BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001O24

Length=500
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009601121.1|  PREDICTED: glucose-6-phosphate/phosphate tra...    100   9e-22   Nicotiana tomentosiformis
ref|XP_009785267.1|  PREDICTED: glucose-6-phosphate/phosphate tra...  99.0    2e-21   Nicotiana sylvestris
ref|XP_006366041.1|  PREDICTED: glucose-6-phosphate/phosphate tra...  94.4    1e-19   Solanum tuberosum [potatoes]
emb|CDP05779.1|  unnamed protein product                              83.2    1e-15   Coffea canephora [robusta coffee]
ref|XP_004244144.1|  PREDICTED: glucose-6-phosphate/phosphate tra...  81.6    3e-15   Solanum lycopersicum
ref|XP_011095359.1|  PREDICTED: glucose-6-phosphate/phosphate tra...  73.6    3e-12   Sesamum indicum [beniseed]
ref|XP_011009303.1|  PREDICTED: glucose-6-phosphate/phosphate tra...  73.6    3e-12   Populus euphratica
ref|XP_011009302.1|  PREDICTED: glucose-6-phosphate/phosphate tra...  73.2    3e-12   Populus euphratica
ref|XP_006370658.1|  glucose-6-phosphate/phosphate-translocator p...  72.4    6e-12   
gb|KDP39078.1|  hypothetical protein JCGZ_00835                       71.6    1e-11   Jatropha curcas
ref|XP_004142557.1|  PREDICTED: glucose-6-phosphate/phosphate tra...  68.9    1e-10   
ref|XP_004294354.1|  PREDICTED: glucose-6-phosphate/phosphate tra...  68.2    2e-10   Fragaria vesca subsp. vesca
ref|XP_008463436.1|  PREDICTED: glucose-6-phosphate/phosphate tra...  68.2    2e-10   Cucumis melo [Oriental melon]
ref|XP_011030834.1|  PREDICTED: glucose-6-phosphate/phosphate tra...  68.2    2e-10   Populus euphratica
ref|XP_008454525.1|  PREDICTED: glucose-6-phosphate/phosphate tra...  67.4    4e-10   
ref|XP_006377841.1|  hypothetical protein POPTR_0011s13920g           66.6    5e-10   
ref|XP_002316985.2|  glucose-6-phosphate/phosphate-translocator p...  66.2    8e-10   Populus trichocarpa [western balsam poplar]
ref|XP_004152937.1|  PREDICTED: glucose-6-phosphate/phosphate tra...  65.9    1e-09   Cucumis sativus [cucumbers]
ref|XP_007213874.1|  hypothetical protein PRUPE_ppa006795mg           65.5    2e-09   Prunus persica
gb|EYU19234.1|  hypothetical protein MIMGU_mgv1a007836mg              63.2    1e-08   Erythranthe guttata [common monkey flower]
ref|XP_002523008.1|  Glucose-6-phosphate/phosphate translocator 1...  62.8    1e-08   Ricinus communis
ref|XP_008226825.1|  PREDICTED: glucose-6-phosphate/phosphate tra...  61.6    3e-08   Prunus mume [ume]
ref|XP_009358127.1|  PREDICTED: glucose-6-phosphate/phosphate tra...  58.5    4e-07   Pyrus x bretschneideri [bai li]
ref|XP_009342585.1|  PREDICTED: glucose-6-phosphate/phosphate tra...  58.5    4e-07   Pyrus x bretschneideri [bai li]
ref|XP_011097912.1|  PREDICTED: glucose-6-phosphate/phosphate tra...  57.8    5e-07   Sesamum indicum [beniseed]
gb|EPS72032.1|  glucose-6-phosphate/phosphate translocator 1, chl...  57.0    9e-07   Genlisea aurea
ref|XP_008365529.1|  PREDICTED: glucose-6-phosphate/phosphate tra...  56.6    2e-06   
gb|KDO50251.1|  hypothetical protein CISIN_1g0163482mg                55.1    3e-06   Citrus sinensis [apfelsine]
ref|XP_006452222.1|  hypothetical protein CICLE_v10008564mg           55.1    5e-06   Citrus clementina [clementine]
ref|XP_010276000.1|  PREDICTED: glucose-6-phosphate/phosphate tra...  53.9    1e-05   Nelumbo nucifera [Indian lotus]
ref|XP_010060420.1|  PREDICTED: glucose-6-phosphate/phosphate tra...  53.5    1e-05   Eucalyptus grandis [rose gum]
ref|XP_006493943.1|  PREDICTED: glucose-6-phosphate/phosphate tra...  53.5    1e-05   Citrus sinensis [apfelsine]
gb|KCW67182.1|  hypothetical protein EUGRSUZ_F00969                   53.1    2e-05   Eucalyptus grandis [rose gum]
gb|ACJ84766.1|  unknown                                               52.0    2e-05   Medicago truncatula
gb|AEJ36128.1|  triosephosphate translocator                          49.3    5e-05   Trifolium repens [creeping white clover]
gb|KJB81792.1|  hypothetical protein B456_013G161500                  52.0    5e-05   Gossypium raimondii
ref|XP_003599946.1|  Glucose-6-phosphate/phosphate-translocator       52.0    5e-05   Medicago truncatula
gb|KJB81793.1|  hypothetical protein B456_013G161500                  51.6    6e-05   Gossypium raimondii
ref|XP_009378791.1|  PREDICTED: glucose-6-phosphate/phosphate tra...  51.6    7e-05   Pyrus x bretschneideri [bai li]
gb|AEJ36127.1|  triosephosphate translocator                          48.1    1e-04   Trigonella kotschyi
gb|KHG04645.1|  Glucose-6-phosphate/phosphate translocator 1, chl...  50.4    2e-04   Gossypium arboreum [tree cotton]
gb|ABY82455.1|  triosephosphate translocator                          47.8    2e-04   Galega orientalis
ref|XP_007020963.1|  Glucose 6-phosphate/phosphate translocator 1...  50.4    2e-04   Theobroma cacao [chocolate]
ref|XP_010267729.1|  PREDICTED: glucose-6-phosphate/phosphate tra...  48.5    6e-04   Nelumbo nucifera [Indian lotus]
ref|XP_003545023.1|  PREDICTED: glucose-6-phosphate/phosphate tra...  48.1    0.001   Glycine max [soybeans]
ref|XP_003519563.1|  PREDICTED: glucose-6-phosphate/phosphate tra...  48.1    0.001   Glycine max [soybeans]
gb|KHN38297.1|  Glucose-6-phosphate/phosphate translocator 1, chl...  48.1    0.001   Glycine soja [wild soybean]



