BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001O23

Length=540
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP01661.1|  unnamed protein product                                175   5e-47   Coffea canephora [robusta coffee]
ref|XP_009587166.1|  PREDICTED: probable receptor protein kinase ...    173   2e-46   Nicotiana tomentosiformis
ref|XP_009769564.1|  PREDICTED: probable receptor protein kinase ...    171   1e-45   Nicotiana sylvestris
gb|KJB43187.1|  hypothetical protein B456_007G187900                    166   6e-44   Gossypium raimondii
ref|XP_006494665.1|  PREDICTED: probable receptor protein kinase ...    164   1e-43   Citrus sinensis [apfelsine]
ref|XP_006494664.1|  PREDICTED: probable receptor protein kinase ...    165   2e-43   Citrus sinensis [apfelsine]
gb|KDO41053.1|  hypothetical protein CISIN_1g002238mg                   162   5e-43   Citrus sinensis [apfelsine]
gb|KDO41052.1|  hypothetical protein CISIN_1g002238mg                   163   8e-43   Citrus sinensis [apfelsine]
ref|XP_009775667.1|  PREDICTED: probable receptor protein kinase ...    162   1e-42   Nicotiana sylvestris
ref|XP_002533475.1|  receptor protein kinase, putative                  162   1e-42   Ricinus communis
ref|XP_010528574.1|  PREDICTED: probable receptor protein kinase ...    161   3e-42   Tarenaya hassleriana [spider flower]
ref|XP_009370081.1|  PREDICTED: probable receptor protein kinase ...    161   3e-42   Pyrus x bretschneideri [bai li]
ref|XP_002305223.1|  hypothetical protein POPTR_0004s08230g             159   1e-41   Populus trichocarpa [western balsam poplar]
ref|XP_007032165.1|  Transmembrane kinase 1 isoform 1                   159   2e-41   
ref|XP_008343073.1|  PREDICTED: LOW QUALITY PROTEIN: probable rec...    158   5e-41   
ref|XP_009594248.1|  PREDICTED: probable receptor protein kinase ...    157   7e-41   Nicotiana tomentosiformis
gb|KHG20581.1|  putative receptor protein kinase TMK1                   156   2e-40   Gossypium arboreum [tree cotton]
ref|XP_004289581.2|  PREDICTED: probable receptor protein kinase ...    155   6e-40   Fragaria vesca subsp. vesca
ref|XP_010690479.1|  PREDICTED: probable receptor protein kinase ...    154   9e-40   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006391349.1|  hypothetical protein EUTSA_v10018085mg             154   1e-39   Eutrema salsugineum [saltwater cress]
emb|CDY39246.1|  BnaC06g27450D                                          154   1e-39   Brassica napus [oilseed rape]
ref|XP_009105191.1|  PREDICTED: probable receptor protein kinase ...    154   1e-39   Brassica rapa
emb|CDY07484.1|  BnaA07g25630D                                          154   2e-39   Brassica napus [oilseed rape]
ref|XP_011043912.1|  PREDICTED: probable receptor protein kinase ...    154   2e-39   Populus euphratica
gb|KFK41035.1|  hypothetical protein AALP_AA2G077000                    153   2e-39   Arabis alpina [alpine rockcress]
ref|XP_009378958.1|  PREDICTED: probable receptor protein kinase ...    153   3e-39   Pyrus x bretschneideri [bai li]
ref|XP_011099938.1|  PREDICTED: probable receptor protein kinase ...    152   5e-39   Sesamum indicum [beniseed]
ref|XP_011038249.1|  PREDICTED: probable receptor protein kinase ...    151   1e-38   Populus euphratica
ref|XP_006350960.1|  PREDICTED: probable receptor protein kinase ...    151   1e-38   Solanum tuberosum [potatoes]
ref|XP_010415157.1|  PREDICTED: probable receptor protein kinase ...    150   2e-38   Camelina sativa [gold-of-pleasure]
ref|XP_006372526.1|  receptor protein kinase TMK1 precursor             149   5e-38   Populus trichocarpa [western balsam poplar]
gb|KDP25825.1|  hypothetical protein JCGZ_22547                         149   6e-38   Jatropha curcas
ref|XP_010551437.1|  PREDICTED: probable receptor protein kinase ...    149   6e-38   Tarenaya hassleriana [spider flower]
pdb|4HQ1|A  Chain A, Crystal Structure Of An Lrr Protein With Two...    144   2e-37   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010648936.1|  PREDICTED: probable receptor protein kinase ...    147   2e-37   Vitis vinifera
ref|XP_006300693.1|  hypothetical protein CARUB_v10019739mg             147   3e-37   Capsella rubella
ref|XP_007214949.1|  hypothetical protein PRUPE_ppa000942mg             147   3e-37   Prunus persica
ref|XP_010470484.1|  PREDICTED: probable receptor protein kinase ...    146   6e-37   Camelina sativa [gold-of-pleasure]
ref|XP_004249911.1|  PREDICTED: probable receptor protein kinase ...    146   7e-37   Solanum lycopersicum
ref|NP_176789.1|  transmembrane kinase 1                                146   9e-37   Arabidopsis thaliana [mouse-ear cress]
gb|ACN59264.1|  leucine-rich repeat receptor-like protein kinase        145   1e-36   Arabidopsis thaliana [mouse-ear cress]
gb|AAP04161.1|  putative receptor protein kinase (TMK1)                 145   1e-36   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010511542.1|  PREDICTED: probable receptor protein kinase ...    145   1e-36   Camelina sativa [gold-of-pleasure]
ref|XP_008244390.1|  PREDICTED: probable receptor protein kinase ...    145   1e-36   Prunus mume [ume]
ref|XP_002887010.1|  hypothetical protein ARALYDRAFT_475717             145   2e-36   
ref|XP_003552883.2|  PREDICTED: probable receptor protein kinase ...    140   1e-34   Glycine max [soybeans]
ref|XP_004140293.1|  PREDICTED: probable receptor protein kinase ...    139   2e-34   
ref|XP_008463160.1|  PREDICTED: probable receptor protein kinase ...    139   2e-34   Cucumis melo [Oriental melon]
ref|NP_001238698.1|  NAK-type protein kinase precursor                  137   2e-33   Glycine max [soybeans]
gb|KHN24152.1|  Putative receptor protein kinase TMK1                   134   1e-32   Glycine soja [wild soybean]
ref|XP_010032738.1|  PREDICTED: probable receptor protein kinase ...    134   2e-32   Eucalyptus grandis [rose gum]
gb|EYU30867.1|  hypothetical protein MIMGU_mgv1a001044mg                131   1e-31   Erythranthe guttata [common monkey flower]
ref|XP_010271200.1|  PREDICTED: probable receptor protein kinase ...    131   1e-31   Nelumbo nucifera [Indian lotus]
ref|XP_002314766.1|  hypothetical protein POPTR_0010s11360g             125   2e-29   
gb|KHN39482.1|  Putative receptor protein kinase TMK1                   125   2e-29   Glycine soja [wild soybean]
ref|XP_006346490.1|  PREDICTED: probable receptor protein kinase ...    124   3e-29   Solanum tuberosum [potatoes]
ref|XP_004490803.1|  PREDICTED: probable receptor protein kinase ...    123   1e-28   
emb|CBI26796.3|  unnamed protein product                                120   5e-28   Vitis vinifera
ref|XP_007141936.1|  hypothetical protein PHAVU_008G238600g             120   6e-28   Phaseolus vulgaris [French bean]
ref|XP_002281552.2|  PREDICTED: probable receptor protein kinase ...    120   6e-28   Vitis vinifera
ref|XP_011021737.1|  PREDICTED: probable receptor protein kinase ...    120   7e-28   Populus euphratica
ref|XP_009619244.1|  PREDICTED: probable receptor protein kinase ...    120   9e-28   Nicotiana tomentosiformis
ref|XP_002312477.1|  hypothetical protein POPTR_0008s13710g             120   1e-27   
gb|AAF66615.1|  LRR receptor-like protein kinase                        120   1e-27   Nicotiana tabacum [American tobacco]
ref|XP_009757873.1|  PREDICTED: probable receptor protein kinase ...    119   2e-27   Nicotiana sylvestris
ref|XP_004230827.1|  PREDICTED: probable receptor protein kinase ...    119   3e-27   Solanum lycopersicum
ref|XP_002527538.1|  receptor protein kinase, putative                  117   1e-26   Ricinus communis
emb|CDP05529.1|  unnamed protein product                                116   3e-26   Coffea canephora [robusta coffee]
ref|XP_009368765.1|  PREDICTED: probable receptor protein kinase ...    111   4e-25   
ref|XP_011070546.1|  PREDICTED: probable receptor protein kinase ...    112   5e-25   Sesamum indicum [beniseed]
ref|XP_011070545.1|  PREDICTED: probable receptor protein kinase ...    112   8e-25   Sesamum indicum [beniseed]
ref|XP_010043988.1|  PREDICTED: probable receptor protein kinase ...    108   1e-23   Eucalyptus grandis [rose gum]
ref|XP_010315276.1|  PREDICTED: probable receptor protein kinase ...    108   2e-23   Solanum lycopersicum
ref|XP_003616214.1|  Kinase-like protein                                107   2e-23   Medicago truncatula
gb|EPS64046.1|  hypothetical protein M569_10735                         107   3e-23   Genlisea aurea
ref|XP_006448112.1|  hypothetical protein CICLE_v10014172mg             106   4e-23   Citrus clementina [clementine]
gb|KDO60837.1|  hypothetical protein CISIN_1g002255mg                   106   4e-23   Citrus sinensis [apfelsine]
ref|XP_006469286.1|  PREDICTED: probable receptor protein kinase ...    106   6e-23   Citrus sinensis [apfelsine]
gb|KDO60836.1|  hypothetical protein CISIN_1g002255mg                   106   6e-23   Citrus sinensis [apfelsine]
ref|XP_006448111.1|  hypothetical protein CICLE_v10014172mg             106   6e-23   Citrus clementina [clementine]
ref|XP_010553548.1|  PREDICTED: probable receptor protein kinase ...    104   2e-22   Tarenaya hassleriana [spider flower]
ref|XP_008220934.1|  PREDICTED: probable receptor protein kinase ...    104   3e-22   Prunus mume [ume]
ref|XP_010553540.1|  PREDICTED: probable receptor protein kinase ...    104   3e-22   Tarenaya hassleriana [spider flower]
ref|XP_002893435.1|  leucine-rich repeat family protein                 103   8e-22   Arabidopsis lyrata subsp. lyrata
ref|XP_010046493.1|  PREDICTED: probable receptor protein kinase ...  99.8    9e-22   Eucalyptus grandis [rose gum]
ref|XP_007225345.1|  hypothetical protein PRUPE_ppa000982mg             102   1e-21   Prunus persica
ref|XP_006290562.1|  hypothetical protein CARUB_v10016649mg             102   1e-21   Capsella rubella
gb|EYU30155.1|  hypothetical protein MIMGU_mgv1a001033mg                101   4e-21   Erythranthe guttata [common monkey flower]
ref|XP_008467095.1|  PREDICTED: probable receptor protein kinase ...    100   6e-21   Cucumis melo [Oriental melon]
ref|XP_004142822.1|  PREDICTED: probable receptor protein kinase ...  98.6    3e-20   Cucumis sativus [cucumbers]
gb|KDP38160.1|  hypothetical protein JCGZ_04803                       97.1    1e-19   Jatropha curcas
ref|XP_006826595.1|  hypothetical protein AMTR_s00138p00056480        96.3    2e-19   
ref|XP_010246966.1|  PREDICTED: probable receptor protein kinase ...  95.1    2e-19   Nelumbo nucifera [Indian lotus]
ref|XP_010424954.1|  PREDICTED: probable receptor protein kinase ...  96.3    2e-19   Camelina sativa [gold-of-pleasure]
ref|XP_010513910.1|  PREDICTED: probable receptor protein kinase ...  96.3    2e-19   Camelina sativa [gold-of-pleasure]
ref|XP_008389147.1|  PREDICTED: probable receptor protein kinase ...  95.9    2e-19   
emb|CDP16901.1|  unnamed protein product                              89.7    3e-19   Coffea canephora [robusta coffee]
ref|XP_010556225.1|  PREDICTED: probable receptor protein kinase ...  95.9    3e-19   Tarenaya hassleriana [spider flower]
ref|XP_002876780.1|  hypothetical protein ARALYDRAFT_484098           95.9    3e-19   
ref|XP_009101318.1|  PREDICTED: probable receptor protein kinase ...  95.5    4e-19   Brassica rapa
ref|XP_008358283.1|  PREDICTED: probable receptor protein kinase ...  95.1    5e-19   
ref|XP_009102141.1|  PREDICTED: probable receptor protein kinase ...  93.2    5e-19   Brassica rapa
ref|XP_010246532.1|  PREDICTED: probable receptor protein kinase ...  94.7    7e-19   Nelumbo nucifera [Indian lotus]
emb|CDY35882.1|  BnaA07g01050D                                        92.8    8e-19   Brassica napus [oilseed rape]
ref|XP_010502174.1|  PREDICTED: probable receptor protein kinase ...  94.4    9e-19   Camelina sativa [gold-of-pleasure]
ref|XP_007045490.1|  Leucine-rich repeat protein kinase family pr...  94.4    1e-18   
gb|KHN16510.1|  Putative receptor protein kinase TMK1                 93.6    2e-18   Glycine soja [wild soybean]
ref|XP_003532526.1|  PREDICTED: probable receptor protein kinase ...  93.6    2e-18   Glycine max [soybeans]
ref|XP_009101661.1|  PREDICTED: probable receptor protein kinase ...  92.8    2e-18   
gb|AAG03120.1|AC004133_14  F5A9.23                                    93.2    2e-18   Arabidopsis thaliana [mouse-ear cress]
emb|CDY17635.1|  BnaA06g34540D                                        92.8    2e-18   Brassica napus [oilseed rape]
ref|NP_173869.1|  leucine-rich repeat protein kinase family protein   92.8    3e-18   Arabidopsis thaliana [mouse-ear cress]
gb|KJB50422.1|  hypothetical protein B456_008G170100                  93.2    3e-18   Gossypium raimondii
ref|XP_009351579.1|  PREDICTED: probable receptor protein kinase ...  92.8    3e-18   Pyrus x bretschneideri [bai li]
ref|XP_003529231.1|  PREDICTED: probable receptor protein kinase ...  92.8    3e-18   Glycine max [soybeans]
ref|XP_008787910.1|  PREDICTED: probable receptor protein kinase ...  92.8    3e-18   Phoenix dactylifera
ref|XP_009351578.1|  PREDICTED: probable receptor protein kinase ...  92.4    4e-18   Pyrus x bretschneideri [bai li]
emb|CDY40785.1|  BnaAnng06480D                                        91.7    6e-18   Brassica napus [oilseed rape]
ref|XP_008381802.1|  PREDICTED: probable receptor protein kinase ...  92.0    6e-18   
ref|XP_009103048.1|  PREDICTED: probable receptor protein kinase ...  92.0    6e-18   Brassica rapa
ref|XP_003631009.1|  Kinase-like protein                              91.7    6e-18   
gb|KJB79021.1|  hypothetical protein B456_013G030200                  91.7    7e-18   Gossypium raimondii
ref|XP_008381795.1|  PREDICTED: probable receptor protein kinase ...  90.9    8e-18   
ref|XP_004503323.1|  PREDICTED: probable receptor protein kinase ...  91.3    9e-18   Cicer arietinum [garbanzo]
ref|XP_007153205.1|  hypothetical protein PHAVU_003G015800g           91.3    9e-18   Phaseolus vulgaris [French bean]
ref|XP_007160467.1|  hypothetical protein PHAVU_002G324600g           91.3    1e-17   Phaseolus vulgaris [French bean]
ref|XP_006395848.1|  hypothetical protein EUTSA_v10003606mg           91.3    1e-17   Eutrema salsugineum [saltwater cress]
ref|XP_010462912.1|  PREDICTED: probable receptor protein kinase ...  90.9    1e-17   Camelina sativa [gold-of-pleasure]
ref|XP_009789399.1|  PREDICTED: probable receptor protein kinase ...  90.9    1e-17   Nicotiana sylvestris
ref|NP_178291.1|  receptor-like kinase TMK3                           89.7    3e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008789301.1|  PREDICTED: probable receptor protein kinase ...  89.4    4e-17   Phoenix dactylifera
ref|XP_006830550.1|  hypothetical protein AMTR_s00117p00096300        89.4    5e-17   
emb|CDY03867.1|  BnaC07g10920D                                        88.6    8e-17   
ref|XP_010685103.1|  PREDICTED: probable receptor protein kinase ...  88.6    8e-17   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003601704.1|  Receptor-like kinase                             88.6    9e-17   Medicago truncatula
ref|XP_010527815.1|  PREDICTED: probable receptor protein kinase ...  88.6    9e-17   Tarenaya hassleriana [spider flower]
emb|CDY26344.1|  BnaA03g60200D                                        86.7    1e-16   Brassica napus [oilseed rape]
emb|CDY52761.1|  BnaC02g47770D                                        87.4    2e-16   Brassica napus [oilseed rape]
ref|XP_010501607.1|  PREDICTED: probable receptor protein kinase ...  87.4    2e-16   Camelina sativa [gold-of-pleasure]
ref|XP_006303733.1|  hypothetical protein CARUB_v10011871mg           87.4    2e-16   
emb|CDP03933.1|  unnamed protein product                              86.3    5e-16   Coffea canephora [robusta coffee]
ref|XP_010246967.1|  PREDICTED: probable receptor protein kinase ...  86.3    5e-16   Nelumbo nucifera [Indian lotus]
gb|KFK45034.1|  hypothetical protein AALP_AA1G335600                  86.3    6e-16   Arabis alpina [alpine rockcress]
ref|XP_010936890.1|  PREDICTED: probable receptor protein kinase ...  85.9    6e-16   Elaeis guineensis
ref|XP_009610544.1|  PREDICTED: probable receptor protein kinase ...  85.9    6e-16   Nicotiana tomentosiformis
ref|XP_009129193.1|  PREDICTED: probable receptor protein kinase ...  85.9    7e-16   Brassica rapa
emb|CDY09413.1|  BnaA02g25970D                                        85.9    7e-16   Brassica napus [oilseed rape]
ref|XP_009124646.1|  PREDICTED: probable receptor protein kinase ...  84.3    8e-16   Brassica rapa
ref|XP_002324686.2|  hypothetical protein POPTR_0018s13780g           85.5    1e-15   
ref|XP_003572876.1|  PREDICTED: probable receptor protein kinase ...  84.7    1e-15   Brachypodium distachyon [annual false brome]
ref|XP_010668632.1|  PREDICTED: probable receptor protein kinase ...  84.7    2e-15   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008665300.1|  PREDICTED: probable receptor protein kinase ...  84.3    2e-15   Zea mays [maize]
ref|XP_002463990.1|  hypothetical protein SORBIDRAFT_01g010110        83.6    4e-15   Sorghum bicolor [broomcorn]
ref|XP_008795408.1|  PREDICTED: probable receptor protein kinase ...  83.6    4e-15   Phoenix dactylifera
gb|KHM99461.1|  Putative receptor protein kinase TMK1                 83.6    4e-15   Glycine soja [wild soybean]
ref|XP_008644567.1|  PREDICTED: probable receptor protein kinase ...  83.2    5e-15   
ref|XP_006415826.1|  hypothetical protein EUTSA_v10009860mg           82.8    8e-15   
ref|XP_010105561.1|  putative receptor protein kinase TMK1            82.0    1e-14   Morus notabilis
emb|CBI39471.3|  unnamed protein product                              81.6    2e-14   Vitis vinifera
ref|XP_002268601.2|  PREDICTED: probable receptor protein kinase ...  81.6    2e-14   Vitis vinifera
ref|XP_009404143.1|  PREDICTED: probable receptor protein kinase ...  81.3    2e-14   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004247046.1|  PREDICTED: probable receptor protein kinase ...  81.3    2e-14   Solanum lycopersicum
ref|XP_010068984.1|  PREDICTED: probable receptor protein kinase ...  80.9    3e-14   Eucalyptus grandis [rose gum]
gb|KDO47459.1|  hypothetical protein CISIN_1g0023461mg                80.9    3e-14   Citrus sinensis [apfelsine]
gb|KFK44514.1|  hypothetical protein AALP_AA1G266600                  80.1    4e-14   Arabis alpina [alpine rockcress]
ref|XP_006421039.1|  hypothetical protein CICLE_v10004263mg           80.5    4e-14   Citrus clementina [clementine]
ref|XP_006492525.1|  PREDICTED: probable receptor protein kinase ...  80.5    5e-14   Citrus sinensis [apfelsine]
ref|XP_010907801.1|  PREDICTED: probable receptor protein kinase ...  79.7    7e-14   
ref|XP_010932521.1|  PREDICTED: LOW QUALITY PROTEIN: probable rec...  79.7    7e-14   
ref|XP_010907800.1|  PREDICTED: probable receptor protein kinase ...  79.7    8e-14   Elaeis guineensis
ref|XP_009408287.1|  PREDICTED: probable receptor protein kinase ...  79.7    8e-14   
ref|XP_006576140.1|  PREDICTED: protein kinase isoform X1             79.7    9e-14   
ref|XP_010939998.1|  PREDICTED: probable receptor protein kinase ...  79.7    9e-14   Elaeis guineensis
ref|XP_009408286.1|  PREDICTED: probable receptor protein kinase ...  79.3    9e-14   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001238095.1|  protein kinase precursor                         79.7    9e-14   
gb|EPS70426.1|  hypothetical protein M569_04331                       79.7    1e-13   Genlisea aurea
gb|ACM89521.1|  receptor-like protein kinase-like protein             79.3    1e-13   Glycine max [soybeans]
emb|CDY36252.1|  BnaC07g21060D                                        77.0    1e-13   Brassica napus [oilseed rape]
ref|XP_008798481.1|  PREDICTED: probable receptor protein kinase ...  79.0    1e-13   Phoenix dactylifera
ref|XP_008795571.1|  PREDICTED: probable receptor protein kinase ...  79.0    1e-13   Phoenix dactylifera
ref|XP_010650399.1|  PREDICTED: probable receptor protein kinase ...  79.0    1e-13   Vitis vinifera
emb|CDY03105.1|  BnaC07g21220D                                        78.2    2e-13   
ref|XP_004491185.1|  PREDICTED: somatic embryogenesis receptor ki...  74.7    3e-13   Cicer arietinum [garbanzo]
ref|XP_011046412.1|  PREDICTED: probable receptor protein kinase ...  77.8    3e-13   Populus euphratica
emb|CDX98478.1|  BnaC05g38970D                                        75.9    4e-13   
gb|ABD96566.1|  Rhg4-like receptor kinase II                          77.8    4e-13   Glycine max [soybeans]
gb|KEH40666.1|  receptor kinase TMK1-like protein                     77.8    4e-13   Medicago truncatula
ref|XP_010906324.1|  PREDICTED: probable receptor protein kinase ...  77.4    4e-13   
ref|XP_008380457.1|  PREDICTED: probable receptor protein kinase ...  77.0    6e-13   
ref|XP_006448113.1|  hypothetical protein CICLE_v10017498mg           74.7    6e-13   
ref|XP_008809243.1|  PREDICTED: probable receptor protein kinase ...  77.0    6e-13   Phoenix dactylifera
gb|KHG14431.1|  putative receptor protein kinase TMK1                 76.6    1e-12   Gossypium arboreum [tree cotton]
gb|KJB12519.1|  hypothetical protein B456_002G022400                  72.8    1e-12   Gossypium raimondii
ref|XP_004981977.1|  PREDICTED: probable receptor protein kinase ...  76.3    1e-12   Setaria italica
gb|KJB12518.1|  hypothetical protein B456_002G022400                  72.8    1e-12   Gossypium raimondii
ref|XP_004504378.1|  PREDICTED: probable receptor protein kinase ...  75.9    1e-12   Cicer arietinum [garbanzo]
ref|NP_001236021.1|  Rhg4-like receptor kinase II precursor           75.9    1e-12   
gb|EPS70217.1|  hypothetical protein M569_04541                       75.9    2e-12   Genlisea aurea
ref|XP_009604417.1|  PREDICTED: probable receptor protein kinase ...  75.9    2e-12   Nicotiana tomentosiformis
ref|XP_010910643.1|  PREDICTED: LOW QUALITY PROTEIN: probable rec...  75.9    2e-12   
ref|XP_006361096.1|  PREDICTED: probable receptor protein kinase ...  75.9    2e-12   Solanum tuberosum [potatoes]
emb|CDP06852.1|  unnamed protein product                              75.5    2e-12   Coffea canephora [robusta coffee]
ref|XP_011042599.1|  PREDICTED: probable receptor protein kinase ...  75.5    2e-12   Populus euphratica
ref|XP_009767007.1|  PREDICTED: probable receptor protein kinase ...  75.5    2e-12   Nicotiana sylvestris
gb|KHN21189.1|  Putative receptor protein kinase TMK1-like protein    75.1    3e-12   Glycine soja [wild soybean]
gb|KJB09134.1|  hypothetical protein B456_001G125200                  75.1    3e-12   Gossypium raimondii
ref|XP_002980529.1|  hypothetical protein SELMODRAFT_233539           75.1    3e-12   
ref|XP_009625585.1|  PREDICTED: probable receptor protein kinase ...  74.7    3e-12   Nicotiana tomentosiformis
emb|CAA69028.1|  TMK                                                  74.7    4e-12   Oryza sativa Indica Group [Indian rice]
gb|ABF98558.1|  Protein kinase domain containing protein, expressed   74.7    4e-12   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010673234.1|  PREDICTED: BRASSINOSTEROID INSENSITIVE 1-ass...  71.6    4e-12   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009380072.1|  PREDICTED: probable receptor protein kinase ...  74.7    4e-12   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY17632.1|  BnaA06g34510D                                        72.4    4e-12   Brassica napus [oilseed rape]
ref|XP_010543834.1|  PREDICTED: probable receptor protein kinase ...  74.7    4e-12   Tarenaya hassleriana [spider flower]
gb|KCW85997.1|  hypothetical protein EUGRSUZ_B02701                   72.0    4e-12   Eucalyptus grandis [rose gum]
ref|XP_009101657.1|  PREDICTED: probable receptor protein kinase ...  72.4    5e-12   
ref|XP_002322788.2|  hypothetical protein POPTR_0016s07120g           74.3    5e-12   
gb|KDP36118.1|  hypothetical protein JCGZ_08762                       74.3    5e-12   Jatropha curcas
gb|EYU40639.1|  hypothetical protein MIMGU_mgv1a027041mg              74.3    5e-12   Erythranthe guttata [common monkey flower]
ref|XP_006592356.1|  PREDICTED: probable receptor protein kinase ...  74.3    5e-12   Glycine max [soybeans]
ref|XP_002976801.1|  hypothetical protein SELMODRAFT_268021           73.9    6e-12   
ref|XP_004241337.1|  PREDICTED: probable receptor protein kinase ...  73.9    6e-12   Solanum lycopersicum
ref|XP_011101591.1|  PREDICTED: probable receptor protein kinase ...  73.9    6e-12   Sesamum indicum [beniseed]
ref|XP_004293117.1|  PREDICTED: probable receptor protein kinase ...  73.9    7e-12   Fragaria vesca subsp. vesca
ref|NP_001131017.1|  uncharacterized LOC100192365 precursor           73.9    7e-12   Zea mays [maize]
ref|XP_007203232.1|  hypothetical protein PRUPE_ppa000956mg           73.6    8e-12   Prunus persica
ref|XP_009399943.1|  PREDICTED: somatic embryogenesis receptor ki...  70.5    8e-12   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHG10644.1|  Somatic embryogenesis receptor kinase 1 -like pro...  70.5    9e-12   Gossypium arboreum [tree cotton]
ref|XP_009373574.1|  PREDICTED: probable receptor protein kinase ...  73.6    1e-11   Pyrus x bretschneideri [bai li]
gb|KDO70607.1|  hypothetical protein CISIN_1g002150mg                 73.2    1e-11   Citrus sinensis [apfelsine]
ref|XP_006481595.1|  PREDICTED: probable receptor protein kinase ...  72.8    1e-11   Citrus sinensis [apfelsine]
ref|XP_002309250.1|  hypothetical protein POPTR_0006s22000g           72.8    1e-11   
emb|CAH68356.1|  H0723C07.6                                           72.8    2e-11   Oryza sativa [red rice]
dbj|BAF79934.1|  receptor-like kinase                                 72.8    2e-11   Marchantia polymorpha
ref|NP_001054323.1|  Os04g0685900                                     72.4    2e-11   
emb|CAN69461.1|  hypothetical protein VITISV_043132                   72.4    2e-11   Vitis vinifera
ref|XP_008241052.1|  PREDICTED: probable receptor protein kinase ...  72.4    2e-11   Prunus mume [ume]
ref|XP_007139094.1|  hypothetical protein PHAVU_008G000600g           69.3    2e-11   Phaseolus vulgaris [French bean]
gb|KCW51007.1|  hypothetical protein EUGRSUZ_J00633                   68.9    2e-11   Eucalyptus grandis [rose gum]
ref|XP_006438831.1|  hypothetical protein CICLE_v10032710mg           69.3    2e-11   Citrus clementina [clementine]
ref|XP_010535762.1|  PREDICTED: somatic embryogenesis receptor ki...  68.9    2e-11   Tarenaya hassleriana [spider flower]
ref|XP_003629623.1|  Receptor-like kinase                             72.0    3e-11   Medicago truncatula
ref|XP_006844558.1|  hypothetical protein AMTR_s00016p00184680        68.9    3e-11   Amborella trichopoda
ref|XP_009383147.1|  PREDICTED: probable receptor protein kinase ...  72.0    3e-11   
ref|XP_010090693.1|  hypothetical protein L484_017499                 68.9    3e-11   
gb|ABD96567.1|  Rhg4-like receptor kinase I                           72.0    3e-11   Glycine max [soybeans]
ref|XP_009414792.1|  PREDICTED: probable receptor protein kinase ...  72.0    3e-11   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABD96565.1|  Rhg4-like receptor kinase I                           72.0    3e-11   Glycine max [soybeans]
ref|XP_002530200.1|  serine-threonine protein kinase, plant-type,...  68.9    3e-11   Ricinus communis
ref|XP_010904696.1|  PREDICTED: somatic embryogenesis receptor ki...  68.9    3e-11   Elaeis guineensis
gb|ADO12863.1|  leucine-rich repeat receptor-like kinase              71.6    3e-11   Glycine max [soybeans]
ref|XP_010031651.1|  PREDICTED: somatic embryogenesis receptor ki...  68.6    3e-11   Eucalyptus grandis [rose gum]
ref|XP_006430067.1|  hypothetical protein CICLE_v10010999mg           71.6    3e-11   Citrus clementina [clementine]
gb|AES80551.2|  receptor-like kinase, putative                        71.6    3e-11   Medicago truncatula
gb|KFK39671.1|  hypothetical protein AALP_AA3G274200                  71.6    4e-11   Arabis alpina [alpine rockcress]
ref|XP_009124332.1|  PREDICTED: somatic embryogenesis receptor ki...  68.6    4e-11   Brassica rapa
ref|XP_003624333.1|  Receptor-like kinase                             71.6    4e-11   
ref|XP_004961662.1|  PREDICTED: somatic embryogenesis receptor ki...  68.6    4e-11   Setaria italica
ref|XP_006592774.1|  PREDICTED: probable receptor protein kinase ...  71.6    4e-11   Glycine max [soybeans]
ref|XP_008222737.1|  PREDICTED: probable receptor protein kinase ...  71.2    4e-11   Prunus mume [ume]
gb|ACN40873.1|  unknown                                               68.2    4e-11   Picea sitchensis
gb|KFK27996.1|  hypothetical protein AALP_AA8G458100                  70.5    5e-11   Arabis alpina [alpine rockcress]
gb|EMS63078.1|  putative receptor protein kinase TMK1                 71.2    5e-11   Triticum urartu
gb|KHG03733.1|  putative receptor protein kinase TMK1                 71.2    5e-11   Gossypium arboreum [tree cotton]
ref|XP_006854639.1|  hypothetical protein AMTR_s00030p00189200        71.2    5e-11   Amborella trichopoda
dbj|BAJ90742.1|  predicted protein                                    68.2    5e-11   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KEH40667.1|  receptor-like kinase                                  71.2    5e-11   Medicago truncatula
dbj|BAJ87965.1|  predicted protein                                    68.2    5e-11   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010097979.1|  putative receptor protein kinase TMK1            71.2    5e-11   Morus notabilis
ref|XP_009414221.1|  PREDICTED: somatic embryogenesis receptor ki...  68.2    6e-11   Musa acuminata subsp. malaccensis [pisang utan]
gb|ACU22741.1|  unknown                                               68.2    6e-11   Glycine max [soybeans]
ref|XP_006470435.1|  PREDICTED: somatic embryogenesis receptor ki...  68.2    6e-11   Citrus sinensis [apfelsine]
ref|NP_001241394.1|  somatic embryogenesis receptor kinase 1-like...  67.8    6e-11   Glycine max [soybeans]
ref|XP_002299778.2|  hypothetical protein POPTR_0001s22540g           70.9    6e-11   
emb|CDX70962.1|  BnaC03g10460D                                        67.8    6e-11   
gb|ACU19288.1|  unknown                                               67.8    6e-11   Glycine max [soybeans]
gb|EYU32717.1|  hypothetical protein MIMGU_mgv1a001138mg              70.9    7e-11   Erythranthe guttata [common monkey flower]
ref|XP_003519488.1|  PREDICTED: somatic embryogenesis receptor ki...  67.8    7e-11   Glycine max [soybeans]
ref|XP_010657622.1|  PREDICTED: BRASSINOSTEROID INSENSITIVE 1-ass...  70.1    7e-11   Vitis vinifera
ref|NP_001239998.1|  uncharacterized protein LOC100778819 precursor   67.8    8e-11   
gb|KDO66367.1|  hypothetical protein CISIN_1g027683mg                 67.0    8e-11   
gb|KHN38434.1|  BRASSINOSTEROID INSENSITIVE 1-associated receptor...  67.4    8e-11   
gb|ACN94266.1|  leucine-rich repeat protein                           67.4    9e-11   
ref|XP_006366998.1|  PREDICTED: probable receptor protein kinase ...  70.5    9e-11   
gb|KHG03667.1|  putative receptor protein kinase TMK1                 70.5    9e-11   
ref|XP_010657620.1|  PREDICTED: BRASSINOSTEROID INSENSITIVE 1-ass...  70.1    9e-11   
ref|XP_010657621.1|  PREDICTED: BRASSINOSTEROID INSENSITIVE 1-ass...  70.1    9e-11   
emb|CDX88826.1|  BnaA03g08230D                                        67.4    9e-11   
ref|XP_009777835.1|  PREDICTED: BRASSINOSTEROID INSENSITIVE 1-ass...  67.4    9e-11   
gb|KDO66365.1|  hypothetical protein CISIN_1g027683mg                 67.4    1e-10   
ref|XP_009131837.1|  PREDICTED: somatic embryogenesis receptor ki...  67.4    1e-10   
emb|CDY36253.1|  BnaC07g21070D                                        70.5    1e-10   
ref|XP_004303383.1|  PREDICTED: probable receptor protein kinase ...  70.5    1e-10   
ref|XP_002976216.1|  hypothetical protein SELMODRAFT_175461           70.1    1e-10   
gb|KDO66366.1|  hypothetical protein CISIN_1g027683mg                 67.0    1e-10   
ref|XP_010251701.1|  PREDICTED: somatic embryogenesis receptor ki...  67.4    1e-10   
ref|XP_011010010.1|  PREDICTED: probable receptor protein kinase ...  70.1    1e-10   
gb|KFK26321.1|  hypothetical protein AALP_AA8G232500                  67.4    1e-10   
ref|XP_010657614.1|  PREDICTED: BRASSINOSTEROID INSENSITIVE 1-ass...  69.7    1e-10   
ref|XP_007141566.1|  hypothetical protein PHAVU_008G206700g           67.0    1e-10   
ref|XP_006418841.1|  hypothetical protein EUTSA_v10002394mg           70.1    1e-10   
gb|KEH28345.1|  somatic embryogenesis receptor kinase-like protein    66.2    1e-10   
ref|XP_009624197.1|  PREDICTED: BRASSINOSTEROID INSENSITIVE 1-ass...  66.6    1e-10   
emb|CDX92412.1|  BnaA10g14510D                                        67.0    1e-10   
ref|NP_197608.1|  leucine-rich repeat-containing protein              66.6    2e-10   
ref|XP_007162969.1|  hypothetical protein PHAVU_001G195500g           69.7    2e-10   
ref|XP_004498720.1|  PREDICTED: probable receptor protein kinase ...  69.7    2e-10   
ref|XP_007015693.1|  Leucine-rich repeat protein kinase family pr...  69.7    2e-10   
gb|KHG06891.1|  putative receptor protein kinase TMK1                 69.7    2e-10   
ref|XP_002987123.1|  hypothetical protein SELMODRAFT_269219           69.7    2e-10   
gb|KFK32923.1|  hypothetical protein AALP_AA6G306900                  69.3    2e-10   
emb|CBI30387.3|  unnamed protein product                              69.3    2e-10   
ref|XP_003617092.1|  Somatic embryogenesis receptor kinase            65.9    2e-10   
gb|KJB36268.1|  hypothetical protein B456_006G149500                  69.3    2e-10   
ref|XP_009349030.1|  PREDICTED: probable receptor protein kinase ...  69.3    2e-10   
ref|XP_009420192.1|  PREDICTED: probable receptor protein kinase ...  69.3    2e-10   
ref|XP_008360596.1|  PREDICTED: probable receptor protein kinase ...  69.3    2e-10   
ref|XP_006446385.1|  hypothetical protein CICLE_v10016555mg           65.9    2e-10   
ref|XP_009408496.1|  PREDICTED: probable receptor protein kinase ...  69.3    2e-10   
emb|CBI20077.3|  unnamed protein product                              69.3    2e-10   
gb|KJB20251.1|  hypothetical protein B456_003G140700                  66.6    2e-10   
gb|AET00051.2|  somatic embryogenesis receptor kinase-like protein    65.9    2e-10   
ref|XP_011070023.1|  PREDICTED: somatic embryogenesis receptor ki...  66.2    2e-10   
ref|XP_006446388.1|  hypothetical protein CICLE_v10016555mg           66.2    3e-10   
ref|XP_009120732.1|  PREDICTED: somatic embryogenesis receptor ki...  66.2    3e-10   
ref|XP_002975116.1|  hypothetical protein SELMODRAFT_102446           68.9    3e-10   
gb|KDO60835.1|  hypothetical protein CISIN_1g0428251mg                68.6    3e-10   
ref|XP_002989008.1|  hypothetical protein SELMODRAFT_129007           68.9    3e-10   
ref|XP_004298491.1|  PREDICTED: probable receptor protein kinase ...  68.9    3e-10   
ref|XP_003538632.1|  PREDICTED: BRASSINOSTEROID INSENSITIVE 1-ass...  65.9    3e-10   
ref|XP_006446387.1|  hypothetical protein CICLE_v10016555mg           65.9    3e-10   
ref|XP_002274910.2|  PREDICTED: probable receptor protein kinase ...  68.9    3e-10   
ref|XP_010247002.1|  PREDICTED: probable receptor protein kinase ...  68.9    3e-10   
gb|ADO15292.1|  somatic embryogenesis receptor kinase 4               68.6    3e-10   
ref|XP_002283683.1|  PREDICTED: somatic embryogenesis receptor ki...  65.9    3e-10   
gb|EYU35664.1|  hypothetical protein MIMGU_mgv1a013556mg              65.9    3e-10   
emb|CDY16593.1|  BnaC09g36800D                                        65.9    3e-10   
ref|XP_003593157.1|  Somatic embryogenesis receptor-like kinase-l...  68.6    3e-10   
ref|XP_010520487.1|  PREDICTED: somatic embryogenesis receptor ki...  65.9    3e-10   
emb|CDP15110.1|  unnamed protein product                              68.6    3e-10   
ref|XP_010024201.1|  PREDICTED: somatic embryogenesis receptor ki...  65.9    4e-10   
ref|XP_006400679.1|  hypothetical protein EUTSA_v10014631mg           65.9    4e-10   
ref|XP_011079162.1|  PREDICTED: somatic embryogenesis receptor ki...  65.5    4e-10   
ref|XP_009336462.1|  PREDICTED: somatic embryogenesis receptor ki...  65.9    4e-10   
emb|CAN79640.1|  hypothetical protein VITISV_017953                   68.6    4e-10   
ref|XP_002314247.1|  hypothetical protein POPTR_0009s02400g           65.5    4e-10   
ref|XP_008389928.1|  PREDICTED: somatic embryogenesis receptor ki...  65.5    4e-10   
ref|XP_007205892.1|  hypothetical protein PRUPE_ppa011333mg           65.5    4e-10   
ref|XP_010031559.1|  PREDICTED: probable receptor protein kinase ...  68.6    4e-10   
ref|XP_007141567.1|  hypothetical protein PHAVU_008G206700g           66.6    4e-10   
ref|XP_006288424.1|  hypothetical protein CARUB_v10001683mg           66.2    4e-10   
ref|XP_004487454.1|  PREDICTED: probable receptor protein kinase ...  68.6    4e-10   
ref|XP_010657619.1|  PREDICTED: BRASSINOSTEROID INSENSITIVE 1-ass...  68.2    4e-10   
ref|XP_008389927.1|  PREDICTED: somatic embryogenesis receptor ki...  65.5    4e-10   
ref|XP_006446386.1|  hypothetical protein CICLE_v10016555mg           65.5    4e-10   
ref|XP_007225784.1|  hypothetical protein PRUPE_ppa011206mg           65.5    4e-10   
ref|XP_009393396.1|  PREDICTED: probable receptor protein kinase ...  68.2    4e-10   
gb|KCW60656.1|  hypothetical protein EUGRSUZ_H03383                   65.5    5e-10   
emb|CDY50112.1|  BnaC01g43600D                                        66.6    5e-10   
ref|XP_008380290.1|  PREDICTED: probable receptor protein kinase ...  68.2    5e-10   
gb|ACJ85954.1|  unknown                                               65.5    5e-10   
ref|XP_003617091.1|  Somatic embryogenesis receptor kinase            65.5    5e-10   
ref|XP_004298216.1|  PREDICTED: probable receptor protein kinase ...  68.2    5e-10   
ref|XP_004487455.1|  PREDICTED: probable receptor protein kinase ...  68.2    5e-10   
gb|KJB71981.1|  hypothetical protein B456_011G151900                  68.2    5e-10   
gb|AFK45363.1|  unknown                                               65.1    5e-10   
gb|KJB71982.1|  hypothetical protein B456_011G151900                  68.2    5e-10   
gb|ACD49737.1|  BRI1-associated receptor kinase 1 protein             67.8    5e-10   
ref|XP_011003857.1|  PREDICTED: somatic embryogenesis receptor ki...  65.1    5e-10   
gb|ACN59321.1|  leucine-rich repeat receptor-like protein kinase      68.2    6e-10   
ref|NP_189017.1|  leucine-rich repeat protein kinase-like protein     68.2    6e-10   
ref|XP_009102585.1|  PREDICTED: probable receptor protein kinase ...  68.2    6e-10   
gb|EMT31112.1|  Somatic embryogenesis receptor kinase 2               67.4    6e-10   
ref|XP_010676236.1|  PREDICTED: probable receptor protein kinase ...  67.8    6e-10   
ref|XP_007043860.1|  Leucine-rich repeat family protein               65.1    6e-10   
gb|KJB35445.1|  hypothetical protein B456_006G115200                  67.8    6e-10   
ref|XP_007027971.1|  Leucine-rich repeat protein kinase family pr...  67.8    7e-10   
ref|XP_008222348.1|  PREDICTED: somatic embryogenesis receptor ki...  65.9    7e-10   
gb|KJB35444.1|  hypothetical protein B456_006G115200                  67.8    7e-10   
ref|XP_006389323.1|  hypothetical protein POPTR_0030s00450g           67.8    7e-10   
ref|XP_007221303.1|  hypothetical protein PRUPE_ppa001041mg           67.8    7e-10   
ref|XP_009419841.1|  PREDICTED: somatic embryogenesis receptor ki...  64.7    7e-10   
gb|KHG15618.1|  putative receptor protein kinase TMK1                 67.8    7e-10   
ref|XP_009349015.1|  PREDICTED: somatic embryogenesis receptor ki...  64.7    7e-10   
gb|KDP32592.1|  hypothetical protein JCGZ_13142                       67.8    8e-10   
ref|XP_010247019.1|  PREDICTED: probable receptor protein kinase ...  67.8    8e-10   
ref|XP_010685432.1|  PREDICTED: probable receptor protein kinase ...  67.8    8e-10   
ref|XP_008231130.1|  PREDICTED: somatic embryogenesis receptor ki...  64.7    8e-10   
ref|XP_007027970.1|  Leucine-rich repeat protein kinase family pr...  67.4    8e-10   
gb|KJB16548.1|  hypothetical protein B456_002G235300                  67.4    8e-10   
ref|XP_002489035.1|  hypothetical protein SORBIDRAFT_0343s002010      67.4    8e-10   
dbj|BAK05837.1|  predicted protein                                    67.0    8e-10   
gb|ABN05373.1|  BRI1-associated receptor kinase 1                     67.0    8e-10   
emb|CBI32849.3|  unnamed protein product                              65.9    9e-10   
ref|NP_001052975.1|  Os04g0457800                                     67.0    9e-10   
ref|XP_007150032.1|  hypothetical protein PHAVU_005G120300g           67.4    9e-10   
ref|XP_002299783.1|  hypothetical protein POPTR_0001s22700g           64.3    9e-10   
ref|XP_011006057.1|  PREDICTED: somatic embryogenesis receptor ki...  64.3    9e-10   
ref|XP_011020830.1|  PREDICTED: somatic embryogenesis receptor ki...  64.3    9e-10   
gb|EPS68163.1|  hypothetical protein M569_06603                       67.4    1e-09   
gb|KEH40668.1|  receptor kinase TMK1-like protein, putative           67.4    1e-09   
ref|XP_008385628.1|  PREDICTED: somatic embryogenesis receptor ki...  64.3    1e-09   
gb|KHG12648.1|  brassinosteroid insensitive 1-associated receptor...  64.3    1e-09   
gb|ACF86786.1|  unknown                                               63.9    1e-09   
ref|XP_002313480.2|  hypothetical protein POPTR_0009s02550g           67.4    1e-09   
ref|XP_004491677.1|  PREDICTED: somatic embryogenesis receptor ki...  64.3    1e-09   
emb|CDY61573.1|  BnaCnng38030D                                        67.0    1e-09   
gb|KJB20254.1|  hypothetical protein B456_003G140700                  64.3    1e-09   
gb|EPS68473.1|  hypothetical protein M569_06294                       63.9    1e-09   
ref|XP_003537524.1|  PREDICTED: probable receptor protein kinase ...  67.0    1e-09   
ref|XP_009374103.1|  PREDICTED: probable receptor protein kinase ...  67.0    1e-09   
emb|CDY63752.1|  BnaAnng19060D                                        67.0    1e-09   
ref|XP_011017684.1|  PREDICTED: probable receptor protein kinase ...  67.0    1e-09   
ref|XP_004249343.1|  PREDICTED: BRASSINOSTEROID INSENSITIVE 1-ass...  64.3    1e-09   
ref|XP_004506220.1|  PREDICTED: probable receptor protein kinase ...  67.0    1e-09   
ref|XP_011003774.1|  PREDICTED: probable receptor protein kinase ...  67.0    1e-09   
ref|XP_007163803.1|  hypothetical protein PHAVU_001G265500g           67.0    1e-09   
ref|XP_011042042.1|  PREDICTED: probable receptor protein kinase ...  67.0    1e-09   
ref|XP_009339518.1|  PREDICTED: somatic embryogenesis receptor ki...  63.9    1e-09   
gb|AAO72615.1|  receptor-like protein kinase-like protein             67.0    1e-09   
gb|KHN26729.1|  BRASSINOSTEROID INSENSITIVE 1-associated receptor...  66.6    1e-09   
gb|AFV33711.1|  leucine rich repeat protein                           63.9    1e-09   
ref|XP_011005684.1|  PREDICTED: probable receptor protein kinase ...  66.6    1e-09   
ref|XP_006339232.1|  PREDICTED: BRASSINOSTEROID INSENSITIVE 1-ass...  63.9    1e-09   
ref|XP_006601886.1|  PREDICTED: probable receptor protein kinase ...  66.6    1e-09   
ref|XP_004247890.2|  PREDICTED: probable receptor protein kinase ...  66.6    1e-09   
ref|XP_006584457.1|  PREDICTED: somatic embryogenesis receptor-li...  66.2    2e-09   
emb|CBI39413.3|  unnamed protein product                              66.6    2e-09   
gb|AAP23944.1|  leucine-rich repeat protein                           63.9    2e-09   
ref|XP_002532551.1|  Serine/threonine-protein kinase PBS1, putative   66.6    2e-09   
ref|XP_001784078.1|  predicted protein                                63.9    2e-09   
ref|XP_010922094.1|  PREDICTED: somatic embryogenesis receptor ki...  63.5    2e-09   
ref|XP_002263688.1|  PREDICTED: somatic embryogenesis receptor ki...  63.5    2e-09   
ref|XP_006832864.1|  hypothetical protein AMTR_s00095p00075330        63.5    2e-09   
ref|XP_002275877.1|  PREDICTED: somatic embryogenesis receptor ki...  63.5    2e-09   
gb|KJB56059.1|  hypothetical protein B456_009G105500                  63.5    2e-09   
gb|KCW60658.1|  hypothetical protein EUGRSUZ_H03383                   63.5    2e-09   
ref|XP_004494248.1|  PREDICTED: probable receptor protein kinase ...  66.2    2e-09   
ref|XP_009106355.1|  PREDICTED: probable receptor protein kinase ...  66.2    2e-09   
gb|EYU18122.1|  hypothetical protein MIMGU_mgv1a000918mg              66.2    2e-09   
ref|XP_006841985.1|  hypothetical protein AMTR_s00144p00059190        63.2    2e-09   
ref|XP_006360918.1|  PREDICTED: probable receptor protein kinase ...  66.2    2e-09   
emb|CAN61408.1|  hypothetical protein VITISV_035126                   63.2    2e-09   
gb|KDP42891.1|  hypothetical protein JCGZ_23833                       63.5    2e-09   
emb|CDY18093.1|  BnaA01g23540D                                        65.9    2e-09   
ref|XP_002986550.1|  hypothetical protein SELMODRAFT_446618           63.2    3e-09   
ref|XP_010454429.1|  PREDICTED: somatic embryogenesis receptor ki...  63.2    3e-09   
ref|XP_009777291.1|  PREDICTED: probable receptor protein kinase ...  65.9    3e-09   
ref|XP_002979077.1|  hypothetical protein SELMODRAFT_444078           63.2    3e-09   
ref|XP_004252979.1|  PREDICTED: probable receptor protein kinase ...  65.9    3e-09   
ref|XP_006591063.1|  PREDICTED: probable receptor protein kinase ...  65.9    3e-09   
ref|XP_010023622.1|  PREDICTED: probable receptor protein kinase ...  65.9    3e-09   
ref|XP_003596879.1|  Receptor-like protein kinase                     65.9    3e-09   
gb|KHN17972.1|  Putative receptor protein kinase TMK1                 65.5    3e-09   
ref|XP_010023621.1|  PREDICTED: probable receptor protein kinase ...  65.9    3e-09   
gb|KHN19921.1|  Putative receptor protein kinase TMK1                 65.5    3e-09   
ref|XP_011036144.1|  PREDICTED: somatic embryogenesis receptor ki...  62.8    3e-09   
gb|KDP23101.1|  hypothetical protein JCGZ_00527                       65.5    4e-09   
ref|XP_011089643.1|  PREDICTED: probable receptor protein kinase ...  65.5    4e-09   
ref|XP_006653057.1|  PREDICTED: probable receptor protein kinase ...  65.5    4e-09   
gb|ACM89489.1|  receptor-like kinase                                  65.5    4e-09   
dbj|BAH56606.1|  receptor-like kinase                                 65.5    4e-09   
ref|XP_010917500.1|  PREDICTED: probable receptor protein kinase ...  65.5    4e-09   
ref|XP_004979222.1|  PREDICTED: probable receptor protein kinase ...  65.5    4e-09   
gb|EYU31524.1|  hypothetical protein MIMGU_mgv1a001083mg              65.1    4e-09   
ref|XP_010493229.1|  PREDICTED: somatic embryogenesis receptor ki...  62.8    4e-09   
gb|ADO66723.1|  somatic embryogenesis receptor kinase 3 splice va...  62.0    4e-09   
ref|XP_009416848.1|  PREDICTED: somatic embryogenesis receptor ki...  62.8    4e-09   
ref|XP_006349904.1|  PREDICTED: probable receptor protein kinase ...  65.1    5e-09   
ref|XP_004160232.1|  PREDICTED: somatic embryogenesis receptor ki...  61.6    5e-09   
dbj|BAH56605.1|  receptor-like kinase                                 65.1    5e-09   
gb|KEH29775.1|  receptor kinase TMK1-like protein                     65.1    5e-09   
ref|XP_010673522.1|  PREDICTED: probable receptor protein kinase ...  65.1    5e-09   
gb|ABK21187.1|  unknown                                               62.4    5e-09   
gb|KJB37881.1|  hypothetical protein B456_006G224800                  65.1    5e-09   
ref|XP_008804489.1|  PREDICTED: somatic embryogenesis receptor ki...  64.7    5e-09   
ref|XP_003579497.1|  PREDICTED: probable receptor protein kinase ...  65.1    5e-09   
ref|XP_010059098.1|  PREDICTED: probable receptor protein kinase ...  65.1    5e-09   
gb|EYU36035.1|  hypothetical protein MIMGU_mgv1a000849mg              65.1    5e-09   
gb|AEC46977.1|  somatic embryogenesis receptor-like kinase            64.7    5e-09   
ref|XP_006385886.1|  hypothetical protein POPTR_0003s16460g           62.4    6e-09   
ref|XP_010466732.1|  PREDICTED: probable receptor protein kinase ...  65.1    6e-09   
ref|XP_002303765.1|  hypothetical protein POPTR_0003s16460g           62.4    6e-09   
emb|CDP13397.1|  unnamed protein product                              62.4    6e-09   
gb|EYU35887.1|  hypothetical protein MIMGU_mgv1a003189mg              64.7    6e-09   
ref|XP_006481539.1|  PREDICTED: probable receptor protein kinase ...  64.7    6e-09   
ref|XP_006424117.1|  hypothetical protein CICLE_v10027751mg           64.7    6e-09   
gb|EPS58386.1|  hypothetical protein M569_16428                       61.6    6e-09   
gb|ABK24062.1|  unknown                                               62.0    6e-09   
gb|KDO58246.1|  hypothetical protein CISIN_1g041143mg                 64.7    6e-09   
ref|XP_004144110.1|  PREDICTED: somatic embryogenesis receptor ki...  62.0    6e-09   
ref|XP_009138577.1|  PREDICTED: probable receptor protein kinase ...  64.7    6e-09   
gb|AFO67894.1|  leucine-rich repeat receptor-like kinase              64.3    7e-09   
gb|KCW59923.1|  hypothetical protein EUGRSUZ_H02647                   64.7    7e-09   
ref|XP_008230174.1|  PREDICTED: probable receptor protein kinase ...  64.7    7e-09   
ref|XP_008451095.1|  PREDICTED: somatic embryogenesis receptor ki...  62.0    7e-09   
emb|CDX89615.1|  BnaC03g45290D                                        64.3    7e-09   
ref|XP_010512862.1|  PREDICTED: probable receptor protein kinase ...  64.7    7e-09   
gb|EMT17636.1|  Putative receptor protein kinase TMK1                 64.7    7e-09   
emb|CDX93126.1|  BnaA03g38480D                                        64.3    8e-09   



