVKNFAAIYV  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDITEVPDFN MYELYDP T MFF+RNKHIMIDLGTGNNNKINW L DKQ+ ID++ETVY
Sbjct  61   VDITEVPDFNKMYELYDPCTTMFFYRNKHIMIDLGTGNNNKINWPLTDKQDMIDVIETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKG+GLVI+PKD+STKY+Y
Sbjct  121  RGARKGKGLVISPKDFSTKYKY  142



>ref|XP_007846877.1| thioredoxin-like protein 4a [Moniliophthora roreri MCA 2997]
 gb|ESK93827.1| thioredoxin-like protein 4a [Moniliophthora roreri MCA 2997]
Length=142

 Score =   246 bits (629),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 110/142 (77%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSY LPHL SGW VD+AI +EE+R+V+IRFGHDWD  CM MDE L +VAE ++NFAV+YL
Sbjct  1    MSYFLPHLPSGWHVDEAIKSEEDRVVVIRFGHDWDSQCMTMDETLYAVAEKVQNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
             DITEVPDFN MYELYDP TVMFF+RNKHIMIDLGTGNNNKINWA+ +KQE IDI+ETVY
Sbjct  61   CDITEVPDFNKMYELYDPCTVMFFYRNKHIMIDLGTGNNNKINWAMDNKQELIDIIETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGA KGRGLV++PKDYST+YRY
Sbjct  121  RGASKGRGLVVSPKDYSTRYRY  142



>gb|KIM87909.1| hypothetical protein PILCRDRAFT_265038 [Piloderma croceum F 1598]
Length=142

 Score =   246 bits (628),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 111/142 (78%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSY LPHL SGW VD+AI +EE+R+V++RFGHDWD  CM MDE L  VAE ++NFAV+YL
Sbjct  1    MSYFLPHLPSGWHVDEAIKSEEDRVVVMRFGHDWDSQCMTMDETLYGVAEKVQNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDITEVPDFN MYELYDP TVMFF+RNKHIMIDLGTGNNNKINWA+ +KQE IDIVETVY
Sbjct  61   VDITEVPDFNKMYELYDPCTVMFFYRNKHIMIDLGTGNNNKINWAMDNKQELIDIVETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGA KGRGLV++PKDYST+YRY
Sbjct  121  RGASKGRGLVVSPKDYSTRYRY  142



>ref|XP_007772300.1| 4A 4B type thioredoxin-like protein [Coniophora puteana RWD-64-598 
SS2]
 gb|EIW78031.1| 4A 4B type thioredoxin-like protein [Coniophora puteana RWD-64-598 
SS2]
Length=142

 Score =   246 bits (628),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 109/142 (77%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSY LPHL +GW VDQAIL+EE+R+V++RFGHDWD  CM MDE L SV+E ++NFAV+YL
Sbjct  1    MSYFLPHLPTGWHVDQAILSEEDRIVVLRFGHDWDAQCMTMDETLYSVSEKIQNFAVVYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDI+EVPDF  MYELYDP TVMFF+RNKHIMIDLGTGNNNKINWA+ +KQE IDI+ETVY
Sbjct  61   VDISEVPDFTKMYELYDPCTVMFFYRNKHIMIDLGTGNNNKINWAMDNKQELIDIIETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGA KGRGLV++PKDYST+YRY
Sbjct  121  RGASKGRGLVVSPKDYSTRYRY  142



>gb|KIK97816.1| hypothetical protein PAXRUDRAFT_824538 [Paxillus rubicundulus 
Ve08.2h10]
Length=142

 Score =   246 bits (628),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 111/142 (78%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSY LPHL SGW VD+AI +EE+R+V++RFGHDWD  CM MDE L SVAE ++NFAV+YL
Sbjct  1    MSYFLPHLPSGWHVDEAIKSEEDRVVVVRFGHDWDPQCMTMDETLYSVAEKVQNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDIT VPDFN MYELYDP TVMFF+RNKHIMIDLGTGNNNKINWA+ +KQE IDIVETVY
Sbjct  61   VDITAVPDFNKMYELYDPCTVMFFYRNKHIMIDLGTGNNNKINWAMDNKQEMIDIVETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGA KGRGLV++PKDYST+YRY
Sbjct  121  RGASKGRGLVVSPKDYSTRYRY  142