>ref|XP_009601121.1| PREDICTED: glucose-6-phosphate/phosphate translocator 1, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=398

 Score =   100 bits (248),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 52/101 (51%), Positives = 72/101 (71%), Gaps = 4/101 (4%)
 Frame = +1

Query  202  MISAVRQSGPLAIRGSDFFRPK--SPAPAPKLCVLPPLPALKPCRGSVLSLARPVHVSSV  375
            MIS V+QS  + + GSDF R K  +     +  +LPPLPA+ P R S +SL++P++VSSV
Sbjct  1    MISTVKQSA-VTLNGSDFNRSKFQTLTSLRRFSLLPPLPAMNPRRNSGVSLSKPIYVSSV  59

Query  376  ETFGSLKERSRGDDHEKRALVTCKAYEADRSQPIEEPAAKS  498
            E FG+L+ RS+G D EK  LV CKAYEADR++PI+ P +K+
Sbjct  60   EKFGTLR-RSKGHDQEKSCLVKCKAYEADRAEPIDGPESKT  99



>ref|XP_009785267.1| PREDICTED: glucose-6-phosphate/phosphate translocator 1, chloroplastic-like 
[Nicotiana sylvestris]
Length=398

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 51/101 (50%), Positives = 72/101 (71%), Gaps = 4/101 (4%)
 Frame = +1

Query  202  MISAVRQSGPLAIRGSDFFRPK--SPAPAPKLCVLPPLPALKPCRGSVLSLARPVHVSSV  375
            MIS V+QS  + + GSDF R K  +     +  +LPPLPA+ P + S +SL++P++VSSV
Sbjct  1    MISTVKQSA-VTLNGSDFNRSKFQTLTSLRRFSLLPPLPAMNPSQSSGVSLSKPIYVSSV  59

Query  376  ETFGSLKERSRGDDHEKRALVTCKAYEADRSQPIEEPAAKS  498
            E FG+L+ RS+G D EK  LV CKAYEADR++PI+ P +K+
Sbjct  60   EKFGTLR-RSKGHDQEKSCLVKCKAYEADRAEPIDGPESKT  99



>ref|XP_006366041.1| PREDICTED: glucose-6-phosphate/phosphate translocator 1, chloroplastic-like 
[Solanum tuberosum]
Length=396

 Score = 94.4 bits (233),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 52/101 (51%), Positives = 68/101 (67%), Gaps = 6/101 (6%)
 Frame = +1

Query  202  MISAVRQSGPLAIRGSDFFRPKSPAPAP--KLCVLPPLPALKPCRGSVLSLARPVHVSSV  375
            MIS V+QS    I G DF R KS + A   ++ VLPPLPA+K  R S +S+++PV VSSV
Sbjct  1    MISTVKQSA-FTINGCDFIRSKSQSLASSRRISVLPPLPAMKSRRSSGVSISKPVFVSSV  59

Query  376  ETFGSLKERSRGDDHEKRALVTCKAYEADRSQPIEEPAAKS  498
            E+FG LK   R ++     LV CKAYEADR++PIE P +K+
Sbjct  60   ESFGGLK---RSNEKTDSGLVKCKAYEADRAEPIEGPESKT  97



>emb|CDP05779.1| unnamed protein product [Coffea canephora]
Length=408

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 52/111 (47%), Positives = 73/111 (66%), Gaps = 14/111 (13%)
 Frame = +1

Query  202  MISAVRQSGPLA-IRGSDFFRPKSPAPAPKLCVLPPLPALKP-CRGSVLSLARPVHVSSV  375
            M+S+++Q  P+    GSD FRP+S  P+ +  VLPPLPAL      SV+SL++P+ VS V
Sbjct  1    MMSSLKQ--PVVHFHGSDAFRPQSSVPSRRFSVLPPLPALNTRWSSSVVSLSKPLFVSKV  58

Query  376  ETF---GSLK-ERSRGD----DH--EKRALVTCKAYEADRSQPIEEPAAKS  498
            E+F   G+LK   S GD    DH  +KR L+ C+AYEAD+S PI++  A+S
Sbjct  59   ESFSPLGTLKRSSSTGDAGDNDHVPQKRDLIICRAYEADKSIPIDDSQARS  109



>ref|XP_004244144.1| PREDICTED: glucose-6-phosphate/phosphate translocator 1, chloroplastic 
[Solanum lycopersicum]
Length=396

 Score = 81.6 bits (200),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 68/101 (67%), Gaps = 6/101 (6%)
 Frame = +1

Query  202  MISAVRQSGPLAIRGSDFFRPKSPAPAP--KLCVLPPLPALKPCRGSVLSLARPVHVSSV  375
            M+S V+Q+    I G DF R KS + A   ++ +LPPLPA+K  R S +S+++PV VSSV
Sbjct  1    MMSTVKQAA-FTINGCDFIRSKSQSLASTRRISLLPPLPAMKSRRSSGVSVSKPVFVSSV  59

Query  376  ETFGSLKERSRGDDHEKRALVTCKAYEADRSQPIEEPAAKS  498
            E+FG LK   R ++     LV CKAYEADR++P+E P +K+
Sbjct  60   ESFGGLK---RSNEKTDSGLVKCKAYEADRAEPMEGPESKA  97



>ref|XP_011095359.1| PREDICTED: glucose-6-phosphate/phosphate translocator 1, chloroplastic-like 
[Sesamum indicum]
Length=391

 Score = 73.6 bits (179),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 48/100 (48%), Positives = 65/100 (65%), Gaps = 9/100 (9%)
 Frame = +1

Query  202  MISAVRQSGPLAIRGSDFFRPKSPAPAPKLCVLPPLPALKPCRGSVLSLARPVHVSSVET  381
            MIS+++Q   L +  S+F   +    A    VLP LPA+K  RG+V+SL++P+HVS VE+
Sbjct  1    MISSLKQPA-LPLHDSNFRHSRRNFLARHSPVLPSLPAVKTSRGAVVSLSKPLHVSKVES  59

Query  382  FGSLKERSRGDDHEKRALVTCKAYEADRSQPIEEPA-AKS  498
            F   KE+       K +L+TCKAYEADRS+PI E A AKS
Sbjct  60   FSINKEK-------KPSLITCKAYEADRSKPIVESAEAKS  92



>ref|XP_011009303.1| PREDICTED: glucose-6-phosphate/phosphate translocator 1, chloroplastic 
isoform X2 [Populus euphratica]
Length=392

 Score = 73.6 bits (179),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 46/101 (46%), Positives = 62/101 (61%), Gaps = 10/101 (10%)
 Frame = +1