>emb|CDP01661.1| unnamed protein product [Coffea canephora]
Length=943

 Score =   175 bits (443),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 102/145 (70%), Positives = 116/145 (80%), Gaps = 2/145 (1%)
 Frame = +3

Query  102  MRVHLGLKLPALVFLGIFASLFVNAVSQAGQNDDASVMFALKKSLNPPSDMGWSGQDPCK  281
            MR  LG K+ A +FLG F+SL  +A SQ   ND A VM ALKKSLNPP  +GWS  DPCK
Sbjct  1    MRTKLGFKIAAFLFLG-FSSLLFSADSQPTSND-AEVMLALKKSLNPPETLGWSDPDPCK  58

Query  282  WNHVGCSDDRRVIRIQIGHNSLQGTLPPDLSKLTQLQRLELQWNNIsgplpslnglsslR  461
            W HVGCSDD+RVIRIQIG+ +L+GTLP  LS LT+L+RLEL WNNISGPLPSL GLSSL+
Sbjct  59   WPHVGCSDDKRVIRIQIGNRNLKGTLPQSLSNLTELERLELHWNNISGPLPSLKGLSSLQ  118

Query  462  VLMLSNNHFTSIPSDFFVGMSSLQS  536
            VLMLSNN FTSIP+DFF GM+SL S
Sbjct  119  VLMLSNNQFTSIPADFFAGMTSLIS  143



>ref|XP_009587166.1| PREDICTED: probable receptor protein kinase TMK1 [Nicotiana tomentosiformis]
Length=943

 Score =   173 bits (439),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 102/145 (70%), Positives = 117/145 (81%), Gaps = 4/145 (3%)
 Frame = +3

Query  102  MRVHLGLKLPALVFLGIFASLFVNAVSQAGQNDDASVMFALKKSLNPPSDMGWSGQDPCK  281
            M+  +GLKL   + LGI A LF  A SQ    +DASVM ALKKSLN P ++GW   DPCK
Sbjct  1    MKTLIGLKLVTFLVLGISA-LFSGANSQ---ENDASVMLALKKSLNSPQELGWLDPDPCK  56

Query  282  WNHVGCSDDRRVIRIQIGHNSLQGTLPPDLSKLTQLQRLELQWNNIsgplpslnglsslR  461
            WNHVGCSDD+RV RIQIGH +LQG LP +LSKLT+L+RLELQWNNISGPLPSL+GLSSL+
Sbjct  57   WNHVGCSDDKRVTRIQIGHKNLQGNLPQELSKLTELERLELQWNNISGPLPSLSGLSSLQ  116

Query  462  VLMLSNNHFTSIPSDFFVGMSSLQS  536
            VLMLSNN F+ IP+DFF GMSSLQS
Sbjct  117  VLMLSNNQFSFIPADFFAGMSSLQS  141



>ref|XP_009769564.1| PREDICTED: probable receptor protein kinase TMK1 [Nicotiana sylvestris]
Length=943

 Score =   171 bits (433),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 101/145 (70%), Positives = 116/145 (80%), Gaps = 4/145 (3%)
 Frame = +3

Query  102  MRVHLGLKLPALVFLGIFASLFVNAVSQAGQNDDASVMFALKKSLNPPSDMGWSGQDPCK  281
            M+  +GLKL   + LGI A LF  A SQ    +DASVM ALKKSLN P ++GW   DPCK
Sbjct  1    MKTLIGLKLVTFLVLGISA-LFSGANSQ---ENDASVMLALKKSLNSPQELGWLDPDPCK  56

Query  282  WNHVGCSDDRRVIRIQIGHNSLQGTLPPDLSKLTQLQRLELQWNNIsgplpslnglsslR  461
            W+HVGCSDD+RV RIQIGH +LQG LP +LSKLT+L+RLELQWNNISGPLPSL+GLSSL+
Sbjct  57   WDHVGCSDDKRVTRIQIGHKNLQGNLPTELSKLTELERLELQWNNISGPLPSLSGLSSLQ  116

Query  462  VLMLSNNHFTSIPSDFFVGMSSLQS  536
            VLMLSNN F+ IP DFF GMSSLQS
Sbjct  117  VLMLSNNQFSFIPVDFFTGMSSLQS  141



>gb|KJB43187.1| hypothetical protein B456_007G187900 [Gossypium raimondii]
Length=953

 Score =   166 bits (421),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 90/144 (63%), Positives = 112/144 (78%), Gaps = 0/144 (0%)
 Frame = +3

Query  105  RVHLGLKLPALVFLGIFASLFVNAVSQAGQNDDASVMFALKKSLNPPSDMGWSGQDPCKW  284
            +  LG       F+  F+S+F++  SQ   +DDA+ M ALKK+L PP  +GW+  DPCKW
Sbjct  4    KPRLGFCFKLFAFIIGFSSIFISVKSQTTASDDAAAMLALKKTLGPPESLGWTDPDPCKW  63

Query  285  NHVGCSDDRRVIRIQIGHNSLQGTLPPDLSKLTQLQRLELQWNNIsgplpslnglsslRV  464
             HV CS+D+RV RIQIGH +LQGTLP D+  LT+L+RLE+QWNNISGP+PSLNGLSSL+V
Sbjct  64   KHVFCSEDKRVTRIQIGHQNLQGTLPSDIQILTELERLEVQWNNISGPVPSLNGLSSLQV  123

Query  465  LMLSNNHFTSIPSDFFVGMSSLQS  536
            LMLSNNHFTS P+DFF G+SSLQS
Sbjct  124  LMLSNNHFTSFPTDFFSGLSSLQS  147



>ref|XP_006494665.1| PREDICTED: probable receptor protein kinase TMK1-like isoform 
X2 [Citrus sinensis]
Length=787

 Score =   164 bits (416),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 92/144 (64%), Positives = 115/144 (80%), Gaps = 4/144 (3%)
 Frame = +3

Query  105  RVHLGLKLPALVFLGIFASLFVNAVSQAGQNDDASVMFALKKSLNPPSDMGWSGQDPCKW  284
            +  +G KL  L ++G  + LFV+A   +G + DA+VM ALKKSLNPP  +GWS  DPCKW
Sbjct  4    KTCVGFKLLTL-YVGFCSILFVSA---SGDDGDAAVMLALKKSLNPPESLGWSDTDPCKW  59

Query  285  NHVGCSDDRRVIRIQIGHNSLQGTLPPDLSKLTQLQRLELQWNNIsgplpslnglsslRV  464
            NHV C++D+R+ RIQIGH +LQGTLP +L  LT+L+RLELQWN+ISGPL SLNGL+SL V
Sbjct  60   NHVVCTEDKRITRIQIGHQNLQGTLPSNLQNLTKLERLELQWNSISGPLRSLNGLASLEV  119

Query  465  LMLSNNHFTSIPSDFFVGMSSLQS  536
            +MLSNN FTS+PSDFF G+SSLQS
Sbjct  120  VMLSNNQFTSVPSDFFTGLSSLQS  143



>ref|XP_006494664.1| PREDICTED: probable receptor protein kinase TMK1-like isoform 
X1 [Citrus sinensis]
Length=948

 Score =   165 bits (417),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 92/144 (64%), Positives = 115/144 (80%), Gaps = 4/144 (3%)
 Frame = +3

Query  105  RVHLGLKLPALVFLGIFASLFVNAVSQAGQNDDASVMFALKKSLNPPSDMGWSGQDPCKW  284
            +  +G KL  L ++G  + LFV+A   +G + DA+VM ALKKSLNPP  +GWS  DPCKW
Sbjct  4    KTCVGFKLLTL-YVGFCSILFVSA---SGDDGDAAVMLALKKSLNPPESLGWSDTDPCKW  59

Query  285  NHVGCSDDRRVIRIQIGHNSLQGTLPPDLSKLTQLQRLELQWNNIsgplpslnglsslRV  464
            NHV C++D+R+ RIQIGH +LQGTLP +L  LT+L+RLELQWN+ISGPL SLNGL+SL V
Sbjct  60   NHVVCTEDKRITRIQIGHQNLQGTLPSNLQNLTKLERLELQWNSISGPLRSLNGLASLEV  119

Query  465  LMLSNNHFTSIPSDFFVGMSSLQS  536
            +MLSNN FTS+PSDFF G+SSLQS
Sbjct  120  VMLSNNQFTSVPSDFFTGLSSLQS  143



>gb|KDO41053.1| hypothetical protein CISIN_1g002238mg [Citrus sinensis]
Length=787

 Score =   162 bits (411),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 93/144 (65%), Positives = 115/144 (80%), Gaps = 4/144 (3%)
 Frame = +3

Query  105  RVHLGLKLPALVFLGIFASLFVNAVSQAGQNDDASVMFALKKSLNPPSDMGWSGQDPCKW  284
            +  +G KL  L ++G  + LFV+A   +G + DA+VM ALKKSLNPP  +GWS  DPCKW
Sbjct  4    KTCVGFKLLTL-YVGFCSILFVSA---SGDDGDAAVMLALKKSLNPPESLGWSDTDPCKW  59

Query  285  NHVGCSDDRRVIRIQIGHNSLQGTLPPDLSKLTQLQRLELQWNNIsgplpslnglsslRV  464
            NHV C +D+R+ RIQIGH +LQGTLP +L  LT+L+RLELQWN+ISGPLPSLNGL+SL V
Sbjct  60   NHVVCIEDKRITRIQIGHQNLQGTLPSNLQNLTKLERLELQWNSISGPLPSLNGLASLEV  119

Query  465  LMLSNNHFTSIPSDFFVGMSSLQS  536
            +MLSNN FTS+PSDFF G+SSLQS
Sbjct  120  VMLSNNQFTSVPSDFFTGLSSLQS  143



>gb|KDO41052.1| hypothetical protein CISIN_1g002238mg [Citrus sinensis]
Length=948

 Score =   163 bits (412),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 93/144 (65%), Positives = 115/144 (80%), Gaps = 4/144 (3%)
 Frame = +3

Query  105  RVHLGLKLPALVFLGIFASLFVNAVSQAGQNDDASVMFALKKSLNPPSDMGWSGQDPCKW  284
            +  +G KL  L ++G  + LFV+A   +G + DA+VM ALKKSLNPP  +GWS  DPCKW
Sbjct  4    KTCVGFKLLTL-YVGFCSILFVSA---SGDDGDAAVMLALKKSLNPPESLGWSDTDPCKW  59

Query  285  NHVGCSDDRRVIRIQIGHNSLQGTLPPDLSKLTQLQRLELQWNNIsgplpslnglsslRV  464
            NHV C +D+R+ RIQIGH +LQGTLP +L  LT+L+RLELQWN+ISGPLPSLNGL+SL V
Sbjct  60   NHVVCIEDKRITRIQIGHQNLQGTLPSNLQNLTKLERLELQWNSISGPLPSLNGLASLEV  119

Query  465  LMLSNNHFTSIPSDFFVGMSSLQS  536
            +MLSNN FTS+PSDFF G+SSLQS
Sbjct  120  VMLSNNQFTSVPSDFFTGLSSLQS  143



>ref|XP_009775667.1| PREDICTED: probable receptor protein kinase TMK1 [Nicotiana sylvestris]
Length=948

 Score =   162 bits (411),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 94/144 (65%), Positives = 113/144 (78%), Gaps = 3/144 (2%)
 Frame = +3

Query  105  RVHLGLKLPALVFLGIFASLFVNAVSQAGQNDDASVMFALKKSLNPPSDMGWSGQDPCKW  284
            + HLGLKL A + LG F++ F    SQ    +DA+VM ALKKSLNPP +MGW   DPCKW
Sbjct  3    KTHLGLKLVAFLVLGFFSAFFSGVKSQ---ENDATVMLALKKSLNPPQEMGWLDPDPCKW  59

Query  285  NHVGCSDDRRVIRIQIGHNSLQGTLPPDLSKLTQLQRLELQWNNIsgplpslnglsslRV  464
            +HVGCS  +RV RIQIGH +L+GTLP +L+KLT L+ LELQWN ISGPLPSLNGLSSL+V
Sbjct  60   SHVGCSVGKRVTRIQIGHQNLEGTLPQELAKLTALEHLELQWNKISGPLPSLNGLSSLQV  119

Query  465  LMLSNNHFTSIPSDFFVGMSSLQS  536
            L++SNN F+SIP DFF GM+SL S
Sbjct  120  LIISNNQFSSIPIDFFSGMTSLIS  143



>ref|XP_002533475.1| receptor protein kinase, putative [Ricinus communis]
 gb|EEF28907.1| receptor protein kinase, putative [Ricinus communis]
Length=951

 Score =   162 bits (411),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 92/146 (63%), Positives = 110/146 (75%), Gaps = 1/146 (1%)
 Frame = +3

Query  99   EMRVHLGLKLPALVFLGIFASLFVNAVSQAGQNDDASVMFALKKSLNPPSDMGWSGQDPC  278
            E RV++  K   L+FL  F S FVN   Q   ++DA VMFAL+KSLN P  +GWS  DPC
Sbjct  2    EKRVYIKFK-SLLIFLSGFCSFFVNVSCQGSPSEDAPVMFALRKSLNVPDSLGWSDPDPC  60

Query  279  KWNHVGCSDDRRVIRIQIGHNSLQGTLPPDLSKLTQLQRLELQWNNIsgplpslnglssl  458
             W HV CSD++RV RIQIG  +L+GTLP +L  LTQL+RLELQWN+ISGPLP+L GL+SL
Sbjct  61   NWKHVTCSDEKRVTRIQIGRQNLEGTLPSNLQNLTQLERLELQWNSISGPLPTLKGLASL  120

Query  459  RVLMLSNNHFTSIPSDFFVGMSSLQS  536
             V+MLS N FTSIPSDFF G+SSLQS
Sbjct  121  LVVMLSGNQFTSIPSDFFTGLSSLQS  146



>ref|XP_010528574.1| PREDICTED: probable receptor protein kinase TMK1 [Tarenaya hassleriana]
Length=944

 Score =   161 bits (408),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 93/138 (67%), Positives = 112/138 (81%), Gaps = 4/138 (3%)
 Frame = +3

Query  132  ALVFLGIFASLFVNAVSQAGQN---DDASVMFALKKSLNPPSDMGWSGQDPCKWNHVGCS  302
            +++FL  FAS F  + +QA  +   DDAS M AL+KSLNPP  +GWSG +PCKW +VGC+
Sbjct  9    SILFLA-FASAFHLSRAQASSSNGGDDASAMLALRKSLNPPPSLGWSGPNPCKWKNVGCA  67

Query  303  DDRRVIRIQIGHNSLQGTLPPDLSKLTQLQRLELQWNNIsgplpslnglsslRVLMLSNN  482
            D  RV RIQIGH +LQGTLPPDL  L++L+RLELQWN ISGP+PSL+GLSSL+VLMLSNN
Sbjct  68   DSNRVTRIQIGHCNLQGTLPPDLRNLSELERLELQWNKISGPVPSLSGLSSLQVLMLSNN  127

Query  483  HFTSIPSDFFVGMSSLQS  536
             F SIPSDFFVG+SSLQS
Sbjct  128  QFDSIPSDFFVGLSSLQS  145



>ref|XP_009370081.1| PREDICTED: probable receptor protein kinase TMK1 [Pyrus x bretschneideri]
Length=949

 Score =   161 bits (408),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 90/144 (63%), Positives = 110/144 (76%), Gaps = 1/144 (1%)
 Frame = +3

Query  105  RVHLGLKLPALVFLGIFASLFVNAVSQAGQNDDASVMFALKKSLNPPSDMGWSGQDPCKW  284
            + H G K  A++  G F+S  + A SQ   ++DA VM ALKK+LNP   +GWS  DPC W
Sbjct  4    KTHAGFKFLAILLAG-FSSFLLCANSQPSSSNDAEVMLALKKTLNPSESLGWSDPDPCTW  62

Query  285  NHVGCSDDRRVIRIQIGHNSLQGTLPPDLSKLTQLQRLELQWNNIsgplpslnglsslRV  464
             HVGCSDD+RV RIQ+GH +++GTLP  L  LTQL+RLELQWN I+GPLPSL+GLS+L+V
Sbjct  63   THVGCSDDKRVTRIQLGHLNIEGTLPLSLQNLTQLERLELQWNKITGPLPSLSGLSALQV  122

Query  465  LMLSNNHFTSIPSDFFVGMSSLQS  536
            LMLSNN FTSIP DFF GM+SLQS
Sbjct  123  LMLSNNLFTSIPGDFFSGMTSLQS  146



>ref|XP_002305223.1| hypothetical protein POPTR_0004s08230g [Populus trichocarpa]
 gb|EEE85734.1| hypothetical protein POPTR_0004s08230g [Populus trichocarpa]
Length=946

 Score =   159 bits (403),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 92/134 (69%), Positives = 110/134 (82%), Gaps = 2/134 (1%)
 Frame = +3

Query  135  LVFLGIFASLFVNAVSQAGQNDDASVMFALKKSLNPPSDMGWSGQDPCKWNHVGCSDDRR  314
            L+FL  F+S+F  A SQA  + DA VM +LKKSLN P  +GWS  DPCKWNHVGCSD++R
Sbjct  13   LIFLVGFSSIFRYASSQA--SPDAEVMLSLKKSLNVPDSLGWSDPDPCKWNHVGCSDEKR  70

Query  315  VIRIQIGHNSLQGTLPPDLSKLTQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFTS  494
            V RIQIG  +LQGTLP +L  LTQL+RLELQ+NNISG LPSLNGLSSL+V++LS+N FTS
Sbjct  71   VTRIQIGRQNLQGTLPSNLQNLTQLERLELQYNNISGHLPSLNGLSSLQVILLSDNKFTS  130