>ref|XP_009551647.1| hypothetical protein HETIRDRAFT_480925 [Heterobasidion irregulare 
TC 32-1]
 gb|ETW76775.1| hypothetical protein HETIRDRAFT_480925 [Heterobasidion irregulare 
TC 32-1]
Length=142

 Score =   246 bits (627),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 111/142 (78%), Positives = 125/142 (88%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSY LPHL SGW VD+AI +EE+R V+IRFGHDWD  CM MDE L  VAE ++NFAV+YL
Sbjct  1    MSYFLPHLPSGWHVDEAIKSEEDRTVVIRFGHDWDTQCMTMDETLYGVAEKVQNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDITEVPDFN MYELYDP TVMFF+RNKHIMIDLGTGNNNKINWA+ +KQE IDI+ETVY
Sbjct  61   VDITEVPDFNKMYELYDPCTVMFFYRNKHIMIDLGTGNNNKINWAMDNKQELIDIIETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGA KGRGLV++PKDYST+YRY
Sbjct  121  RGASKGRGLVVSPKDYSTRYRY  142



>gb|EJU00533.1| 4A/4B type thioredoxin-like protein [Dacryopinax sp. DJM-731 
SS1]
Length=142

 Score =   246 bits (627),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 108/142 (76%), Positives = 128/142 (90%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSY LPHL SGW VDQAIL+EE+R+V +RFGHDWD  CM+MDE L ++AE ++NFAV+YL
Sbjct  1    MSYFLPHLPSGWHVDQAILSEEDRVVCLRFGHDWDSQCMKMDETLYNIAERVQNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDIT+VPDFN MYELYDP T+MFF+RNKHIMIDLGTGNNNKINWA+ +KQE IDI+ETVY
Sbjct  61   VDITQVPDFNKMYELYDPCTLMFFYRNKHIMIDLGTGNNNKINWAIDNKQEMIDIIETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGA KGRGLV++P+DYST+YRY
Sbjct  121  RGASKGRGLVVSPRDYSTRYRY  142



>ref|XP_009583558.1| PREDICTED: thioredoxin-like protein 4A, partial [Fulmarus glacialis]
 gb|KFQ79821.1| Thioredoxin-like 4A, partial [Phaethon lepturus]
 gb|KFV88382.1| Thioredoxin-like 4A, partial [Struthio camelus australis]
Length=131

 Score =   245 bits (626),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 111/131 (85%), Positives = 124/131 (95%), Gaps = 0/131 (0%)
 Frame = +2

Query  59   WAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYLVDITEVPDFNT  238
            W VDQAIL+EE+R+V+IRFGHDWD TCM+MDEVL S+AE +KNFAV+YLVDITEVPDFN 
Sbjct  1    WQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYLVDITEVPDFNK  60

Query  239  MYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVYRGARKGRGLVI  418
            MYELYDP TVMFFFRNKHIMIDLGTGNNNKINWA++DKQE IDI+ETVYRGARKGRGLV+
Sbjct  61   MYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWAMEDKQEMIDIIETVYRGARKGRGLVV  120

Query  419  APKDYSTKYRY  451
            +PKDYSTKYRY
Sbjct  121  SPKDYSTKYRY  131



>gb|KIM69609.1| hypothetical protein SCLCIDRAFT_1208074 [Scleroderma citrinum 
Foug A]
Length=142

 Score =   246 bits (627),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 109/142 (77%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSY LPHL SGW VD+AI +EE+R+V+IRFGHDWD  CM+MDE L +VAE ++NFAV+YL
Sbjct  1    MSYFLPHLPSGWHVDEAIKSEEDRIVVIRFGHDWDPQCMKMDETLYAVAEKVQNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDIT VPDFN MYELYDP TVMFF+RNKHIMIDLGTGNNNKINWA+ +KQE ID++ETVY
Sbjct  61   VDITNVPDFNKMYELYDPCTVMFFYRNKHIMIDLGTGNNNKINWAMDNKQELIDVIETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGA KGRGLV++PKDYST+YRY
Sbjct  121  RGASKGRGLVVSPKDYSTRYRY  142