Query  202  MISAVRQSGPL-AIRGSD-FFRPKSPAPAPKLCVLPPLPALKPCRGSVLSLARPVHVSSV  375
            MI +V+QS     I GSD  FR K+P+   +  +LP L   K  +  VLS+++P+HVS V
Sbjct  1    MICSVKQSVITPTINGSDTIFRRKNPSAIQRSLILPSLNGNKSSK-PVLSMSKPLHVSKV  59

Query  376  ETFGSLKERSRGDDHEKRALVTCKAYEADRSQPIEEPAAKS  498
            E+F   K        +KR+L+TC AYEADRS+PIE P  KS
Sbjct  60   ESFALSKP-------QKRSLITCNAYEADRSEPIEAPVVKS  93



>ref|XP_011009302.1| PREDICTED: glucose-6-phosphate/phosphate translocator 1, chloroplastic 
isoform X1 [Populus euphratica]
Length=400

 Score = 73.2 bits (178),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 46/101 (46%), Positives = 62/101 (61%), Gaps = 10/101 (10%)
 Frame = +1

Query  202  MISAVRQSGPL-AIRGSD-FFRPKSPAPAPKLCVLPPLPALKPCRGSVLSLARPVHVSSV  375
            MI +V+QS     I GSD  FR K+P+   +  +LP L   K  +  VLS+++P+HVS V
Sbjct  1    MICSVKQSVITPTINGSDTIFRRKNPSAIQRSLILPSLNGNKSSK-PVLSMSKPLHVSKV  59

Query  376  ETFGSLKERSRGDDHEKRALVTCKAYEADRSQPIEEPAAKS  498
            E+F   K        +KR+L+TC AYEADRS+PIE P  KS
Sbjct  60   ESFALSKP-------QKRSLITCNAYEADRSEPIEAPVVKS  93



>ref|XP_006370658.1| glucose-6-phosphate/phosphate-translocator precursor family protein 
[Populus trichocarpa]
 gb|ERP67227.1| glucose-6-phosphate/phosphate-translocator precursor family protein 
[Populus trichocarpa]
Length=400

 Score = 72.4 bits (176),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 46/101 (46%), Positives = 62/101 (61%), Gaps = 10/101 (10%)
 Frame = +1

Query  202  MISAVRQSGPL-AIRGSD-FFRPKSPAPAPKLCVLPPLPALKPCRGSVLSLARPVHVSSV  375
            MI +V+QS     I GSD  FR K+P+   +  +LP L   K  +  VLS+++P+HVS V
Sbjct  1    MICSVKQSVITPTINGSDTIFRRKNPSAIQRSLILPSLNGNKSSK-PVLSMSKPLHVSKV  59

Query  376  ETFGSLKERSRGDDHEKRALVTCKAYEADRSQPIEEPAAKS  498
            E+F   K        +KR+L+TC AYEADRS+PIE P  KS
Sbjct  60   ESFALSKP-------QKRSLITCNAYEADRSEPIEAPEVKS  93



>gb|KDP39078.1| hypothetical protein JCGZ_00835 [Jatropha curcas]
Length=392

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 46/101 (46%), Positives = 63/101 (62%), Gaps = 10/101 (10%)
 Frame = +1

Query  202  MISAVRQSGPL-AIRGSD-FFRPKSPAPAPKLCVLPPLPALKPCRGSVLSLARPVHVSSV  375
            MI  V+QS  L  I GS+  FR K+P    +   LP LPA K  + +VL++++P+HVSS+
Sbjct  1    MICTVKQSALLPTINGSETIFRRKNPFTTQRSLFLPSLPAKKSPK-TVLAVSKPLHVSSI  59

Query  376  ETFGSLKERSRGDDHEKRALVTCKAYEADRSQPIEEPAAKS  498
            E+F   K        +K +L+TCKAYEADRSQPI+    KS
Sbjct  60   ESFALPKP-------QKESLITCKAYEADRSQPIDAAETKS  93



>ref|XP_004142557.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic-like 
[Cucumis sativus]
 ref|XP_004157149.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic-like 
[Cucumis sativus]
 gb|KGN66695.1| hypothetical protein Csa_1G660150 [Cucumis sativus]
Length=396

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 44/94 (47%), Positives = 56/94 (60%), Gaps = 10/94 (11%)
 Frame = +1

Query  202  MISAVRQSGPLAIRGSD-FFRPKSPAPAPKLCVLPPLPALKPCRGSVLSLARPVHVSSVE  378
            MI AV+Q     I  SD   R K+  P+ +   LPPLP  KP R S +S+ + VHVSS+E
Sbjct  1    MICAVKQCSR-GIHCSDGVIRSKTSVPSQRSSFLPPLPVQKP-RNSAISVYKAVHVSSLE  58

Query  379  TFGSLKERSRGDDHEKRALVTCKAYEADRSQPIE  480
             FG+L  R       K  L+ C+AYEA+RSQPIE
Sbjct  59   NFGTLGVR-------KANLIKCEAYEAERSQPIE  85



>ref|XP_004294354.1| PREDICTED: glucose-6-phosphate/phosphate translocator 1, chloroplastic-like 
[Fragaria vesca subsp. vesca]
Length=391

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 64/97 (66%), Gaps = 13/97 (13%)
 Frame = +1

Query  202  MISAVRQSGPLAIRGSD-FFRPKS-PAPAPKLCVLPPLPALKPCRGSVLSLARPVHVSSV  375
            MI +++QS P    G D + RP++ PA    L  LP LP LK  + SVLS+ +P+H+SS+
Sbjct  1    MICSLKQS-PAITSGCDVYLRPRTLPAVQGSLH-LPSLP-LKNFQRSVLSVQKPLHISSL  57

Query  376  ETFGSLKERSRGDDHEKRALVTCKAYEADRSQPIEEP  486
            E+FGSLK R+        +L+ C+AYEAD+S+PIE P
Sbjct  58   ESFGSLKSRT--------SLIKCQAYEADQSEPIELP  86



>ref|XP_008463436.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic-like 
[Cucumis melo]
Length=396

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 44/94 (47%), Positives = 53/94 (56%), Gaps = 10/94 (11%)
 Frame = +1

Query  202  MISAVRQSGPLAIRGSD-FFRPKSPAPAPKLCVLPPLPALKPCRGSVLSLARPVHVSSVE  378
            MIS++ QS    I GSD   R  SP P  +    P LPA KP   SV+ +   +H+SSV 
Sbjct  1    MISSLTQSAK-PINGSDVILRRSSPVPIRRFSYSPSLPAQKP-HNSVVCMKNALHISSVS  58

Query  379  TFGSLKERSRGDDHEKRALVTCKAYEADRSQPIE  480
             FG+L         +KR   TCKAYEADRSQPIE
Sbjct  59   KFGTLGT-------QKRDFNTCKAYEADRSQPIE  85