Query  495  IPSDFFVGMSSLQS  536
            +PSDFF G+SSLQS
Sbjct  131  VPSDFFAGLSSLQS  144



>ref|XP_007032165.1| Transmembrane kinase 1 isoform 1 [Theobroma cacao]
 gb|EOY03091.1| Transmembrane kinase 1 isoform 1 [Theobroma cacao]
Length=953

 Score =   159 bits (403),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 85/125 (68%), Positives = 103/125 (82%), Gaps = 0/125 (0%)
 Frame = +3

Query  162  LFVNAVSQAGQNDDASVMFALKKSLNPPSDMGWSGQDPCKWNHVGCSDDRRVIRIQIGHN  341
            +FV+  SQ   +DDA+VM AL+K+LNPP  +GWS  DPCKW+HV CS+ +RV RIQIGH 
Sbjct  23   IFVSVKSQKSASDDAAVMLALRKTLNPPESLGWSDTDPCKWSHVVCSEGKRVTRIQIGHQ  82

Query  342  SLQGTLPPDLSKLTQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFTSIPSDFFVGM  521
            +LQGTLP +L  LT+L+RLELQWNNISG +PSLNGLSSL+V+MLSNN FTS P DFF G+
Sbjct  83   NLQGTLPSNLQNLTELERLELQWNNISGSVPSLNGLSSLQVVMLSNNRFTSFPDDFFSGL  142

Query  522  SSLQS  536
            SSLQS
Sbjct  143  SSLQS  147



>ref|XP_008343073.1| PREDICTED: LOW QUALITY PROTEIN: probable receptor protein kinase 
TMK1 [Malus domestica]
Length=952

 Score =   158 bits (399),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 87/144 (60%), Positives = 112/144 (78%), Gaps = 1/144 (1%)
 Frame = +3

Query  105  RVHLGLKLPALVFLGIFASLFVNAVSQAGQNDDASVMFALKKSLNPPSDMGWSGQDPCKW  284
            + H G K   ++  G+ +S+ + A SQ   ++DA+VM ALKK+L P   +GWS  DPC+W
Sbjct  4    KTHAGFKFLTILLAGL-SSILLGANSQPSSSNDAAVMLALKKTLKPSESVGWSDPDPCQW  62

Query  285  NHVGCSDDRRVIRIQIGHNSLQGTLPPDLSKLTQLQRLELQWNNIsgplpslnglsslRV  464
             HVGCSDD+RV RIQ+GH +++GTLP  L  LT+L+RLELQWN ISGPLPSL+GLSSL+V
Sbjct  63   THVGCSDDKRVTRIQLGHLNIEGTLPSSLQNLTELERLELQWNKISGPLPSLSGLSSLQV  122

Query  465  LMLSNNHFTSIPSDFFVGMSSLQS  536
            L++SNN FTSIPSDFF GM+SLQS
Sbjct  123  LLISNNLFTSIPSDFFTGMTSLQS  146



>ref|XP_009594248.1| PREDICTED: probable receptor protein kinase TMK1 [Nicotiana tomentosiformis]
Length=943

 Score =   157 bits (398),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 93/144 (65%), Positives = 111/144 (77%), Gaps = 7/144 (5%)
 Frame = +3

Query  105  RVHLGLKLPALVFLGIFASLFVNAVSQAGQNDDASVMFALKKSLNPPSDMGWSGQDPCKW  284
            +  LGLKL A + L  F+ +         Q +DA+VM ALKKSLNPP +MGW   DPCKW
Sbjct  3    KTPLGLKLVAFLVLVFFSGV-------KSQENDATVMLALKKSLNPPQEMGWLDPDPCKW  55

Query  285  NHVGCSDDRRVIRIQIGHNSLQGTLPPDLSKLTQLQRLELQWNNIsgplpslnglsslRV  464
            NHVGCS D+RV RIQIGH++L+GTLP +LSKLT L+ LELQWN ISGPLPSLNGLSSL+V
Sbjct  56   NHVGCSVDKRVTRIQIGHHNLEGTLPQELSKLTALEHLELQWNKISGPLPSLNGLSSLQV  115

Query  465  LMLSNNHFTSIPSDFFVGMSSLQS  536
            L++SNN F+SIP DFF GM+SL S
Sbjct  116  LIISNNQFSSIPVDFFSGMTSLIS  139



>gb|KHG20581.1| putative receptor protein kinase TMK1 [Gossypium arboreum]
Length=953

 Score =   156 bits (395),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 89/133 (67%), Positives = 108/133 (81%), Gaps = 0/133 (0%)
 Frame = +3

Query  138  VFLGIFASLFVNAVSQAGQNDDASVMFALKKSLNPPSDMGWSGQDPCKWNHVGCSDDRRV  317
             F+  F+S+F++  SQ   +DDA+ M ALKK+L PP  +GW+  DPCKW HV CS+DRRV
Sbjct  15   AFIIGFSSIFISVKSQTTASDDAAAMLALKKTLGPPESLGWTDPDPCKWKHVFCSEDRRV  74

Query  318  IRIQIGHNSLQGTLPPDLSKLTQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFTSI  497
             RIQIGH +LQGTLP D+  LT+L+RLE+QWNNISGP+PSLNGLSSL VLMLSNNHFTS 
Sbjct  75   TRIQIGHQNLQGTLPSDIQNLTELERLEVQWNNISGPVPSLNGLSSLLVLMLSNNHFTSF  134

Query  498  PSDFFVGMSSLQS  536
            P+DFF G+SSLQS
Sbjct  135  PTDFFSGLSSLQS  147



>ref|XP_004289581.2| PREDICTED: probable receptor protein kinase TMK1 [Fragaria vesca 
subsp. vesca]
Length=913

 Score =   155 bits (391),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 83/108 (77%), Positives = 95/108 (88%), Gaps = 0/108 (0%)
 Frame = +3

Query  213  MFALKKSLNPPSDMGWSGQDPCKWNHVGCSDDRRVIRIQIGHNSLQGTLPPDLSKLTQLQ  392
            M ALKKSLNPP+  GWS  +PCKW++VGCSDD+RV RIQIGH ++QGTLPP L  LTQL+
Sbjct  1    MLALKKSLNPPASFGWSDPNPCKWSYVGCSDDKRVTRIQIGHQNIQGTLPPSLQNLTQLE  60

Query  393  RLELQWNNIsgplpslnglsslRVLMLSNNHFTSIPSDFFVGMSSLQS  536
            RLELQWNNISGPLPSL+GL SL+VL+LSNN FTSIPSDFF GM+SLQS
Sbjct  61   RLELQWNNISGPLPSLSGLGSLQVLLLSNNLFTSIPSDFFTGMTSLQS  108



>ref|XP_010690479.1| PREDICTED: probable receptor protein kinase TMK1 [Beta vulgaris 
subsp. vulgaris]
Length=946

 Score =   154 bits (390),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 83/120 (69%), Positives = 103/120 (86%), Gaps = 0/120 (0%)
 Frame = +3

Query  177  VSQAGQNDDASVMFALKKSLNPPSDMGWSGQDPCKWNHVGCSDDRRVIRIQIGHNSLQGT  356
            ++ + + DD SVM ALKKSLNPP  +GWS  DPCKW+HV CS++++V RIQIGH +L+G 
Sbjct  26   IAYSQEEDDVSVMLALKKSLNPPVSLGWSDPDPCKWSHVVCSEEKKVTRIQIGHQNLEGN  85

Query  357  LPPDLSKLTQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFTSIPSDFFVGMSSLQS  536
            LPP+LS LT L+RLELQWNNISGP+PSLNGL+SL+V+MLSNN F+SIPSDFF G+SSLQS
Sbjct  86   LPPNLSLLTSLERLELQWNNISGPIPSLNGLNSLQVIMLSNNQFSSIPSDFFDGLSSLQS  145



>ref|XP_006391349.1| hypothetical protein EUTSA_v10018085mg [Eutrema salsugineum]
 gb|ESQ28635.1| hypothetical protein EUTSA_v10018085mg [Eutrema salsugineum]
Length=938

 Score =   154 bits (388),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 86/117 (74%), Positives = 96/117 (82%), Gaps = 0/117 (0%)
 Frame = +3

Query  186  AGQNDDASVMFALKKSLNPPSDMGWSGQDPCKWNHVGCSDDRRVIRIQIGHNSLQGTLPP  365
            A  + D S M ALKKSLNPPS +GWS  DPCKW HV C+  +RV RIQIGH+ LQGTL P
Sbjct  23   ADSDGDVSAMLALKKSLNPPSSLGWSDPDPCKWTHVVCTGSKRVTRIQIGHSGLQGTLSP  82

Query  366  DLSKLTQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFTSIPSDFFVGMSSLQS  536
            DL  LT+L+RLELQWNNISGP+PSLNGLSSL+VLMLSNNHF SIPSD F G+SSLQS
Sbjct  83   DLRSLTELERLELQWNNISGPVPSLNGLSSLQVLMLSNNHFESIPSDVFQGLSSLQS  139



>emb|CDY39246.1| BnaC06g27450D [Brassica napus]
Length=942

 Score =   154 bits (388),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 83/119 (70%), Positives = 98/119 (82%), Gaps = 0/119 (0%)
 Frame = +3

Query  180  SQAGQNDDASVMFALKKSLNPPSDMGWSGQDPCKWNHVGCSDDRRVIRIQIGHNSLQGTL  359
            S+A  + DAS M +LKKSLNPPS  GWS  DPCKW HV C+  +RV RIQIGH+ LQGTL
Sbjct  23   SKADSDGDASAMLSLKKSLNPPSSFGWSDPDPCKWTHVVCTGTKRVTRIQIGHSGLQGTL  82

Query  360  PPDLSKLTQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFTSIPSDFFVGMSSLQS  536
             PD+  LT+L+RLELQWNNISGP+P+L+GLSSL+VLMLSNNHF SIPSD F G++SLQS
Sbjct  83   SPDIRSLTELERLELQWNNISGPIPTLSGLSSLQVLMLSNNHFDSIPSDIFQGLTSLQS  141



>ref|XP_009105191.1| PREDICTED: probable receptor protein kinase TMK1 [Brassica rapa]
Length=943

 Score =   154 bits (388),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 83/119 (70%), Positives = 98/119 (82%), Gaps = 0/119 (0%)
 Frame = +3

Query  180  SQAGQNDDASVMFALKKSLNPPSDMGWSGQDPCKWNHVGCSDDRRVIRIQIGHNSLQGTL  359
            S+A  + DAS M +LKKSLNPPS  GWS  DPCKW HV C+  +RV RIQIGH+ LQGTL
Sbjct  23   SKADSDGDASAMLSLKKSLNPPSSFGWSDPDPCKWTHVVCTGTKRVTRIQIGHSGLQGTL  82

Query  360  PPDLSKLTQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFTSIPSDFFVGMSSLQS  536
             PD+  LT+L+RLELQWNNISGP+P+L+GLSSL+VLMLSNNHF SIPSD F G++SLQS
Sbjct  83   SPDIRSLTELERLELQWNNISGPIPTLSGLSSLQVLMLSNNHFDSIPSDIFQGLTSLQS  141



>emb|CDY07484.1| BnaA07g25630D [Brassica napus]
Length=943

 Score =   154 bits (388),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 83/119 (70%), Positives = 98/119 (82%), Gaps = 0/119 (0%)
 Frame = +3

Query  180  SQAGQNDDASVMFALKKSLNPPSDMGWSGQDPCKWNHVGCSDDRRVIRIQIGHNSLQGTL  359
            S+A  + DAS M +LKKSLNPPS  GWS  DPCKW HV C+  +RV RIQIGH+ LQGTL
Sbjct  23   SKADSDGDASAMLSLKKSLNPPSSFGWSDPDPCKWTHVVCTGTKRVTRIQIGHSGLQGTL  82

Query  360  PPDLSKLTQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFTSIPSDFFVGMSSLQS  536
             PD+  LT+L+RLELQWNNISGP+P+L+GLSSL+VLMLSNNHF SIPSD F G++SLQS
Sbjct  83   SPDIRSLTELERLELQWNNISGPIPTLSGLSSLQVLMLSNNHFDSIPSDIFQGLTSLQS  141



>ref|XP_011043912.1| PREDICTED: probable receptor protein kinase TMK1 [Populus euphratica]
Length=946

 Score =   154 bits (388),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 91/134 (68%), Positives = 109/134 (81%), Gaps = 2/134 (1%)
 Frame = +3

Query  135  LVFLGIFASLFVNAVSQAGQNDDASVMFALKKSLNPPSDMGWSGQDPCKWNHVGCSDDRR  314
            L+FL  F+S+F  A SQA  + DA VM +LKKSLN P  +GWS  DPC WNHV CSD++R
Sbjct  13   LIFLVGFSSIFRYASSQA--SPDAEVMLSLKKSLNVPDSLGWSDPDPCNWNHVVCSDEKR  70

Query  315  VIRIQIGHNSLQGTLPPDLSKLTQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFTS  494
            V RIQIG  +LQGTLP +L  LTQL+RLELQ+NNISGPLPSLNGLSSL+V++LS+N FTS
Sbjct  71   VTRIQIGRQNLQGTLPSNLQNLTQLERLELQYNNISGPLPSLNGLSSLQVILLSDNKFTS  130

Query  495  IPSDFFVGMSSLQS  536
            +PSDFF G+SSLQS
Sbjct  131  VPSDFFAGLSSLQS  144



>gb|KFK41035.1| hypothetical protein AALP_AA2G077000 [Arabis alpina]
Length=939

 Score =   153 bits (387),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 83/119 (70%), Positives = 98/119 (82%), Gaps = 0/119 (0%)
 Frame = +3

Query  180  SQAGQNDDASVMFALKKSLNPPSDMGWSGQDPCKWNHVGCSDDRRVIRIQIGHNSLQGTL  359
            S+A  N DAS M +LKKSLNPP+  GWS  DPC+W HV C+  +RV RIQIGH+ LQGTL
Sbjct  23   SKADSNGDASAMLSLKKSLNPPASFGWSDPDPCEWTHVVCTGTKRVTRIQIGHSGLQGTL  82

Query  360  PPDLSKLTQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFTSIPSDFFVGMSSLQS  536
             PDL  L++L+RLELQWNNISGP+PSL+GL+SL+VLMLSNNHF SIPSD F G+SSLQS
Sbjct  83   SPDLRNLSELERLELQWNNISGPVPSLSGLNSLQVLMLSNNHFDSIPSDIFEGLSSLQS  141



>ref|XP_009378958.1| PREDICTED: probable receptor protein kinase TMK1 [Pyrus x bretschneideri]
Length=950

 Score =   153 bits (387),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 86/144 (60%), Positives = 112/144 (78%), Gaps = 3/144 (2%)
 Frame = +3

Query  105  RVHLGLKLPALVFLGIFASLFVNAVSQAGQNDDASVMFALKKSLNPPSDMGWSGQDPCKW  284
            + H   K   ++  G+ +S+ + A S +  ++DA+VM ALKK+L P   +GWS  DPC+W
Sbjct  4    KTHAAFKFLTILLAGL-SSVLLGANSHS--SNDAAVMLALKKTLKPSESLGWSDPDPCQW  60

Query  285  NHVGCSDDRRVIRIQIGHNSLQGTLPPDLSKLTQLQRLELQWNNIsgplpslnglsslRV  464
             HVGCSDD+RV RIQ+GH +++GTLPP L  LT+L+RLELQWN ISGPLPSL+GLSSL+V
Sbjct  61   THVGCSDDKRVTRIQLGHLNIEGTLPPSLQNLTELERLELQWNKISGPLPSLSGLSSLQV  120

Query  465  LMLSNNHFTSIPSDFFVGMSSLQS  536
            L++SNN FTSIPSDFF GM+SLQS
Sbjct  121  LLISNNLFTSIPSDFFTGMTSLQS  144



>ref|XP_011099938.1| PREDICTED: probable receptor protein kinase TMK1 [Sesamum indicum]
Length=945

 Score =   152 bits (384),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 97/148 (66%), Positives = 113/148 (76%), Gaps = 5/148 (3%)
 Frame = +3

Query  102  MRVHLGLKLPAL--VFLGIFA-SLFVNAVSQAGQNDDASVMFALKKSLNPPSDMGWSGQD  272
            M+   G+K  +L  +F G+   S+F+ A SQ    DDAS MFALKKSLNPP ++ WS  D
Sbjct  1    MKSCSGVKFQSLASIFHGLLLLSVFLCANSQTSP-DDASAMFALKKSLNPPDELSWSDPD  59

Query  273  PCKWNHVGCSDDRRVIRIQIGHNSLQGTLPPDLSKLTQLQRLELQWNNIsgplpslngls  452
            PCKW HV CS++R V RIQIGH +L GTLP +LS LTQL+RLE+QWNNISGPLPSL GLS
Sbjct  60   PCKWGHVLCSENR-VTRIQIGHQNLAGTLPKELSSLTQLERLEVQWNNISGPLPSLKGLS  118

Query  453  slRVLMLSNNHFTSIPSDFFVGMSSLQS  536
            SL+VLMLSNN FT IP DFF GMSSLQS
Sbjct  119  SLQVLMLSNNQFTLIPDDFFSGMSSLQS  146



>ref|XP_011038249.1| PREDICTED: probable receptor protein kinase TMK1 [Populus euphratica]
Length=945

 Score =   151 bits (382),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 95/144 (66%), Positives = 112/144 (78%), Gaps = 3/144 (2%)
 Frame = +3

Query  105  RVHLGLKLPALVFLGIFASLFVNAVSQAGQNDDASVMFALKKSLNPPSDMGWSGQDPCKW  284
            R H   KL  LVFL  F+S+F  A SQ   + DA VMF+LKKSLN P  +GWS  DPC W
Sbjct  4    RSHRRTKL-LLVFLVGFSSIFHFANSQT--SPDAEVMFSLKKSLNVPDSLGWSDPDPCNW  60

Query  285  NHVGCSDDRRVIRIQIGHNSLQGTLPPDLSKLTQLQRLELQWNNIsgplpslnglsslRV  464
            NHV CSD++RV RIQIG  +LQGTLP +L  LTQL+RLELQ+NNISGPLPSLNGLSSL+V
Sbjct  61   NHVVCSDEKRVTRIQIGRQNLQGTLPSNLQNLTQLERLELQYNNISGPLPSLNGLSSLQV  120

Query  465  LMLSNNHFTSIPSDFFVGMSSLQS  536
            ++LS+N F S+PSDFF G+SSLQS
Sbjct  121  ILLSDNKFISVPSDFFTGLSSLQS  144



>ref|XP_006350960.1| PREDICTED: probable receptor protein kinase TMK1-like [Solanum 
tuberosum]
Length=938

 Score =   151 bits (381),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 84/115 (73%), Positives = 98/115 (85%), Gaps = 1/115 (1%)
 Frame = +3

Query  192  QNDDASVMFALKKSLNPPSDMGWSGQDPCKWNHVGCSDDRRVIRIQIGHNSLQGTLPPDL  371
            Q+DD SVM ALKKSLNPP ++GWS  DPCKWNHVGCSD +RV RIQIG  ++QGTLPP++
Sbjct  27   QDDDVSVMLALKKSLNPPQEVGWSDSDPCKWNHVGCSD-KRVTRIQIGRQNIQGTLPPEI  85

Query  372  SKLTQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFTSIPSDFFVGMSSLQS  536
            SKLT+L+RLELQ NNISGPLPSL GLSSL+VL+L  N F+SIP+DFF  MSSL S
Sbjct  86   SKLTELERLELQGNNISGPLPSLKGLSSLQVLLLGENQFSSIPADFFTDMSSLLS  140



>ref|XP_010415157.1| PREDICTED: probable receptor protein kinase TMK1 [Camelina sativa]
Length=944

 Score =   150 bits (380),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 85/134 (63%), Positives = 104/134 (78%), Gaps = 1/134 (1%)
 Frame = +3

Query  135  LVFLGIFASLFVNAVSQAGQNDDASVMFALKKSLNPPSDMGWSGQDPCKWNHVGCSDDRR  314
            L+F   F  L +N+ S+A  + D S M +LKKSLNPP  +GWSG DPCKW HV C+  +R
Sbjct  8    LLFSISFLILLLNS-SKADSDGDISAMLSLKKSLNPPVSLGWSGPDPCKWTHVVCTSTKR  66

Query  315  VIRIQIGHNSLQGTLPPDLSKLTQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFTS  494
            V RIQIGH+ LQGTL PDL  L +L+RLELQWNNISG +PSL+GL+SL+VLMLSNN+F S
Sbjct  67   VTRIQIGHSGLQGTLSPDLRNLPELERLELQWNNISGSVPSLSGLASLQVLMLSNNNFES  126

Query  495  IPSDFFVGMSSLQS  536
            IPSD F G++SLQS
Sbjct  127  IPSDVFEGLTSLQS  140



>ref|XP_006372526.1| receptor protein kinase TMK1 precursor [Populus trichocarpa]
 gb|ERP50323.1| receptor protein kinase TMK1 precursor [Populus trichocarpa]
Length=945

 Score =   149 bits (377),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 94/144 (65%), Positives = 111/144 (77%), Gaps = 3/144 (2%)
 Frame = +3

Query  105  RVHLGLKLPALVFLGIFASLFVNAVSQAGQNDDASVMFALKKSLNPPSDMGWSGQDPCKW  284
            R H   KL  LVFL  F+S+F  A SQ   + DA VMF+LKKSLN P  +GWS  DPC W
Sbjct  4    RSHRRTKL-LLVFLVGFSSIFHFANSQT--SPDAEVMFSLKKSLNVPDSLGWSDPDPCNW  60

Query  285  NHVGCSDDRRVIRIQIGHNSLQGTLPPDLSKLTQLQRLELQWNNIsgplpslnglsslRV  464
            NHV CSD++RV RIQIG  +LQGTLP +L  L QL+RLELQ+NNISGPLPSLNGLSSL+V
Sbjct  61   NHVVCSDEKRVTRIQIGRQNLQGTLPSNLRNLAQLERLELQYNNISGPLPSLNGLSSLQV  120

Query  465  LMLSNNHFTSIPSDFFVGMSSLQS  536
            ++LS+N F S+PSDFF G+SSLQS
Sbjct  121  ILLSDNKFISVPSDFFTGLSSLQS  144



>gb|KDP25825.1| hypothetical protein JCGZ_22547 [Jatropha curcas]
Length=951

 Score =   149 bits (377),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 89/143 (62%), Positives = 106/143 (74%), Gaps = 1/143 (1%)
 Frame = +3

Query  105  RVHLGLKLPALVFLGIFASLFVNAVSQAGQNDDASVMFALKKSLNPPSDMGWSGQDPCKW  284
            R H    +  L FL  F+S+F    SQA  + DA+VMF+LKKSLN P  +GWS  DPC W
Sbjct  5    RSHFSFNIFLLFFLSGFSSMFHFVNSQANPSQDAAVMFSLKKSLNVPDSLGWSDPDPCNW  64

Query  285  NHVGCSDDRRVIRIQIGHNSLQGTLPPDLSKLTQLQRLELQWNNIsgplpslnglsslRV  464
            N V C++ +RV RIQIG   LQGTLP +L  LTQL RLE+QWNNISGP+PSL+GLSSL+V
Sbjct  65   NRVTCTE-KRVTRIQIGRQGLQGTLPSNLQNLTQLVRLEVQWNNISGPVPSLSGLSSLQV  123

Query  465  LMLSNNHFTSIPSDFFVGMSSLQ  533
            +MLS N FTSIPSDFF G+SSLQ
Sbjct  124  VMLSGNQFTSIPSDFFTGLSSLQ  146



>ref|XP_010551437.1| PREDICTED: probable receptor protein kinase TMK1 [Tarenaya hassleriana]
Length=944

 Score =   149 bits (376),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 83/119 (70%), Positives = 97/119 (82%), Gaps = 0/119 (0%)
 Frame = +3

Query  180  SQAGQNDDASVMFALKKSLNPPSDMGWSGQDPCKWNHVGCSDDRRVIRIQIGHNSLQGTL  359
            S +    DA+ MFAL+KSLNPP  +GWS  DPCKW+HVGC+D  RV RIQIGH +LQGTL
Sbjct  27   SSSNGGGDAAAMFALRKSLNPPPSLGWSDPDPCKWDHVGCTDGNRVTRIQIGHCNLQGTL  86

Query  360  PPDLSKLTQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFTSIPSDFFVGMSSLQS  536
            PPDL  L++L+RLELQ N ISGP+PSL+GLSSL+VLMLSNN F SIP DFF G+SSLQS
Sbjct  87   PPDLRNLSELERLELQLNKISGPVPSLSGLSSLQVLMLSNNLFDSIPRDFFSGLSSLQS  145



>pdb|4HQ1|A Chain A, Crystal Structure Of An Lrr Protein With Two Solenoids
Length=475

 Score =   144 bits (364),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 79/118 (67%), Positives = 96/118 (81%), Gaps = 0/118 (0%)
 Frame = +3

Query  183  QAGQNDDASVMFALKKSLNPPSDMGWSGQDPCKWNHVGCSDDRRVIRIQIGHNSLQGTLP  362
            +A  + D S M +LKKSLNPPS  GWS  DPCKW H+ C+  +RV RIQIGH+ LQGTL 
Sbjct  22   KADSDGDLSAMLSLKKSLNPPSSFGWSDPDPCKWTHIVCTGTKRVTRIQIGHSGLQGTLS  81

Query  363  PDLSKLTQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFTSIPSDFFVGMSSLQS  536
            PDL  L++L+RLELQWNNISGP+PSL+GL+SL+VLMLSNN+F SIPSD F G++SLQS
Sbjct  82   PDLRNLSELERLELQWNNISGPVPSLSGLASLQVLMLSNNNFDSIPSDVFQGLTSLQS  139



>ref|XP_010648936.1| PREDICTED: probable receptor protein kinase TMK1 [Vitis vinifera]
Length=948

 Score =   147 bits (372),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 87/133 (65%), Positives = 101/133 (76%), Gaps = 4/133 (3%)
 Frame = +3

Query  138  VFLGIFASLFVNAVSQAGQNDDASVMFALKKSLNPPSDMGWSGQDPCKWNHVGCSDDRRV  317
            +F+  F SL + A SQ    +DASVM ALK SL+    +GWSG DPC+W HV CS+D+RV
Sbjct  10   IFVAGFCSLLLCAESQ----EDASVMLALKDSLSNSESLGWSGPDPCEWKHVVCSEDKRV  65

Query  318  IRIQIGHNSLQGTLPPDLSKLTQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFTSI  497
             RIQ+G   LQGTLP  L  LT+L+RLELQWNNISGPLPSL GLSSL+VLMLSNN FT I
Sbjct  66   TRIQVGRQGLQGTLPSSLGNLTELERLELQWNNISGPLPSLKGLSSLQVLMLSNNQFTYI  125

Query  498  PSDFFVGMSSLQS  536
            P DFF G+SSLQS
Sbjct  126  PVDFFSGLSSLQS  138



>ref|XP_006300693.1| hypothetical protein CARUB_v10019739mg [Capsella rubella]
 gb|EOA33591.1| hypothetical protein CARUB_v10019739mg [Capsella rubella]
Length=940

 Score =   147 bits (372),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 78/119 (66%), Positives = 97/119 (82%), Gaps = 0/119 (0%)
 Frame = +3

Query  180  SQAGQNDDASVMFALKKSLNPPSDMGWSGQDPCKWNHVGCSDDRRVIRIQIGHNSLQGTL  359
            ++A  + D S M +LKKSLNPP  +GWS  DPCKW+HV C+  +RV RIQIGH+ LQGTL
Sbjct  22   TKADSDGDVSAMLSLKKSLNPPVSLGWSDPDPCKWSHVVCTGTKRVTRIQIGHSGLQGTL  81

Query  360  PPDLSKLTQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFTSIPSDFFVGMSSLQS  536
             PDL  L++L+RLELQWNNISG +PSL+GL+SL+VLMLSNN+F SIPSD F G++SLQS
Sbjct  82   SPDLRNLSELERLELQWNNISGSVPSLSGLASLQVLMLSNNNFESIPSDVFEGLTSLQS  140



>ref|XP_007214949.1| hypothetical protein PRUPE_ppa000942mg [Prunus persica]
 gb|EMJ16148.1| hypothetical protein PRUPE_ppa000942mg [Prunus persica]
Length=954

 Score =   147 bits (371),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 92/144 (64%), Positives = 110/144 (76%), Gaps = 1/144 (1%)
 Frame = +3

Query  105  RVHLGLKLPALVFLGIFASLFVNAVSQAGQNDDASVMFALKKSLNPPSDMGWSGQDPCKW  284
            + H G KL   +FL  F+S  + A SQ   ++DASVM  LKKSLNP   +GWS  DP KW
Sbjct  4    KTHFGFKL-LTIFLAGFSSFLLCANSQPSSSNDASVMLDLKKSLNPSESLGWSDPDPRKW  62

Query  285  NHVGCSDDRRVIRIQIGHNSLQGTLPPDLSKLTQLQRLELQWNNIsgplpslnglsslRV  464
            +HVG SDD+RV RIQ+GH +L+GTLPP L  LT+L+RLELQWN ISGPLPSLNGLS L+V
Sbjct  63   SHVGWSDDKRVTRIQLGHLNLEGTLPPSLQNLTKLERLELQWNKISGPLPSLNGLSLLQV  122

Query  465  LMLSNNHFTSIPSDFFVGMSSLQS  536
            L+LSNN F+SIPSDFF  M+SLQS
Sbjct  123  LLLSNNQFSSIPSDFFTDMTSLQS  146



>ref|XP_010470484.1| PREDICTED: probable receptor protein kinase TMK1 [Camelina sativa]
Length=940

 Score =   146 bits (369),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 78/118 (66%), Positives = 95/118 (81%), Gaps = 0/118 (0%)
 Frame = +3

Query  183  QAGQNDDASVMFALKKSLNPPSDMGWSGQDPCKWNHVGCSDDRRVIRIQIGHNSLQGTLP  362
            +A  + D S M +LKKSLNPP  +GWS  DPCKW HV C+  +RV RIQIGH+ LQGTL 
Sbjct  23   KADSDGDISAMLSLKKSLNPPVSLGWSDPDPCKWTHVVCTGSKRVTRIQIGHSGLQGTLS  82

Query  363  PDLSKLTQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFTSIPSDFFVGMSSLQS  536
            PDL  L++L+RLELQWNNISG +PSL+GL+SL+VLMLSNN+F SIPSD F G++SLQS
Sbjct  83   PDLRNLSELERLELQWNNISGSVPSLSGLASLQVLMLSNNNFESIPSDVFEGLTSLQS  140



>ref|XP_004249911.1| PREDICTED: probable receptor protein kinase TMK1 [Solanum lycopersicum]
Length=937

 Score =   146 bits (368),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 85/115 (74%), Positives = 101/115 (88%), Gaps = 1/115 (1%)
 Frame = +3

Query  192  QNDDASVMFALKKSLNPPSDMGWSGQDPCKWNHVGCSDDRRVIRIQIGHNSLQGTLPPDL  371
            Q+DD SVM ALKKSLNPP ++GWS  DPCKWNHVGCSD +RVIRIQIGH ++QGTLPP++
Sbjct  26   QDDDVSVMLALKKSLNPPKEVGWSDPDPCKWNHVGCSD-KRVIRIQIGHQNIQGTLPPEI  84

Query  372  SKLTQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFTSIPSDFFVGMSSLQS  536
            SKLT+L+RLELQ NNISGPLPSL+GLSSL+VL+L  N F+SIP++FF  MSSL S
Sbjct  85   SKLTELERLELQGNNISGPLPSLSGLSSLQVLLLGENQFSSIPANFFTDMSSLLS  139



>ref|NP_176789.1| transmembrane kinase 1 [Arabidopsis thaliana]
 sp|P43298.1|TMK1_ARATH RecName: Full=Probable receptor protein kinase TMK1; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAG51302.1|AC026480_9 receptor protein kinase (TMK1), putative [Arabidopsis thaliana]
 gb|AAA32876.1| protein kinase [Arabidopsis thaliana]
 gb|AEE34468.1| transmembrane kinase 1 [Arabidopsis thaliana]
Length=942

 Score =   146 bits (368),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 79/118 (67%), Positives = 96/118 (81%), Gaps = 0/118 (0%)
 Frame = +3

Query  183  QAGQNDDASVMFALKKSLNPPSDMGWSGQDPCKWNHVGCSDDRRVIRIQIGHNSLQGTLP  362
            +A  + D S M +LKKSLNPPS  GWS  DPCKW H+ C+  +RV RIQIGH+ LQGTL 
Sbjct  22   KADSDGDLSAMLSLKKSLNPPSSFGWSDPDPCKWTHIVCTGTKRVTRIQIGHSGLQGTLS  81

Query  363  PDLSKLTQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFTSIPSDFFVGMSSLQS  536
            PDL  L++L+RLELQWNNISGP+PSL+GL+SL+VLMLSNN+F SIPSD F G++SLQS
Sbjct  82   PDLRNLSELERLELQWNNISGPVPSLSGLASLQVLMLSNNNFDSIPSDVFQGLTSLQS  139



>gb|ACN59264.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
Length=942

 Score =   145 bits (367),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 79/118 (67%), Positives = 96/118 (81%), Gaps = 0/118 (0%)
 Frame = +3

Query  183  QAGQNDDASVMFALKKSLNPPSDMGWSGQDPCKWNHVGCSDDRRVIRIQIGHNSLQGTLP  362
            +A  + D S M +LKKSLNPPS  GWS  DPCKW H+ C+  +RV RIQIGH+ LQGTL 
Sbjct  22   KADSDGDLSAMLSLKKSLNPPSSFGWSDPDPCKWTHIVCTGTKRVTRIQIGHSGLQGTLS  81

Query  363  PDLSKLTQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFTSIPSDFFVGMSSLQS  536
            PDL  L++L+RLELQWNNISGP+PSL+GL+SL+VLMLSNN+F SIPSD F G++SLQS
Sbjct  82   PDLRNLSELERLELQWNNISGPVPSLSGLASLQVLMLSNNNFDSIPSDVFQGLTSLQS  139



>gb|AAP04161.1| putative receptor protein kinase (TMK1) [Arabidopsis thaliana]
 dbj|BAF00566.1| putative receptor protein kinase [Arabidopsis thaliana]
Length=942

 Score =   145 bits (367),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 79/118 (67%), Positives = 96/118 (81%), Gaps = 0/118 (0%)
 Frame = +3

Query  183  QAGQNDDASVMFALKKSLNPPSDMGWSGQDPCKWNHVGCSDDRRVIRIQIGHNSLQGTLP  362
            +A  + D S M +LKKSLNPPS  GWS  DPCKW H+ C+  +RV RIQIGH+ LQGTL 
Sbjct  22   KADSDGDLSAMLSLKKSLNPPSSFGWSDPDPCKWTHIVCTGTKRVTRIQIGHSGLQGTLS  81

Query  363  PDLSKLTQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFTSIPSDFFVGMSSLQS  536
            PDL  L++L+RLELQWNNISGP+PSL+GL+SL+VLMLSNN+F SIPSD F G++SLQS
Sbjct  82   PDLRNLSELERLELQWNNISGPVPSLSGLASLQVLMLSNNNFDSIPSDVFQGLTSLQS  139



>ref|XP_010511542.1| PREDICTED: probable receptor protein kinase TMK1 [Camelina sativa]
Length=943

 Score =   145 bits (367),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 77/118 (65%), Positives = 95/118 (81%), Gaps = 0/118 (0%)
 Frame = +3

Query  183  QAGQNDDASVMFALKKSLNPPSDMGWSGQDPCKWNHVGCSDDRRVIRIQIGHNSLQGTLP  362
            +A  + D S M +LKKSLNPP  +GWS  DPCKW H+ C+  +RV RIQIGH+ LQGTL 
Sbjct  23   KADSDGDISAMLSLKKSLNPPVSLGWSDPDPCKWTHIVCTGTKRVTRIQIGHSGLQGTLS  82

Query  363  PDLSKLTQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFTSIPSDFFVGMSSLQS  536
            PDL  L++L+RLELQWNNISG +PSL+GL+SL+VLMLSNN+F SIPSD F G++SLQS
Sbjct  83   PDLRNLSELERLELQWNNISGSVPSLSGLASLQVLMLSNNNFESIPSDVFQGLTSLQS  140



>ref|XP_008244390.1| PREDICTED: probable receptor protein kinase TMK1 [Prunus mume]
Length=947

 Score =   145 bits (367),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 90/144 (63%), Positives = 109/144 (76%), Gaps = 1/144 (1%)
 Frame = +3

Query  105  RVHLGLKLPALVFLGIFASLFVNAVSQAGQNDDASVMFALKKSLNPPSDMGWSGQDPCKW  284
            + H G K    +FL  F+S  + A SQ   ++DASVM  LKKSLNP   +GWS  DP KW
Sbjct  4    KTHFGFKF-LTIFLAGFSSFLLCANSQPSSSNDASVMLDLKKSLNPSESLGWSDPDPRKW  62