>gb|KIJ62414.1| hypothetical protein HYDPIDRAFT_114514 [Hydnomerulius pinastri 
MD-312]
Length=142

 Score =   246 bits (627),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 110/142 (77%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSY LPHL SGW VD+AI +EE+R+V+IRFGHDWD  CM MDE L +VAE ++NFAV+YL
Sbjct  1    MSYFLPHLPSGWHVDEAIKSEEDRVVVIRFGHDWDSQCMTMDETLYAVAEKVQNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDIT VPDFN MYELYDP TVMFF+RNKHIMIDLGTGNNNKINWA+ +KQE IDI+ETVY
Sbjct  61   VDITAVPDFNKMYELYDPCTVMFFYRNKHIMIDLGTGNNNKINWAMDNKQELIDIIETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGA KGRGLV++PKDYST+YRY
Sbjct  121  RGASKGRGLVVSPKDYSTRYRY  142



>ref|XP_008044177.1| Txnl4a protein [Trametes versicolor FP-101664 SS1]
 gb|EIW52587.1| Txnl4a protein [Trametes versicolor FP-101664 SS1]
Length=142

 Score =   245 bits (626),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 110/142 (77%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSY LPHL SGW VD+AI +EE+R+V++RFGHDWD  CM MDE L  VAE ++NFAV+YL
Sbjct  1    MSYFLPHLPSGWHVDEAIKSEEDRVVVLRFGHDWDSQCMTMDETLYGVAEKVQNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDITEVPDFN MYELYDP TVMFF+RNKHIMIDLGTGNNNKINWA+ +KQE IDI+ETVY
Sbjct  61   VDITEVPDFNKMYELYDPCTVMFFYRNKHIMIDLGTGNNNKINWAMDNKQELIDIIETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGA KGRGLV++PKDYST+YRY
Sbjct  121  RGAAKGRGLVVSPKDYSTRYRY  142



>ref|XP_728199.1| hypothetical protein [Plasmodium yoelii yoelii 17XNL]
 ref|XP_008622770.1| thioredoxin-like protein 4A [Plasmodium vinckei vinckei]
 gb|EAA19764.1| Drosophila melanogaster RE13747p [Plasmodium yoelii yoelii]
 gb|ETB61820.1| thioredoxin-like protein 4A [Plasmodium yoelii 17X]
 gb|KEG03964.1| thioredoxin-like protein 4A [Plasmodium vinckei vinckei]
 emb|CDR16947.1| mitosis protein dim1, putative [Plasmodium chabaudi chabaudi]
 emb|CDS52204.1| mitosis protein dim1, putative [Plasmodium berghei ANKA]
 emb|CDU20832.1| mitosis protein dim1, putative [Plasmodium yoelii]
 emb|CDZ14460.1| mitosis protein dim1, putative [Plasmodium yoelii]
Length=142

 Score =   245 bits (626),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 110/142 (77%), Positives = 130/142 (92%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MS++L HL+SGWAVDQAI+ E+ERLV IRFGHD+D  CM+MDE+L  VA+ +KNF V+YL
Sbjct  1    MSFMLQHLNSGWAVDQAIVNEDERLVCIRFGHDYDPDCMKMDELLYKVADDIKNFCVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDITEVPDFNTMYELYDP +VMFF+RNKH+MIDLGTGNNNKINW + +KQEFIDIVET++
Sbjct  61   VDITEVPDFNTMYELYDPVSVMFFYRNKHMMIDLGTGNNNKINWPMNNKQEFIDIVETIF  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLVI+PKDYSTKY+Y
Sbjct  121  RGARKGRGLVISPKDYSTKYKY  142



>ref|XP_003030947.1| hypothetical protein SCHCODRAFT_16105 [Schizophyllum commune 
H4-8]
 gb|EFI96044.1| hypothetical protein SCHCODRAFT_16105 [Schizophyllum commune 
H4-8]
Length=142