>ref|XP_011030834.1| PREDICTED: glucose-6-phosphate/phosphate translocator 1, chloroplastic-like 
[Populus euphratica]
Length=391

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 45/101 (45%), Positives = 60/101 (59%), Gaps = 11/101 (11%)
 Frame = +1

Query  202  MISAVRQSGPL-AIRGSD-FFRPKSPAPAPKLCVLPPLPALKPCRGSVLSLARPVHVSSV  375
            MI +++QS     I GSD  FR K+ +   +  +LP L A K     VLS+++P+HVS V
Sbjct  1    MICSIKQSTMTPTINGSDTIFRRKNMSAIQRSLILPSLNANK--SKPVLSMSKPLHVSKV  58

Query  376  ETFGSLKERSRGDDHEKRALVTCKAYEADRSQPIEEPAAKS  498
            E+F   K        +KR L+TCKAYEADRS+PIE    KS
Sbjct  59   ESFALSKP-------QKRTLITCKAYEADRSEPIEASEVKS  92



>ref|XP_008454525.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic-like 
[Cucumis melo]
Length=396

 Score = 67.4 bits (163),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 45/94 (48%), Positives = 56/94 (60%), Gaps = 10/94 (11%)
 Frame = +1

Query  202  MISAVRQSGPLAIRGSD-FFRPKSPAPAPKLCVLPPLPALKPCRGSVLSLARPVHVSSVE  378
            MI AV+Q    AI  SD   R K+  P+     LPPLP  KP R S +S+ + VHVSS+E
Sbjct  1    MICAVKQCSR-AIHCSDGAIRSKTSVPSRGSSFLPPLPVQKP-RNSAISVHKAVHVSSLE  58

Query  379  TFGSLKERSRGDDHEKRALVTCKAYEADRSQPIE  480
             FG+L  R       K  L+ C+AYEA+RSQPIE
Sbjct  59   NFGTLGVR-------KANLIKCEAYEAERSQPIE  85



>ref|XP_006377841.1| hypothetical protein POPTR_0011s13920g [Populus trichocarpa]
 gb|ERP55638.1| hypothetical protein POPTR_0011s13920g [Populus trichocarpa]
Length=378

 Score = 66.6 bits (161),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 45/101 (45%), Positives = 61/101 (60%), Gaps = 11/101 (11%)
 Frame = +1

Query  202  MISAVRQSGPL-AIRGSD-FFRPKSPAPAPKLCVLPPLPALKPCRGSVLSLARPVHVSSV  375
            MI +++QS     I GSD  FR K+ +   +  +LP L A K     VLS+++P+HVS V
Sbjct  1    MICSIKQSTITPTINGSDTIFRRKNMSAIQRSLILPSLNANKS--KPVLSMSKPLHVSKV  58

Query  376  ETFGSLKERSRGDDHEKRALVTCKAYEADRSQPIEEPAAKS  498
            E+F      SR    +KR ++TCKAYEADRS+PIE    KS
Sbjct  59   ESFA----LSR---PQKRTMITCKAYEADRSEPIEASEVKS  92



>ref|XP_002316985.2| glucose-6-phosphate/phosphate-translocator precursor family protein 
[Populus trichocarpa]
 gb|EEE97597.2| glucose-6-phosphate/phosphate-translocator precursor family protein 
[Populus trichocarpa]
Length=391

 Score = 66.2 bits (160),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 45/101 (45%), Positives = 61/101 (60%), Gaps = 11/101 (11%)
 Frame = +1

Query  202  MISAVRQSGPL-AIRGSD-FFRPKSPAPAPKLCVLPPLPALKPCRGSVLSLARPVHVSSV  375
            MI +++QS     I GSD  FR K+ +   +  +LP L A K     VLS+++P+HVS V
Sbjct  1    MICSIKQSTITPTINGSDTIFRRKNMSAIQRSLILPSLNANK--SKPVLSMSKPLHVSKV  58

Query  376  ETFGSLKERSRGDDHEKRALVTCKAYEADRSQPIEEPAAKS  498
            E+F      SR    +KR ++TCKAYEADRS+PIE    KS
Sbjct  59   ESFA----LSRP---QKRTMITCKAYEADRSEPIEASEVKS  92



>ref|XP_004152937.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic-like 
[Cucumis sativus]
 ref|XP_004164339.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic-like 
[Cucumis sativus]
 gb|KGN56144.1| hypothetical protein Csa_3G078260 [Cucumis sativus]
Length=396

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 43/94 (46%), Positives = 52/94 (55%), Gaps = 10/94 (11%)
 Frame = +1

Query  202  MISAVRQSGPLAIRGSD-FFRPKSPAPAPKLCVLPPLPALKPCRGSVLSLARPVHVSSVE  378
            MIS++ QS   +I GSD   R  SP P  +    P LPA KP   SV+ +   +H+SSV 
Sbjct  1    MISSLTQSAK-SINGSDVILRRSSPVPIRRFSCSPSLPAQKP-HSSVVCVKNALHISSVS  58

Query  379  TFGSLKERSRGDDHEKRALVTCKAYEADRSQPIE  480
             FG+L  R       K     CKAYEADRSQPIE
Sbjct  59   NFGTLGTR-------KSDFNACKAYEADRSQPIE  85



>ref|XP_007213874.1| hypothetical protein PRUPE_ppa006795mg [Prunus persica]
 gb|EMJ15073.1| hypothetical protein PRUPE_ppa006795mg [Prunus persica]
Length=395

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 41/94 (44%), Positives = 58/94 (62%), Gaps = 11/94 (12%)
 Frame = +1

Query  202  MISAVRQSGPLAIRGSD-FFRPKSPAPAPKLCVLPPLPALKPCRGSVLSLARPVHVSSVE  378
            MI +V+Q   +   GSD F R  +  P  +  +LP LP  K  R SV+S+ + +HVS++E
Sbjct  1    MICSVKQYSTIT-NGSDIFLRQSTRPPMQRSLLLPSLPVQKSQR-SVISVQKALHVSAIE  58

Query  379  TFGSLKERSRGDDHEKRALVTCKAYEADRSQPIE  480
            +FGS K R+        +L+ C+AYEADRSQPIE
Sbjct  59   SFGSPKPRT--------SLIKCQAYEADRSQPIE  84



>gb|EYU19234.1| hypothetical protein MIMGU_mgv1a007836mg [Erythranthe guttata]
Length=394

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 44/102 (43%), Positives = 60/102 (59%), Gaps = 10/102 (10%)
 Frame = +1