Query  285  NHVGCSDDRRVIRIQIGHNSLQGTLPPDLSKLTQLQRLELQWNNIsgplpslnglsslRV  464
            +HVG SDD+RV RIQ+GH +L+GTLPP L  LT+L+RLELQWN ISGPLPSL+GLS L+V
Sbjct  63   SHVGWSDDQRVTRIQLGHLNLEGTLPPSLQNLTKLERLELQWNKISGPLPSLSGLSLLQV  122

Query  465  LMLSNNHFTSIPSDFFVGMSSLQS  536
            L+LSNN F+SIPSDFF  M+SLQS
Sbjct  123  LLLSNNQFSSIPSDFFTDMTSLQS  146



>ref|XP_002887010.1| hypothetical protein ARALYDRAFT_475717 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63269.1| hypothetical protein ARALYDRAFT_475717 [Arabidopsis lyrata subsp. 
lyrata]
Length=937

 Score =   145 bits (365),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 78/118 (66%), Positives = 96/118 (81%), Gaps = 0/118 (0%)
 Frame = +3

Query  183  QAGQNDDASVMFALKKSLNPPSDMGWSGQDPCKWNHVGCSDDRRVIRIQIGHNSLQGTLP  362
            ++  + D S M +LKKSLNPPS  GWS  DPCKW H+ C+  +RV RIQIGH+ LQGTL 
Sbjct  17   KSDSDGDLSAMISLKKSLNPPSSFGWSDPDPCKWTHIVCTGTKRVTRIQIGHSGLQGTLS  76

Query  363  PDLSKLTQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFTSIPSDFFVGMSSLQS  536
            PDL  L++L+RLELQWNNISGP+PSL+GL+SL+VLMLSNN+F SIPSD F G++SLQS
Sbjct  77   PDLRNLSELERLELQWNNISGPVPSLSGLASLQVLMLSNNNFDSIPSDVFEGLTSLQS  134



>ref|XP_003552883.2| PREDICTED: probable receptor protein kinase TMK1-like [Glycine 
max]
Length=984

 Score =   140 bits (352),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 83/134 (62%), Positives = 101/134 (75%), Gaps = 3/134 (2%)
 Frame = +3

Query  144  LGIFASLFVNAVSQAGQNDDASVMFALKKSLNPPSDMGWSGQDPCKWNHVGCSDD-RRVI  320
            +  + S F++ +  A   DDAS M +L+ SLNPP  +GWS  DPCKW HV CS++ +R+I
Sbjct  43   IATYLSCFLSIILYAHSQDDASAMLSLRDSLNPPESLGWSDPDPCKWKHVACSEEVKRII  102

Query  321  RIQIGHNSLQGTLPPD--LSKLTQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFTS  494
            RIQIGH  LQGTLP    +  LTQL+RLELQ+NNISGPLPSLNGL SL+VL+LSNN F+S
Sbjct  103  RIQIGHLGLQGTLPNATVIQTLTQLERLELQFNNISGPLPSLNGLGSLQVLILSNNQFSS  162

Query  495  IPSDFFVGMSSLQS  536
            IP DFF GMS LQS
Sbjct  163  IPDDFFAGMSELQS  176



>ref|XP_004140293.1| PREDICTED: probable receptor protein kinase TMK1-like [Cucumis 
sativus]
 ref|XP_004155738.1| PREDICTED: probable receptor protein kinase TMK1-like [Cucumis 
sativus]
 gb|KGN51072.1| hypothetical protein Csa_5G429450 [Cucumis sativus]
Length=953

 Score =   139 bits (351),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 79/112 (71%), Positives = 90/112 (80%), Gaps = 0/112 (0%)
 Frame = +3

Query  201  DASVMFALKKSLNPPSDMGWSGQDPCKWNHVGCSDDRRVIRIQIGHNSLQGTLPPDLSKL  380
            DA  M ALKKSLNP   +GWS  +PCKWNHV CSDD RV RIQIG  +LQG LP +L  L
Sbjct  33   DAPAMTALKKSLNPTESLGWSDPNPCKWNHVLCSDDNRVTRIQIGRQNLQGMLPLNLQNL  92

Query  381  TQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFTSIPSDFFVGMSSLQS  536
            T L+RLELQWN ISGPLPSL+GL+SL+VL+LS N FTSIPSDFF GM+SLQ+
Sbjct  93   TALERLELQWNKISGPLPSLSGLTSLQVLLLSGNQFTSIPSDFFAGMTSLQA  144



>ref|XP_008463160.1| PREDICTED: probable receptor protein kinase TMK1 [Cucumis melo]
Length=950

 Score =   139 bits (350),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 86/144 (60%), Positives = 105/144 (73%), Gaps = 4/144 (3%)
 Frame = +3

Query  105  RVHLGLKLPALVFLGIFASLFVNAVSQAGQNDDASVMFALKKSLNPPSDMGWSGQDPCKW  284
            + H G K    + L IF S+F ++V     + DA  M ALKKSLNP   +GWS  +PCKW
Sbjct  5    KSHFGNK--HFLILAIF-SIF-HSVEPQELSPDAPAMAALKKSLNPTESLGWSDPNPCKW  60

Query  285  NHVGCSDDRRVIRIQIGHNSLQGTLPPDLSKLTQLQRLELQWNNIsgplpslnglsslRV  464
            NHV CSDD RV RIQIG  +LQG LP ++  LT L+RLELQWN ISGPLPSL+GL+SL+V
Sbjct  61   NHVLCSDDNRVTRIQIGRQNLQGMLPSNIQNLTALERLELQWNKISGPLPSLSGLASLQV  120

Query  465  LMLSNNHFTSIPSDFFVGMSSLQS  536
            L+LS N FTSIP+DFF GM+SLQ+
Sbjct  121  LLLSGNQFTSIPADFFAGMTSLQA  144



>ref|NP_001238698.1| NAK-type protein kinase precursor [Glycine max]
 gb|ACM89508.1| NAK-type protein kinase [Glycine max]
Length=941

 Score =   137 bits (344),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 83/137 (61%), Positives = 97/137 (71%), Gaps = 3/137 (2%)
 Frame = +3

Query  126  LPALVFLGIFASLFVNAVSQAGQNDDASVMFALKKSLNPPSDMGWSGQDPCKWNHVGCSD  305
            + AL  L I     +    +    DDASVM ALK SLNPP   GWS  DPCKW  V CSD
Sbjct  1    MKALALLAIIVFTLLVRSQEEEDYDDASVMLALKNSLNPP---GWSDPDPCKWARVLCSD  57

Query  306  DRRVIRIQIGHNSLQGTLPPDLSKLTQLQRLELQWNNIsgplpslnglsslRVLMLSNNH  485
            D+RV RIQIG  +LQGTLP  L KLT L+ LELQ+NNISGPLPSLNGL+SLRV + SNN 
Sbjct  58   DKRVTRIQIGRLNLQGTLPTTLQKLTHLEHLELQYNNISGPLPSLNGLTSLRVFLASNNR  117

Query  486  FTSIPSDFFVGMSSLQS  536
            F+++P+DFF GMS LQ+
Sbjct  118  FSAVPADFFAGMSQLQA  134



>gb|KHN24152.1| Putative receptor protein kinase TMK1 [Glycine soja]
Length=861

 Score =   134 bits (337),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 78/134 (58%), Positives = 97/134 (72%), Gaps = 3/134 (2%)
 Frame = +3

Query  144  LGIFASLFVNAVSQAGQNDDASVMFALKKSLNPPSDMGWSGQDPCKWNHVGCSDD-RRVI  320
            +  + S F++ +  A   DD S M AL+ +LNPP  +GWS  DPCKW HV  S++ +RV 
Sbjct  8    IATYPSCFLSVILYAHSQDDTSAMLALRDTLNPPESLGWSDPDPCKWKHVVRSEEVKRVA  67

Query  321  RIQIGHNSLQGTLPPD--LSKLTQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFTS  494
            RIQIGH  LQGTLP    +  LTQL+RLELQ+NNI G L SLNGLSSL+VL+LSNN F S
Sbjct  68   RIQIGHQGLQGTLPNPTVIQTLTQLERLELQFNNILGHLLSLNGLSSLQVLILSNNQFYS  127

Query  495  IPSDFFVGMSSLQS  536
            IP+DFF+G+S LQS
Sbjct  128  IPNDFFIGLSELQS  141



>ref|XP_010032738.1| PREDICTED: probable receptor protein kinase TMK1 [Eucalyptus 
grandis]
Length=946

 Score =   134 bits (336),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 76/108 (70%), Positives = 87/108 (81%), Gaps = 0/108 (0%)
 Frame = +3

Query  213  MFALKKSLNPPSDMGWSGQDPCKWNHVGCSDDRRVIRIQIGHNSLQGTLPPDLSKLTQLQ  392
            M AL+KSL  P  +GWS  DPCKW HV CS   RV RIQIGH  L+GTLPPDL+ LTQL+
Sbjct  37   MLALRKSLAAPESLGWSDPDPCKWAHVVCSQSNRVTRIQIGHQGLEGTLPPDLNALTQLE  96

Query  393  RLELQWNNIsgplpslnglsslRVLMLSNNHFTSIPSDFFVGMSSLQS  536
            RLELQ+N ISGPLPSL+GLSSL+VLML NN F S+P+DFF G+SSLQS
Sbjct  97   RLELQFNGISGPLPSLSGLSSLQVLMLGNNQFDSVPADFFDGLSSLQS  144



>gb|EYU30867.1| hypothetical protein MIMGU_mgv1a001044mg [Erythranthe guttata]
Length=905

 Score =   131 bits (330),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 77/109 (71%), Positives = 90/109 (83%), Gaps = 2/109 (2%)
 Frame = +3

Query  213  MFALKKSLNPPSD-MGWSGQDPCKWNHVGCSDDRRVIRIQIGHNSLQGTLPPDLSKLTQL  389
            MFALKK+LNPP D + WS  DPCKW  V CS++R V +IQIGH +LQGTLP +LS LTQL
Sbjct  1    MFALKKNLNPPPDALSWSDPDPCKWARVHCSENR-VTQIQIGHQNLQGTLPNELSLLTQL  59

Query  390  QRLELQWNNIsgplpslnglsslRVLMLSNNHFTSIPSDFFVGMSSLQS  536
            +RLELQWNNISGPLP+L G +SL+ L+LSNN FT IP DFF+GMSSLQS
Sbjct  60   ERLELQWNNISGPLPNLKGFTSLQYLILSNNRFTFIPDDFFIGMSSLQS  108



>ref|XP_010271200.1| PREDICTED: probable receptor protein kinase TMK1 [Nelumbo nucifera]
Length=950

 Score =   131 bits (329),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 79/130 (61%), Positives = 97/130 (75%), Gaps = 1/130 (1%)
 Frame = +3

Query  144  LGIFASLFVNAVSQAGQNDDASVMFALKKSLNPPSDMGWSGQDPCKWNHVGCSDDRRVIR  323
            L +F S+F +  SQ    D ASVM  LKKSLN P  +GWS  DPC W+HV C+D+++V R
Sbjct  15   LAVFLSVFFSVQSQTNPGD-ASVMQELKKSLNVPVGLGWSDPDPCNWDHVQCNDNKQVTR  73

Query  324  IQIGHNSLQGTLPPDLSKLTQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFTSIPS  503
            IQIG   LQGTLPP+L  LT L+RLELQ N ISGPLPSL+GLSSL+V++L NN F+ IP+
Sbjct  74   IQIGGQDLQGTLPPNLGNLTALERLELQKNQISGPLPSLSGLSSLQVVLLGNNQFSKIPA  133

Query  504  DFFVGMSSLQ  533
            DFF  +SSLQ
Sbjct  134  DFFAKLSSLQ  143



>ref|XP_002314766.1| hypothetical protein POPTR_0010s11360g [Populus trichocarpa]
 gb|EEF00937.1| hypothetical protein POPTR_0010s11360g [Populus trichocarpa]
Length=930

 Score =   125 bits (314),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 72/115 (63%), Positives = 85/115 (74%), Gaps = 1/115 (1%)
 Frame = +3

Query  192  QNDDASVMFALKKSLNPPSDMGWSGQDPCKWNHVGCSDDRRVIRIQIGHNSLQGTLPPDL  371
            QNDDA+ M  L+ SL  PS +GWSG DPC W HVGC D+R V RIQIG+ +LQGTLPP+L
Sbjct  24   QNDDAAAMMKLRGSLGNPSTLGWSGSDPCNWLHVGCLDNR-VTRIQIGNQNLQGTLPPEL  82

Query  372  SKLTQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFTSIPSDFFVGMSSLQS  536
              LTQL R E+  N + G LPSL+GLS L+VL L NN F+SIP DFF GM+SL S
Sbjct  83   KDLTQLTRFEVMNNQLMGALPSLSGLSFLQVLFLHNNTFSSIPPDFFAGMTSLTS  137



>gb|KHN39482.1| Putative receptor protein kinase TMK1 [Glycine soja]
Length=912

 Score =   125 bits (313),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 74/108 (69%), Positives = 85/108 (79%), Gaps = 3/108 (3%)
 Frame = +3

Query  213  MFALKKSLNPPSDMGWSGQDPCKWNHVGCSDDRRVIRIQIGHNSLQGTLPPDLSKLTQLQ  392
            M ALK SLNPP   GWS  DPCKW  V CSDD+RV RIQIG  +LQGTLP  L KLT L+
Sbjct  1    MLALKNSLNPP---GWSDPDPCKWARVLCSDDKRVTRIQIGRLNLQGTLPTTLQKLTHLE  57

Query  393  RLELQWNNIsgplpslnglsslRVLMLSNNHFTSIPSDFFVGMSSLQS  536
             LELQ+NNISGPLPSLNGL+SLRV + SNN F+++P+DFF GMS LQ+
Sbjct  58   HLELQYNNISGPLPSLNGLTSLRVFVASNNRFSAVPADFFAGMSQLQA  105



>ref|XP_006346490.1| PREDICTED: probable receptor protein kinase TMK1-like [Solanum 
tuberosum]
Length=942

 Score =   124 bits (312),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 68/143 (48%), Positives = 98/143 (69%), Gaps = 2/143 (1%)
 Frame = +3

Query  114  LGLKLPALVFLG--IFASLFVNAVSQAGQNDDASVMFALKKSLNPPSDMGWSGQDPCKWN  287
            + LK P L F+   I  S  V+  SQ     DA+VM  LKK ++PPS + W   DPCKW 
Sbjct  1    MKLKKPHLGFVCFLILLSFVVSVYSQGSAATDAAVMQELKKGISPPSSLNWDDPDPCKWG  60

Query  288  HVGCSDDRRVIRIQIGHNSLQGTLPPDLSKLTQLQRLELQWNNIsgplpslnglsslRVL  467
             V C+ D RV RIQ+G+  L+G+LPP+++ LT+LQ  E+Q N ++G +P+  G++SL+ +
Sbjct  61   KVTCTKDGRVTRIQVGNQGLKGSLPPNMNNLTELQVFEVQHNALTGAIPTFAGMNSLQSI  120

Query  468  MLSNNHFTSIPSDFFVGMSSLQS  536
            +L+NN FTSIPSDFF GM++LQ+
Sbjct  121  LLNNNGFTSIPSDFFEGMTNLQN  143



>ref|XP_004490803.1| PREDICTED: probable receptor protein kinase TMK1-like [Cicer 
arietinum]
Length=976

 Score =   123 bits (308),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 70/116 (60%), Positives = 81/116 (70%), Gaps = 0/116 (0%)
 Frame = +3

Query  189  GQNDDASVMFALKKSLNPPSDMGWSGQDPCKWNHVGCSDDRRVIRIQIGHNSLQGTLPPD  368
             QNDDAS+M  LK +LNPP  +GWS  DPCKWNHV CSDD RV RIQIG  +L G  P  
Sbjct  56   AQNDDASLMQTLKTNLNPPLSLGWSDPDPCKWNHVTCSDDNRVTRIQIGRQNLHGAFPQT  115

Query  369  LSKLTQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFTSIPSDFFVGMSSLQS  536
            L  LT+LQ LELQ+NN +GPLPSL  L+SL+V + SNN FTS   +FF G   L S
Sbjct  116  LLNLTELQHLELQFNNFTGPLPSLTSLNSLQVFIASNNGFTSFSGEFFAGKEQLVS  171



>emb|CBI26796.3| unnamed protein product [Vitis vinifera]
Length=828

 Score =   120 bits (302),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 76/133 (57%), Positives = 99/133 (74%), Gaps = 1/133 (1%)
 Frame = +3

Query  138  VFLGIFASLFVNAVSQAGQNDDASVMFALKKSLNPPSDMGWSGQDPCKWNHVGCSDDRRV  317
            V L    +L +N  SQ+  + DA VM  LKK+LN PSD+GWS  DPCKW+ V C  DRRV
Sbjct  7    VVLVCLLALTLNVQSQS-SSGDADVMQVLKKNLNQPSDLGWSDSDPCKWDGVSCDGDRRV  65

Query  318  IRIQIGHNSLQGTLPPDLSKLTQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFTSI  497
             RIQIG  +L+G+LP +L+ LT L+ LE+Q+N +SGPLPSL+ LS L+ L+LSNN+FTS+
Sbjct  66   TRIQIGGKNLKGSLPSNLTDLTALEILEVQYNQLSGPLPSLSRLSLLQRLLLSNNNFTSV  125

Query  498  PSDFFVGMSSLQS  536
            PS FF GM+SLQ+
Sbjct  126  PSGFFDGMTSLQT  138



>ref|XP_007141936.1| hypothetical protein PHAVU_008G238600g [Phaseolus vulgaris]
 gb|ESW13930.1| hypothetical protein PHAVU_008G238600g [Phaseolus vulgaris]
Length=947

 Score =   120 bits (302),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 84/137 (61%), Positives = 102/137 (74%), Gaps = 10/137 (7%)
 Frame = +3

Query  126  LPALVFLGIFASLFVNAVSQAGQNDDASVMFALKKSLNPPSDMGWSGQDPCKWNHVGCSD  305
            LP ++FL I   LF NA       DD SVM ALK SLNPP   GW+G DPC W+HV CS+
Sbjct  16   LPFVIFLTIIV-LFANA------QDDVSVMLALKNSLNPP---GWTGPDPCMWDHVRCSE  65

Query  306  DRRVIRIQIGHNSLQGTLPPDLSKLTQLQRLELQWNNIsgplpslnglsslRVLMLSNNH  485
            D+RV RIQIG  +LQGTLP  L  LTQLQ+LELQ+NNISGP+PSLNGL++LRV + SNN 
Sbjct  66   DKRVTRIQIGRLNLQGTLPATLHNLTQLQQLELQYNNISGPIPSLNGLTNLRVFIASNNR  125

Query  486  FTSIPSDFFVGMSSLQS  536
            F+++P+DFF GM  LQ+
Sbjct  126  FSAVPADFFAGMPQLQA  142



>ref|XP_002281552.2| PREDICTED: probable receptor protein kinase TMK1 [Vitis vinifera]
Length=937

 Score =   120 bits (302),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 76/133 (57%), Positives = 99/133 (74%), Gaps = 1/133 (1%)
 Frame = +3

Query  138  VFLGIFASLFVNAVSQAGQNDDASVMFALKKSLNPPSDMGWSGQDPCKWNHVGCSDDRRV  317
            V L    +L +N  SQ+  + DA VM  LKK+LN PSD+GWS  DPCKW+ V C  DRRV
Sbjct  7    VVLVCLLALTLNVQSQS-SSGDADVMQVLKKNLNQPSDLGWSDSDPCKWDGVSCDGDRRV  65

Query  318  IRIQIGHNSLQGTLPPDLSKLTQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFTSI  497
             RIQIG  +L+G+LP +L+ LT L+ LE+Q+N +SGPLPSL+ LS L+ L+LSNN+FTS+
Sbjct  66   TRIQIGGKNLKGSLPSNLTDLTALEILEVQYNQLSGPLPSLSRLSLLQRLLLSNNNFTSV  125

Query  498  PSDFFVGMSSLQS  536
            PS FF GM+SLQ+
Sbjct  126  PSGFFDGMTSLQT  138



>ref|XP_011021737.1| PREDICTED: probable receptor protein kinase TMK1 [Populus euphratica]
Length=930

 Score =   120 bits (301),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 70/115 (61%), Positives = 85/115 (74%), Gaps = 1/115 (1%)
 Frame = +3

Query  192  QNDDASVMFALKKSLNPPSDMGWSGQDPCKWNHVGCSDDRRVIRIQIGHNSLQGTLPPDL  371
            QNDDA+ M  L+ SL  PS +GWSG DPC W HV C  +R V RIQIG+ +LQGTLPP+L
Sbjct  24   QNDDAAAMMKLRDSLGNPSTLGWSGSDPCNWPHVACLTNR-VTRIQIGNQNLQGTLPPEL  82

Query  372  SKLTQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFTSIPSDFFVGMSSLQS  536
              LTQL R E+  N ++G LPSL+GLSSL+VL L+NN  +SIP DFF GM+SL S
Sbjct  83   KDLTQLTRFEVMNNQLTGALPSLSGLSSLQVLFLNNNTLSSIPPDFFAGMTSLTS  137



>ref|XP_009619244.1| PREDICTED: probable receptor protein kinase TMK1 [Nicotiana tomentosiformis]
Length=944

 Score =   120 bits (301),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 88/118 (75%), Gaps = 0/118 (0%)
 Frame = +3

Query  183  QAGQNDDASVMFALKKSLNPPSDMGWSGQDPCKWNHVGCSDDRRVIRIQIGHNSLQGTLP  362
            +    +DA+VM  LKK +NPPS +GW+  DPCKW  V C+ D RV RIQIG+  L+G+LP
Sbjct  29   EGSATNDAAVMQELKKRINPPSSLGWNDPDPCKWEKVQCTKDGRVTRIQIGNQGLKGSLP  88

Query  363  PDLSKLTQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFTSIPSDFFVGMSSLQS  536
            P+L+ LT+L   E+Q N ++G LPS +GL SL+ L+L+NN FTSIP+DFF G++SLQS
Sbjct  89   PNLNNLTELLVFEVQNNGLTGSLPSFSGLDSLQSLLLNNNGFTSIPTDFFDGLTSLQS  146



>ref|XP_002312477.1| hypothetical protein POPTR_0008s13710g [Populus trichocarpa]
 gb|EEE89844.1| hypothetical protein POPTR_0008s13710g [Populus trichocarpa]
Length=931

 Score =   120 bits (300),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 76/135 (56%), Positives = 101/135 (75%), Gaps = 3/135 (2%)
 Frame = +3

Query  138  VFLGIFASLFVN--AVSQAGQNDDASVMFALKKSLNPPSDMGWSGQDPCKWNHVGCSDDR  311
            V+L I  SL ++   ++ + QNDDA+VM  L+ SL   S +GWS  DPC+W HVGC+++R
Sbjct  3    VWLFIHTSLLLSLLCIAHSQQNDDAAVMLKLRDSLVKSSTLGWSASDPCQWAHVGCTNNR  62

Query  312  RVIRIQIGHNSLQGTLPPDLSKLTQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFT  491
             V RIQIG+ +LQGTLPP+L  LTQL R E+  NN++G LPSL+GLSSL+VL+L  N+F+
Sbjct  63   -VDRIQIGYQNLQGTLPPELRNLTQLTRFEVMSNNLTGSLPSLSGLSSLQVLLLHTNNFS  121

Query  492  SIPSDFFVGMSSLQS  536
            SIP DFF GM+SL S
Sbjct  122  SIPPDFFTGMTSLTS  136



>gb|AAF66615.1| LRR receptor-like protein kinase [Nicotiana tabacum]
Length=945

 Score =   120 bits (300),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 65/113 (58%), Positives = 87/113 (77%), Gaps = 0/113 (0%)
 Frame = +3

Query  198  DDASVMFALKKSLNPPSDMGWSGQDPCKWNHVGCSDDRRVIRIQIGHNSLQGTLPPDLSK  377
            +DA+VM  LKK +NPPS +GW+  DPCKW  V C+ D RV RIQIG+  L+G+LPP+L+ 
Sbjct  34   NDAAVMQELKKRINPPSSLGWNDPDPCKWGKVQCTKDGRVTRIQIGNQGLKGSLPPNLNN  93

Query  378  LTQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFTSIPSDFFVGMSSLQS  536
            LT+L   E+Q N ++G LPS +GL SL+ L+L+NN FTSIP+DFF G++SLQS
Sbjct  94   LTELLVFEVQNNGLTGSLPSFSGLDSLQSLLLNNNGFTSIPTDFFDGLTSLQS  146



>ref|XP_009757873.1| PREDICTED: probable receptor protein kinase TMK1 [Nicotiana sylvestris]
Length=944

 Score =   119 bits (299),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 65/113 (58%), Positives = 87/113 (77%), Gaps = 0/113 (0%)
 Frame = +3

Query  198  DDASVMFALKKSLNPPSDMGWSGQDPCKWNHVGCSDDRRVIRIQIGHNSLQGTLPPDLSK  377
            +DA+VM  LKK +NPPS +GW+  DPCKW  V C+ D RV RIQIG+  L+G+LPP+L+ 
Sbjct  34   NDAAVMQELKKRINPPSSLGWNDPDPCKWGKVQCTKDGRVTRIQIGNQGLKGSLPPNLNN  93

Query  378  LTQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFTSIPSDFFVGMSSLQS  536
            LT+L   E+Q N ++G LPS +GL SL+ L+L+NN FTSIP+DFF G++SLQS
Sbjct  94   LTELLVFEVQNNGLTGSLPSFSGLDSLQSLLLNNNGFTSIPTDFFDGLTSLQS  146



>ref|XP_004230827.1| PREDICTED: probable receptor protein kinase TMK1 isoform X1 [Solanum 
lycopersicum]
Length=940

 Score =   119 bits (297),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 68/141 (48%), Positives = 95/141 (67%), Gaps = 2/141 (1%)
 Frame = +3

Query  120  LKLPALVFLG--IFASLFVNAVSQAGQNDDASVMFALKKSLNPPSDMGWSGQDPCKWNHV  293
            LK P L F+   I  S  V+  SQ     DA+VM  LKK ++PPS + W   +PCKW  V
Sbjct  3    LKKPHLGFVCFLILLSFVVSVYSQGSAATDAAVMQELKKGISPPSSLKWDDPNPCKWGKV  62

Query  294  GCSDDRRVIRIQIGHNSLQGTLPPDLSKLTQLQRLELQWNNIsgplpslnglsslRVLML  473
             C+ D RV RIQ+G+  L+G+LPP ++ LT+LQ  E+Q N ++GP+PS  G++SL+ ++L
Sbjct  63   QCTKDGRVTRIQVGNQGLKGSLPPSMNNLTELQVFEVQNNALTGPIPSFAGMNSLQTILL  122

Query  474  SNNHFTSIPSDFFVGMSSLQS  536
             NN FTSIP DFF GM++LQ+
Sbjct  123  DNNGFTSIPVDFFEGMTNLQT  143



>ref|XP_002527538.1| receptor protein kinase, putative [Ricinus communis]
 gb|EEF34847.1| receptor protein kinase, putative [Ricinus communis]
Length=935

 Score =   117 bits (292),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 76/146 (52%), Positives = 101/146 (69%), Gaps = 10/146 (7%)
 Frame = +3

Query  105  RVHLGLKLPALVFLGIFASLFVNAVSQAGQNDDASVMFALKKSLNPPSDMGWSGQDPC--  278
            + H G+ L    F+G  +      ++ + QN DASVM  LK+SL  PS   WSG DPC  
Sbjct  3    KRHPGVSLIPFFFMGFLS------LANSQQNGDASVMLKLKESLGNPS--FWSGSDPCND  54

Query  279  KWNHVGCSDDRRVIRIQIGHNSLQGTLPPDLSKLTQLQRLELQWNNIsgplpslnglssl  458
            KW+HV C    RV  IQIG  +L GTLPP+LSKLT L+RLE+ +NN+SGP+PSL+GLSSL
Sbjct  55   KWDHVTCDSSNRVTDIQIGRQNLVGTLPPELSKLTALKRLEVMFNNLSGPVPSLSGLSSL  114

Query  459  RVLMLSNNHFTSIPSDFFVGMSSLQS  536
            +V++L NN F+S PSDFF G++S+ +
Sbjct  115  QVVLLHNNEFSSFPSDFFNGLNSITT  140



>emb|CDP05529.1| unnamed protein product [Coffea canephora]
Length=1066

 Score =   116 bits (290),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 84/165 (51%), Positives = 104/165 (63%), Gaps = 12/165 (7%)
 Frame = +3

Query  54   SIKTLLFLSKSNLFTEM-RVHLGLKLP---ALVFLGIFASLFVNAVSQAGQNDDASVMFA  221
            S K  LFL K     +M   HLG  L     ++FLG   S+         Q+ DASVM  
Sbjct  106  SEKLKLFLQKEEFQWKMGEAHLGFPLMLSFVIIFLGFSPSIH-------SQSSDASVMQD  158

Query  222  LKKSLNPPSDMGWSGQDPCKWNHVGCS-DDRRVIRIQIGHNSLQGTLPPDLSKLTQLQRL  398
            LKK+LNPPS +GW   DPC+W +V CS +D RV RIQIG+  L G+LP  LSKL  LQ L
Sbjct  159  LKKALNPPSSLGWDDPDPCQWKNVDCSKNDNRVNRIQIGNQGLTGSLPDSLSKLNALQFL  218

Query  399  ELQWNNIsgplpslnglsslRVLMLSNNHFTSIPSDFFVGMSSLQ  533
            ELQ N+++GPLPSLNG  SL+  +L  N+F+ IP DFF GM+SLQ
Sbjct  219  ELQNNHLTGPLPSLNGFGSLQRALLGYNNFSYIPPDFFAGMNSLQ  263



>ref|XP_009368765.1| PREDICTED: probable receptor protein kinase TMK1 [Pyrus x bretschneideri]
Length=610

 Score =   111 bits (278),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 68/147 (46%), Positives = 96/147 (65%), Gaps = 9/147 (6%)
 Frame = +3

Query  120  LKLPALVFLGIFASLFV--------NAVSQAGQNDDASVMFALKKSLNPPSDMGWSGQDP  275
            +K P L F G F  + +        +A SQ+   DD + M AL KS+ P S +GWSG D 
Sbjct  1    MKDPHLGFWGCFPGVLLLFFSLYSPSAHSQSAGGDDGAAMEALSKSIGPNS-LGWSGTDY  59

Query  276  CKWNHVGCSDDRRVIRIQIGHNSLQGTLPPDLSKLTQLQRLELQWNNIsgplpslnglss  455
            C W  V C+ D +V +IQ+G+  L GTLPP++ KL+ LQ+LE+Q N ++GP PSL+GL  
Sbjct  60   CNWGQVSCTKDGKVFKIQLGNQKLTGTLPPEIQKLSNLQQLEVQNNQLTGPFPSLSGLQP  119

Query  456  lRVLMLSNNHFTSIPSDFFVGMSSLQS  536
            L+VL+  +N+F+S PSDFF G++SL S
Sbjct  120  LQVLLAHDNNFSSFPSDFFTGLTSLDS  146



>ref|XP_011070546.1| PREDICTED: probable receptor protein kinase TMK1 isoform X2 [Sesamum 
indicum]
Length=775

 Score =   112 bits (279),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 71/135 (53%), Positives = 94/135 (70%), Gaps = 3/135 (2%)
 Frame = +3

Query  132  ALVFLGIFASLFVNAVSQAGQNDDASVMFALKKSLNPPSDMGWSGQDPCKWNHVGCSDDR  311
             L FL + + L     SQ+G   DA+VM  LKKSLN P  +GW   +PC W +V CS D 
Sbjct  4    GLFFLALCSLLATVGRSQSG---DAAVMQELKKSLNAPIQLGWGDANPCNWKYVQCSRDG  60

Query  312  RVIRIQIGHNSLQGTLPPDLSKLTQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFT  491
            RV RIQI + +LQG+LP  L+KL+ LQ  E+Q N++ GP+PS +GLSSL+ ++LS N+FT
Sbjct  61   RVTRIQIKNQNLQGSLPSTLNKLSSLQVFEVQDNHLGGPVPSFSGLSSLQSVILSRNNFT  120

Query  492  SIPSDFFVGMSSLQS  536
            SIP DFF G++SLQS
Sbjct  121  SIPPDFFDGLTSLQS  135



>ref|XP_011070545.1| PREDICTED: probable receptor protein kinase TMK1 isoform X1 [Sesamum 
indicum]
Length=930

 Score =   112 bits (279),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 71/135 (53%), Positives = 94/135 (70%), Gaps = 3/135 (2%)
 Frame = +3

Query  132  ALVFLGIFASLFVNAVSQAGQNDDASVMFALKKSLNPPSDMGWSGQDPCKWNHVGCSDDR  311
             L FL + + L     SQ+G   DA+VM  LKKSLN P  +GW   +PC W +V CS D 
Sbjct  4    GLFFLALCSLLATVGRSQSG---DAAVMQELKKSLNAPIQLGWGDANPCNWKYVQCSRDG  60

Query  312  RVIRIQIGHNSLQGTLPPDLSKLTQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFT  491
            RV RIQI + +LQG+LP  L+KL+ LQ  E+Q N++ GP+PS +GLSSL+ ++LS N+FT
Sbjct  61   RVTRIQIKNQNLQGSLPSTLNKLSSLQVFEVQDNHLGGPVPSFSGLSSLQSVILSRNNFT  120

Query  492  SIPSDFFVGMSSLQS  536
            SIP DFF G++SLQS
Sbjct  121  SIPPDFFDGLTSLQS  135



>ref|XP_010043988.1| PREDICTED: probable receptor protein kinase TMK1 [Eucalyptus 
grandis]
 gb|KCW85995.1| hypothetical protein EUGRSUZ_B02699 [Eucalyptus grandis]
Length=939

 Score =   108 bits (270),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 64/112 (57%), Positives = 81/112 (72%), Gaps = 1/112 (1%)
 Frame = +3

Query  201  DASVMFALKKSLNPPSDMGWSGQDPCKWNHVGCSDDRRVIRIQIGHNSLQGTLPPDLSKL  380
            D + M ALKKS+  PS + WS  DPCKW  V C+ + RV RIQIG   + GTLPPD+S L
Sbjct  36   DVNAMQALKKSVTLPSSLDWSDADPCKWPQVSCTGN-RVTRIQIGMRGVSGTLPPDISNL  94

Query  381  TQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFTSIPSDFFVGMSSLQS  536
            T+L R E+  +  SGPLPS  GL+ L+VL+L+ N+FTSIP+DFF GMSSLQ+
Sbjct  95   TELTRFEVMNSQFSGPLPSFAGLAQLQVLLLNRNNFTSIPADFFTGMSSLQA  146



>ref|XP_010315276.1| PREDICTED: probable receptor protein kinase TMK1 isoform X2 [Solanum 
lycopersicum]
Length=913

 Score =   108 bits (269),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 65/128 (51%), Positives = 89/128 (70%), Gaps = 3/128 (2%)
 Frame = +3

Query  162  LFVNAVS---QAGQNDDASVMFALKKSLNPPSDMGWSGQDPCKWNHVGCSDDRRVIRIQI  332
            LF N VS   Q     DA+VM   KK +  P+ + W+  DPCKW+ V CS D RVIRIQ+
Sbjct  12   LFSNVVSVYSQGSAATDAAVMQEFKKQIINPNPLNWNDPDPCKWDKVQCSKDGRVIRIQV  71

Query  333  GHNSLQGTLPPDLSKLTQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFTSIPSDFF  512
            G   L+GTLP +++ LT+LQ  E+Q N  +GPLPS +GL+SL+ ++L+ N FTSIP++FF
Sbjct  72   GDQGLKGTLPSNINTLTELQVFEVQRNTFTGPLPSFSGLNSLQTILLNGNGFTSIPNEFF  131

Query  513  VGMSSLQS  536
             GM++LQS
Sbjct  132  QGMTNLQS  139



>ref|XP_003616214.1| Kinase-like protein [Medicago truncatula]
 gb|AES99172.1| LRR receptor-like kinase [Medicago truncatula]
Length=945

 Score =   107 bits (268),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 80/145 (55%), Positives = 96/145 (66%), Gaps = 3/145 (2%)
 Frame = +3

Query  102  MRVHLGLKLPALVFLGIFASLFVNAVSQAGQNDDASVMFALKKSLNPPSDMGWSGQDPCK  281
            M ++  + +  L F  +F S+     SQ    +DAS+M  LK +L PP  +GWS  DPCK
Sbjct  1    MNMNKNIIVHPLTFFTLFFSIITFTHSQT---NDASIMQTLKNNLKPPLSLGWSDPDPCK  57