 Score =   245 bits (626),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 109/142 (77%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSY LPHL SGW VD+AI +EE+R+V+IRFGHDWD  CM MDE L +VAE ++NFAV+YL
Sbjct  1    MSYFLPHLPSGWHVDEAIKSEEDRVVVIRFGHDWDSQCMTMDETLYAVAEKVQNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
             DIT+VPDFN MYELYDP TVMFF+RNKHIMIDLGTGNNNKINWA+ +KQE IDI+ETVY
Sbjct  61   CDITQVPDFNKMYELYDPCTVMFFYRNKHIMIDLGTGNNNKINWAMDNKQELIDIIETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGA KGRGLV++PKDYST+YRY
Sbjct  121  RGASKGRGLVVSPKDYSTRYRY  142



>gb|ADD38623.1| Thioredoxin-like protein 4A [Lepeophtheirus salmonis]
Length=142

 Score =   245 bits (626),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 109/142 (77%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSY++ HL +G  VDQAIL+EE+R++ IRFGHDWD TCM+MDE L  +AE +KNF V+YL
Sbjct  1    MSYMISHLENGRQVDQAILSEEDRVICIRFGHDWDPTCMKMDETLFGIAERVKNFCVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDIT+VPDFN MYELYDP TVM+FFRNKHIMIDLGTGNNNKINW ++DKQE IDI+ETVY
Sbjct  61   VDITQVPDFNKMYELYDPCTVMYFFRNKHIMIDLGTGNNNKINWPMEDKQEMIDIIETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLV++PKDYSTKYRY
Sbjct  121  RGARKGRGLVVSPKDYSTKYRY  142



>ref|XP_001838225.2| Txnl4a protein [Coprinopsis cinerea okayama7#130]
 gb|EAU83593.2| Txnl4a protein [Coprinopsis cinerea okayama7#130]
Length=142

 Score =   245 bits (626),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 109/142 (77%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSY LPHL SGW VD+AI +EE+R+V+IRFGHDWD  CM MDE L  ++E ++NFAV+YL
Sbjct  1    MSYFLPHLPSGWHVDEAIKSEEDRVVVIRFGHDWDSQCMTMDETLYGISEKVQNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDITEVPDFN MYELYDP TVMFF+RNKHIMIDLGTGNNNKINWA+ +KQE IDI+ETVY
Sbjct  61   VDITEVPDFNKMYELYDPCTVMFFYRNKHIMIDLGTGNNNKINWAMDNKQEMIDIIETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGA KGRGLV++PKDYST+YRY
Sbjct  121  RGASKGRGLVVSPKDYSTRYRY  142



>gb|KDQ22912.1| hypothetical protein PLEOSDRAFT_1095121 [Pleurotus ostreatus 
PC15]
Length=142

 Score =   245 bits (625),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 110/142 (77%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSY LPHL SGW VD+AI +EE+R+V+IRFGHDWD  CM MDE L +VAE ++NFAV+YL
Sbjct  1    MSYFLPHLPSGWHVDEAIKSEEDRVVVIRFGHDWDTQCMVMDETLYAVAEKVQNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
             DITEVPDFN MYELYDP TVMFF+RNKHIMIDLGTGNNNKINWA+ +KQE IDI+ETVY
Sbjct  61   TDITEVPDFNKMYELYDPCTVMFFYRNKHIMIDLGTGNNNKINWAMDNKQELIDIIETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGA KGRGLV++PKDYST+YRY
Sbjct  121  RGASKGRGLVVSPKDYSTRYRY  142



>gb|EJY79946.1| Thioredoxin-like protein 4A [Oxytricha trifallax]
Length=142

 Score =   245 bits (625),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 106/142 (75%), Positives = 128/142 (90%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSYLLPHL +GW VDQ IL+EE+R+V IRFGHDWD TCM+MDEVL   +E ++NFAV+YL
Sbjct  1    MSYLLPHLDNGWEVDQGILSEEDRVVCIRFGHDWDPTCMKMDEVLVKCSEEVQNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDI+ VPDFNTMYELYDP TVMFFFRN+HIM+D GTGNNNK+NWAL +KQ+ IDI+E+VY
Sbjct  61   VDISSVPDFNTMYELYDPCTVMFFFRNRHIMVDFGTGNNNKLNWALSNKQDMIDILESVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKG+GLV++PKD+STKY+Y
Sbjct  121  RGARKGKGLVVSPKDFSTKYKY  142