Query  202  MISAVRQSGPLAIRGSDFFRPKSPAPAPKLCVLPPLPAL-KPCRGSVLSLARPVHVSSVE  378
            MIS+++QS   ++ GS F +P+   P        P  A  KP R   +SL++P+HVS V 
Sbjct  1    MISSLKQSA-FSLHGSSFLQPRRNFPTHHSAAALPSLAAAKPLRSKTISLSKPLHVSKVG  59

Query  379  TFGSLKERSRGDDHEKRAL-VTCKAYEADRSQPI-EEPAAKS  498
            +F      S  D+ E+R+  VTCKAYEADRS+PI E P  KS
Sbjct  60   SF------SVVDEEERRSSPVTCKAYEADRSEPILESPEVKS  95



>ref|XP_002523008.1| Glucose-6-phosphate/phosphate translocator 1, chloroplast precursor, 
putative [Ricinus communis]
 gb|EEF39438.1| Glucose-6-phosphate/phosphate translocator 1, chloroplast precursor, 
putative [Ricinus communis]
Length=392

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 44/101 (44%), Positives = 57/101 (56%), Gaps = 10/101 (10%)
 Frame = +1

Query  202  MISAVRQSGPL-AIRGSD-FFRPKSPAPAPKLCVLPPLPALKPCRGSVLSLARPVHVSSV  375
            MI  ++QS     I GSD  FR K   P      LP L   K  R S+LSL++P+HVSS+
Sbjct  1    MICTIKQSVVTPTINGSDAIFRRKVQPPTRGSLFLPSLSIQKSQR-SLLSLSKPLHVSSI  59

Query  376  ETFGSLKERSRGDDHEKRALVTCKAYEADRSQPIEEPAAKS  498
            E+       S     ++ +L+TCKAYEADRSQPI+    KS
Sbjct  60   ES-------SFAVPSKESSLITCKAYEADRSQPIDTTEGKS  93



>ref|XP_008226825.1| PREDICTED: glucose-6-phosphate/phosphate translocator 1, chloroplastic-like 
[Prunus mume]
Length=395

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 40/94 (43%), Positives = 57/94 (61%), Gaps = 11/94 (12%)
 Frame = +1

Query  202  MISAVRQSGPLAIRGSD-FFRPKSPAPAPKLCVLPPLPALKPCRGSVLSLARPVHVSSVE  378
            MI +V+Q   +   GSD F R  +  P  +  +LP LP  K  R SV+S+ + +HVS++E
Sbjct  1    MICSVKQYSTIT-NGSDIFLRQSTRPPMQRSLLLPSLPVQKSQR-SVISVQKALHVSAIE  58

Query  379  TFGSLKERSRGDDHEKRALVTCKAYEADRSQPIE  480
            +F S K R+        +L+ C+AYEADRSQPIE
Sbjct  59   SFRSPKPRT--------SLIKCQAYEADRSQPIE  84



>ref|XP_009358127.1| PREDICTED: glucose-6-phosphate/phosphate translocator 1, chloroplastic-like 
[Pyrus x bretschneideri]
Length=398

 Score = 58.5 bits (140),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 37/95 (39%), Positives = 56/95 (59%), Gaps = 10/95 (11%)
 Frame = +1

Query  202  MISAVRQSGPLAIRGSDFF--RPKSPAPAPKLCVLPPLPALKPCRGSVLSLARPVHVSSV  375
            MI +V+Q   +   GSD F  R   P P  +   LP LPA +P R  + SL + +HVS++
Sbjct  1    MICSVKQYTGVT-NGSDIFLRRSTRPPPVQRSLFLPSLPAHQPHRSGI-SLQKALHVSAI  58

Query  376  ETFGSLKERSRGDDHEKRALVTCKAYEADRSQPIE  480
             + G+L + +R       +++ C+A+EADRSQPIE
Sbjct  59   GSLGALPKPTR------MSVIKCQAFEADRSQPIE  87



>ref|XP_009342585.1| PREDICTED: glucose-6-phosphate/phosphate translocator 1, chloroplastic-like 
[Pyrus x bretschneideri]
Length=398

 Score = 58.5 bits (140),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 37/95 (39%), Positives = 56/95 (59%), Gaps = 10/95 (11%)
 Frame = +1

Query  202  MISAVRQSGPLAIRGSDFF--RPKSPAPAPKLCVLPPLPALKPCRGSVLSLARPVHVSSV  375
            MI +V+Q   +   GSD F  R   P P  +   LP LPA +P R  + SL + +HVS++
Sbjct  1    MICSVKQYTGVT-NGSDIFLRRSTRPPPVQRSLFLPSLPAHQPHRSGI-SLQKALHVSAI  58

Query  376  ETFGSLKERSRGDDHEKRALVTCKAYEADRSQPIE  480
             + G+L + +R       +++ C+A+EADRSQPIE
Sbjct  59   GSLGALPKPTR------MSVIKCQAFEADRSQPIE  87



>ref|XP_011097912.1| PREDICTED: glucose-6-phosphate/phosphate translocator 1, chloroplastic-like 
[Sesamum indicum]
Length=391

 Score = 57.8 bits (138),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 43/102 (42%), Positives = 62/102 (61%), Gaps = 13/102 (13%)
 Frame = +1

Query  202  MISAV--RQSGPLAIRGSDFFRPKSPAPAPKLCVLPPLPALKPCRGSVLSLARPVHVSSV  375
            MIS+V  +Q   L+I GSDF + +     P+    P  PA +P R  VLSL++P+H+S V
Sbjct  1    MISSVSVKQPTGLSIHGSDFLQARRKF-LPRHS--PVFPA-EPRRTFVLSLSKPLHISKV  56

Query  376  ETFGSLKERSRGDDHEKRALVTCKAYEADRSQPI-EEPAAKS  498
            E+F +      G +  +R  + CKAYEA+RS+PI E P A+S
Sbjct  57   ESFSA----DAGTEGSRR--IVCKAYEAERSEPIGESPEARS  92



>gb|EPS72032.1| glucose-6-phosphate/phosphate translocator 1, chloroplastic, 
partial [Genlisea aurea]
Length=313

 Score = 57.0 bits (136),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 49/86 (57%), Gaps = 10/86 (12%)
 Frame = +1

Query  235  AIRGSDFFRPKSPAPAPKLCVLPPLPALKPCRGSVLSLARPVHVSSVETFGSLKERSRGD  414
            ++ GS+F   +   PA +   L P    +P R S+++L+RP+++S  E+F      S GD
Sbjct  1    SVNGSNFLPSRRRFPAAQSLTLTPFTLGEPRRTSIVNLSRPLYISKAESF------SGGD  54