Query  282  WNHVGCSDDRRVIRIQIGHNSLQGTLPPDLSKLTQLQRLELQWNNIsgplpslnglsslR  461
            W HV CSDD RV RIQIG  +L GTLP  L  LT LQ LELQ+NN +GPLPSLNGL+SL+
Sbjct  58   WTHVSCSDDNRVTRIQIGRQNLHGTLPQTLQNLTNLQHLELQFNNFTGPLPSLNGLNSLQ  117

Query  462  VLMLSNNHFTSIPSDFFVGMSSLQS  536
            V M S N F+S PSDFF GMS L S
Sbjct  118  VFMASGNSFSSFPSDFFAGMSQLVS  142



>gb|EPS64046.1| hypothetical protein M569_10735 [Genlisea aurea]
Length=949

 Score =   107 bits (267),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 63/128 (49%), Positives = 88/128 (69%), Gaps = 0/128 (0%)
 Frame = +3

Query  150  IFASLFVNAVSQAGQNDDASVMFALKKSLNPPSDMGWSGQDPCKWNHVGCSDDRRVIRIQ  329
            + A+L V      GQ++DA+VM +LK  L+    +GWSG DPC+W  +      RV RIQ
Sbjct  7    LLAALAVVFGVSGGQSNDAAVMLSLKNGLSGTGGLGWSGSDPCQWTPLVHCSGGRVTRIQ  66

Query  330  IGHNSLQGTLPPDLSKLTQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFTSIPSDF  509
            IGH +L G LPP+++ LT LQ  E+Q N +SGPLPS +G+S L+ L+L+ N+F+SIP DF
Sbjct  67   IGHQNLAGNLPPNMNNLTALQVFEVQGNQLSGPLPSFSGMSQLQSLLLTGNNFSSIPPDF  126

Query  510  FVGMSSLQ  533
            F G++SLQ
Sbjct  127  FDGLTSLQ  134



>ref|XP_006448112.1| hypothetical protein CICLE_v10014172mg [Citrus clementina]
 gb|ESR61352.1| hypothetical protein CICLE_v10014172mg [Citrus clementina]
Length=779

 Score =   106 bits (265),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 58/112 (52%), Positives = 83/112 (74%), Gaps = 0/112 (0%)
 Frame = +3

Query  201  DASVMFALKKSLNPPSDMGWSGQDPCKWNHVGCSDDRRVIRIQIGHNSLQGTLPPDLSKL  380
            DA+ M ALK SL  P+ +GW+  DPCKW H+ CS   RV RIQIG  +++GTLP +L+ L
Sbjct  29   DAAAMQALKTSLGNPASLGWTDPDPCKWKHIQCSPSNRVTRIQIGGQNIEGTLPKELNSL  88

Query  381  TQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFTSIPSDFFVGMSSLQS  536
            + L  LE+  N ++G +PSL+GLSSL+ ++  +N+FTS+PSDFF G++SLQ+
Sbjct  89   SSLTVLEVMKNKLTGRIPSLSGLSSLQEVLFDDNNFTSVPSDFFKGLTSLQT  140



>gb|KDO60837.1| hypothetical protein CISIN_1g002255mg [Citrus sinensis]
Length=779

 Score =   106 bits (265),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 58/112 (52%), Positives = 83/112 (74%), Gaps = 0/112 (0%)
 Frame = +3

Query  201  DASVMFALKKSLNPPSDMGWSGQDPCKWNHVGCSDDRRVIRIQIGHNSLQGTLPPDLSKL  380
            DA+ M ALK SL  P+ +GW+  DPCKW H+ CS   RV RIQIG  +++GTLP +L+ L
Sbjct  29   DAAAMQALKTSLGNPASLGWTDPDPCKWKHIQCSPSNRVTRIQIGGQNIEGTLPKELNSL  88

Query  381  TQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFTSIPSDFFVGMSSLQS  536
            + L  LE+  N ++G +PSL+GLSSL+ ++  +N+FTS+PSDFF G++SLQ+
Sbjct  89   SSLTVLEVMKNKLTGQIPSLSGLSSLQEVLFDDNNFTSVPSDFFKGLTSLQT  140



>ref|XP_006469286.1| PREDICTED: probable receptor protein kinase TMK1-like [Citrus 
sinensis]
Length=947

 Score =   106 bits (265),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 58/112 (52%), Positives = 83/112 (74%), Gaps = 0/112 (0%)
 Frame = +3

Query  201  DASVMFALKKSLNPPSDMGWSGQDPCKWNHVGCSDDRRVIRIQIGHNSLQGTLPPDLSKL  380
            DA+ M ALK SL  P+ +GW+  DPCKW H+ CS   RV RIQIG  +++GTLP +L+ L
Sbjct  29   DAAAMQALKTSLGNPASLGWTDPDPCKWKHIQCSPSNRVTRIQIGGQNIEGTLPKELNSL  88

Query  381  TQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFTSIPSDFFVGMSSLQS  536
            + L  LE+  N ++G +PSL+GLSSL+ ++  +N+FTS+PSDFF G++SLQ+
Sbjct  89   SSLTVLEVMKNKLTGRIPSLSGLSSLQEVLFDDNNFTSVPSDFFKGLTSLQT  140



>gb|KDO60836.1| hypothetical protein CISIN_1g002255mg [Citrus sinensis]
Length=947

 Score =   106 bits (265),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 58/112 (52%), Positives = 83/112 (74%), Gaps = 0/112 (0%)
 Frame = +3

Query  201  DASVMFALKKSLNPPSDMGWSGQDPCKWNHVGCSDDRRVIRIQIGHNSLQGTLPPDLSKL  380
            DA+ M ALK SL  P+ +GW+  DPCKW H+ CS   RV RIQIG  +++GTLP +L+ L
Sbjct  29   DAAAMQALKTSLGNPASLGWTDPDPCKWKHIQCSPSNRVTRIQIGGQNIEGTLPKELNSL  88

Query  381  TQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFTSIPSDFFVGMSSLQS  536
            + L  LE+  N ++G +PSL+GLSSL+ ++  +N+FTS+PSDFF G++SLQ+
Sbjct  89   SSLTVLEVMKNKLTGQIPSLSGLSSLQEVLFDDNNFTSVPSDFFKGLTSLQT  140



>ref|XP_006448111.1| hypothetical protein CICLE_v10014172mg [Citrus clementina]
 gb|ESR61351.1| hypothetical protein CICLE_v10014172mg [Citrus clementina]
Length=947

 Score =   106 bits (265),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 58/112 (52%), Positives = 83/112 (74%), Gaps = 0/112 (0%)
 Frame = +3

Query  201  DASVMFALKKSLNPPSDMGWSGQDPCKWNHVGCSDDRRVIRIQIGHNSLQGTLPPDLSKL  380
            DA+ M ALK SL  P+ +GW+  DPCKW H+ CS   RV RIQIG  +++GTLP +L+ L
Sbjct  29   DAAAMQALKTSLGNPASLGWTDPDPCKWKHIQCSPSNRVTRIQIGGQNIEGTLPKELNSL  88

Query  381  TQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFTSIPSDFFVGMSSLQS  536
            + L  LE+  N ++G +PSL+GLSSL+ ++  +N+FTS+PSDFF G++SLQ+
Sbjct  89   SSLTVLEVMKNKLTGRIPSLSGLSSLQEVLFDDNNFTSVPSDFFKGLTSLQT  140



>ref|XP_010553548.1| PREDICTED: probable receptor protein kinase TMK1 isoform X2 [Tarenaya 
hassleriana]
Length=938

 Score =   104 bits (260),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 74/143 (52%), Positives = 91/143 (64%), Gaps = 6/143 (4%)
 Frame = +3

Query  105  RVHLGLKLPALVFLGIFASLFVNAVSQAGQNDDASVMFALKKSLNPPSDMGWSGQDPCKW  284
            + HLG+ L   VF+  FA     AVSQ+  + DAS M ALK SL   SD+ WS  +PC+W
Sbjct  3    KPHLGI-LCLFVFVVDFADF---AVSQS--SPDASSMQALKSSLKLTSDVDWSDPNPCRW  56

Query  285  NHVGCSDDRRVIRIQIGHNSLQGTLPPDLSKLTQLQRLELQWNNIsgplpslnglsslRV  464
              V C D  RV RIQ+    ++GTLPPDL  LT L  LEL  N +SGP+P L+GLS L+ 
Sbjct  57   TSVQCDDSSRVTRIQLKSKGIRGTLPPDLKNLTALTVLELFQNQLSGPIPDLSGLSQLQR  116

Query  465  LMLSNNHFTSIPSDFFVGMSSLQ  533
            L L NN FTS+P D F GM+SLQ
Sbjct  117  LNLHNNQFTSVPKDLFTGMTSLQ  139



>ref|XP_008220934.1| PREDICTED: probable receptor protein kinase TMK1 [Prunus mume]
Length=941

 Score =   104 bits (260),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 69/145 (48%), Positives = 96/145 (66%), Gaps = 9/145 (6%)
 Frame = +3

Query  120  LKLPALVFLG------IFASLFVNAVSQAGQNDDASVMFALKKSLNPPSDMGWSGQDPCK  281
            +K P L F G      +   L+    SQ+G   D   M AL+KS+ P S +GWSG D CK
Sbjct  1    MKEPHLGFRGSFLLLLLLFPLYAPVQSQSGP--DGVAMEALRKSIGPNS-LGWSGSDHCK  57

Query  282  WNHVGCSDDRRVIRIQIGHNSLQGTLPPDLSKLTQLQRLELQWNNIsgplpslnglsslR  461
            W+ V C+ D +V +IQIG+  L G+LPP+L  L  LQ+LE+Q N ++GP PSL+GL+SL+
Sbjct  58   WSQVSCTSDSKVFKIQIGNQKLTGSLPPELKNLAYLQQLEVQSNQLTGPFPSLSGLTSLQ  117

Query  462  VLMLSNNHFTSIPSDFFVGMSSLQS  536
            VL+  NN+F+S P DFFVG+++L S
Sbjct  118  VLLAHNNNFSSFPQDFFVGLTNLVS  142



>ref|XP_010553540.1| PREDICTED: probable receptor protein kinase TMK1 isoform X1 [Tarenaya 
hassleriana]
Length=940

 Score =   104 bits (260),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 74/143 (52%), Positives = 91/143 (64%), Gaps = 6/143 (4%)
 Frame = +3

Query  105  RVHLGLKLPALVFLGIFASLFVNAVSQAGQNDDASVMFALKKSLNPPSDMGWSGQDPCKW  284
            + HLG+ L   VF+  FA     AVSQ+  + DAS M ALK SL   SD+ WS  +PC+W
Sbjct  3    KPHLGI-LCLFVFVVDFADF---AVSQS--SPDASSMQALKSSLKLTSDVDWSDPNPCRW  56

Query  285  NHVGCSDDRRVIRIQIGHNSLQGTLPPDLSKLTQLQRLELQWNNIsgplpslnglsslRV  464
              V C D  RV RIQ+    ++GTLPPDL  LT L  LEL  N +SGP+P L+GLS L+ 
Sbjct  57   TSVQCDDSSRVTRIQLKSKGIRGTLPPDLKNLTALTVLELFQNQLSGPIPDLSGLSQLQR  116

Query  465  LMLSNNHFTSIPSDFFVGMSSLQ  533
            L L NN FTS+P D F GM+SLQ
Sbjct  117  LNLHNNQFTSVPKDLFTGMTSLQ  139



>ref|XP_002893435.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69694.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=894

 Score =   103 bits (256),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 62/125 (50%), Positives = 81/125 (65%), Gaps = 1/125 (1%)
 Frame = +3

Query  165  FVNAVSQAGQNDDASVMFALKKSLNPPSDMGWSGQDPCKWNHVGCSD-DRRVIRIQIGHN  341
            F+  V+     D+A +M AL+ SLN    + WSG DPCKW+ V C D   RV  IQIG  
Sbjct  13   FIALVNGESSPDEAVIMIALRDSLNLTGSLNWSGSDPCKWSLVQCDDTSNRVTAIQIGGK  72

Query  342  SLQGTLPPDLSKLTQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFTSIPSDFFVGM  521
             + GTLPPDL  LT L + E+  N+++GP+PSL GL SL  +  ++N FTS+P DFF G+
Sbjct  73   GISGTLPPDLGNLTSLTKFEVMRNHLTGPIPSLAGLKSLVTVYANDNDFTSVPVDFFTGL  132

Query  522  SSLQS  536
            SSLQS
Sbjct  133  SSLQS  137



>ref|XP_010046493.1| PREDICTED: probable receptor protein kinase TMK1 [Eucalyptus 
grandis]
Length=307

 Score = 99.8 bits (247),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 62/112 (55%), Positives = 76/112 (68%), Gaps = 1/112 (1%)
 Frame = +3

Query  201  DASVMFALKKSLNPPSDMGWSGQDPCKWNHVGCSDDRRVIRIQIGHNSLQGTLPPDLSKL  380
            D   M ALK  L  PS + WS  DPC W  V C+ +R V+RIQIG   + GTLPPD+SKL
Sbjct  36   DVLAMQALKNRLTLPSSLDWSNADPCNWPQVMCTGNR-VVRIQIGMRGVSGTLPPDISKL  94

Query  381  TQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFTSIPSDFFVGMSSLQS  536
            T L R E+  +  SGPLPS  GL+ L+VL L+ N+FT IP+DFF GMSSLQ+
Sbjct  95   TALTRFEVMDSQFSGPLPSFAGLAQLQVLFLNRNNFTFIPADFFTGMSSLQA  146



>ref|XP_007225345.1| hypothetical protein PRUPE_ppa000982mg [Prunus persica]
 gb|EMJ26544.1| hypothetical protein PRUPE_ppa000982mg [Prunus persica]
Length=941

 Score =   102 bits (255),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 63/119 (53%), Positives = 87/119 (73%), Gaps = 3/119 (3%)
 Frame = +3

Query  180  SQAGQNDDASVMFALKKSLNPPSDMGWSGQDPCKWNHVGCSDDRRVIRIQIGHNSLQGTL  359
            SQ+G   D   M AL+KS+ P S +GWSG D CKW+ V C +D +V +IQIG+  L G+L
Sbjct  27   SQSGP--DGVAMEALRKSIGPNS-LGWSGSDYCKWSKVSCKNDNKVFKIQIGNQKLTGSL  83

Query  360  PPDLSKLTQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFTSIPSDFFVGMSSLQS  536
            P +L KL  LQ+LE+Q N ++GP PSL+GL+SL+VL+  NN+F+S P DFFVG+++L S
Sbjct  84   PTELQKLAYLQQLEVQSNELTGPFPSLSGLTSLQVLIAHNNNFSSFPPDFFVGLTNLYS  142



>ref|XP_006290562.1| hypothetical protein CARUB_v10016649mg [Capsella rubella]
 gb|EOA23460.1| hypothetical protein CARUB_v10016649mg [Capsella rubella]
Length=947

 Score =   102 bits (254),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 74/147 (50%), Positives = 94/147 (64%), Gaps = 12/147 (8%)
 Frame = +3

Query  102  MRVHLGLKLPALVFLGIFASL--FVN-AVSQAGQNDDASVMFALKKSLNPPSDMGWSGQD  272
            M+ HLG       FL  F SL  FV+ +VSQ+G +D  S M ALK SLN  SD+ WS  +
Sbjct  2    MKSHLG-------FLCFFISLLGFVDFSVSQSGVDD--STMIALKSSLNLTSDVDWSNPN  52

Query  273  PCKWNHVGCSDDRRVIRIQIGHNSLQGTLPPDLSKLTQLQRLELQWNNIsgplpslngls  452
            PCKW  V C    RV +IQ+    ++GTLPPDL  L++L  LEL  N ISGP+P L+GLS
Sbjct  53   PCKWVAVECDGSNRVTKIQLKQKGIRGTLPPDLQNLSELVVLELFLNRISGPIPDLSGLS  112

Query  453  slRVLMLSNNHFTSIPSDFFVGMSSLQ  533
             L+ L L +N FTS+P + F GM+SLQ
Sbjct  113  RLQTLNLHDNLFTSVPKNLFAGMNSLQ  139



>gb|EYU30155.1| hypothetical protein MIMGU_mgv1a001033mg [Erythranthe guttata]
Length=907

 Score =   101 bits (251),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 68/108 (63%), Positives = 84/108 (78%), Gaps = 1/108 (1%)
 Frame = +3

Query  213  MFALKKSLNPPSDMGWSGQDPCKWNHVGCSDDRRVIRIQIGHNSLQ-GTLPPDLSKLTQL  389
            M   KKSLNPPS++GW+  D CKW  V CS D RV RIQIG+ +LQ GTLPP+L+ LT L
Sbjct  1    MQDFKKSLNPPSELGWADSDTCKWKGVSCSRDGRVTRIQIGNMNLQGGTLPPNLNNLTSL  60

Query  390  QRLELQWNNIsgplpslnglsslRVLMLSNNHFTSIPSDFFVGMSSLQ  533
            Q  E+Q N ++GPLPS +GL+SL+ L+LSNN+FTSIP DFF GM+SLQ
Sbjct  61   QVFEVQQNQLTGPLPSFSGLNSLQSLLLSNNNFTSIPPDFFDGMTSLQ  108



>ref|XP_008467095.1| PREDICTED: probable receptor protein kinase TMK1 [Cucumis melo]
Length=947

 Score =   100 bits (249),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 59/144 (41%), Positives = 86/144 (60%), Gaps = 2/144 (1%)
 Frame = +3

Query  105  RVHLGLKLPALVFLGIFASLFVNAVSQAGQNDDASVMFALKKSLNPPSDMGWSGQDPCKW  284
            + HLG  +  LVF      L  +  +Q     D SVM  LK S+  PS +GW+G D C+W
Sbjct  3    KPHLGFGVFLLVFPLFLQFLGFSVFAQPAAGGDGSVMSLLKNSIGAPSSLGWTGSDYCQW  62

Query  285  NHVGCSDDRRVIRIQIGHNSLQGTLPPDLSKLTQLQRLELQWNNIsgplpslnglsslRV  464
             HV C    RV++IQIG+ +L+G+LP +L  L+ L +LE+Q N +    P  N   SL++
Sbjct  63   KHVKCDSQSRVVKIQIGNQNLKGSLPKELFSLSALVQLEVQSNQL--GGPFPNLADSLQI  120

Query  465  LMLSNNHFTSIPSDFFVGMSSLQS  536
            L+  +N FTS+P+DFF   S+LQ+
Sbjct  121  LLAHDNFFTSMPADFFAKKSALQT  144



>ref|XP_004142822.1| PREDICTED: probable receptor protein kinase TMK1-like [Cucumis 
sativus]
 ref|XP_004170157.1| PREDICTED: probable receptor protein kinase TMK1-like [Cucumis 
sativus]
 gb|KGN51453.1| hypothetical protein Csa_5G550170 [Cucumis sativus]
Length=950

 Score = 98.6 bits (244),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 55/121 (45%), Positives = 78/121 (64%), Gaps = 2/121 (2%)
 Frame = +3

Query  174  AVSQAGQNDDASVMFALKKSLNPPSDMGWSGQDPCKWNHVGCSDDRRVIRIQIGHNSLQG  353
            A   AG   D SVM  LK S+  PS +GW+G D C+WNHV C    RV++IQIG+ +L+G
Sbjct  28   AQPAAGGAGDGSVMNLLKNSVGAPSSLGWTGSDYCQWNHVKCDSQSRVVKIQIGNQNLKG  87

Query  354  TLPPDLSKLTQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFTSIPSDFFVGMSSLQ  533
            +LP +L  L+ L +LE+Q N +    P  N   SL++L+  +N FTS+P+DFF   S+LQ
Sbjct  88   SLPKELFSLSALVQLEVQSNQL--GGPFPNLADSLQILLAHDNLFTSMPADFFAKKSALQ  145

Query  534  S  536
            +
Sbjct  146  T  146



>gb|KDP38160.1| hypothetical protein JCGZ_04803 [Jatropha curcas]
Length=942

 Score = 97.1 bits (240),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 69/121 (57%), Positives = 88/121 (73%), Gaps = 0/121 (0%)
 Frame = +3

Query  174  AVSQAGQNDDASVMFALKKSLNPPSDMGWSGQDPCKWNHVGCSDDRRVIRIQIGHNSLQG  353
            +V+++ Q+ DA+VM  L+ SL  PS++GWSG DPCKW HV C+   +V +IQI    L G
Sbjct  23   SVAKSQQSGDAAVMIKLRDSLGNPSNIGWSGSDPCKWIHVECNPSNQVTKIQIAGKGLTG  82

Query  354  TLPPDLSKLTQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFTSIPSDFFVGMSSLQ  533
            TLP DL KLT LQ LE+  NN++GP+PSL GLSSL+ L L +N F+S PSDFF GMSSL 
Sbjct  83   TLPSDLKKLTALQILEVMSNNLTGPVPSLAGLSSLQTLNLHDNGFSSFPSDFFSGMSSLS  142

Query  534  S  536
            S
Sbjct  143  S  143



>ref|XP_006826595.1| hypothetical protein AMTR_s00138p00056480 [Amborella trichopoda]
 gb|ERM93832.1| hypothetical protein AMTR_s00138p00056480 [Amborella trichopoda]
Length=800

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 69/132 (52%), Positives = 85/132 (64%), Gaps = 4/132 (3%)
 Frame = +3

Query  150  IFASLFVNAVSQAGQND--DASVMFALKKSLNPPSDMGW-SGQDPCKWNHVGCSDDRRVI  320
            +FA L V       Q D  DASVM  L  S+N    +GW S  DPC W  V CS  R + 
Sbjct  23   VFALLIVALGFSEAQTDPNDASVMQKLAISINAGKTLGWTSDTDPCSWKQVYCSQSR-IE  81

Query  321  RIQIGHNSLQGTLPPDLSKLTQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFTSIP  500
             IQIGH SLQGTLP DL+KL+ L RLEL  N +SGPLP+L GLSSL +L++  N+F+SIP
Sbjct  82   SIQIGHQSLQGTLPDDLNKLSSLVRLELMSNQLSGPLPTLKGLSSLSILIIERNNFSSIP  141

Query  501  SDFFVGMSSLQS  536
             DFF G+ +L +
Sbjct  142  GDFFSGLIALTA  153


 Score = 48.9 bits (115),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 50/102 (49%), Gaps = 4/102 (4%)
 Frame = +3

Query  126  LPALVFLGIFASLFVNAVSQAGQND-DASVMFALKKSLNPPSDMG--WSGQDPC-KWNHV  293
            LP++V + + A      +   G  D   + + ++ + L  P +    W G DPC +WN+V
Sbjct  318  LPSIVSVDMVAQTNSFCLDVPGDCDPRVNSLLSIAEPLGYPDNFATNWKGNDPCNQWNYV  377

Query  294  GCSDDRRVIRIQIGHNSLQGTLPPDLSKLTQLQRLELQWNNI  419
             CS    +  +     +L GT+ PD S+   LQRL L  NN+
Sbjct  378  TCSSQGNITILNFQGLNLTGTISPDFSRFESLQRLLLGRNNL  419



>ref|XP_010246966.1| PREDICTED: probable receptor protein kinase TMK1 [Nelumbo nucifera]
Length=496

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 61/112 (54%), Positives = 73/112 (65%), Gaps = 1/112 (1%)
 Frame = +3

Query  198  DDASVMFALKKSLNPPSDMGWSGQDPCKWNHVGCSDDRRVIRIQIGHNSLQGTLPPDLSK  377
            DDA VM  L  SL P +  GWSG DPCKW  V C  + R+  I +   SL GTLP DL++
Sbjct  28   DDAFVMNKLAASLKP-TPSGWSGSDPCKWTGVNCDSNHRITAINLASRSLSGTLPSDLNQ  86

Query  378  LTQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFTSIPSDFFVGMSSLQ  533
            L+QLQ L LQ N ISGPLPSL  L++L    L  N+FTS+P  FFVG+ SLQ
Sbjct  87   LSQLQILSLQNNIISGPLPSLANLTNLEEAFLDRNNFTSVPLSFFVGLESLQ  138



>ref|XP_010424954.1| PREDICTED: probable receptor protein kinase TMK1 [Camelina sativa]
Length=948

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 71/146 (49%), Positives = 90/146 (62%), Gaps = 8/146 (5%)
 Frame = +3

Query  102  MRVHLGLKLPALVFLGIFASLFVN-AVSQAGQNDDASVMFALKKSLNPPSDMGWSGQDPC  278
            M  HLG+    +  LG     F+N +VSQ G +D  S M ALK SLN  SD+ WS  +PC
Sbjct  2    MTSHLGILCFFISLLG-----FLNFSVSQNGVDD--STMKALKSSLNLTSDVDWSNPNPC  54

Query  279  KWNHVGCSDDRRVIRIQIGHNSLQGTLPPDLSKLTQLQRLELQWNNIsgplpslnglssl  458
            KW  V C    RV +IQ+    + GTLPPDL  L++L  LEL  N ISGP+P L+GLS L
Sbjct  55   KWVSVECDGSNRVTKIQLKQKGILGTLPPDLQNLSELVILELFLNRISGPIPDLSGLSRL  114

Query  459  RVLMLSNNHFTSIPSDFFVGMSSLQS  536
            + L L +N FTS+P + F GM+SLQ 
Sbjct  115  QTLNLHDNLFTSVPKNLFAGMNSLQE  140



>ref|XP_010513910.1| PREDICTED: probable receptor protein kinase TMK1 [Camelina sativa]
Length=953

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 71/146 (49%), Positives = 90/146 (62%), Gaps = 8/146 (5%)
 Frame = +3

Query  102  MRVHLGLKLPALVFLGIFASLFVN-AVSQAGQNDDASVMFALKKSLNPPSDMGWSGQDPC  278
            M  HLG+    +  LG     F+N +VSQ G +D  S M ALK SLN  SD+ WS  +PC
Sbjct  2    MTSHLGILCFFISLLG-----FLNFSVSQNGVDD--STMQALKSSLNLTSDVDWSNPNPC  54

Query  279  KWNHVGCSDDRRVIRIQIGHNSLQGTLPPDLSKLTQLQRLELQWNNIsgplpslnglssl  458
            KW  V C    RV +IQ+    + GTLPPDL  L++L  LEL  N ISGP+P L+GLS L
Sbjct  55   KWVSVECDGSNRVTKIQLKQKGILGTLPPDLQNLSELVILELFLNRISGPIPDLSGLSRL  114

Query  459  RVLMLSNNHFTSIPSDFFVGMSSLQS  536
            + L L +N FTS+P + F GM+SLQ 
Sbjct  115  QTLNLHDNLFTSVPKNLFAGMNSLQE  140



>ref|XP_008389147.1| PREDICTED: probable receptor protein kinase TMK1 [Malus domestica]
Length=940

 Score = 95.9 bits (237),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 71/143 (50%), Positives = 98/143 (69%), Gaps = 2/143 (1%)
 Frame = +3

Query  111  HLGLKLPALVFLGIFASLFVNAV-SQAGQNDDASVMFALKKSLNPPSDMGWSGQDPCKWN  287
            HLG      V L +F SL+  +V SQ+G  DD + M AL KS+ P S +GWSG D C W 
Sbjct  5    HLGFWGCFPVLLLLFVSLYPPSVHSQSGGGDDGAAMEALSKSIGPNS-LGWSGTDYCNWG  63

Query  288  HVGCSDDRRVIRIQIGHNSLQGTLPPDLSKLTQLQRLELQWNNIsgplpslnglsslRVL  467
             V C+ D +V +IQ+G+  L GTLPP++ KL+ LQ+LE+Q N ++GP PSL+GL  L+VL
Sbjct  64   QVSCTKDGKVFKIQLGNQKLTGTLPPEIQKLSNLQQLEVQNNQLTGPFPSLSGLQPLQVL  123

Query  468  MLSNNHFTSIPSDFFVGMSSLQS  536
            +  +N+F+S PSDFF G++SL S
Sbjct  124  LAHDNNFSSFPSDFFSGLTSLDS  146



>emb|CDP16901.1| unnamed protein product [Coffea canephora]
Length=125

 Score = 89.7 bits (221),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 53/109 (49%), Positives = 66/109 (61%), Gaps = 11/109 (10%)
 Frame = +3

Query  105  RVHLGLKLP---ALVFLGIFASLFVNAVSQAGQNDDASVMFALKKSLNPPSDMGWSGQDP  275
              HLG  L     ++FLG   S+         Q+ DASVM  LKK+LNPPS +GW   DP
Sbjct  3    ETHLGFPLMLSFVIIFLGFSPSIH-------SQSSDASVMQDLKKALNPPSSLGWDDPDP  55

Query  276  CKWNHVGCS-DDRRVIRIQIGHNSLQGTLPPDLSKLTQLQRLELQWNNI  419
            C+W +V CS +D RV RIQIG+  L G+LP  LSKL   Q LELQ N++
Sbjct  56   CQWKNVECSKNDNRVNRIQIGNQGLTGSLPDSLSKLNAPQFLELQNNHL  104



>ref|XP_010556225.1| PREDICTED: probable receptor protein kinase TMK1 [Tarenaya hassleriana]
Length=932

 Score = 95.9 bits (237),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 59/116 (51%), Positives = 75/116 (65%), Gaps = 0/116 (0%)
 Frame = +3

Query  186  AGQNDDASVMFALKKSLNPPSDMGWSGQDPCKWNHVGCSDDRRVIRIQIGHNSLQGTLPP  365
            A  + DA+   ALK SL  P ++ WSG DPC+W  + C   +RV RIQ+ +  + GTLPP
Sbjct  24   AQSSPDAAPAQALKASLKLPPNLVWSGPDPCEWTGLQCDKSQRVTRIQLANRGISGTLPP  83

Query  366  DLSKLTQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFTSIPSDFFVGMSSLQ  533
            DL  L+ L  LE   N ++GP+PSL GL SL  L L +N FTSIP+DFF GMSSL 
Sbjct  84   DLRNLSSLTILEFMQNKLTGPIPSLAGLKSLMTLNLHDNGFTSIPADFFTGMSSLH  139



>ref|XP_002876780.1| hypothetical protein ARALYDRAFT_484098 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53039.1| hypothetical protein ARALYDRAFT_484098 [Arabidopsis lyrata subsp. 
lyrata]
Length=946

 Score = 95.9 bits (237),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 83/124 (67%), Gaps = 3/124 (2%)
 Frame = +3

Query  165  FVN-AVSQAGQNDDASVMFALKKSLNPPSDMGWSGQDPCKWNHVGCSDDRRVIRIQIGHN  341
            F+N +VSQ G +D  S M ALK SLN  SD+ WS  +PCKW  V C    RV +IQ+   
Sbjct  18   FINLSVSQNGVDD--STMEALKSSLNLTSDVDWSNPNPCKWESVECDGSNRVTKIQLKQK  75

Query  342  SLQGTLPPDLSKLTQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFTSIPSDFFVGM  521
             ++GTLP DL KL++L  LEL  N ISGP+P L+GLS L+ L L +N F S+P++ F GM
Sbjct  76   GIRGTLPTDLQKLSELVVLELFLNRISGPIPDLSGLSRLQTLNLHDNLFDSVPNNLFSGM  135

Query  522  SSLQ  533
            SSLQ
Sbjct  136  SSLQ  139



>ref|XP_009101318.1| PREDICTED: probable receptor protein kinase TMK1 [Brassica rapa]
Length=949

 Score = 95.5 bits (236),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 58/117 (50%), Positives = 76/117 (65%), Gaps = 0/117 (0%)
 Frame = +3

Query  186  AGQNDDASVMFALKKSLNPPSDMGWSGQDPCKWNHVGCSDDRRVIRIQIGHNSLQGTLPP  365
            A   DDA++M +LK SLN  SD+ WS  +PCKW+ V C    RV RIQ+    ++GTLPP
Sbjct  20   AASQDDATIMQSLKSSLNLTSDVDWSNPNPCKWDTVQCDGSSRVTRIQLKQKGIRGTLPP  79

Query  366  DLSKLTQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFTSIPSDFFVGMSSLQS  536
            DL  L++L  LE   N ISGP+P L+GL+ L+ L L +N F S P + F GM+SLQ 
Sbjct  80   DLQNLSELVVLEFFSNKISGPIPDLSGLTHLQTLNLHDNLFDSTPKNLFSGMNSLQE  136



>ref|XP_008358283.1| PREDICTED: probable receptor protein kinase TMK1 [Malus domestica]
Length=925

 Score = 95.1 bits (235),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 70/159 (44%), Positives = 101/159 (64%), Gaps = 14/159 (9%)
 Frame = +3

Query  84   SNLFTEMRVHLGLKLPALVFLGIFA-------SLFVNAVSQAGQNDDASV-MFALKKSLN  239
            S +F+E +    +K P L F G FA       SL+    SQ+G   D    M AL+KS+ 
Sbjct  74   SYIFSEKK----MKEPQLGFWGSFAVLLLLFFSLYPPVHSQSGGGGDDGAAMEALRKSIG  129

Query  240  PPSDMGWSGQDPCKWNHVGCSDDRRVIRIQIGHNSLQGTLPPDLSKLTQLQRLELQWNNI  419
              S +GWSG D CKW  V C D + V +IQ+G+  L GTLPP++ KL+ LQ+LE+Q N +
Sbjct  130  SNS-LGWSGTDYCKWGKVSCKDGK-VFKIQLGNQKLTGTLPPEIQKLSNLQQLEVQNNQL  187

Query  420  sgplpslnglsslRVLMLSNNHFTSIPSDFFVGMSSLQS  536
            +GP PSL+G+  L+VL++ +N+ +S PSDFF G++SL +
Sbjct  188  TGPFPSLSGVQPLQVLLVHDNNISSFPSDFFTGLTSLDN  226



>ref|XP_009102141.1| PREDICTED: probable receptor protein kinase TMK1 [Brassica rapa]
Length=457

 Score = 93.2 bits (230),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 59/119 (50%), Positives = 78/119 (66%), Gaps = 0/119 (0%)
 Frame = +3

Query  177  VSQAGQNDDASVMFALKKSLNPPSDMGWSGQDPCKWNHVGCSDDRRVIRIQIGHNSLQGT  356
            V+ A   DDA++M +LK +L+   D+ WS  DPCKW  V C    RV RIQ+    + GT
Sbjct  16   VNFAASQDDATIMQSLKSTLHLTPDVDWSNPDPCKWPSVQCDGSNRVTRIQLKQKGISGT  75

Query  357  LPPDLSKLTQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFTSIPSDFFVGMSSLQ  533
            LPPDL KL++L  LEL  N ISGP+P L+GL+ L+ L L +N F S P++ F GM+SLQ
Sbjct  76   LPPDLQKLSELIVLELFSNKISGPVPDLSGLTHLQRLNLHDNLFESTPANLFSGMNSLQ  134



>ref|XP_010246532.1| PREDICTED: probable receptor protein kinase TMK1 [Nelumbo nucifera]
Length=928

 Score = 94.7 bits (234),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 59/113 (52%), Positives = 78/113 (69%), Gaps = 3/113 (3%)
 Frame = +3

Query  198  DDASVMFALKKSLNP-PSDMGWSGQDPCKWNHVGCSDDRRVIRIQIGHNSLQGTLPPDLS  374
            DDA++M  L  SL+P PSD  WSG DPCKW  V C  + R+  I +   SL GTLP DL+
Sbjct  28   DDAAIMNKLAASLSPTPSD--WSGNDPCKWTGVNCDANERITAISLASKSLTGTLPSDLN  85

Query  375  KLTQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFTSIPSDFFVGMSSLQ  533
            +LTQL+ L LQ N+ISGPLPSL  L++L+ + L +N+FTS+P  F  G+ +LQ
Sbjct  86   QLTQLKILALQNNHISGPLPSLANLTNLQEVYLDSNNFTSVPDSFLTGLDNLQ  138



>emb|CDY35882.1| BnaA07g01050D [Brassica napus]
Length=457

 Score = 92.8 bits (229),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 59/119 (50%), Positives = 78/119 (66%), Gaps = 0/119 (0%)
 Frame = +3

Query  177  VSQAGQNDDASVMFALKKSLNPPSDMGWSGQDPCKWNHVGCSDDRRVIRIQIGHNSLQGT  356
            V+ A   DDA++M +LK +L+   D+ WS  DPCKW  V C    RV RIQ+    + GT
Sbjct  16   VNFAASQDDATIMQSLKSTLHLTPDVEWSNPDPCKWPSVQCDGSNRVTRIQLKQKGISGT  75

Query  357  LPPDLSKLTQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFTSIPSDFFVGMSSLQ  533
            LPPDL KL++L  LEL  N ISGP+P L+GL+ L+ L L +N F S P++ F GM+SLQ
Sbjct  76   LPPDLQKLSELIVLELFSNKISGPVPDLSGLTHLQRLNLHDNLFDSTPANLFSGMNSLQ  134