>gb|KIL59987.1| hypothetical protein M378DRAFT_84351 [Amanita muscaria Koide 
BX008]
Length=142

 Score =   245 bits (625),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 109/142 (77%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSY LPHL SGW VD+AI +EE+R V+IRFGHDWDE CM MDE L S+AE ++NFAV+YL
Sbjct  1    MSYFLPHLPSGWHVDEAIKSEEDRAVVIRFGHDWDEQCMVMDETLYSIAEKVQNFAVVYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDIT+VPDFN MYELYDP TVMFF+RNKHIMIDLGTGNNNKINWA+ +KQE ID++ETVY
Sbjct  61   VDITDVPDFNKMYELYDPCTVMFFYRNKHIMIDLGTGNNNKINWAIDNKQELIDVIETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGA KGRGLV++P+DYST+YRY
Sbjct  121  RGASKGRGLVVSPRDYSTRYRY  142



>ref|XP_007400208.1| hypothetical protein PHACADRAFT_263005 [Phanerochaete carnosa 
HHB-10118-sp]
 gb|EKM51049.1| hypothetical protein PHACADRAFT_263005 [Phanerochaete carnosa 
HHB-10118-sp]
Length=142

 Score =   245 bits (625),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 110/142 (77%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSY LPHL SGW VD+AI +EE+R+V+IRFGHDWD  CM MDE L +VA+ ++NFAV+YL
Sbjct  1    MSYFLPHLPSGWHVDEAIKSEEDRVVVIRFGHDWDPQCMVMDETLYAVADKVQNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDITEVPDFN MYELYDP TVMFF+RNKHIMIDLGTGNNNKINWA+ +KQE IDI+ETVY
Sbjct  61   VDITEVPDFNKMYELYDPCTVMFFYRNKHIMIDLGTGNNNKINWAMDNKQELIDIIETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGA KGRGLV++PKDYST+YRY
Sbjct  121  RGASKGRGLVVSPKDYSTRYRY  142



>gb|KIM43951.1| hypothetical protein M413DRAFT_371899 [Hebeloma cylindrosporum 
h7]
Length=142

 Score =   245 bits (625),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 109/142 (77%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSY LPHL SGW VD+AI +EE+R+V+IRFGHDWD  CM MDE L + AE ++NFAV+YL
Sbjct  1    MSYFLPHLPSGWHVDEAIKSEEDRVVVIRFGHDWDSQCMTMDETLYACAEKVQNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDIT+VPDFN MYELYDP TVMFF+RNKHIMIDLGTGNNNKINWA+ +KQE IDI+ETVY
Sbjct  61   VDITDVPDFNKMYELYDPCTVMFFYRNKHIMIDLGTGNNNKINWAMDNKQELIDIIETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGA KGRGLV++PKDYST+YRY
Sbjct  121  RGASKGRGLVVSPKDYSTRYRY  142



>dbj|GAA55172.1| U5 snRNP protein DIM1 family [Clonorchis sinensis]
Length=212

 Score =   247 bits (631),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 109/142 (77%), Positives = 128/142 (90%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSY+L HL +GW VDQAIL+EE+R+V+IRFGHDWD +CM MDE L  +AE +KNFAV+YL
Sbjct  71   MSYMLSHLTNGWQVDQAILSEEDRVVVIRFGHDWDPSCMVMDETLFKIAEKVKNFAVIYL  130

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDIT+VPDFN MYELYDP TVMFF+RNKHIMIDLGTGNNNKINW ++D QE +DI+ETV+
Sbjct  131  VDITKVPDFNKMYELYDPCTVMFFYRNKHIMIDLGTGNNNKINWPIEDGQEMLDIIETVF  190

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLV++PKDYSTKYRY
Sbjct  191  RGARKGRGLVVSPKDYSTKYRY  212



>gb|EWM21942.1| thioredoxin-like protein 4a [Nannochloropsis gaditana]
Length=182

 Score =   246 bits (628),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 109/143 (76%), Positives = 127/143 (89%), Gaps = 0/143 (0%)
 Frame = +2