Query  415  DHEKRALVTCKAYEADRSQPIEEPAA  492
                RA + C AYEADRS+PI   AA
Sbjct  55   ----RASIACNAYEADRSEPITGAAA  76



>ref|XP_008365529.1| PREDICTED: glucose-6-phosphate/phosphate translocator 1, chloroplastic-like 
[Malus domestica]
 ref|XP_008345056.1| PREDICTED: glucose-6-phosphate/phosphate translocator 1, chloroplastic-like 
[Malus domestica]
Length=398

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 37/95 (39%), Positives = 55/95 (58%), Gaps = 10/95 (11%)
 Frame = +1

Query  202  MISAVRQSGPLAIRGSDFF--RPKSPAPAPKLCVLPPLPALKPCRGSVLSLARPVHVSSV  375
            MI +V+Q   +   GSD F  R   P P  +   LP LPA +  R  + S+ + +HVS++
Sbjct  1    MICSVKQYTGVT-NGSDIFLRRSTRPPPVQRSLFLPXLPAHQXQRSGI-SVQKALHVSAI  58

Query  376  ETFGSLKERSRGDDHEKRALVTCKAYEADRSQPIE  480
             T G+L + +R       ++V C+A+EADRSQPIE
Sbjct  59   ATLGALPKPTR------MSVVKCQAFEADRSQPIE  87



>gb|KDO50251.1| hypothetical protein CISIN_1g0163482mg, partial [Citrus sinensis]
Length=242

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 40/101 (40%), Positives = 60/101 (59%), Gaps = 11/101 (11%)
 Frame = +1

Query  202  MISAVRQSGPLA-IRGSD-FFRPKSPAPAPKLCVLPPLPALKPCRGSVLSLARPVHVSSV  375
            MIS+++ + P A I GSD  FR +  +P  +   LPPL  +     S  SL+RP+H+S+V
Sbjct  1    MISSIKATVPTATINGSDSIFRKRLLSPTQRSLFLPPL-QVDSSSKSEFSLSRPLHISNV  59

Query  376  ETFGSLKERSRGDDHEKRALVTCKAYEADRSQPIEEPAAKS  498
              F  ++         +++L+ CKAYEA++SQPIE   AKS
Sbjct  60   SCFEPVRV--------QKSLIKCKAYEAEQSQPIEREEAKS  92



>ref|XP_006452222.1| hypothetical protein CICLE_v10008564mg [Citrus clementina]
 gb|ESR65462.1| hypothetical protein CICLE_v10008564mg [Citrus clementina]
Length=391

 Score = 55.1 bits (131),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 40/101 (40%), Positives = 60/101 (59%), Gaps = 11/101 (11%)
 Frame = +1

Query  202  MISAVRQSGPLA-IRGSD-FFRPKSPAPAPKLCVLPPLPALKPCRGSVLSLARPVHVSSV  375
            MIS+++ + P A I GSD  FR +  +P  +   LPPL  +     S  SL+RP+H+S+V
Sbjct  1    MISSIKATVPTATINGSDSIFRKRLLSPTQRSLFLPPLQ-VDSSSKSEFSLSRPLHISNV  59

Query  376  ETFGSLKERSRGDDHEKRALVTCKAYEADRSQPIEEPAAKS  498
              F  ++ +        ++L+ CKAYEA++SQPIE   AKS
Sbjct  60   SCFEPVRVQ--------KSLIKCKAYEAEQSQPIEREEAKS  92



>ref|XP_010276000.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic-like 
[Nelumbo nucifera]
 ref|XP_010276002.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic-like 
[Nelumbo nucifera]
 ref|XP_010276003.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic-like 
[Nelumbo nucifera]
Length=399

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 36/95 (38%), Positives = 54/95 (57%), Gaps = 9/95 (9%)
 Frame = +1

Query  202  MISAVRQSGP-LAIRGSDFFRPKSPAPAPKLCVLPP-LPALKPCRGSVLSLARPVHVSSV  375
            M+ +VR SG  L +      RPKS  P  ++ + P  L A KP  G  L   +P+++SS+
Sbjct  1    MMCSVRPSGTTLTVSDVSRLRPKSSVPQSRISLFPSMLSAKKPDSG--LWTRKPLYISSL  58

Query  376  ETFGSLKERSRGDDHEKRALVTCKAYEADRSQPIE  480
            + FGS +         ++ ++ CKAYEADRSQPI+
Sbjct  59   QGFGSFE-----GAKPRKPIIECKAYEADRSQPID  88



>ref|XP_010060420.1| PREDICTED: glucose-6-phosphate/phosphate translocator 1, chloroplastic-like 
[Eucalyptus grandis]
 gb|KCW67181.1| hypothetical protein EUGRSUZ_F00969 [Eucalyptus grandis]
Length=390

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 43/100 (43%), Positives = 59/100 (59%), Gaps = 12/100 (12%)
 Frame = +1

Query  202  MISAVRQS-GPLAIRGSD-FFRPKSPAPAPKLCVLPPLPALKPCRGSVLSLARPVH-VSS  372
            MI + RQS  P  + GS+     K   P+ +  +LPPL   K  R +V+SL+RP+H V+S
Sbjct  1    MICSARQSLSP--VHGSEVLLSQKRVFPSSRSSLLPPLRTQKSSR-AVVSLSRPLHIVAS  57

Query  373  VETFGSLKERSRGDDHEKRALVTCKAYEADRSQPIEEPAA  492
            VE+FG    R  G D     L+ C+AYEAD+S+PIE  A 
Sbjct  58   VESFGP-SPRREGKD-----LIKCEAYEADQSKPIEAGAG  91



>ref|XP_006493943.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic-like 
[Citrus sinensis]
Length=391

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 40/101 (40%), Positives = 59/101 (58%), Gaps = 11/101 (11%)
 Frame = +1

Query  202  MISAVRQSGPLA-IRGSD-FFRPKSPAPAPKLCVLPPLPALKPCRGSVLSLARPVHVSSV  375
            MIS+++ + P A I GSD  FR +  +P  +   LPPL  +     S  SL+RP+H+S+V
Sbjct  1    MISSIKATVPTATINGSDSIFRKRLLSPTQRSLFLPPLQ-VDSSSKSEFSLSRPLHISNV  59

Query  376  ETFGSLKERSRGDDHEKRALVTCKAYEADRSQPIEEPAAKS  498
              F  ++ +        ++L  CKAYEA++SQPIE   AKS
Sbjct  60   SCFEPVRVQ--------KSLTKCKAYEAEQSQPIEREEAKS  92



>gb|KCW67182.1| hypothetical protein EUGRSUZ_F00969 [Eucalyptus grandis]
Length=289