>ref|XP_010502174.1| PREDICTED: probable receptor protein kinase TMK1 isoform X1 [Camelina 
sativa]
 ref|XP_010502175.1| PREDICTED: probable receptor protein kinase TMK1 isoform X2 [Camelina 
sativa]
Length=948

 Score = 94.4 bits (233),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 70/146 (48%), Positives = 90/146 (62%), Gaps = 8/146 (5%)
 Frame = +3

Query  102  MRVHLGLKLPALVFLGIFASLFVN-AVSQAGQNDDASVMFALKKSLNPPSDMGWSGQDPC  278
            M  HLG+    +  LG     F+N +VSQ G +D  S M ALK SLN  SD+ WS  +PC
Sbjct  2    MTSHLGILCFFISLLG-----FLNFSVSQNGVDD--STMKALKSSLNLTSDVDWSNPNPC  54

Query  279  KWNHVGCSDDRRVIRIQIGHNSLQGTLPPDLSKLTQLQRLELQWNNIsgplpslnglssl  458
            KW  V C    RV +IQ+    + GTLPP+L  L++L  LEL  N ISGP+P L+GLS L
Sbjct  55   KWVSVECDGSNRVTKIQLKQKGILGTLPPNLQNLSELVILELFLNRISGPIPDLSGLSRL  114

Query  459  RVLMLSNNHFTSIPSDFFVGMSSLQS  536
            + L L +N FTS+P + F GM+SLQ 
Sbjct  115  QTLNLHDNLFTSVPKNLFAGMNSLQE  140



>ref|XP_007045490.1| Leucine-rich repeat protein kinase family protein [Theobroma 
cacao]
 gb|EOY01322.1| Leucine-rich repeat protein kinase family protein [Theobroma 
cacao]
Length=936

 Score = 94.4 bits (233),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 62/132 (47%), Positives = 82/132 (62%), Gaps = 3/132 (2%)
 Frame = +3

Query  141  FLGIFASLFVNAVSQAGQNDDASVMFALKKSLNPPSDMGWSGQDPCKWNHVGCSDDRRVI  320
            FL +         SQ+G   D+SVM  LK SL  PS + WS  DPC+W++V C ++ RV 
Sbjct  14   FLSLLCFFTFQVSSQSGP--DSSVMEKLKTSLKIPSSLDWSNPDPCQWDNVRC-ENNRVT  70

Query  321  RIQIGHNSLQGTLPPDLSKLTQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFTSIP  500
            RIQI + ++ G LPPDL  L+QL   E+  N ISG +PSL GL  L+     NN+F+S P
Sbjct  71   RIQIPNKNVGGILPPDLKNLSQLTVFEVMNNQISGQIPSLAGLGQLQEANFHNNNFSSFP  130

Query  501  SDFFVGMSSLQS  536
            SDFF G++SL S
Sbjct  131  SDFFAGLTSLTS  142



>gb|KHN16510.1| Putative receptor protein kinase TMK1 [Glycine soja]
Length=897

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 68/112 (61%), Gaps = 2/112 (2%)
 Frame = +3

Query  201  DASVMFALKKSLNPPSDMGWSGQDPCKWNHVGCSDDRRVIRIQIGHNSLQGTLPPDLSKL  380
            DA VM  LK  +N P    W+  D CKW HV C   +RV  IQIG  +LQG+LP +L KL
Sbjct  32   DAEVMGILKIMINAPISFQWTNPDVCKWRHVTCDSSKRVTAIQIGSQNLQGSLPKELVKL  91

Query  381  TQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFTSIPSDFFVGMSSLQS  536
            T L+R E Q+N++    P      SL+ L++ +N F+ IP+DFF GMS LQ 
Sbjct  92   TSLERFECQFNSL--TGPFPYLSKSLQKLVIHDNKFSFIPNDFFKGMSHLQE  141



>ref|XP_003532526.1| PREDICTED: probable receptor protein kinase TMK1-like [Glycine 
max]
Length=897

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 68/112 (61%), Gaps = 2/112 (2%)
 Frame = +3

Query  201  DASVMFALKKSLNPPSDMGWSGQDPCKWNHVGCSDDRRVIRIQIGHNSLQGTLPPDLSKL  380
            DA VM  LK  +N P    W+  D CKW HV C   +RV  IQIG  +LQG+LP +L KL
Sbjct  32   DAEVMGILKIMINAPISFQWTNPDVCKWRHVTCDSSKRVTAIQIGSQNLQGSLPKELVKL  91

Query  381  TQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFTSIPSDFFVGMSSLQS  536
            T L+R E Q+N++    P      SL+ L++ +N F+ IP+DFF GMS LQ 
Sbjct  92   TSLERFECQFNSL--TGPFPYLSKSLQKLVIHDNKFSFIPNDFFKGMSHLQE  141



>ref|XP_009101661.1| PREDICTED: probable receptor protein kinase TMK1 [Brassica rapa]
Length=877

 Score = 92.8 bits (229),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 56/113 (50%), Positives = 75/113 (66%), Gaps = 0/113 (0%)
 Frame = +3

Query  198  DDASVMFALKKSLNPPSDMGWSGQDPCKWNHVGCSDDRRVIRIQIGHNSLQGTLPPDLSK  377
            DDA +M + K SLN  SD+ WS  +PCKW+ V C    RV RIQ+    ++GTLPP+L  
Sbjct  24   DDARIMLSFKSSLNLTSDVDWSNPNPCKWDTVQCDGSSRVTRIQLNQKGIRGTLPPNLQN  83

Query  378  LTQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFTSIPSDFFVGMSSLQS  536
            L++L  LEL  N ISGP+P L+GL++L+ L L +N F S P + F GM+SLQ 
Sbjct  84   LSELVVLELFSNRISGPIPDLSGLTNLQTLNLHDNLFDSTPENLFSGMNSLQE  136



>gb|AAG03120.1|AC004133_14 F5A9.23 [Arabidopsis thaliana]
Length=924

 Score = 93.2 bits (230),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 56/112 (50%), Positives = 72/112 (64%), Gaps = 1/112 (1%)
 Frame = +3

Query  201  DASVMFALKKSLNPPSDMGWSGQDPCKWN-HVGCSDDRRVIRIQIGHNSLQGTLPPDLSK  377
            D +VM AL+ SL    +  WSG DPCKW+  + C    RV  IQIG   + G LPPDL K
Sbjct  23   DEAVMIALRDSLKLSGNPNWSGSDPCKWSMFIKCDASNRVTAIQIGDRGISGKLPPDLGK  82

Query  378  LTQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFTSIPSDFFVGMSSLQ  533
            LT L + E+  N ++GP+PSL GL SL  +  ++N FTS+P DFF G+SSLQ
Sbjct  83   LTSLTKFEVMRNRLTGPIPSLAGLKSLVTVYANDNDFTSVPEDFFSGLSSLQ  134



>emb|CDY17635.1| BnaA06g34540D [Brassica napus]
Length=877

 Score = 92.8 bits (229),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 56/113 (50%), Positives = 75/113 (66%), Gaps = 0/113 (0%)
 Frame = +3

Query  198  DDASVMFALKKSLNPPSDMGWSGQDPCKWNHVGCSDDRRVIRIQIGHNSLQGTLPPDLSK  377
            DDA +M + K SLN  SD+ WS  +PCKW+ V C    RV RIQ+    ++GTLPP+L  
Sbjct  24   DDARIMLSFKSSLNLTSDVDWSNPNPCKWDTVQCDGSSRVTRIQLNQKGIRGTLPPNLQN  83

Query  378  LTQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFTSIPSDFFVGMSSLQS  536
            L++L  LEL  N ISGP+P L+GL++L+ L L +N F S P + F GM+SLQ 
Sbjct  84   LSELVVLELFSNRISGPIPDLSGLTNLQTLNLHDNLFDSTPENLFSGMNSLQE  136



>ref|NP_173869.1| leucine-rich repeat protein kinase family protein [Arabidopsis 
thaliana]
 gb|AAF97970.1|AC000103_20 F21J9.31 [Arabidopsis thaliana]
 gb|ACN59232.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AEE30556.1| leucine-rich repeat protein kinase family protein [Arabidopsis 
thaliana]
Length=886

 Score = 92.8 bits (229),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 56/112 (50%), Positives = 72/112 (64%), Gaps = 1/112 (1%)
 Frame = +3

Query  201  DASVMFALKKSLNPPSDMGWSGQDPCKWNH-VGCSDDRRVIRIQIGHNSLQGTLPPDLSK  377
            D +VM AL+ SL    +  WSG DPCKW+  + C    RV  IQIG   + G LPPDL K
Sbjct  23   DEAVMIALRDSLKLSGNPNWSGSDPCKWSMFIKCDASNRVTAIQIGDRGISGKLPPDLGK  82

Query  378  LTQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFTSIPSDFFVGMSSLQ  533
            LT L + E+  N ++GP+PSL GL SL  +  ++N FTS+P DFF G+SSLQ
Sbjct  83   LTSLTKFEVMRNRLTGPIPSLAGLKSLVTVYANDNDFTSVPEDFFSGLSSLQ  134



>gb|KJB50422.1| hypothetical protein B456_008G170100 [Gossypium raimondii]
Length=928

 Score = 93.2 bits (230),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 63/134 (47%), Positives = 81/134 (60%), Gaps = 3/134 (2%)
 Frame = +3

Query  135  LVFLGIFASLFVNAVSQAGQNDDASVMFALKKSLNPPSDMGWSGQDPCKWNHVGCSDDRR  314
            L FL +     +   SQ  Q+ D S M  LKKSL  P  + WS  DPC+W  V C ++ R
Sbjct  12   LRFLSVICFFTLKVCSQ--QSPDLSAMEKLKKSLKIPPSLDWSDPDPCQWAKVECQEN-R  68

Query  315  VIRIQIGHNSLQGTLPPDLSKLTQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFTS  494
            V RIQI   ++ GTLPP+L  LTQL   E+  N I+GP+PSL GL  L+     NN+F+S
Sbjct  69   VTRIQIPSKNIGGTLPPELKNLTQLTIFEVMNNQINGPIPSLAGLIQLQEANFHNNNFSS  128

Query  495  IPSDFFVGMSSLQS  536
             PSDFF G++SL S
Sbjct  129  FPSDFFTGLTSLTS  142



>ref|XP_009351579.1| PREDICTED: probable receptor protein kinase TMK1 isoform X2 [Pyrus 
x bretschneideri]
Length=807

 Score = 92.8 bits (229),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 55/108 (51%), Positives = 79/108 (73%), Gaps = 2/108 (2%)
 Frame = +3

Query  213  MFALKKSLNPPSDMGWSGQDPCKWNHVGCSDDRRVIRIQIGHNSLQGTLPPDLSKLTQLQ  392
            M AL+KS+   S +GWSG D CKW  V C D + V +IQ+G+  L GTLPP++ KL+ LQ
Sbjct  40   MEALRKSIGSNS-LGWSGTDYCKWGKVSCQDGK-VFKIQLGNQKLTGTLPPEIQKLSYLQ  97

Query  393  RLELQWNNIsgplpslnglsslRVLMLSNNHFTSIPSDFFVGMSSLQS  536
            +LE+Q N ++GP PSL+G+  L+VL+  +N+F+S PSDFF G++SL +
Sbjct  98   QLEVQNNQLTGPFPSLSGVQPLQVLLAHDNNFSSFPSDFFTGLTSLDN  145



>ref|XP_003529231.1| PREDICTED: probable receptor protein kinase TMK1-like [Glycine 
max]
Length=932

 Score = 92.8 bits (229),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 52/114 (46%), Positives = 73/114 (64%), Gaps = 2/114 (2%)
 Frame = +3

Query  192  QNDDASVMFALKKSLNPPSDMGWSGQDPCKWNHVGCSDDRRVIRIQIGHNSLQGTLPPDL  371
            QN+D +VM  LKK++  P+D+ W+  D CKW HV C+  +RV  IQIG  SL G+LP +L
Sbjct  22   QNNDVAVMNTLKKAIKEPNDLQWNDPDVCKWEHVQCNTMKRVTAIQIGGQSLNGSLPKEL  81

Query  372  SKLTQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFTSIPSDFFVGMSSLQ  533
             +L++L R E    N +   P  N   SL VL++ NN+F S+  DFF GM++LQ
Sbjct  82   LQLSELTRFECM--NNAFTGPFPNMPKSLEVLLIHNNNFNSMSGDFFNGMTNLQ  133



>ref|XP_008787910.1| PREDICTED: probable receptor protein kinase TMK1 [Phoenix dactylifera]
Length=955

 Score = 92.8 bits (229),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 77/114 (68%), Gaps = 3/114 (3%)
 Frame = +3

Query  201  DASVMFALKKSLNPPSDMGWSGQ-DPCKWNHVGCSDDRRVIRIQIGHNSLQGTLPPDLSK  377
            DA+ M AL K L     +GW+G  DPC W  V C+D  RV  IQIG+ SL GTLP ++  
Sbjct  36   DAAAMRALAKGLGADRALGWTGTADPCTWTGVTCTD-ARVAAIQIGNRSLVGTLPAEVRN  94

Query  378  LTQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFT-SIPSDFFVGMSSLQS  536
            LT L RLELQ N +SG LPSL GLSSL+ L+L  N F+ ++P DFF G+SSLQS
Sbjct  95   LTSLLRLELQENQLSGHLPSLAGLSSLQTLLLHGNRFSGALPPDFFAGLSSLQS  148



>ref|XP_009351578.1| PREDICTED: probable receptor protein kinase TMK1 isoform X1 [Pyrus 
x bretschneideri]
Length=945

 Score = 92.4 bits (228),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 55/108 (51%), Positives = 79/108 (73%), Gaps = 2/108 (2%)
 Frame = +3

Query  213  MFALKKSLNPPSDMGWSGQDPCKWNHVGCSDDRRVIRIQIGHNSLQGTLPPDLSKLTQLQ  392
            M AL+KS+   S +GWSG D CKW  V C D + V +IQ+G+  L GTLPP++ KL+ LQ
Sbjct  40   MEALRKSIGSNS-LGWSGTDYCKWGKVSCQDGK-VFKIQLGNQKLTGTLPPEIQKLSYLQ  97

Query  393  RLELQWNNIsgplpslnglsslRVLMLSNNHFTSIPSDFFVGMSSLQS  536
            +LE+Q N ++GP PSL+G+  L+VL+  +N+F+S PSDFF G++SL +
Sbjct  98   QLEVQNNQLTGPFPSLSGVQPLQVLLAHDNNFSSFPSDFFTGLTSLDN  145



>emb|CDY40785.1| BnaAnng06480D [Brassica napus]
Length=795

 Score = 91.7 bits (226),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 55/128 (43%), Positives = 79/128 (62%), Gaps = 0/128 (0%)
 Frame = +3

Query  150  IFASLFVNAVSQAGQNDDASVMFALKKSLNPPSDMGWSGQDPCKWNHVGCSDDRRVIRIQ  329
            +F  L   A+  A Q+ D + M AL+ SL  P D  W+G DPCKW+ V C    R+ RIQ
Sbjct  8    LFCFLCAIALVSAQQSPDLATMNALRDSLKFPKDFSWTGPDPCKWSGVQCDRSNRITRIQ  67

Query  330  IGHNSLQGTLPPDLSKLTQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFTSIPSDF  509
            IG+  + GTL  DL+ L+ L   E+  N ++G +PSL GL++L+ +   +N FTSI +D 
Sbjct  68   IGNKGMSGTLTSDLNTLSSLTVFEVMGNKLTGGIPSLAGLNALQTINAHDNSFTSISADI  127

Query  510  FVGMSSLQ  533
            F G++SLQ
Sbjct  128  FTGLTSLQ  135



>ref|XP_008381802.1| PREDICTED: probable receptor protein kinase TMK1 [Malus domestica]
Length=971

 Score = 92.0 bits (227),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 63/134 (47%), Positives = 91/134 (68%), Gaps = 3/134 (2%)
 Frame = +3

Query  138  VFLGIFASLFVNAVSQAGQNDDASV-MFALKKSLNPPSDMGWSGQDPCKWNHVGCSDDRR  314
            V L +F SL+    SQ+G   D    M AL+KS+   S +GWSG D CKW  V C D + 
Sbjct  43   VLLLLFFSLYPPVHSQSGGGGDDGAAMEALRKSIGSNS-LGWSGTDYCKWGKVSCKDGK-  100

Query  315  VIRIQIGHNSLQGTLPPDLSKLTQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFTS  494
            V +IQ+G+  L GTLPP++ KL+ LQ+LE+Q N ++GP PSL+G+  L+VL++ +N+ +S
Sbjct  101  VFKIQLGNQKLTGTLPPEIQKLSNLQQLEVQNNQLTGPFPSLSGVQPLQVLLVHDNNISS  160

Query  495  IPSDFFVGMSSLQS  536
             PSDFF G++SL +
Sbjct  161  FPSDFFTGLTSLDN  174



>ref|XP_009103048.1| PREDICTED: probable receptor protein kinase TMK1 [Brassica rapa]
Length=891

 Score = 92.0 bits (227),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 55/128 (43%), Positives = 79/128 (62%), Gaps = 0/128 (0%)
 Frame = +3

Query  150  IFASLFVNAVSQAGQNDDASVMFALKKSLNPPSDMGWSGQDPCKWNHVGCSDDRRVIRIQ  329
            +F  L   A+  A Q+ D + M AL+ SL  P D  W+G DPCKW+ V C    R+ RIQ
Sbjct  10   LFCFLCAIALVSAQQSPDLATMNALRDSLKFPKDFSWTGPDPCKWSGVQCDRSNRITRIQ  69

Query  330  IGHNSLQGTLPPDLSKLTQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFTSIPSDF  509
            IG+  + GTL  DL+ L+ L   E+  N ++G +PSL GL++L+ +   +N FTSI +D 
Sbjct  70   IGNKGMSGTLTSDLNTLSSLTVFEVMGNKLTGGIPSLAGLNALQTINAHDNSFTSISADI  129

Query  510  FVGMSSLQ  533
            F G++SLQ
Sbjct  130  FTGLTSLQ  137



>ref|XP_003631009.1| Kinase-like protein [Medicago truncatula]
 gb|AET05485.1| LRR receptor-like kinase [Medicago truncatula]
Length=925

 Score = 91.7 bits (226),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 50/113 (44%), Positives = 69/113 (61%), Gaps = 2/113 (2%)
 Frame = +3

Query  198  DDASVMFALKKSLNPPSDMGWSGQDPCKWNHVGCSDDRRVIRIQIGHNSLQGTLPPDLSK  377
            +D  VM  LKK++N P    W+  D CKW HV C   + VI IQIG+ +LQG LP +L  
Sbjct  30   EDVEVMNILKKTINAPVTFQWTDPDVCKWKHVNCDSRKHVIAIQIGNQNLQGFLPKELVM  89

Query  378  LTQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFTSIPSDFFVGMSSLQS  536
            LT LQ+ E Q N +    P      SL+ L++ +N F+S+P++FF GMS+LQ 
Sbjct  90   LTTLQKFECQRNGL--TGPFPYLSKSLQRLLIHDNKFSSLPNNFFTGMSNLQE  140



>gb|KJB79021.1| hypothetical protein B456_013G030200 [Gossypium raimondii]
Length=937

 Score = 91.7 bits (226),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 60/119 (50%), Positives = 81/119 (68%), Gaps = 3/119 (3%)
 Frame = +3

Query  180  SQAGQNDDASVMFALKKSLNPPSDMGWSGQDPCKWNHVGCSDDRRVIRIQIGHNSLQGTL  359
            SQ+G   D+SVM  LK SL  PS + WS  DPC+W +V C +++R+ RIQI   ++ GTL
Sbjct  29   SQSGP--DSSVMGKLKTSLKLPSSLDWSDPDPCQWTNVRC-ENQRITRIQIPSKNVGGTL  85

Query  360  PPDLSKLTQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFTSIPSDFFVGMSSLQS  536
            PPDL  L+QL+  E+  N ISGP+PSL GLS L      +N+F+S PSDFF G++SL +
Sbjct  86   PPDLKDLSQLKVFEVMNNQISGPIPSLAGLSLLEEANFHDNNFSSFPSDFFTGLTSLTA  144



>ref|XP_008381795.1| PREDICTED: probable receptor protein kinase TMK1 [Malus domestica]
Length=557

 Score = 90.9 bits (224),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 65/145 (45%), Positives = 94/145 (65%), Gaps = 10/145 (7%)
 Frame = +3

Query  120  LKLPALVFLG-------IFASLFVNAVSQAGQNDDAS-VMFALKKSLNPPSDMGWSGQDP  275
            +K P L F G       +F SL+    SQ+G   D    M AL+KS+   +++GWSG D 
Sbjct  1    MKEPQLGFWGSFPVLLLLFFSLYPPVHSQSGGGGDDGGAMEALRKSIGS-NNLGWSGTDY  59

Query  276  CKWNHVGCSDDRRVIRIQIGHNSLQGTLPPDLSKLTQLQRLELQWNNIsgplpslnglss  455
            CKW  V C   + V +IQ+G+  L GTLPP++ KL+ LQ+LE+Q N ++GP PSL+G+  
Sbjct  60   CKWGKVSCQAGK-VFKIQLGNQKLTGTLPPEIQKLSNLQQLEVQNNQLTGPFPSLSGVQP  118

Query  456  lRVLMLSNNHFTSIPSDFFVGMSSL  530
            L+VL+  +N+F+S PSDFF G++SL
Sbjct  119  LQVLLAHDNNFSSFPSDFFTGLTSL  143



>ref|XP_004503323.1| PREDICTED: probable receptor protein kinase TMK1-like [Cicer 
arietinum]
Length=890

 Score = 91.3 bits (225),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 53/129 (41%), Positives = 74/129 (57%), Gaps = 7/129 (5%)
 Frame = +3

Query  150  IFASLFVNAVSQAGQNDDASVMFALKKSLNPPSDMGWSGQDPCKWNHVGCSDDRRVIRIQ  329
            +F    ++A+ Q     D  VM  LK ++N P    W+  D CKW H+ C   +RV  IQ
Sbjct  13   VFCIFIISAMCQ-----DVEVMNILKNTINAPITFQWTDPDVCKWKHIQCDWRKRVTAIQ  67

Query  330  IGHNSLQGTLPPDLSKLTQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFTSIPSDF  509
            IG+ +LQG+LP +L  LT LQR E Q N +    P      SL+ L++ +N F+S+P+DF
Sbjct  68   IGNQNLQGSLPKELVMLTALQRFECQGNGL--TGPFPYLSKSLQRLVIHDNKFSSMPTDF  125

Query  510  FVGMSSLQS  536
            F G SSLQ 
Sbjct  126  FKGTSSLQE  134



>ref|XP_007153205.1| hypothetical protein PHAVU_003G015800g [Phaseolus vulgaris]
 gb|ESW25199.1| hypothetical protein PHAVU_003G015800g [Phaseolus vulgaris]
Length=929

 Score = 91.3 bits (225),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 53/112 (47%), Positives = 68/112 (61%), Gaps = 2/112 (2%)
 Frame = +3

Query  201  DASVMFALKKSLNPPSDMGWSGQDPCKWNHVGCSDDRRVIRIQIGHNSLQGTLPPDLSKL  380
            D  VM  LKK++     + W+  D CKW HV CS  +RV  IQIG  SLQG+LP +L +L
Sbjct  23   DDVVMNMLKKAVKESDGLQWNDPDVCKWKHVQCSAMKRVTAIQIGGQSLQGSLPKELGQL  82

Query  381  TQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFTSIPSDFFVGMSSLQS  536
            ++L R E   NN     P  N   SL VL++ NN+F S P DFF GM++LQS
Sbjct  83   SELTRFECMSNNF--TGPFPNMPKSLEVLLIHNNNFQSFPGDFFTGMTNLQS  132



>ref|XP_007160467.1| hypothetical protein PHAVU_002G324600g [Phaseolus vulgaris]
 gb|ESW32461.1| hypothetical protein PHAVU_002G324600g [Phaseolus vulgaris]
Length=918

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 49/112 (44%), Positives = 66/112 (59%), Gaps = 2/112 (2%)
 Frame = +3

Query  201  DASVMFALKKSLNPPSDMGWSGQDPCKWNHVGCSDDRRVIRIQIGHNSLQGTLPPDLSKL  380
            DA ++  LK ++N P    W+GQD CKW H+ C   +RV  IQIG+ +LQGTLP +L  L
Sbjct  32   DAEIIGILKNTINVPVSFEWTGQDICKWKHIVCDVSKRVKAIQIGNQNLQGTLPKELVML  91

Query  381  TQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFTSIPSDFFVGMSSLQS  536
            T L R E Q N++           SL+  ++ +N+F   P DFF GMSSLQ 
Sbjct  92   TALTRFECQGNSL--TGSFPYLSKSLQKFIIHDNNFNLFPQDFFKGMSSLQE  141



>ref|XP_006395848.1| hypothetical protein EUTSA_v10003606mg [Eutrema salsugineum]
 gb|ESQ33134.1| hypothetical protein EUTSA_v10003606mg [Eutrema salsugineum]
Length=948

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 66/144 (46%), Positives = 87/144 (60%), Gaps = 6/144 (4%)
 Frame = +3

Query  105  RVHLGLKLPALVFLGIFASLFVNAVSQAGQNDDASVMFALKKSLNPPSDMGWSGQDPCKW  284
            + HLG  L  LV L  FA+     + QAG +D   +M ALK SLN  SD+ WS  +PCKW
Sbjct  3    KFHLGF-LCYLVSLVGFANF---PIVQAGVDD--PIMQALKSSLNLTSDVDWSNSNPCKW  56

Query  285  NHVGCSDDRRVIRIQIGHNSLQGTLPPDLSKLTQLQRLELQWNNIsgplpslnglsslRV  464
              V C    RV RIQ+    ++G LPPD+  L++L  LEL  N +SGP+P L+GL+ L+ 
Sbjct  57   ETVQCDGSNRVTRIQLKQKGIRGILPPDIQNLSELTVLELFLNQLSGPIPDLSGLTRLQK  116

Query  465  LMLSNNHFTSIPSDFFVGMSSLQS  536
            L L  N F S+P + F GM+SLQ 
Sbjct  117  LNLHGNLFDSVPKNLFSGMTSLQE  140



>ref|XP_010462912.1| PREDICTED: probable receptor protein kinase TMK1 [Camelina sativa]
Length=871

 Score = 90.9 bits (224),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 54/124 (44%), Positives = 76/124 (61%), Gaps = 1/124 (1%)
 Frame = +3

Query  165  FVNAVSQAGQNDDASVMFALKKSLNPPSDMGWSGQDPCKW-NHVGCSDDRRVIRIQIGHN  341
            FV +V     + DA+ M AL++SL  P  + WS  DPCKW + + C  + R+ +IQIG+ 
Sbjct  13   FVASVYGQSSSPDAAAMTALRRSLKLPGSLNWSDPDPCKWSSSIQCDGNNRITKIQIGNK  72

Query  342  SLQGTLPPDLSKLTQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFTSIPSDFFVGM  521
             + GTLPPDL  L+ L   E+  N I+G +PS  GL SL  +  ++N F SI SDFF  +
Sbjct  73   GISGTLPPDLKNLSSLMIFEVMHNKITGKIPSFAGLKSLNRVYFNDNSFDSIDSDFFANL  132

Query  522  SSLQ  533
            +SLQ
Sbjct  133  TSLQ  136



>ref|XP_009789399.1| PREDICTED: probable receptor protein kinase TMK1 [Nicotiana sylvestris]
Length=917

 Score = 90.9 bits (224),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 57/124 (46%), Positives = 78/124 (63%), Gaps = 1/124 (1%)
 Frame = +3

Query  162  LFVNAVSQAGQNDDASVMFALKKSLNPPSDMGWSGQDPCKWNHVGCSDDRRVIRIQIGHN  341
            + + A +  G   D++VM  L KSL P +  GWSG D CKW  V C    RV  I +   
Sbjct  19   IAITASANDGSAGDSAVMAKLAKSLTP-TPTGWSGPDVCKWPGVSCDSSGRVSSISLISK  77

Query  342  SLQGTLPPDLSKLTQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFTSIPSDFFVGM  521
            S+ G LPPDL++L+ LQ L LQ N + G LP L+ LSSL+ + L NN+FTS+PS+F  G+
Sbjct  78   SVAGELPPDLNQLSNLQSLNLQRNRLYGSLPPLSDLSSLQEVHLDNNNFTSVPSNFLKGL  137

Query  522  SSLQ  533
            +SL+
Sbjct  138  TSLE  141



>ref|NP_178291.1| receptor-like kinase TMK3 [Arabidopsis thaliana]
 gb|AAD21776.1| putative receptor-like protein kinase [Arabidopsis thaliana]
 gb|ACN59281.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AEC05504.1| receptor-like kinase TMK3 [Arabidopsis thaliana]
Length=943

 Score = 89.7 bits (221),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 66/141 (47%), Positives = 86/141 (61%), Gaps = 6/141 (4%)
 Frame = +3

Query  111  HLGLKLPALVFLGIFASLFVNAVSQAGQNDDASVMFALKKSLNPPSDMGWSGQDPCKWNH  290
            HLG     L F+     L   ++SQ G +D  S M +LK SLN  SD+ WS  +PCKW  
Sbjct  5    HLG----TLCFIISLLGLANFSLSQTGLDD--STMQSLKSSLNLTSDVDWSNPNPCKWQS  58

Query  291  VGCSDDRRVIRIQIGHNSLQGTLPPDLSKLTQLQRLELQWNNIsgplpslnglsslRVLM  470
            V C    RV +IQ+    ++GTLP +L  L++L  LEL  N ISGP+P L+GLS L+ L 
Sbjct  59   VQCDGSNRVTKIQLKQKGIRGTLPTNLQSLSELVILELFLNRISGPIPDLSGLSRLQTLN  118

Query  471  LSNNHFTSIPSDFFVGMSSLQ  533
            L +N FTS+P + F GMSSLQ
Sbjct  119  LHDNLFTSVPKNLFSGMSSLQ  139



>ref|XP_008789301.1| PREDICTED: probable receptor protein kinase TMK1 [Phoenix dactylifera]
Length=930

 Score = 89.4 bits (220),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 59/108 (55%), Positives = 73/108 (68%), Gaps = 3/108 (3%)
 Frame = +3

Query  213  MFALKKSLNPPSDMGW-SGQDPCK-WNHVGCSDDRRVIRIQIGHNSLQGTLPPDLSKLTQ  386
            M  L KSL+P S +GW    DPC  W  V CS DR V+ IQ+G+  L G LPPD+  LT 
Sbjct  41   MRTLAKSLDPASKLGWLDSSDPCDHWVGVRCSGDR-VVAIQVGNRGLSGVLPPDIRNLTA  99

Query  387  LQRLELQWNNIsgplpslnglsslRVLMLSNNHFTSIPSDFFVGMSSL  530
            L RLEL  N +SGP+PSL GL++L  L L+NN+F+SIP DFF G+ SL
Sbjct  100  LTRLELMSNRLSGPIPSLTGLATLETLFLANNNFSSIPGDFFSGLYSL  147



>ref|XP_006830550.1| hypothetical protein AMTR_s00117p00096300 [Amborella trichopoda]
 gb|ERM97966.1| hypothetical protein AMTR_s00117p00096300 [Amborella trichopoda]
Length=922

 Score = 89.4 bits (220),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 53/112 (47%), Positives = 80/112 (71%), Gaps = 1/112 (1%)
 Frame = +3

Query  201  DASVMFALKKSLNPPSDMGWSGQDPCKWNHVGCSDDRRVIRIQIGHNSLQGTLPPDLSKL  380
            D++ M  L K++NP +++GW+G DPC W +V C++ R V  I++   +L+GTLP  ++ L
Sbjct  20   DSTAMLDLAKAINPVANLGWTGSDPCNWKNVDCTNGR-VTAIRLPGQNLKGTLPSSINSL  78

Query  381  TQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFTSIPSDFFVGMSSLQS  536
            + L  L LQ N++SGPLPS +G+SSL+ L L  N F+SIP DFF G++SLQ+
Sbjct  79   SMLSILTLQGNSLSGPLPSFSGMSSLQTLYLDGNQFSSIPGDFFRGLTSLQN  130



>emb|CDY03867.1| BnaC07g10920D [Brassica napus]
Length=889

 Score = 88.6 bits (218),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 54/128 (42%), Positives = 78/128 (61%), Gaps = 0/128 (0%)
 Frame = +3

Query  150  IFASLFVNAVSQAGQNDDASVMFALKKSLNPPSDMGWSGQDPCKWNHVGCSDDRRVIRIQ  329
            +F  L   A+  A  + D + M AL+ SL  P D  W+G DPCKW+ V C    R+ RIQ
Sbjct  8    LFCFLCAIALVSAQPSPDLATMNALRDSLKFPKDSSWTGPDPCKWSGVQCDRSNRITRIQ  67

Query  330  IGHNSLQGTLPPDLSKLTQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFTSIPSDF  509
            IG+  + GTL  DL+ L+ L   E+  N ++G +PSL GL++L+ +   +N FTSI +D 
Sbjct  68   IGNKGISGTLTSDLNTLSSLTVFEVMGNKLTGGIPSLAGLNALQTINAHDNSFTSISADI  127

Query  510  FVGMSSLQ  533
            F G++SLQ
Sbjct  128  FTGLTSLQ  135



>ref|XP_010685103.1| PREDICTED: probable receptor protein kinase TMK1 [Beta vulgaris 
subsp. vulgaris]
Length=928

 Score = 88.6 bits (218),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 55/135 (41%), Positives = 86/135 (64%), Gaps = 7/135 (5%)
 Frame = +3

Query  132  ALVFLGIFASLFVNAVSQAGQNDDASVMFALKKSLNPPSDMGWSGQDPCKWNHVGCSDDR  311
            A++FL     LF++A+S A   DDA++M  L +S NPP    WSG +PCKW  + C    
Sbjct  18   AVIFL-----LFLSALSTASA-DDATIMMKLSRSFNPPPP-NWSGNNPCKWQGISCGSSG  70

Query  312  RVIRIQIGHNSLQGTLPPDLSKLTQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFT  491
            ++  I +   S+ GTLP ++++L+ L+ L LQ N++SG +P L  +S+L+ + L  N F+
Sbjct  71   QLTSITLVSKSISGTLPSEITQLSNLESLSLQNNHLSGTIPPLANMSNLQEVFLDGNFFS  130

Query  492  SIPSDFFVGMSSLQS  536
             IPS+F VG+ +LQS
Sbjct  131  HIPSNFLVGLPNLQS  145



>ref|XP_003601704.1| Receptor-like kinase [Medicago truncatula]
 gb|AES71955.1| LRR receptor-like kinase [Medicago truncatula]
Length=933

 Score = 88.6 bits (218),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 55/112 (49%), Positives = 69/112 (62%), Gaps = 1/112 (1%)
 Frame = +3

Query  198  DDASVMFALKKSLNPPSDMGWSGQDPCKWNHVGCSDDRRVIRIQIGHNSLQGTLPPDLSK  377
            DD + M  L KSL PP   GWSG   C WN V C    RV  + +   SL GTLP DL+ 
Sbjct  31   DDGAFMSKLAKSLTPPPS-GWSGNSFCSWNGVKCDGSDRVTSLNLASKSLTGTLPSDLNS  89

Query  378  LTQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFTSIPSDFFVGMSSLQ  533
            L+QL  L LQ N+++G LPSL  L+ L+ + L  N+FTSIP   FVG++SLQ
Sbjct  90   LSQLTTLSLQSNSLTGALPSLANLTMLQTVFLGGNNFTSIPDGCFVGLTSLQ  141



>ref|XP_010527815.1| PREDICTED: probable receptor protein kinase TMK1 [Tarenaya hassleriana]
Length=963

 Score = 88.6 bits (218),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 66/142 (46%), Positives = 85/142 (60%), Gaps = 6/142 (4%)
 Frame = +3

Query  111  HLGLKLPALVFLGIFASLFVNAVSQAGQNDDASVMFALKKSLNPPSDMGWSGQDPCKWNH  290
            HLG+    L FL     L   +VSQ+  + DAS M ALK SLN  S + WS  +PC+W  
Sbjct  5    HLGI----LSFLVSVLGLADFSVSQS--SPDASSMQALKSSLNLTSYVDWSDPNPCRWLS  58

Query  291  VGCSDDRRVIRIQIGHNSLQGTLPPDLSKLTQLQRLELQWNNIsgplpslnglsslRVLM  470
            V C    RV RIQ+    ++GTLPPDL  LT L  LE   N + GP+P L+GLS L+ L 
Sbjct  59   VQCDSSNRVTRIQLKSKGIRGTLPPDLKNLTSLTVLEFFANQLWGPVPDLSGLSQLQRLN  118