Query  23   RMSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLY  202
            +MSY+LPHL SGWAVDQAIL EE ++V+IRFGHD +ETCMQMDE+L  ++E ++NFA +Y
Sbjct  40   KMSYMLPHLRSGWAVDQAILNEENKVVVIRFGHDENETCMQMDEILYKISEDVRNFAAIY  99

Query  203  LVDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETV  382
            LVD TEVPDFN MYELYD  T MFFFRNKHIMIDLGTGNNNKIN+ + DKQE IDI+ETV
Sbjct  100  LVDTTEVPDFNVMYELYDECTCMFFFRNKHIMIDLGTGNNNKINFLISDKQEMIDIIETV  159

Query  383  YRGARKGRGLVIAPKDYSTKYRY  451
            YRGARKGRGLV++PKDYST+YRY
Sbjct  160  YRGARKGRGLVVSPKDYSTRYRY  182



>gb|KIK18903.1| hypothetical protein PISMIDRAFT_683760 [Pisolithus microcarpus 
441]
 gb|KIN98582.1| hypothetical protein M404DRAFT_157412 [Pisolithus tinctorius 
Marx 270]
Length=142

 Score =   244 bits (624),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 109/142 (77%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSY LPHL SGW VD+AI +EE+R+V+IRFGHDWD  CM MDE L ++AE ++NFAV+YL
Sbjct  1    MSYFLPHLPSGWHVDEAIKSEEDRIVVIRFGHDWDPQCMTMDETLYAIAEKVQNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDIT VPDFN MYELYDP TVMFF+RNKHIMIDLGTGNNNKINWA+ +KQE IDI+ETVY
Sbjct  61   VDITAVPDFNKMYELYDPCTVMFFYRNKHIMIDLGTGNNNKINWAMDNKQELIDIIETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGA KGRGLV++PKDYST+YRY
Sbjct  121  RGASKGRGLVVSPKDYSTRYRY  142



>emb|CDO76842.1| hypothetical protein BN946_scf185033.g39 [Trametes cinnabarina]
Length=142

 Score =   244 bits (624),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 110/142 (77%), Positives = 125/142 (88%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSY LPHL SGW VD+AI +EE+R+V+IRFGHDWD  CM MDE L  VAE ++NFAV+YL
Sbjct  1    MSYFLPHLPSGWHVDEAIKSEEDRVVVIRFGHDWDPQCMTMDETLYGVAEKVQNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDITEVPDFN MYELYDP TVMFF+RNKHIMIDLGTGNNNKINW + +KQE IDI+ETVY
Sbjct  61   VDITEVPDFNKMYELYDPCTVMFFYRNKHIMIDLGTGNNNKINWPMDNKQELIDIIETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGA KGRGLV++PKDYST+YRY
Sbjct  121  RGASKGRGLVVSPKDYSTRYRY  142



>gb|KIP02616.1| hypothetical protein PHLGIDRAFT_130648 [Phlebiopsis gigantea 
11061_1 CR5-6]
Length=142

 Score =   244 bits (624),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 110/142 (77%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSY LPHL SGW VD+AI +EE+R+V++RFGHDWD  CM MDE L  VAE ++NFAV+YL
Sbjct  1    MSYFLPHLPSGWHVDEAIKSEEDRVVVLRFGHDWDTQCMTMDETLYGVAEKVQNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDITEVPDFN MYELYDP TVMFF+RNKHIMIDLGTGNNNKINWA+ +KQE IDI+ETVY
Sbjct  61   VDITEVPDFNKMYELYDPCTVMFFYRNKHIMIDLGTGNNNKINWAMDNKQELIDIMETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGA KGRGLV++PKDYST+YRY
Sbjct  121  RGAAKGRGLVVSPKDYSTRYRY  142



>gb|KIH46527.1| mitosis protein DIM1 [Ancylostoma duodenale]
Length=139

 Score =   244 bits (623),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 107/139 (77%), Positives = 125/139 (90%), Gaps = 0/139 (0%)
 Frame = +2