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 42/100 (42%), Positives = 59/100 (59%), Gaps = 12/100 (12%)
 Frame = +1

Query  202  MISAVRQS-GPLAIRGSD-FFRPKSPAPAPKLCVLPPLPALKPCRGSVLSLARPVH-VSS  372
            MI + RQS  P  + GS+     K   P+ +  +LPPL   K  R +V+SL+RP+H V+S
Sbjct  1    MICSARQSLSP--VHGSEVLLSQKRVFPSSRSSLLPPLRTQKSSR-AVVSLSRPLHIVAS  57

Query  373  VETFGSLKERSRGDDHEKRALVTCKAYEADRSQPIEEPAA  492
            VE+FG    R      E + L+ C+AYEAD+S+PIE  A 
Sbjct  58   VESFGPSPRR------EGKDLIKCEAYEADQSKPIEAGAG  91



>gb|ACJ84766.1| unknown [Medicago truncatula]
Length=218

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/96 (41%), Positives = 52/96 (54%), Gaps = 8/96 (8%)
 Frame = +1

Query  202  MISAVRQSGPLAIRGSDF-FRPKSPAPAPKLCVLPPLPALKPCRGSVLSLARPVHVS--S  372
            MIS++RQ G + I GSD   R +          LP L   K  R SV+S+ +P+H++   
Sbjct  1    MISSLRQPG-IVITGSDAGLRKRHATLVQPQSFLPSLVGGKSQR-SVISMKKPLHIACAG  58

Query  373  VETFGSLKE---RSRGDDHEKRALVTCKAYEADRSQ  471
            V  FGS+K     S     EK  LV C+AYEADRS+
Sbjct  59   VGNFGSVKNFEFESEKKSFEKGDLVKCEAYEADRSE  94



>gb|AEJ36128.1| triosephosphate translocator [Trifolium repens]
Length=102

 Score = 49.3 bits (116),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 44/82 (54%), Gaps = 4/82 (5%)
 Frame = +1

Query  235  AIRGSDFFRPKSPAPAPK-LCVLPPLPALKPCRGSVLSLARPVHVS--SVETFGSLKERS  405
            AI GSD    K  A   +    LP L + K  R SV+SL RP+H++   V  FGS+K   
Sbjct  1    AISGSDVVFGKRHATLIQPRSFLPSLISEKSHR-SVVSLKRPLHIACLGVGNFGSVKNFE  59

Query  406  RGDDHEKRALVTCKAYEADRSQ  471
                 EK  LV C AYEADRS+
Sbjct  60   TEKSFEKGDLVKCGAYEADRSE  81



>gb|KJB81792.1| hypothetical protein B456_013G161500 [Gossypium raimondii]
Length=390

 Score = 52.0 bits (123),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 27/65 (42%), Positives = 39/65 (60%), Gaps = 10/65 (15%)
 Frame = +1

Query  295  VLPPLPALKPCRGSVLSLARPVHVSSVETFGSLKERSRGDDHEKRALVTCKAYEADRSQP  474
            +LPPL      + + LSL++P+HVS+VE  G           +K  ++ C+AYEAD+SQP
Sbjct  32   ILPPLVFQNNSKRTNLSLSKPLHVSAVEIIG----------KDKEPVIKCRAYEADKSQP  81

Query  475  IEEPA  489
            IE  A
Sbjct  82   IEAAA  86



>ref|XP_003599946.1| Glucose-6-phosphate/phosphate-translocator [Medicago truncatula]
 gb|AES70197.1| glucose-6-phosphate/phosphate translocator-like protein [Medicago 
truncatula]
 gb|AFK43777.1| unknown [Medicago truncatula]
Length=401

 Score = 52.0 bits (123),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 39/96 (41%), Positives = 52/96 (54%), Gaps = 8/96 (8%)
 Frame = +1

Query  202  MISAVRQSGPLAIRGSDF-FRPKSPAPAPKLCVLPPLPALKPCRGSVLSLARPVHVS--S  372
            MIS++RQ G + I GSD   R +          LP L   K  R SV+S+ +P+H++   
Sbjct  1    MISSLRQPG-IVITGSDAGLRKRHATLVQPQSFLPSLVGGKSQR-SVISMKKPLHIACAG  58

Query  373  VETFGSLKE---RSRGDDHEKRALVTCKAYEADRSQ  471
            V  FGS+K     S     EK  LV C+AYEADRS+
Sbjct  59   VGNFGSVKNFEFESEKKSFEKGDLVKCEAYEADRSE  94



>gb|KJB81793.1| hypothetical protein B456_013G161500 [Gossypium raimondii]
Length=439

 Score = 51.6 bits (122),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 27/65 (42%), Positives = 39/65 (60%), Gaps = 10/65 (15%)
 Frame = +1

Query  295  VLPPLPALKPCRGSVLSLARPVHVSSVETFGSLKERSRGDDHEKRALVTCKAYEADRSQP  474
            +LPPL      + + LSL++P+HVS+VE  G           +K  ++ C+AYEAD+SQP
Sbjct  32   ILPPLVFQNNSKRTNLSLSKPLHVSAVEIIGK----------DKEPVIKCRAYEADKSQP  81

Query  475  IEEPA  489
            IE  A
Sbjct  82   IEAAA  86



>ref|XP_009378791.1| PREDICTED: glucose-6-phosphate/phosphate translocator 1, chloroplastic-like 
[Pyrus x bretschneideri]
Length=398

 Score = 51.6 bits (122),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 34/95 (36%), Positives = 51/95 (54%), Gaps = 10/95 (11%)
 Frame = +1

Query  202  MISAVRQSGPLAIRGSDFF--RPKSPAPAPKLCVLPPLPALKPCRGSVLSLARPVHVSSV  375
            MI +V+Q   +   G D F  R   P P  +  + P L   K  R SV+S+ + +HVS++
Sbjct  1    MICSVKQYSAVT-NGPDIFLRRSTRPTPVQRSLLFPSLQGQKTQR-SVISVQKALHVSAI  58

Query  376  ETFGSLKERSRGDDHEKRALVTCKAYEADRSQPIE  480
             + G L   +R   ++      C+A+EADRSQPIE
Sbjct  59   RSLGGLPTPTRTSVNK------CQAFEADRSQPIE  87



>gb|AEJ36127.1| triosephosphate translocator [Trigonella kotschyi]
Length=103

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/83 (40%), Positives = 43/83 (52%), Gaps = 4/83 (5%)
 Frame = +1