Query  471  LSNNHFTSIPSDFFVGMSSLQS  536
            L +N FTS+P++ F GM+ LQ 
Sbjct  119  LRDNQFTSVPNNLFAGMTMLQE  140



>emb|CDY26344.1| BnaA03g60200D [Brassica napus]
Length=457

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 57/119 (48%), Positives = 75/119 (63%), Gaps = 0/119 (0%)
 Frame = +3

Query  177  VSQAGQNDDASVMFALKKSLNPPSDMGWSGQDPCKWNHVGCSDDRRVIRIQIGHNSLQGT  356
            V+ A   DDA++M +LK +L+   D+ WS  DPCKW  V C    RV RIQ+    + GT
Sbjct  16   VNLAASQDDATIMQSLKSTLHLTPDVDWSNPDPCKWVAVQCDGSNRVTRIQLKQKGISGT  75

Query  357  LPPDLSKLTQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFTSIPSDFFVGMSSLQ  533
            LP DL KL++L  LE   N ISGP+P L+GL+ L+ L L +N F S P + F GM+SLQ
Sbjct  76   LPLDLQKLSELIVLEFFSNKISGPVPDLSGLTHLQRLNLHDNLFDSTPKNLFSGMNSLQ  134



>emb|CDY52761.1| BnaC02g47770D [Brassica napus]
Length=872

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 55/112 (49%), Positives = 72/112 (64%), Gaps = 0/112 (0%)
 Frame = +3

Query  201  DASVMFALKKSLNPPSDMGWSGQDPCKWNHVGCSDDRRVIRIQIGHNSLQGTLPPDLSKL  380
            D   M ALK SLN    + WS  +PCKW  V C    RV RIQ+ +  ++GTLPP+L  L
Sbjct  27   DGPTMQALKMSLNLTKGVDWSNPNPCKWPTVQCDASNRVTRIQLNNKGIRGTLPPNLQTL  86

Query  381  TQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFTSIPSDFFVGMSSLQS  536
            T+L  LEL  N ISGP+P L+GL+ L+ L L NN F S+P + F G++SLQ+
Sbjct  87   TELTVLELFQNQISGPIPDLSGLTRLQTLNLHNNLFDSVPKNLFSGLTSLQA  138



>ref|XP_010501607.1| PREDICTED: probable receptor protein kinase TMK1 [Camelina sativa]
Length=888

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 52/111 (47%), Positives = 69/111 (62%), Gaps = 0/111 (0%)
 Frame = +3

Query  201  DASVMFALKKSLNPPSDMGWSGQDPCKWNHVGCSDDRRVIRIQIGHNSLQGTLPPDLSKL  380
            DA+ M ALK+SL  P  + WS  DPCKW+     D  R+ +IQIG+  + GTLPPDL  L
Sbjct  24   DAAAMTALKRSLKLPGSLNWSDPDPCKWSSSIQCDGNRISKIQIGNKGISGTLPPDLKNL  83

Query  381  TQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFTSIPSDFFVGMSSLQ  533
            + L   E+  N I+G +PS  GL SL  +  ++N F SI SDFF  ++SLQ
Sbjct  84   SSLMIFEVMHNKITGKIPSFAGLKSLNRVYFNDNSFDSIDSDFFANLTSLQ  134



>ref|XP_006303733.1| hypothetical protein CARUB_v10011871mg [Capsella rubella]
 gb|EOA36631.1| hypothetical protein CARUB_v10011871mg [Capsella rubella]
Length=891

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 55/123 (45%), Positives = 70/123 (57%), Gaps = 2/123 (2%)
 Frame = +3

Query  165  FVNAVSQAGQNDDASVMFALKKSLNPPSDMGWSGQDPCKWNHVGCSDDRRVIRIQIGHNS  344
            F+  V     + D + M  LK SLN P   GWSG +PC W  V C    +V +IQIG+  
Sbjct  14   FIAYVYGQSSSPDEAAMNVLKNSLNSPP--GWSGSNPCNWTDVDCDGSNQVTKIQIGNKG  71

Query  345  LQGTLPPDLSKLTQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFTSIPSDFFVGMS  524
            + G LP DL  L+ L   E+  NNI G +PSL GL SL  +   +N FTSI +DFF G+ 
Sbjct  72   ISGMLPTDLKSLSSLTVFEVMNNNIIGKIPSLAGLKSLETVNFHDNGFTSIDADFFTGLP  131

Query  525  SLQ  533
            SLQ
Sbjct  132  SLQ  134



>emb|CDP03933.1| unnamed protein product [Coffea canephora]
Length=910

 Score = 86.3 bits (212),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 57/115 (50%), Positives = 73/115 (63%), Gaps = 5/115 (4%)
 Frame = +3

Query  198  DDASVMFALKKSLN--PPSDMGWSGQDPCKWNHVGCSDDRRVIRIQIGHNSLQGTLPPDL  371
            DDA++M  L K  +  PP   GWSG  PCKW  V C    RVI I +   SL G LP  L
Sbjct  29   DDAAIMAELAKGFSNAPP---GWSGNTPCKWTGVQCDSSGRVISIILISKSLSGKLPSGL  85

Query  372  SKLTQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFTSIPSDFFVGMSSLQS  536
            +KL+ LQ L  Q N + GPLPSL+ L+SLR + L  N+FTS+P DF +G++SLQ+
Sbjct  86   NKLSSLQSLNFQRNQLLGPLPSLSNLTSLREVYLDGNNFTSVPPDFLMGLTSLQT  140



>ref|XP_010246967.1| PREDICTED: probable receptor protein kinase TMK1 [Nelumbo nucifera]
Length=859

 Score = 86.3 bits (212),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 56/115 (49%), Positives = 75/115 (65%), Gaps = 5/115 (4%)
 Frame = +3

Query  195  NDDASVMFALKKSL--NPPSDMGWSGQDPCKWNHVGCSDDRRVIRIQIGHNSLQGTLPPD  368
            +DDA++M  L  SL  +PP    WSG DPC W  + C +  RV  I +   SL G+LPPD
Sbjct  27   SDDAAIMGKLAASLSGHPPD---WSGNDPCIWTGITCDNTNRVTGINLPKKSLGGSLPPD  83

Query  369  LSKLTQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFTSIPSDFFVGMSSLQ  533
            L++LTQL+ L LQ N ISG LPSL  L++L  + L++N FTS+P  F  G++SLQ
Sbjct  84   LNQLTQLRLLYLQNNAISGDLPSLANLTNLIEINLNSNKFTSVPDTFLTGLTSLQ  138



>gb|KFK45034.1| hypothetical protein AALP_AA1G335600 [Arabis alpina]
Length=920

 Score = 86.3 bits (212),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 55/108 (51%), Positives = 69/108 (64%), Gaps = 0/108 (0%)
 Frame = +3

Query  213  MFALKKSLNPPSDMGWSGQDPCKWNHVGCSDDRRVIRIQIGHNSLQGTLPPDLSKLTQLQ  392
            M +LK SLN   D+ WS  +PCKW  V C    RV RIQ+    + GTLP +L  LT+L 
Sbjct  1    MQSLKSSLNLTKDIDWSNPNPCKWESVQCDGSNRVTRIQLKQKGIHGTLPSNLQTLTELT  60

Query  393  RLELQWNNIsgplpslnglsslRVLMLSNNHFTSIPSDFFVGMSSLQS  536
             LEL  N ISGP+P L+GL+ L+ L L +N FTS+P + F GMSSLQ 
Sbjct  61   VLELFLNQISGPIPDLSGLTRLQKLNLHDNLFTSVPKNLFFGMSSLQE  108



>ref|XP_010936890.1| PREDICTED: probable receptor protein kinase TMK1 [Elaeis guineensis]
Length=958

 Score = 85.9 bits (211),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 59/114 (52%), Positives = 75/114 (66%), Gaps = 3/114 (3%)
 Frame = +3

Query  201  DASVMFALKKSLNPPSDMGWSGQ-DPCKWNHVGCSDDRRVIRIQIGHNSLQGTLPPDLSK  377
            DA+ M AL K L     +GW+G  DPC W  V C++ R V  IQ+G+ SL GTLP ++  
Sbjct  33   DAAAMRALAKGLEADRALGWTGTTDPCAWTGVTCTEGR-VTAIQVGNRSLAGTLPAEVRN  91

Query  378  LTQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFTSI-PSDFFVGMSSLQS  536
            LT L RLE+  N +SG LPSL GLSSL+ L+L  N F+ + P DFF G+SSLQS
Sbjct  92   LTALLRLEVHDNQLSGVLPSLAGLSSLQALLLHGNRFSGVPPPDFFSGLSSLQS  145



>ref|XP_009610544.1| PREDICTED: probable receptor protein kinase TMK1 [Nicotiana tomentosiformis]
Length=923

 Score = 85.9 bits (211),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 55/115 (48%), Positives = 73/115 (63%), Gaps = 1/115 (1%)
 Frame = +3

Query  189  GQNDDASVMFALKKSLNPPSDMGWSGQDPCKWNHVGCSDDRRVIRIQIGHNSLQGTLPPD  368
            G   DA+VM  L KSL  P+  GWSG + CKW  V C    RV  I +   S+ G LPPD
Sbjct  32   GSAGDAAVMAKLAKSL-APTPTGWSGPNVCKWPGVSCDSSGRVSSISLISKSVAGELPPD  90

Query  369  LSKLTQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFTSIPSDFFVGMSSLQ  533
            L++L+ LQ L LQ N + G LP L+ LSSL+ + L NN+FTS+P +F  G++SL+
Sbjct  91   LNQLSSLQSLNLQRNRLYGSLPPLSDLSSLQEVHLDNNNFTSVPPNFLKGLTSLE  145



>ref|XP_009129193.1| PREDICTED: probable receptor protein kinase TMK1 isoform X1 [Brassica 
rapa]
 ref|XP_009129194.1| PREDICTED: probable receptor protein kinase TMK1 isoform X2 [Brassica 
rapa]
Length=926

 Score = 85.9 bits (211),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 54/112 (48%), Positives = 72/112 (64%), Gaps = 0/112 (0%)
 Frame = +3

Query  201  DASVMFALKKSLNPPSDMGWSGQDPCKWNHVGCSDDRRVIRIQIGHNSLQGTLPPDLSKL  380
            D   M ALK SLN    + WS  +PCKW  V C    RV RIQ+ +  ++GTLPP+L  L
Sbjct  27   DGPTMQALKSSLNLTKGVDWSNPNPCKWPTVQCDASNRVTRIQLNNKGIRGTLPPNLQTL  86

Query  381  TQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFTSIPSDFFVGMSSLQS  536
            T+L  LEL  N ISGP+P L+GL+ L+ L L +N F S+P + F G++SLQ+
Sbjct  87   TELTVLELFKNQISGPIPDLSGLTRLQTLNLHDNLFDSVPKNLFSGLTSLQA  138



>emb|CDY09413.1| BnaA02g25970D [Brassica napus]
Length=915

 Score = 85.9 bits (211),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 54/112 (48%), Positives = 72/112 (64%), Gaps = 0/112 (0%)
 Frame = +3

Query  201  DASVMFALKKSLNPPSDMGWSGQDPCKWNHVGCSDDRRVIRIQIGHNSLQGTLPPDLSKL  380
            D   M ALK SLN    + WS  +PCKW  V C    RV RIQ+ +  ++GTLPP+L  L
Sbjct  27   DGPTMQALKSSLNLTKGVDWSNPNPCKWPTVQCDASNRVTRIQLNNKGIRGTLPPNLQTL  86

Query  381  TQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFTSIPSDFFVGMSSLQS  536
            T+L  LEL  N ISGP+P L+GL+ L+ L L +N F S+P + F G++SLQ+
Sbjct  87   TELTVLELFKNQISGPIPDLSGLTRLQTLNLHDNLFDSVPKNLFSGLTSLQA  138



>ref|XP_009124646.1| PREDICTED: probable receptor protein kinase TMK1 [Brassica rapa]
Length=457

 Score = 84.3 bits (207),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 55/119 (46%), Positives = 74/119 (62%), Gaps = 0/119 (0%)
 Frame = +3

Query  177  VSQAGQNDDASVMFALKKSLNPPSDMGWSGQDPCKWNHVGCSDDRRVIRIQIGHNSLQGT  356
            V+ A   DDA++M +LK +L+   D+ WS  D CKW    C    RV RIQ+    + GT
Sbjct  16   VNLAASQDDATIMQSLKSTLHLTPDVDWSNPDRCKWVVFQCDGSNRVTRIQLKQKGISGT  75

Query  357  LPPDLSKLTQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFTSIPSDFFVGMSSLQ  533
            LPPDL KL++L  LE   N I+GP+P L+GL+ L+ L L +N F S P + F GM+SLQ
Sbjct  76   LPPDLQKLSELIVLEFFSNKITGPVPDLSGLTRLQRLNLHDNLFDSTPKNLFSGMNSLQ  134



>ref|XP_002324686.2| hypothetical protein POPTR_0018s13780g [Populus trichocarpa]
 gb|EEF03251.2| hypothetical protein POPTR_0018s13780g [Populus trichocarpa]
Length=929

 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 55/116 (47%), Positives = 71/116 (61%), Gaps = 4/116 (3%)
 Frame = +3

Query  198  DDASVMFALKKSLNPPSDMGWSGQDP---CKWNHVGCSDDRRVIRIQIGHNSLQGTLPPD  368
            DDA  M  L  +L P +  GWS  +    CKWN V C +   VI I +    L GTLP +
Sbjct  25   DDAGTMLKLASALTP-TPKGWSTTNTNGYCKWNGVKCDNSNNVISINLASQGLSGTLPSE  83

Query  369  LSKLTQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFTSIPSDFFVGMSSLQS  536
            LS L+QLQ   LQ N + GPLPSL  L+ LR + +  N+FTSIP+DFF G++SLQ+
Sbjct  84   LSTLSQLQSFSLQDNKLIGPLPSLANLAFLREVYIGTNNFTSIPADFFKGLTSLQT  139



>ref|XP_003572876.1| PREDICTED: probable receptor protein kinase TMK1 [Brachypodium 
distachyon]
Length=958

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 56/113 (50%), Positives = 73/113 (65%), Gaps = 3/113 (3%)
 Frame = +3

Query  201  DASVMFALKKSLNPPSDMGWSGQDPCK---WNHVGCSDDRRVIRIQIGHNSLQGTLPPDL  371
            DA  M A+  +L     +GW   DPC    W  V CS D RV  +Q+G  SL G L P++
Sbjct  43   DAEAMRAVAVALGADKSLGWDTPDPCSPKPWPGVSCSSDGRVTAVQVGKKSLTGKLAPEV  102

Query  372  SKLTQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFTSIPSDFFVGMSSL  530
              LT+L RLE+  N +SGPLPSL GLSSL+VL+L  N+F SIP+DFF G+++L
Sbjct  103  RNLTELMRLEVFSNKLSGPLPSLAGLSSLQVLLLHGNNFASIPADFFKGLTAL  155



>ref|XP_010668632.1| PREDICTED: probable receptor protein kinase TMK1 [Beta vulgaris 
subsp. vulgaris]
Length=943

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 54/108 (50%), Positives = 72/108 (67%), Gaps = 0/108 (0%)
 Frame = +3

Query  213  MFALKKSLNPPSDMGWSGQDPCKWNHVGCSDDRRVIRIQIGHNSLQGTLPPDLSKLTQLQ  392
            M  LK SL  PS + WS  +PC+W++VGC  + RV RIQ+    + GTL P +  LT L+
Sbjct  42   MQELKLSLKLPSSIDWSNANPCRWDNVGCDSNNRVTRIQLRSEGVSGTLSPAVGNLTNLE  101

Query  393  RLELQWNNIsgplpslnglsslRVLMLSNNHFTSIPSDFFVGMSSLQS  536
             LEL  N ++GPLPSL GLSSL+ L L NN F+S+P + F G++SLQ 
Sbjct  102  VLELMNNALTGPLPSLKGLSSLQRLFLHNNQFSSVPENLFDGLTSLQE  149



>ref|XP_008665300.1| PREDICTED: probable receptor protein kinase TMK1 [Zea mays]
 tpg|DAA51027.1| TPA: putative leucine-rich repeat receptor-like protein kinase 
family protein [Zea mays]
Length=962

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 55/116 (47%), Positives = 73/116 (63%), Gaps = 4/116 (3%)
 Frame = +3

Query  201  DASVMFALKKSLNPPSDMGWS-GQDPC---KWNHVGCSDDRRVIRIQIGHNSLQGTLPPD  368
            D + M A+ K+L     +GW    DPC   +W+ V C    RV  IQ+G   L GTLPP+
Sbjct  44   DVAAMRAVAKALGADKTLGWDVAGDPCSPKRWDGVSCDSSGRVTAIQVGARGLTGTLPPE  103

Query  369  LSKLTQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFTSIPSDFFVGMSSLQS  536
            +  LT+L RLE+  N +SGPLP L GLSSL+VL+  NN F SIP+DFF G++ L +
Sbjct  104  VGDLTELTRLEVFDNKLSGPLPLLPGLSSLQVLLAHNNSFASIPADFFKGLTGLTA  159



>ref|XP_002463990.1| hypothetical protein SORBIDRAFT_01g010110 [Sorghum bicolor]
 gb|EER90988.1| hypothetical protein SORBIDRAFT_01g010110 [Sorghum bicolor]
Length=963

 Score = 83.6 bits (205),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 55/116 (47%), Positives = 73/116 (63%), Gaps = 4/116 (3%)
 Frame = +3

Query  201  DASVMFALKKSLNPPSDMGWS-GQDPC---KWNHVGCSDDRRVIRIQIGHNSLQGTLPPD  368
            D + M A+ K+L     +GW    DPC   +W+ V C    RV  IQ+G   L GTLPP+
Sbjct  45   DVAAMQAVAKALGADKTLGWDVAGDPCSPKRWDGVSCDSSGRVTAIQVGKRGLTGTLPPE  104

Query  369  LSKLTQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFTSIPSDFFVGMSSLQS  536
            +  LT L RLE+  N +SGPLPSL GLSSL++L+  NN F SIP+DFF G++ L +
Sbjct  105  VGDLTALTRLEVFENKLSGPLPSLPGLSSLQILLAHNNSFASIPADFFKGLTGLTA  160



>ref|XP_008795408.1| PREDICTED: probable receptor protein kinase TMK1 [Phoenix dactylifera]
Length=919

 Score = 83.6 bits (205),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 62/147 (42%), Positives = 86/147 (59%), Gaps = 5/147 (3%)
 Frame = +3

Query  102  MRVHLGLKLPALVFLGIFASLFVNAVSQAGQND--DASVMFALKKSLNPPSDMGWSGQ-D  272
            +R H     P+++ + I A L       A Q D  DA+ M  L K+L+P   + WS   D
Sbjct  8    LRRHQHHNHPSVLIVLIAAVLLSAGRLAAAQTDAGDAATMRTLAKALDPSGKLNWSASSD  67

Query  273  PC-KWNHVGCSDDRRVIRIQIGHNSLQGTLPPDLSKLTQLQRLELQWNNIsgplpslngl  449
            PC  W  V C+  R V  + + ++ + G+LPPD+  L+ L RLEL  N +SGPLPSL GL
Sbjct  68   PCTSWGGVRCTSGR-VTGVLVSNSGISGSLPPDVRNLSALTRLELMINKLSGPLPSLAGL  126

Query  450  sslRVLMLSNNHFTSIPSDFFVGMSSL  530
             +L  L L+NN F+SIP DFF G++SL
Sbjct  127  GALTTLFLANNSFSSIPEDFFSGLNSL  153



>gb|KHM99461.1| Putative receptor protein kinase TMK1 [Glycine soja]
Length=904

 Score = 83.6 bits (205),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 48/107 (45%), Positives = 67/107 (63%), Gaps = 2/107 (2%)
 Frame = +3

Query  213  MFALKKSLNPPSDMGWSGQDPCKWNHVGCSDDRRVIRIQIGHNSLQGTLPPDLSKLTQLQ  392
            M  LKK++  P+D+ W+  D CKW HV C+  +RV  IQIG  SL G+LP +L +L++L 
Sbjct  1    MNTLKKAIKEPNDLQWNDPDVCKWEHVQCNTMKRVTAIQIGGQSLNGSLPKELLQLSELT  60

Query  393  RLELQWNNIsgplpslnglsslRVLMLSNNHFTSIPSDFFVGMSSLQ  533
            R E    N +   P  N   SL VL++ NN+F S+  DFF GM++LQ
Sbjct  61   RFECM--NNAFTGPFPNMPKSLEVLLIHNNNFNSMSGDFFNGMTNLQ  105



>ref|XP_008644567.1| PREDICTED: probable receptor protein kinase TMK1 [Zea mays]
 gb|AFW67806.1| putative leucine-rich repeat receptor-like protein kinase family 
protein [Zea mays]
Length=958

 Score = 83.2 bits (204),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 56/116 (48%), Positives = 74/116 (64%), Gaps = 4/116 (3%)
 Frame = +3

Query  201  DASVMFALKKSLNPPSDMGWS-GQDPC---KWNHVGCSDDRRVIRIQIGHNSLQGTLPPD  368
            D + M A+ K+L     +GW    DPC   +W+ V C    RV  IQ+G   L GTLPP+
Sbjct  42   DVAAMRAVAKALGADKTLGWDVAGDPCSPKRWDGVSCDSSGRVTAIQVGARGLTGTLPPE  101

Query  369  LSKLTQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFTSIPSDFFVGMSSLQS  536
            +  LT+L RLE+  N +SGPLPSL GLSSL+VL+  N+ F SIPSDFF G++ L +
Sbjct  102  VGDLTELTRLEVFDNKLSGPLPSLPGLSSLQVLLAHNSSFASIPSDFFKGLTGLTA  157



>ref|XP_006415826.1| hypothetical protein EUTSA_v10009860mg [Eutrema salsugineum]
 gb|ESQ34179.1| hypothetical protein EUTSA_v10009860mg [Eutrema salsugineum]
Length=891

 Score = 82.8 bits (203),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 52/111 (47%), Positives = 70/111 (63%), Gaps = 2/111 (2%)
 Frame = +3

Query  201  DASVMFALKKSLNPPSDMGWSGQDPCKWNHVGCSDDRRVIRIQIGHNSLQGTLPPDLSKL  380
            D  +M  L+ SL   S + WSG DPC W  + C +  RV  IQI +    GTLPPDL KL
Sbjct  24   DMEIMITLRNSLKS-SKLDWSGPDPCHWTGLQC-EGNRVTSIQIRNTGTSGTLPPDLKKL  81

Query  381  TQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFTSIPSDFFVGMSSLQ  533
            + L+  E+  N+++G +PSL GL SLR   + +N FTSI +DFF G+SSL+
Sbjct  82   SSLEVFEVMGNSLTGKIPSLAGLESLRTFNVHDNDFTSIDADFFTGLSSLR  132



>ref|XP_010105561.1| putative receptor protein kinase TMK1 [Morus notabilis]
 gb|EXC05056.1| putative receptor protein kinase TMK1 [Morus notabilis]
Length=958

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 58/136 (43%), Positives = 90/136 (66%), Gaps = 5/136 (4%)
 Frame = +3

Query  135  LVFLGIFASLFVNAVSQAGQNDDASVMFALKKSLNPPSDMGWS-GQDPCKWNHVGCSDDR  311
            +V L IF SLF + V ++  N D   M AL+KS+   + +GW+ G D C W  V C    
Sbjct  19   VVVLSIF-SLFSSPV-KSQSNVDGKAMEALRKSIGQ-NTLGWAAGSDYCNWAKVTCDKSS  75

Query  312  -RVIRIQIGHNSLQGTLPPDLSKLTQLQRLELQWNNIsgplpslnglsslRVLMLSNNHF  488
             RV +IQIG+ +L GTLP +++ L++LQ+ E+  N ++G  P+ +GL+SL+V++  +N+F
Sbjct  76   GRVTKIQIGNQNLAGTLPLEIADLSELQQFEVMTNQLNGAFPNFSGLASLQVVLAHDNNF  135

Query  489  TSIPSDFFVGMSSLQS  536
            TSIPS+ F G+SSL+ 
Sbjct  136  TSIPSNVFDGLSSLEE  151



>emb|CBI39471.3| unnamed protein product [Vitis vinifera]
Length=883

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 53/113 (47%), Positives = 78/113 (69%), Gaps = 1/113 (1%)
 Frame = +3

Query  198  DDASVMFALKKSLNPPSDMGWSGQDPCKWNHVGCSDDRRVIRIQIGHNSLQGTLPPDLSK  377
            D+A+ M  L  +L+P +  GWSG + CKW+ V C    +VI I +   SL G LP D+++
Sbjct  28   DEAAFMTKLAAALSP-TPSGWSGTNHCKWSGVKCDAIGQVISINLASRSLSGMLPSDINQ  86

Query  378  LTQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFTSIPSDFFVGMSSLQS  536
            L QLQ L LQ N +SGPLPSL+ L+SL+ + L NN+F+S+P +F +G++SLQ+
Sbjct  87   LPQLQALSLQKNQLSGPLPSLSNLTSLQSVFLDNNNFSSVPPEFLLGLNSLQT  139



>ref|XP_002268601.2| PREDICTED: probable receptor protein kinase TMK1 [Vitis vinifera]
Length=926

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 53/113 (47%), Positives = 78/113 (69%), Gaps = 1/113 (1%)
 Frame = +3

Query  198  DDASVMFALKKSLNPPSDMGWSGQDPCKWNHVGCSDDRRVIRIQIGHNSLQGTLPPDLSK  377
            D+A+ M  L  +L+P +  GWSG + CKW+ V C    +VI I +   SL G LP D+++
Sbjct  28   DEAAFMTKLAAALSP-TPSGWSGTNHCKWSGVKCDAIGQVISINLASRSLSGMLPSDINQ  86

Query  378  LTQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFTSIPSDFFVGMSSLQS  536
            L QLQ L LQ N +SGPLPSL+ L+SL+ + L NN+F+S+P +F +G++SLQ+
Sbjct  87   LPQLQALSLQKNQLSGPLPSLSNLTSLQSVFLDNNNFSSVPPEFLLGLNSLQT  139



>ref|XP_009404143.1| PREDICTED: probable receptor protein kinase TMK1 [Musa acuminata 
subsp. malaccensis]
Length=957

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 59/114 (52%), Positives = 74/114 (65%), Gaps = 3/114 (3%)
 Frame = +3

Query  201  DASVMFALKKSLNPPSDMGWSGQ-DPC-KWNHVGCSDDRRVIRIQIGHNSLQGTLPPDLS  374
            D + M  L  +L     + WS   DPC  W  V CSD R V  IQ+G+ SL G+LP D+ 
Sbjct  37   DLASMQVLATALGADKALDWSASADPCTAWAGVACSDGR-VTAIQVGNRSLAGSLPADVR  95

Query  375  KLTQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFTSIPSDFFVGMSSLQS  536
             LT L RLELQ N ++GPLPSL GL+SL+VL+   N F+SIP DFF G+SSLQ+
Sbjct  96   NLTSLVRLELQNNRLAGPLPSLAGLASLQVLLFHGNLFSSIPPDFFSGLSSLQA  149


 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 41/81 (51%), Gaps = 3/81 (4%)
 Frame = +3

Query  186  AGQNDD-ASVMFALKKSLNPPSDMG--WSGQDPCKWNHVGCSDDRRVIRIQIGHNSLQGT  356
            AG+ DD  +++ ++ KS   P      W G DPC W  + C  D  +  I     SL GT
Sbjct  331  AGECDDRVTLLLSIAKSFGYPERFAENWKGNDPCGWLGISCDADGNITVINFSRMSLNGT  390

Query  357  LPPDLSKLTQLQRLELQWNNI  419
            + PD S  T LQRL L  NN+
Sbjct  391  ISPDFSAFTSLQRLLLPNNNL  411



>ref|XP_004247046.1| PREDICTED: probable receptor protein kinase TMK1 [Solanum lycopersicum]
Length=941

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 57/122 (47%), Positives = 79/122 (65%), Gaps = 1/122 (1%)
 Frame = +3

Query  168  VNAVSQAGQNDDASVMFALKKSLNPPSDMGWSGQDPCKWNHVGCSDDRRVIRIQIGHNSL  347
            ++ V + G  DDAS+M  L KSL  P+  GWSG + CKW+ V C    RV  I +   SL
Sbjct  30   LSVVVRDGSADDASIMAKLAKSL-IPTPPGWSGSNVCKWSGVSCDSSGRVSSISLISKSL  88

Query  348  QGTLPPDLSKLTQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFTSIPSDFFVGMSS  527
             G LPPDL++L+ LQ   +Q N ISG LPSL+ L SL+   L +N+FTS+P++F  G+++
Sbjct  89   GGQLPPDLNQLSNLQSFNIQKNRISGSLPSLSNLPSLQEAHLDSNNFTSVPTNFLSGLTN  148

Query  528  LQ  533
            LQ
Sbjct  149  LQ  150



>ref|XP_010068984.1| PREDICTED: probable receptor protein kinase TMK1 [Eucalyptus 
grandis]
 gb|KCW57193.1| hypothetical protein EUGRSUZ_H00009 [Eucalyptus grandis]
Length=924

 Score = 80.9 bits (198),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 56/115 (49%), Positives = 74/115 (64%), Gaps = 4/115 (3%)
 Frame = +3

Query  198  DDASVMFALKKSLNP-PSDMGWSGQDP-CKWNHVGCSDDRRVIRIQIGHNSLQGTLPPDL  371
            DD+S M  L+  ++P PS  GWS   P CKW+ V C    RV  I +   SL GTLP DL
Sbjct  36   DDSSAMADLRAGMSPAPS--GWSSSTPYCKWDGVNCDSSSRVTAINLASRSLAGTLPADL  93

Query  372  SKLTQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFTSIPSDFFVGMSSLQS  536
            S L++L+ L LQ N  SGP+PSL  L+SL+ + L  N+FTS+PS  F G++SLQ+
Sbjct  94   SSLSRLKTLSLQKNAFSGPVPSLANLASLQEVYLDVNNFTSVPSGAFAGLTSLQT  148



>gb|KDO47459.1| hypothetical protein CISIN_1g0023461mg, partial [Citrus sinensis]
 gb|KDO47460.1| hypothetical protein CISIN_1g0023461mg, partial [Citrus sinensis]
Length=760

 Score = 80.9 bits (198),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 52/116 (45%), Positives = 72/116 (62%), Gaps = 6/116 (5%)
 Frame = +3

Query  198  DDASVMFALKKSL-NPPSDMGWSGQDP---CKWNHVGCSDDRRVIRIQIGHNSLQGTLPP  365
            DD SVM  L +SL N PSD  WS       C+W  + C +  RV  I +  + L GTL P
Sbjct  27   DDGSVMLKLAQSLQNLPSD--WSSTSSTGYCEWTGINCDNSNRVTTISLAKSGLSGTLSP  84

Query  366  DLSKLTQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFTSIPSDFFVGMSSLQ  533
            ++S LTQL+ L  Q NNI+G +PSL   +SL+ + L NN+FTS+P+  F G+++LQ
Sbjct  85   EISSLTQLETLSFQMNNIAGAIPSLANATSLQDIYLDNNNFTSVPTGCFDGLTNLQ  140



>gb|KFK44514.1| hypothetical protein AALP_AA1G266600 [Arabis alpina]
Length=666

 Score = 80.1 bits (196),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 48/105 (46%), Positives = 67/105 (64%), Gaps = 0/105 (0%)
 Frame = +3

Query  201  DASVMFALKKSLNPPSDMGWSGQDPCKWNHVGCSDDRRVIRIQIGHNSLQGTLPPDLSKL  380
            D + M ALK SL  P   GW+  DPC W    C   +RV+RIQ+G++S+ GTLP D+  L
Sbjct  22   DLATMTALKNSLTLPKGFGWTEADPCLWKGCKCDTSKRVVRIQLGNSSISGTLPSDIQNL  81

Query  381  TQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFTSIPSDFFV  515
            + L   E+  N ++G +PSL+GLSSL+ + + +N FTSI  DFF 
Sbjct  82   SSLTVFEVMNNKLTGKIPSLSGLSSLQRVNVHDNGFTSIDEDFFT  126



>ref|XP_006421039.1| hypothetical protein CICLE_v10004263mg [Citrus clementina]
 gb|ESR34279.1| hypothetical protein CICLE_v10004263mg [Citrus clementina]
Length=933

 Score = 80.5 bits (197),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 52/116 (45%), Positives = 72/116 (62%), Gaps = 6/116 (5%)
 Frame = +3

Query  198  DDASVMFALKKSL-NPPSDMGWSGQDP---CKWNHVGCSDDRRVIRIQIGHNSLQGTLPP  365
            DD SVM  L +SL N PSD  WS       C+W  + C +  RV  I +  + L GTL P
Sbjct  27   DDGSVMLKLAQSLQNLPSD--WSSTSSTGYCRWTGINCDNSNRVTSISLAKSGLSGTLSP  84

Query  366  DLSKLTQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFTSIPSDFFVGMSSLQ  533
            ++S LTQL+ L  Q NNI+G +PSL   +SL+ + L NN+FTS+P+  F G+++LQ
Sbjct  85   EISSLTQLETLSFQINNIAGAIPSLANATSLQDIYLDNNNFTSVPTGCFDGLTNLQ  140



>ref|XP_006492525.1| PREDICTED: probable receptor protein kinase TMK1-like [Citrus 
sinensis]
Length=933

 Score = 80.5 bits (197),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 52/116 (45%), Positives = 72/116 (62%), Gaps = 6/116 (5%)
 Frame = +3

Query  198  DDASVMFALKKSL-NPPSDMGWSGQDP---CKWNHVGCSDDRRVIRIQIGHNSLQGTLPP  365
            DD SVM  L +SL N PSD  WS       C+W  + C +  RV  I +  + L GTL P
Sbjct  27   DDGSVMLKLAQSLQNLPSD--WSSTSSTGYCEWTGINCDNSNRVTTISLAKSGLSGTLSP  84

Query  366  DLSKLTQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFTSIPSDFFVGMSSLQ  533
            ++S LTQL+ L  Q NNI+G +PSL   +SL+ + L NN+FTS+P+  F G+++LQ
Sbjct  85   EISSLTQLETLSFQMNNIAGAIPSLANATSLQDIYLDNNNFTSVPTGCFDGLTNLQ  140



>ref|XP_010907801.1| PREDICTED: probable receptor protein kinase TMK1 isoform X2 [Elaeis 
guineensis]
Length=842

 Score = 79.7 bits (195),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 61/140 (44%), Positives = 85/140 (61%), Gaps = 7/140 (5%)
 Frame = +3

Query  132  ALVFLGIFASLFVNAVSQAGQND--DASVMFALKKSLNPPSDMGW--SGQDPC--KWNHV  293
            A + L I +++  +  +  G+ D  D +++   +K L+ P  + W   G+DPC  KW HV
Sbjct  3    AWISLFIVSAILCSYSAVLGETDENDLAMLDEFRKGLDNPELLRWPADGKDPCGEKWKHV  62

Query  294  GCSDDRRVIRIQIGHNSLQGTLPPDLSKLTQLQRLELQWNNIsgplpslnglsslRVLML  473
             C D  RV +IQ+    L G+LP D +KL  L  L LQ NN SGPLPS +GLS+L+   L
Sbjct  63   FC-DGSRVNQIQVAEVGLSGSLPQDFNKLEMLNNLGLQRNNFSGPLPSFSGLSNLQYAYL  121

Query  474  SNNHFTSIPSDFFVGMSSLQ  533
              N F SIPSDFFVG+++LQ
Sbjct  122  GGNRFDSIPSDFFVGLTNLQ  141



>ref|XP_010932521.1| PREDICTED: LOW QUALITY PROTEIN: probable receptor protein kinase 
TMK1 [Elaeis guineensis]
Length=937

 Score = 79.7 bits (195),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 55/106 (52%), Positives = 70/106 (66%), Gaps = 3/106 (3%)
 Frame = +3

Query  219  ALKKSLNPPSDMGWS-GQDPCK-WNHVGCSDDRRVIRIQIGHNSLQGTLPPDLSKLTQLQ  392
             L +SL+P   +GWS   DPC  W+ V CS DR V+ I + +  L G LPPD   LT L 
Sbjct  49   TLARSLDPAGKLGWSDSSDPCTAWDGVRCSGDR-VVAILVSNRDLSGVLPPDFRNLTALT  107

Query  393  RLELQWNNIsgplpslnglsslRVLMLSNNHFTSIPSDFFVGMSSL  530
            RLEL  N++SGPLPSL GL++L  L L+NN+F+S P DFF G+ SL
Sbjct  108  RLELMSNHLSGPLPSLTGLATLETLFLANNNFSSFPGDFFSGLFSL  153



>ref|XP_010907800.1| PREDICTED: probable receptor protein kinase TMK1 isoform X1 [Elaeis 
guineensis]
Length=946