Query  35   LLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYLVDI  214
            +LPHL +GW VDQAILAEE+R+V++RFGHDWD TCM+MDE L  +A  +KNF+V+YLVDI
Sbjct  1    MLPHLENGWQVDQAILAEEDRVVVVRFGHDWDPTCMRMDETLFKIAPKVKNFSVIYLVDI  60

Query  215  TEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVYRGA  394
            T+VPDFN MYELYDP TVMFFFRNKHIM+DLGTGNNNKINW + D QE IDI+ETVYRGA
Sbjct  61   TKVPDFNKMYELYDPCTVMFFFRNKHIMVDLGTGNNNKINWPITDGQELIDIIETVYRGA  120

Query  395  RKGRGLVIAPKDYSTKYRY  451
            RKGRGLV++PKDYSTKY+Y
Sbjct  121  RKGRGLVVSPKDYSTKYKY  139



>gb|EUD74542.1| thioredoxin-like protein 4A [Plasmodium vinckei petteri]
Length=142

 Score =   244 bits (622),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 109/142 (77%), Positives = 130/142 (92%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MS++L HL+SGWAVDQAI+ E++RLV IRFGHD+D  CM+MDE+L  VA+ +KNF V+YL
Sbjct  1    MSFMLQHLNSGWAVDQAIVNEDDRLVCIRFGHDYDPDCMKMDELLYKVADDIKNFCVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDITEVPDFNTMYELYDP +VMFF+RNKH+MIDLGTGNNNKINW + +KQEFIDIVET++
Sbjct  61   VDITEVPDFNTMYELYDPVSVMFFYRNKHMMIDLGTGNNNKINWPMNNKQEFIDIVETIF  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGARKGRGLVI+PKDYSTKY+Y
Sbjct  121  RGARKGRGLVISPKDYSTKYKY  142



>ref|XP_007263637.1| 4A/4B type thioredoxin-like protein [Fomitiporia mediterranea 
MF3/22]
 gb|EJD05491.1| 4A/4B type thioredoxin-like protein [Fomitiporia mediterranea 
MF3/22]
Length=142

 Score =   244 bits (622),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 108/142 (76%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSY LPHL SGW VD+AI +EE+R+V+IRFGHDWD  CM+MDE L  V+E ++NFAV+YL
Sbjct  1    MSYFLPHLPSGWHVDEAIKSEEDRVVVIRFGHDWDPQCMKMDETLYGVSEKVQNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
             DIT+VPDFN MYELYDP TVMFF+RNKHIMIDLGTGNNNKINWA+ +KQE IDI+ETVY
Sbjct  61   CDITQVPDFNKMYELYDPCTVMFFYRNKHIMIDLGTGNNNKINWAMDNKQELIDIIETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGA KGRGLV++PKDYST+YRY
Sbjct  121  RGASKGRGLVVSPKDYSTRYRY  142



>gb|KIJ40226.1| hypothetical protein M422DRAFT_173930 [Sphaerobolus stellatus 
SS14]
 gb|KIJ42127.1| hypothetical protein M422DRAFT_31492 [Sphaerobolus stellatus 
SS14]
Length=142

 Score =   243 bits (621),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 109/142 (77%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSY LPHL SGW VD+AI +EE+R+V+IRFGHDWD  CM+ DE L  VAE ++NFAV+YL
Sbjct  1    MSYFLPHLPSGWHVDEAIKSEEDRVVVIRFGHDWDTQCMKTDETLYGVAEKVQNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDIT+VPDFN MYELYDP TVMFF+RNKHIMIDLGTGNNNKINWA+ +KQE IDI+ETVY
Sbjct  61   VDITQVPDFNKMYELYDPCTVMFFYRNKHIMIDLGTGNNNKINWAMDNKQEMIDIIETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGA KGRGLV++PKDYST+YRY
Sbjct  121  RGAAKGRGLVVSPKDYSTRYRY  142



>gb|KDQ52504.1| hypothetical protein JAAARDRAFT_40105 [Jaapia argillacea MUCL 
33604]
Length=142

 Score =   243 bits (620),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 108/142 (76%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYL  205
            MSY LPHL SGW VD+AI +EE+R+V++RFGHDWD  CM MDE L  ++E ++NFAV+YL
Sbjct  1    MSYFLPHLPSGWHVDEAIKSEEDRVVVLRFGHDWDSQCMIMDETLYGISEKVQNFAVIYL  60