Query  232  LAIRGSDFFRPKSPAPAPK-LCVLPPLPALKPCRGSVLSLARPVHVS--SVETFGSLKER  402
            L I G D    K  A   +    LP L   K  R SV+S+ +P+H++   V  FGS+K  
Sbjct  1    LGINGCDVVLGKRHATLVQPQSFLPSLVGRKSQR-SVISVKKPLHITCIGVGNFGSVKNF  59

Query  403  SRGDDHEKRALVTCKAYEADRSQ  471
                  EK  LV C+AYEADRS+
Sbjct  60   ESEKGFEKGDLVKCEAYEADRSE  82



>gb|KHG04645.1| Glucose-6-phosphate/phosphate translocator 1, chloroplastic -like 
protein [Gossypium arboreum]
Length=439

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 39/65 (60%), Gaps = 10/65 (15%)
 Frame = +1

Query  295  VLPPLPALKPCRGSVLSLARPVHVSSVETFGSLKERSRGDDHEKRALVTCKAYEADRSQP  474
            +LPPL      + + LSL++P+HVS+VE  G           +K  ++ C+AYEAD+SQP
Sbjct  32   ILPPLVFQNNSKRTNLSLSKPLHVSAVEIIGK----------DKEPVIKCRAYEADKSQP  81

Query  475  IEEPA  489
            I+  A
Sbjct  82   IQAAA  86



>gb|ABY82455.1| triosephosphate translocator [Galega orientalis]
Length=102

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 47/89 (53%), Gaps = 7/89 (8%)
 Frame = +1

Query  238  IRGSDFFRPKSPAP--APKLCVLPPLPALKPCRGSVLSLARPVHVS--SVETFGSLKERS  405
            I GSD    K  A    P+L  LP L   K  R S++S+ +P+H++   V   GS+K   
Sbjct  1    ISGSDVVLGKRHATLVQPQLFFLPSLVREKTHR-SIVSVQKPLHLACLGVGNLGSVKNFE  59

Query  406  RGDDHEKRALVTCKAYEADRSQPIEEPAA  492
             G    K  LV C+AYEADRS+   EPA 
Sbjct  60   LGKSVGKNDLVKCEAYEADRSEI--EPAG  86



>ref|XP_007020963.1| Glucose 6-phosphate/phosphate translocator 1 isoform 1 [Theobroma 
cacao]
 gb|EOY12488.1| Glucose 6-phosphate/phosphate translocator 1 isoform 1 [Theobroma 
cacao]
Length=391

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 32/47 (68%), Gaps = 10/47 (21%)
 Frame = +1

Query  340  LSLARPVHVSSVETFGSLKERSRGDDHEKRALVTCKAYEADRSQPIE  480
            LS+++P+H+SS+E          G   EK+ L+ CKAYEADRSQPIE
Sbjct  49   LSVSKPLHISSIE----------GFVKEKKPLIQCKAYEADRSQPIE  85



>ref|XP_010267729.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic-like 
[Nelumbo nucifera]
Length=399

 Score = 48.5 bits (114),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 55/97 (57%), Gaps = 13/97 (13%)
 Frame = +1

Query  202  MISAVRQSGPLAIRGSDFF--RPKSPAPAPKLCVLPPLPALK-PCRGSVLSLARPVHVSS  372
            M+ +VRQS  + +  SD    RP +P    +L +L P+   K P  G  LS  +P+++SS
Sbjct  1    MMCSVRQSTAI-LTVSDLSKSRPNAPTSQSRLSLLSPVSIAKGPNFG--LSARKPLYISS  57

Query  373  VETFGSLK-ERSRGDDHEKRALVTCKAYEADRSQPIE  480
            ++ F S + ER R   +E      CKAYEADRS PI+
Sbjct  58   LQGFRSFEGERPRNSVNE------CKAYEADRSDPID  88



>ref|XP_003545023.1| PREDICTED: glucose-6-phosphate/phosphate translocator 1, chloroplastic-like 
[Glycine max]
Length=395

 Score = 48.1 bits (113),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 54/96 (56%), Gaps = 13/96 (14%)
 Frame = +1

Query  202  MISAVRQSGPLAIRGSDFFRPK--SPAPAPKLC-VLPPLPALKPCRGSVLSLARPVHVSS  372
            MI  V+Q   ++IRGSD F  K  SP+   + C ++ P    K    S++S+ +P+H+S 
Sbjct  1    MICTVKQP-VISIRGSDLFLRKKCSPSTPVQSCSLVSPSSKEKNSLRSLVSVQKPLHLSR  59

Query  373  V---ETFGSLKERSRGDDHEKRALVTCKAYEADRSQ  471
            V   +  GSL  R R D       VTC+AYEADRS+
Sbjct  60   VGFGDFVGSLVRRERAD------FVTCEAYEADRSK  89



>ref|XP_003519563.1| PREDICTED: glucose-6-phosphate/phosphate translocator 2, chloroplastic-like 
[Glycine max]
Length=395

 Score = 48.1 bits (113),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 37/98 (38%), Positives = 51/98 (52%), Gaps = 15/98 (15%)
 Frame = +1

Query  202  MISAVRQSGPLAIRGSDFFR-----PKSPAPAPKLCVLPPLPALKPCRGSVLSLARPVHV  366
            MI  V+Q   ++IR SD F      P +P  +  +     LP  K    S++S+ +P+H+
Sbjct  1    MICTVKQPA-ISIRVSDIFLRKKGLPSTPVQSCSIVSPSSLPREKNSLRSLVSVQKPLHL  59

Query  367  SSV---ETFGSLKERSRGDDHEKRALVTCKAYEADRSQ  471
            S V   +  GSL  R RGD       VTC AYEADRS+
Sbjct  60   SRVGFGDFVGSLVRRERGD------FVTCDAYEADRSE  91



>gb|KHN38297.1| Glucose-6-phosphate/phosphate translocator 1, chloroplastic [Glycine 
soja]
Length=396

 Score = 48.1 bits (113),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 37/98 (38%), Positives = 51/98 (52%), Gaps = 15/98 (15%)
 Frame = +1

Query  202  MISAVRQSGPLAIRGSDFFR-----PKSPAPAPKLCVLPPLPALKPCRGSVLSLARPVHV  366
            MI  V+Q   ++IR SD F      P +P  +  +     LP  K    S++S+ +P+H+
Sbjct  1    MICTVKQPA-ISIRVSDIFLRKKGLPSTPVQSCSIVSPSSLPREKNSLRSLVSVQKPLHL  59

Query  367  SSV---ETFGSLKERSRGDDHEKRALVTCKAYEADRSQ  471
            S V   +  GSL  R RGD       VTC AYEADRS+
Sbjct  60   SRVGFGDFVGSLVRRERGD------FVTCDAYEADRSE  91



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 567283606695