Query  206  VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY  385
            VDITEVPDFN MYELYDP TVMFF+RNKHIMIDLGTGNNNKINWA+ +KQE IDI+ETVY
Sbjct  61   VDITEVPDFNKMYELYDPCTVMFFYRNKHIMIDLGTGNNNKINWAMDNKQEMIDIIETVY  120

Query  386  RGARKGRGLVIAPKDYSTKYRY  451
            RGA KGRGLV++PKDYST+YRY
Sbjct  121  RGASKGRGLVVSPKDYSTRYRY  142



>ref|XP_001350710.1| DIM1 protein homolog, putative [Plasmodium falciparum 3D7]
 gb|AAN36390.1| DIM1 protein homolog, putative [Plasmodium falciparum 3D7]
 emb|CDO65590.1| DIM1 protein homolog, putative [Plasmodium reichenowi]
Length=139

 Score =   243 bits (619),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 110/139 (79%), Positives = 126/139 (91%), Gaps = 0/139 (0%)
 Frame = +2

Query  35   LLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYLVDI  214
            +L HLHSGW VDQAIL+EEERLV IRFGHD+D  CM+MDE+L  V E +KNF V+YLVDI
Sbjct  1    MLYHLHSGWDVDQAILSEEERLVCIRFGHDYDPDCMKMDELLFKVVEDIKNFCVIYLVDI  60

Query  215  TEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVYRGA  394
            TEVPDFNTMYELYDP +VMFF+RNKH+MIDLGTGNNNKINW + +KQEFIDIVET++RGA
Sbjct  61   TEVPDFNTMYELYDPVSVMFFYRNKHMMIDLGTGNNNKINWPMNNKQEFIDIVETIFRGA  120

Query  395  RKGRGLVIAPKDYSTKYRY  451
            RKGRGLVI+PKDYSTKY+Y
Sbjct  121  RKGRGLVISPKDYSTKYKY  139



>ref|XP_010290296.1| PREDICTED: thioredoxin-like protein 4A, partial [Phaethon lepturus]
Length=130

 Score =   242 bits (618),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 110/129 (85%), Positives = 123/129 (95%), Gaps = 0/129 (0%)
 Frame = +2

Query  65   VDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYLVDITEVPDFNTMY  244
            VDQAIL+EE+R+V+IRFGHDWD TCM+MDEVL S+AE +KNFAV+YLVDITEVPDFN MY
Sbjct  2    VDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYLVDITEVPDFNKMY  61

Query  245  ELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVYRGARKGRGLVIAP  424
            ELYDP TVMFFFRNKHIMIDLGTGNNNKINWA++DKQE IDI+ETVYRGARKGRGLV++P
Sbjct  62   ELYDPCTVMFFFRNKHIMIDLGTGNNNKINWAMEDKQEMIDIIETVYRGARKGRGLVVSP  121

Query  425  KDYSTKYRY  451
            KDYSTKYRY
Sbjct  122  KDYSTKYRY  130



>ref|XP_008500727.1| PREDICTED: thioredoxin-like protein 4A [Calypte anna]
Length=152

 Score =   243 bits (620),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 110/133 (83%), Positives = 126/133 (95%), Gaps = 1/133 (1%)
 Frame = +2

Query  53   SGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETLKNFAVLYLVDITEVPDF  232
            +GW +DQAIL+EE+R+V+IRFGHDWD TCM+MDEV+ S+AE +KNFAV+YLVDITEVPDF
Sbjct  21   TGW-IDQAILSEEDRVVVIRFGHDWDPTCMKMDEVVYSIAEKVKNFAVIYLVDITEVPDF  79

Query  233  NTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVYRGARKGRGL  412
            N MYELYDP TVMFFFRNKHIMIDLGTGNNNKINWA++DKQE IDI+ETVYRGARKGRGL
Sbjct  80   NKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWAMEDKQEMIDIIETVYRGARKGRGL  139

Query  413  VIAPKDYSTKYRY  451
            V++PKDYSTKYRY
Sbjct  140  VVSPKDYSTKYRY  152



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 933768211125