 Score = 79.7 bits (195),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 61/140 (44%), Positives = 85/140 (61%), Gaps = 7/140 (5%)
 Frame = +3

Query  132  ALVFLGIFASLFVNAVSQAGQND--DASVMFALKKSLNPPSDMGW--SGQDPC--KWNHV  293
            A + L I +++  +  +  G+ D  D +++   +K L+ P  + W   G+DPC  KW HV
Sbjct  3    AWISLFIVSAILCSYSAVLGETDENDLAMLDEFRKGLDNPELLRWPADGKDPCGEKWKHV  62

Query  294  GCSDDRRVIRIQIGHNSLQGTLPPDLSKLTQLQRLELQWNNIsgplpslnglsslRVLML  473
             C D  RV +IQ+    L G+LP D +KL  L  L LQ NN SGPLPS +GLS+L+   L
Sbjct  63   FC-DGSRVNQIQVAEVGLSGSLPQDFNKLEMLNNLGLQRNNFSGPLPSFSGLSNLQYAYL  121

Query  474  SNNHFTSIPSDFFVGMSSLQ  533
              N F SIPSDFFVG+++LQ
Sbjct  122  GGNRFDSIPSDFFVGLTNLQ  141



>ref|XP_009408287.1| PREDICTED: probable receptor protein kinase TMK1 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=789

 Score = 79.7 bits (195),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 60/138 (43%), Positives = 81/138 (59%), Gaps = 6/138 (4%)
 Frame = +3

Query  135  LVFLGIFASLFVNAVSQAGQNDDASVMFALKKSLNPPSDMGW--SGQDPCK---WNHVGC  299
            +VFL +F   F + V       D +V+   +K L  P  + W  + +DPC    W HV C
Sbjct  9    IVFLSVFLCCFGSVVFGTTDAGDYAVLDEFRKGLANPELLKWPTNNRDPCGPPLWPHVFC  68

Query  300  SDDRRVIRIQIGHNSLQGTLPPDLSKLTQLQRLELQWNNIsgplpslnglsslRVLMLSN  479
            S  R V +IQ+ +  L G LP D +KL+ L  + LQ NN SG LPS +GLS+L+   L N
Sbjct  69   SGSR-VAQIQVQNLGLSGPLPRDFNKLSMLTNIGLQRNNFSGKLPSFSGLSNLQYAYLGN  127

Query  480  NHFTSIPSDFFVGMSSLQ  533
            N F +IPSDFFVG++SLQ
Sbjct  128  NQFDAIPSDFFVGLTSLQ  145



>ref|XP_006576140.1| PREDICTED: protein kinase isoform X1 [Glycine max]
Length=945

 Score = 79.7 bits (195),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 53/119 (45%), Positives = 74/119 (62%), Gaps = 2/119 (2%)
 Frame = +3

Query  183  QAGQNDDASVMFALKKSLNPPSDMGW--SGQDPCKWNHVGCSDDRRVIRIQIGHNSLQGT  356
             AG  +DA ++  L+  L+ P  + W   G DPC W ++ C  ++RV +IQ    +L G 
Sbjct  18   NAGDPNDAKILRQLRNGLDNPEQLPWPDEGDDPCGWKYIFCDSNKRVNQIQPKGLNLSGP  77

Query  357  LPPDLSKLTQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFTSIPSDFFVGMSSLQ  533
            LP +L++LT L  L LQ N ++GPLPS  GLS L+   L NN+F SIPSDFF G+ SL+
Sbjct  78   LPQNLNQLTMLFNLGLQNNRLNGPLPSFRGLSKLKYAYLDNNNFDSIPSDFFDGLQSLE  136



>ref|XP_010939998.1| PREDICTED: probable receptor protein kinase TMK1 [Elaeis guineensis]
Length=955

 Score = 79.7 bits (195),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 58/114 (51%), Positives = 71/114 (62%), Gaps = 3/114 (3%)
 Frame = +3

Query  201  DASVMFALKKSLNPPSDMGWSG-QDPCKWNHVGCSDDRRVIRIQIGHNSLQGTLPPDLSK  377
            DA+ M AL K L     + W+G  DPC W  V C+   RV  IQIG+ SL G+LP ++  
Sbjct  36   DAAAMRALAKGLGADRALDWTGPADPCTWTGVTCTY-ARVTAIQIGNRSLVGSLPVEVRN  94

Query  378  LTQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFTSI-PSDFFVGMSSLQS  536
            LT L RLEL  N + G LPSL GLSSLR L+L  N F+   P +FF G+SSLQS
Sbjct  95   LTALLRLELHNNQLFGTLPSLAGLSSLRALLLHGNRFSGAPPPEFFAGLSSLQS  148



>ref|XP_009408286.1| PREDICTED: probable receptor protein kinase TMK1 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=954

 Score = 79.3 bits (194),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 60/138 (43%), Positives = 81/138 (59%), Gaps = 6/138 (4%)
 Frame = +3

Query  135  LVFLGIFASLFVNAVSQAGQNDDASVMFALKKSLNPPSDMGW--SGQDPCK---WNHVGC  299
            +VFL +F   F + V       D +V+   +K L  P  + W  + +DPC    W HV C
Sbjct  9    IVFLSVFLCCFGSVVFGTTDAGDYAVLDEFRKGLANPELLKWPTNNRDPCGPPLWPHVFC  68

Query  300  SDDRRVIRIQIGHNSLQGTLPPDLSKLTQLQRLELQWNNIsgplpslnglsslRVLMLSN  479
            S  R V +IQ+ +  L G LP D +KL+ L  + LQ NN SG LPS +GLS+L+   L N
Sbjct  69   SGSR-VAQIQVQNLGLSGPLPRDFNKLSMLTNIGLQRNNFSGKLPSFSGLSNLQYAYLGN  127

Query  480  NHFTSIPSDFFVGMSSLQ  533
            N F +IPSDFFVG++SLQ
Sbjct  128  NQFDAIPSDFFVGLTSLQ  145



>ref|NP_001238095.1| protein kinase precursor [Glycine max]
 gb|ACJ37417.1| protein kinase [Glycine max]
Length=1012

 Score = 79.7 bits (195),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 53/119 (45%), Positives = 74/119 (62%), Gaps = 2/119 (2%)
 Frame = +3

Query  183  QAGQNDDASVMFALKKSLNPPSDMGW--SGQDPCKWNHVGCSDDRRVIRIQIGHNSLQGT  356
             AG  +DA ++  L+  L+ P  + W   G DPC W ++ C  ++RV +IQ    +L G 
Sbjct  18   NAGDPNDAKILRQLRNGLDNPEQLPWPDEGDDPCGWKYIFCDSNKRVNQIQPKGLNLSGP  77

Query  357  LPPDLSKLTQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFTSIPSDFFVGMSSLQ  533
            LP +L++LT L  L LQ N ++GPLPS  GLS L+   L NN+F SIPSDFF G+ SL+
Sbjct  78   LPQNLNQLTMLFNLGLQNNRLNGPLPSFRGLSKLKYAYLDNNNFDSIPSDFFDGLQSLE  136



>gb|EPS70426.1| hypothetical protein M569_04331 [Genlisea aurea]
Length=1687

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 61/143 (43%), Positives = 84/143 (59%), Gaps = 10/143 (7%)
 Frame = +3

Query  126  LPALVFLGIFASLFVNAVSQAGQNDDASVMFALKKSLNPPSDMGW----SGQDPC---KW  284
            + A+VFL +F    V  V  A   DD +++   K+ L     + W    S  DPC    W
Sbjct  2    MEAVVFLAVFTHAVV--VQSATDPDDLAILNQFKQGLENADLLQWPNNGSSIDPCGSPSW  59

Query  285  NHVGCSDDRRVIRIQIGHNSLQGTLPPDLSKLTQLQRLELQWNNIsgplpslnglsslRV  464
             HV CS DR V +IQ+    L+GTLP +L+KL+ L+ L LQ N  +G LPS +GLS LR 
Sbjct  60   PHVYCSGDR-VTQIQVRGLGLKGTLPRNLNKLSMLENLGLQQNQFNGSLPSFSGLSLLRF  118

Query  465  LMLSNNHFTSIPSDFFVGMSSLQ  533
              L +N+F +IPSDFF G+SS++
Sbjct  119  AYLDSNNFDTIPSDFFSGLSSVE  141



>gb|ACM89521.1| receptor-like protein kinase-like protein [Glycine max]
Length=897

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 53/119 (45%), Positives = 74/119 (62%), Gaps = 2/119 (2%)
 Frame = +3

Query  183  QAGQNDDASVMFALKKSLNPPSDMGW--SGQDPCKWNHVGCSDDRRVIRIQIGHNSLQGT  356
             AG  +DA ++  L+  L+ P  + W   G DPC W ++ C  ++RV +IQ    +L G 
Sbjct  18   NAGDPNDAKILRQLRNGLDNPEQLPWPDEGDDPCGWKYIFCDSNKRVNQIQPKGLNLSGP  77

Query  357  LPPDLSKLTQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFTSIPSDFFVGMSSLQ  533
            LP +L++LT L  L LQ N ++GPLPS  GLS L+   L NN+F SIPSDFF G+ SL+
Sbjct  78   LPQNLNQLTMLFNLGLQNNRLNGPLPSFRGLSKLKYAYLDNNNFDSIPSDFFDGLQSLE  136



>emb|CDY36252.1| BnaC07g21060D [Brassica napus]
Length=316

 Score = 77.0 bits (188),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 47/115 (41%), Positives = 68/115 (59%), Gaps = 0/115 (0%)
 Frame = +3

Query  186  AGQNDDASVMFALKKSLNPPSDMGWSGQDPCKWNHVGCSDDRRVIRIQIGHNSLQGTLPP  365
            A   DDA++M + K  LN  SD+ WS  DPCKW+ V C +  R+ RI +    + GTLP 
Sbjct  19   AASQDDATIMQSFKSYLNLTSDVHWSDPDPCKWDGVICGESNRITRILLRDKDIAGTLPQ  78

Query  366  DLSKLTQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFTSIPSDFFVGMSSL  530
            DL KL++L  ++LQ N   GP+P L+GL  LR+  + +N  T +    F G+ +L
Sbjct  79   DLGKLSELVEVDLQVNGFFGPIPDLSGLQYLRLFNVEHNLLTGVVPPSFTGLKTL  133



>ref|XP_008798481.1| PREDICTED: probable receptor protein kinase TMK1 [Phoenix dactylifera]
Length=956

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 58/110 (53%), Positives = 72/110 (65%), Gaps = 3/110 (3%)
 Frame = +3

Query  213  MFALKKSLNPPSDMGWSG-QDPCKWNHVGCSDDRRVIRIQIGHNSLQGTLPPDLSKLTQL  389
            M AL K L     +GW+G  DPC W  V C++ R V  IQ+G+ SL G LPP++  LT L
Sbjct  37   MRALAKGLLADRALGWTGPADPCTWTGVTCTEGR-VTAIQVGNRSLAGKLPPEVRNLTSL  95

Query  390  QRLELQWNNIsgplpslnglsslRVLMLSNNHFTSI-PSDFFVGMSSLQS  536
             RLE+  N +SGPLPSL GLSSL+ L+L  N F+   P DFF G+SSLQS
Sbjct  96   LRLEVYENQLSGPLPSLAGLSSLQALLLHGNSFSGAPPKDFFSGLSSLQS  145



>ref|XP_008795571.1| PREDICTED: probable receptor protein kinase TMK1 [Phoenix dactylifera]
Length=942

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 63/148 (43%), Positives = 83/148 (56%), Gaps = 11/148 (7%)
 Frame = +3

Query  102  MRVHLGLKLPALVFLGIFASLFVNAVSQAGQNDDASVMFALKKSLNPPSDMGW--SGQDP  275
            MR  +GL    LV   I  S   +AV    + +D +++   +K L+ P  + W   G DP
Sbjct  1    MRAWIGL----LVVSAILCS--NSAVFGETEENDLTILEEFRKGLDNPELLQWPAGGGDP  54

Query  276  C--KWNHVGCSDDRRVIRIQIGHNSLQGTLPPDLSKLTQLQRLELQWNNIsgplpslngl  449
            C  +W HV C D R V +IQ+    L G+LP D +KL  L  L LQ NN SG LPS +GL
Sbjct  55   CGERWKHVFCVDSR-VTQIQVAELGLSGSLPKDFNKLEMLNNLGLQRNNFSGELPSFSGL  113

Query  450  sslRVLMLSNNHFTSIPSDFFVGMSSLQ  533
            S+L+   L  N F +IPSDFFVG+  LQ
Sbjct  114  SNLQYAYLGGNRFDTIPSDFFVGLHDLQ  141



>ref|XP_010650399.1| PREDICTED: probable receptor protein kinase TMK1 [Vitis vinifera]
Length=927

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 60/144 (42%), Positives = 87/144 (60%), Gaps = 12/144 (8%)
 Frame = +3

Query  120  LKLPALVFLGIFASLFVNAVSQAGQNDDASVMFALKKSLN-PPSDMGWSGQDPCKWNHVG  296
            L + +LV L +  SL  +A++     DDA+VM  L+K L+  PS  GW+G D C W  + 
Sbjct  5    LNMASLVSLCLLFSLLTSALA-----DDAAVMDNLRKGLSSTPS--GWTGSDFCSWEGIN  57

Query  297  CSD----DRRVIRIQIGHNSLQGTLPPDLSKLTQLQRLELQWNNIsgplpslnglsslRV  464
            C +    + RV  I +    L GTLP DL++L+QL  L  Q N++SG LPSL  L  L+ 
Sbjct  58   CGNTGDSNGRVTAINMASKGLSGTLPSDLNQLSQLVTLSFQSNSLSGSLPSLANLQFLQD  117

Query  465  LMLSNNHFTSIPSDFFVGMSSLQS  536
            + L++N+FTSI  DFF  ++SLQ+
Sbjct  118  IYLNSNNFTSIDKDFFTNLTSLQT  141



>emb|CDY03105.1| BnaC07g21220D [Brassica napus]
Length=521

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 49/115 (43%), Positives = 69/115 (60%), Gaps = 0/115 (0%)
 Frame = +3

Query  186  AGQNDDASVMFALKKSLNPPSDMGWSGQDPCKWNHVGCSDDRRVIRIQIGHNSLQGTLPP  365
            A   DDA++M + K  LN  SD+ WS  DPCKW+ V C +  R+ RI +    + GTLP 
Sbjct  19   AASQDDATIMQSFKSYLNLTSDVHWSDPDPCKWDGVICGESNRITRILLREKWIAGTLPQ  78

Query  366  DLSKLTQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFTSIPSDFFVGMSSL  530
            DL KL+ L  ++LQ N+ SGP+P L+GL  LR+  + +N  T +    F G+ SL
Sbjct  79   DLGKLSDLVEVDLQDNDFSGPIPDLSGLQYLRLFNVEHNMLTGVVPPSFTGLKSL  133



>ref|XP_004491185.1| PREDICTED: somatic embryogenesis receptor kinase 1-like [Cicer 
arietinum]
Length=218

 Score = 74.7 bits (182),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 41/102 (40%), Positives = 57/102 (56%), Gaps = 4/102 (4%)
 Frame = +3

Query  126  LPALVFLGIFASLFVNAVSQAGQNDDASVMFALKKSLNPPSDM--GWSGQ--DPCKWNHV  293
            L +L   GIF +L +  V  A  N +   ++ LK+SL  P ++   W      PC W HV
Sbjct  5    LTSLSLFGIFLTLTLTLVHFAHANSEGDALYTLKRSLTDPDNVLQSWDPTLVSPCTWFHV  64

Query  294  GCSDDRRVIRIQIGHNSLQGTLPPDLSKLTQLQRLELQWNNI  419
             C+ D RV R+ +G+++L G L P+L KL  LQ LEL  NNI
Sbjct  65   TCNQDNRVTRVDLGNSNLSGHLVPELGKLEHLQYLELYKNNI  106



>ref|XP_011046412.1| PREDICTED: probable receptor protein kinase TMK1 [Populus euphratica]
 ref|XP_011046413.1| PREDICTED: probable receptor protein kinase TMK1 [Populus euphratica]
Length=942

 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 59/128 (46%), Positives = 77/128 (60%), Gaps = 6/128 (5%)
 Frame = +3

Query  165  FVNAVSQAGQNDDASVMFALKKSLNPPSDMGWSGQ---DPC--KWNHVGCSDDRRVIRIQ  329
             V  V  A   +D +++ A K+ L  P  + W      DPC   W HV CS  R V +IQ
Sbjct  15   LVTVVFSATDPNDYAIIKAFKEGLENPERLEWPADGDDDPCGLSWKHVFCSGSR-VTQIQ  73

Query  330  IGHNSLQGTLPPDLSKLTQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFTSIPSDF  509
            + + SL+GTLP +L++LT+LQRL LQ N  +G LPSL GLS L+ + L  N F SIPSD 
Sbjct  74   VQNMSLKGTLPQNLNQLTKLQRLGLQKNQFTGALPSLRGLSELQSVYLDFNQFDSIPSDC  133

Query  510  FVGMSSLQ  533
            F G+ SLQ
Sbjct  134  FDGLVSLQ  141



>emb|CDX98478.1| BnaC05g38970D [Brassica napus]
Length=351

 Score = 75.9 bits (185),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 48/112 (43%), Positives = 68/112 (61%), Gaps = 2/112 (2%)
 Frame = +3

Query  201  DASVMFALKKSLNPPSDMGWSGQDPCKWNHVGC-SDDRRVIRIQIGHNSLQGTLPPDLSK  377
            D + MFAL+ SL     + WS  +PC W  +GC +   RV RIQI +  + GTL  D+  
Sbjct  25   DTATMFALRDSLKS-EHLNWSDPNPCVWTGLGCDTGSYRVSRIQIVNRGISGTLTCDIRN  83

Query  378  LTQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFTSIPSDFFVGMSSLQ  533
            L+ L   ++  NN++  +PSL GL  L  +++ NN FTSI +DFF G+SSLQ
Sbjct  84   LSALTDFDVMGNNLTVKIPSLAGLKFLERVLVKNNGFTSIDADFFTGLSSLQ  135



>gb|ABD96566.1| Rhg4-like receptor kinase II [Glycine max]
Length=921

 Score = 77.8 bits (190),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 59/141 (42%), Positives = 83/141 (59%), Gaps = 7/141 (5%)
 Frame = +3

Query  120  LKLP-ALVFLGIFASLFVNAVSQAGQNDDASVMFALKKSLNPPSDMGWSGQDP-CKWNHV  293
            + LP  L+ L +  ++ + AV+     DDA+VM     SL PP   GWS   P C+W  +
Sbjct  1    MSLPKTLLSLSLLFAIAITAVT----GDDAAVMSNFLISLTPPPS-GWSQTTPFCQWKGI  55

Query  294  GCSDDRRVIRIQIGHNSLQGTLPPDLSKLTQLQRLELQWNNIsgplpslnglsslRVLML  473
             C   R V  I +   SL GTLP DL+ L+QL+ L LQ N++SG LPSL+ LS L+   L
Sbjct  56   QCDSSRHVTSISLASQSLTGTLPSDLNSLSQLRTLSLQDNSLSGTLPSLSNLSFLQTAYL  115

Query  474  SNNHFTSIPSDFFVGMSSLQS  536
            + N+FTS+P   F  ++SLQ+
Sbjct  116  NRNNFTSVPPSAFSSLTSLQT  136



>gb|KEH40666.1| receptor kinase TMK1-like protein [Medicago truncatula]
Length=933

 Score = 77.8 bits (190),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 53/128 (41%), Positives = 77/128 (60%), Gaps = 9/128 (7%)
 Frame = +3

Query  150  IFASLFVNAVSQAGQNDDASVMFALKKSL-NPPSDMGWSGQDPCKWNHVGCSDDRRVIRI  326
            +F+ +FV+A SQ    DDA+ M  LK S+ +  S++ WS  D CKW  V C+ +R V  I
Sbjct  14   LFSMIFVSAWSQ----DDAA-MQKLKTSIKSSSSNLDWSNSDYCKWEKVTCNGNR-VTAI  67

Query  327  QIGHNSLQGTLPPDLSKLTQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFTSIPSD  506
            QI   ++QG+LP +L +LT+L R E   N++           SL+ L + NN+F S+PSD
Sbjct  68   QIADTNIQGSLPKELMQLTELTRFECNGNSL--SGDFPYMPISLQHLSIGNNNFASMPSD  125

Query  507  FFVGMSSL  530
            FF  MS+L
Sbjct  126  FFANMSNL  133



>ref|XP_010906324.1| PREDICTED: probable receptor protein kinase TMK1 [Elaeis guineensis]
Length=889

 Score = 77.4 bits (189),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 52/108 (48%), Positives = 70/108 (65%), Gaps = 3/108 (3%)
 Frame = +3

Query  213  MFALKKSLNPPSDMGWSGQ-DPC-KWNHVGCSDDRRVIRIQIGHNSLQGTLPPDLSKLTQ  386
            M  L K+L+P   + WS   DPC  W+ V CS  R V  + + H  + G+LPPD+  L+ 
Sbjct  1    MRTLAKALDPSGKLNWSASTDPCTSWDGVRCSGGR-VTDVLVSHRGISGSLPPDIRNLSA  59

Query  387  LQRLELQWNNIsgplpslnglsslRVLMLSNNHFTSIPSDFFVGMSSL  530
            L RLE+  NN+SGPLPSL GL +L  + L+NN F+SIP DFF G++SL
Sbjct  60   LVRLEVMINNLSGPLPSLAGLGALTTVFLANNSFSSIPDDFFSGLNSL  107



>ref|XP_008380457.1| PREDICTED: probable receptor protein kinase TMK1 [Malus domestica]
Length=924

 Score = 77.0 bits (188),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 53/113 (47%), Positives = 69/113 (61%), Gaps = 2/113 (2%)
 Frame = +3

Query  198  DDASVMFALKKSLNPPSDMGWSGQDP-CKWNHVGCSDDRRVIRIQIGHNSLQGTLPPDLS  374
            DD+ VM  L  SLNP +  GWS     C W+ V C   +RV  I +    L G+LP +L+
Sbjct  28   DDSDVMSKLTASLNP-APKGWSTSTAYCSWDGVNCDTSKRVTSINLASKGLSGSLPSNLN  86

Query  375  KLTQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFTSIPSDFFVGMSSLQ  533
             L+QL  L LQ N++SG  PSL  LSSL+ + L  N+FTSIP+  F G+SSLQ
Sbjct  87   SLSQLTTLSLQSNSLSGAFPSLANLSSLQEVYLDTNNFTSIPAGCFTGLSSLQ  139



>ref|XP_006448113.1| hypothetical protein CICLE_v10017498mg [Citrus clementina]
 gb|ESR61353.1| hypothetical protein CICLE_v10017498mg [Citrus clementina]
Length=305

 Score = 74.7 bits (182),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 50/125 (40%), Positives = 76/125 (61%), Gaps = 5/125 (4%)
 Frame = +3

Query  132  ALVFLGIFASLFVNAVSQAGQNDDASVMFALKKSLNPPSDMGWSGQDPCKWNHVGCSDDR  311
            +LVF+     L ++   Q     DA+VM  LK SL  P  + WS  D C+W+HV CSD+ 
Sbjct  9    SLVFV-----LSISVSVQTQSRPDAAVMQDLKASLVIPKHLKWSDPDACQWSHVICSDNG  63

Query  312  RVIRIQIGHNSLQGTLPPDLSKLTQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFT  491
            ++  I++   +L+GTLPP L KL+ L  + L+ N + GP+PSL GL  L+V++  N+ F+
Sbjct  64   QLTNIELQDQNLKGTLPPSLEKLSSLAVMHLENNQLMGPIPSLVGLRYLQVVIFDNDSFS  123

Query  492  SIPSD  506
             +P D
Sbjct  124  YMPPD  128



>ref|XP_008809243.1| PREDICTED: probable receptor protein kinase TMK1 [Phoenix dactylifera]
Length=942

 Score = 77.0 bits (188),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 54/127 (43%), Positives = 77/127 (61%), Gaps = 5/127 (4%)
 Frame = +3

Query  165  FVNAVSQAGQNDDASVMFALKKSLNPPSDMGW--SGQDPC--KWNHVGCSDDRRVIRIQI  332
            F++AV      +D +++   +K L+ P  + W     DPC  KW HV C+   RV +IQ+
Sbjct  17   FISAVLGDTDQNDMAILDEFRKGLDNPELLQWPAGSTDPCGEKWKHVFCAG-SRVAQIQV  75

Query  333  GHNSLQGTLPPDLSKLTQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFTSIPSDFF  512
             +  L G+LP DL+KL  L  + LQ NN SG LP+ +GLS+L+   LS N F +IPSDFF
Sbjct  76   ANLGLSGSLPQDLNKLQMLSNVGLQRNNFSGKLPTFSGLSNLQYAYLSGNQFDTIPSDFF  135

Query  513  VGMSSLQ  533
             G++ LQ
Sbjct  136  FGLTELQ  142



>gb|KHG14431.1| putative receptor protein kinase TMK1 [Gossypium arboreum]
Length=979

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 58/136 (43%), Positives = 81/136 (60%), Gaps = 7/136 (5%)
 Frame = +3

Query  141  FLGIFASLFVNAVSQAGQNDDASVMFALKKSLNPPSDMGW--SGQDPC---KWNHVGCSD  305
            +LG+F  LF   V  A   +D  ++   KK L  P  + W  +G DPC    W HV CS 
Sbjct  22   YLGVFLGLFT-VVYGATDPNDLKILNDFKKGLENPELLKWPEAGDDPCGPPPWPHVFCSG  80

Query  306  DRRVIRIQIGHNSLQGTLPPDLSKLTQLQRLELQWNNIsgplpslnglsslRVLMLSNNH  485
            DR V +IQ+ +  L+G LP +L++L +L  L LQ N+ +G LPS +GLS L    L NN 
Sbjct  81   DR-VTQIQVQNLGLKGPLPQNLNQLPKLFNLGLQKNHFNGKLPSFSGLSELEFAYLDNNE  139

Query  486  FTSIPSDFFVGMSSLQ  533
            F +IP+DFF G+SS++
Sbjct  140  FDTIPADFFDGLSSVR  155



>gb|KJB12519.1| hypothetical protein B456_002G022400 [Gossypium raimondii]
Length=193

 Score = 72.8 bits (177),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 47/124 (38%), Positives = 69/124 (56%), Gaps = 6/124 (5%)
 Frame = +3

Query  150  IFASLFVNAVSQAGQNDDASVMFALKKSLNPPSDM--GWSGQ--DPCKWNHVGCSDDRRV  317
            +F ++F N ++    N +   ++AL++S+  P ++   W     DPC W HV C  D RV
Sbjct  11   VFVAVFFNTLAPTVANVEGDALYALRRSVKDPKNVLKSWDPTLVDPCTWFHVTCDADNRV  70

Query  318  IRIQIGHNSLQGTLPPDLSKLTQLQRLELQWNNIsgplpslnglsslRV-LMLSNNHFT-  491
             R+ +G+  L+G L P L KL +LQ LEL  NN+ G +P   G     V L L NN+ T 
Sbjct  71   TRLDLGNAKLKGRLVPQLGKLERLQYLELYMNNLEGSIPEEIGGLKSLVSLDLYNNNLTG  130

Query  492  SIPS  503
            SIP+
Sbjct  131  SIPA  134



>ref|XP_004981977.1| PREDICTED: probable receptor protein kinase TMK1-like [Setaria 
italica]
Length=963

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 53/116 (46%), Positives = 71/116 (61%), Gaps = 4/116 (3%)
 Frame = +3

Query  201  DASVMFALKKSLNPPSDMGWS-GQDPCK---WNHVGCSDDRRVIRIQIGHNSLQGTLPPD  368
            D   M A+ K+L     +GW    DPC    W+ V C    RV  IQ+G   L GTL P+
Sbjct  44   DVEAMRAVAKALGADKTLGWDIAGDPCSPKPWDRVSCDSSGRVTAIQVGGRGLTGTLAPE  103

Query  369  LSKLTQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFTSIPSDFFVGMSSLQS  536
            +  LT L RLE+  N ++GPLPSL GLSSL+VL+  + +FTSIP+DFF G++ L +
Sbjct  104  VRNLTALTRLEVFGNFLAGPLPSLAGLSSLQVLLARDCNFTSIPADFFKGLTELAA  159



>gb|KJB12518.1| hypothetical protein B456_002G022400 [Gossypium raimondii]
Length=217

 Score = 72.8 bits (177),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 47/124 (38%), Positives = 69/124 (56%), Gaps = 6/124 (5%)
 Frame = +3

Query  150  IFASLFVNAVSQAGQNDDASVMFALKKSLNPPSDM--GWSGQ--DPCKWNHVGCSDDRRV  317
            +F ++F N ++    N +   ++AL++S+  P ++   W     DPC W HV C  D RV
Sbjct  11   VFVAVFFNTLAPTVANVEGDALYALRRSVKDPKNVLKSWDPTLVDPCTWFHVTCDADNRV  70

Query  318  IRIQIGHNSLQGTLPPDLSKLTQLQRLELQWNNIsgplpslnglsslRV-LMLSNNHFT-  491
             R+ +G+  L+G L P L KL +LQ LEL  NN+ G +P   G     V L L NN+ T 
Sbjct  71   TRLDLGNAKLKGRLVPQLGKLERLQYLELYMNNLEGSIPEEIGGLKSLVSLDLYNNNLTG  130

Query  492  SIPS  503
            SIP+
Sbjct  131  SIPA  134



>ref|XP_004504378.1| PREDICTED: probable receptor protein kinase TMK1-like [Cicer 
arietinum]
Length=912

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 55/126 (44%), Positives = 76/126 (60%), Gaps = 2/126 (2%)
 Frame = +3

Query  159  SLFVNAVSQAGQNDDASVMFALKKSLNPPSDMGWSGQDP-CKWNHVGCSDDRRVIRIQIG  335
            S+ + A +     DDA+V   L +SL P +  GWS + P C+W  + C    RV  I + 
Sbjct  10   SIIITAATITVVADDAAVTTNLLESLKP-TPSGWSSKTPFCQWQGITCDSSNRVTTIDLH  68

Query  336  HNSLQGTLPPDLSKLTQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFTSIPSDFFV  515
              SL GTLP +L+ L+QL  L LQ N +SG LPSL+ LS L+   L +N+FTS+PS  F 
Sbjct  69   SKSLTGTLPSNLNSLSQLTILNLQNNALSGTLPSLSNLSYLQSAFLGSNNFTSVPSAAFS  128

Query  516  GMSSLQ  533
            G++SLQ
Sbjct  129  GLTSLQ  134



>ref|NP_001236021.1| Rhg4-like receptor kinase II precursor [Glycine max]
 gb|ABD96568.1| Rhg4-like receptor kinase II [Glycine max]
Length=921

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 59/141 (42%), Positives = 82/141 (58%), Gaps = 7/141 (5%)
 Frame = +3

Query  120  LKLP-ALVFLGIFASLFVNAVSQAGQNDDASVMFALKKSLNPPSDMGWSGQDP-CKWNHV  293
            + LP  L+ L +  ++ + AV+     DDA+VM     SL PP   GWS   P C+W  +
Sbjct  1    MSLPKTLLSLSLLFAIAITAVT----GDDAAVMSNFLISLTPPPS-GWSQTTPFCQWKGI  55

Query  294  GCSDDRRVIRIQIGHNSLQGTLPPDLSKLTQLQRLELQWNNIsgplpslnglsslRVLML  473
             C   R V  I +   SL GTLP DL+ L+QL+ L LQ N++SG LPSL+ LS L+   L
Sbjct  56   QCDSSRHVTSISLASQSLTGTLPSDLNSLSQLRTLSLQDNSLSGTLPSLSNLSFLQTAYL  115

Query  474  SNNHFTSIPSDFFVGMSSLQS  536
            + N+FTS+P   F   +SLQ+
Sbjct  116  NRNNFTSVPPSAFSSPTSLQT  136



>gb|EPS70217.1| hypothetical protein M569_04541, partial [Genlisea aurea]
Length=873

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 47/108 (44%), Positives = 69/108 (64%), Gaps = 1/108 (1%)
 Frame = +3

Query  213  MFALKKSLNPPSDMGWSGQDPCKWNHVGCSDDRRVIRIQIGHNSLQGTLPPDLSKLTQLQ  392
            M  L KS++P +  GW+G D CKW+ V C   +RV  I +   SL G +PP++++L+ L+
Sbjct  1    MNLLSKSISP-TPPGWTGSDFCKWSGVSCDSSKRVTSINLSSKSLSGKIPPEIAQLSNLK  59

Query  393  RLELQWNNIsgplpslnglsslRVLMLSNNHFTSIPSDFFVGMSSLQS  536
             L LQ N  SGPLP  +G +S+  + LS+N F SIP  F  G+++LQS
Sbjct  60   TLSLQRNRFSGPLPPFSGHTSIEQINLSDNAFDSIPQHFLSGLTALQS  107



>ref|XP_009604417.1| PREDICTED: probable receptor protein kinase TMK1 [Nicotiana tomentosiformis]
Length=927

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 53/117 (45%), Positives = 73/117 (62%), Gaps = 5/117 (4%)
 Frame = +3

Query  195  NDDASVMFALKKSLNP-PSDMGWSGQDP-CKWNHVGCSDDR-RVIRIQIGHNSLQGTLPP  365
            +DDA+VM  L  +L+P PS  GWS   P C W  V C      V+ I I   SL G+LP 
Sbjct  29   SDDAAVMSKLLAALSPAPS--GWSSDKPFCSWTDVSCDKSSGTVVSINIDSQSLSGSLPS  86

Query  366  DLSKLTQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFTSIPSDFFVGMSSLQS  536
            DL++L+ L+ L +Q N++SGPLPS   ++ L  + L NN FTS+P DF +G+ SLQ+
Sbjct  87   DLNQLSNLKTLSVQKNSLSGPLPSFANMTKLAEIYLDNNQFTSVPQDFLLGLPSLQT  143



>ref|XP_010910643.1| PREDICTED: LOW QUALITY PROTEIN: probable receptor protein kinase 
TMK1 [Elaeis guineensis]
Length=958

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 57/137 (42%), Positives = 79/137 (58%), Gaps = 7/137 (5%)
 Frame = +3

Query  135  LVFLGIFASLFVNAVSQAGQNDDASVMFALKKSLNPPSDMGWSGQ--DPC--KWNHVGCS  302
            L+F  I    F +AV      +D +++   +K L+ P  + W     DPC  KW HV C 
Sbjct  25   LLFCAILC--FNSAVLGDTDPNDMAILDEFRKGLDNPELLKWPANSTDPCGEKWEHVFC-  81

Query  303  DDRRVIRIQIGHNSLQGTLPPDLSKLTQLQRLELQWNNIsgplpslnglsslRVLMLSNN  482
            D  RV +IQ+ +  L G+LP DL+KL  L  +  Q NN  G LPS +GLS+L+    S N
Sbjct  82   DGSRVSQIQVANLGLSGSLPQDLNKLEMLSNVGFQRNNFVGKLPSFSGLSNLQYAYFSGN  141

Query  483  HFTSIPSDFFVGMSSLQ  533
             F +IPSDFFVG+++LQ
Sbjct  142  QFDTIPSDFFVGLTNLQ  158



>ref|XP_006361096.1| PREDICTED: probable receptor protein kinase TMK1-like [Solanum 
tuberosum]
Length=978

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 59/135 (44%), Positives = 77/135 (57%), Gaps = 9/135 (7%)
 Frame = +3

Query  144  LGIFASLFVNAVSQAGQNDDASVMFALKKSLNPPSDMGW--SGQDPC---KWNHVGCSDD  308
            LG+F    VN VS     +D  ++   +  L  P  + W   G DPC    W HV CS D
Sbjct  19   LGVF---LVNVVSGVTNLNDFKILSDFRNGLENPELLKWPSKGNDPCGPPAWPHVFCSSD  75

Query  309  RRVIRIQIGHNSLQGTLPPDLSKLTQLQRLELQWNNIsgplpslnglsslRVLMLSNNHF  488
            R V +IQ+    L+G LP +L++L +LQ L LQ N  SG LP+ NGLS L+   L NN F
Sbjct  76   R-VTQIQVQSLGLKGPLPQNLNQLDKLQNLGLQGNGFSGKLPTFNGLSDLKYAYLDNNEF  134

Query  489  TSIPSDFFVGMSSLQ  533
             +IP DFF G+SS+Q
Sbjct  135  DTIPGDFFNGLSSVQ  149



>emb|CDP06852.1| unnamed protein product [Coffea canephora]
Length=918

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 58/138 (42%), Positives = 79/138 (57%), Gaps = 7/138 (5%)
 Frame = +3

Query  138  VFLGI-FASLFVNAVSQAGQNDDASVMFALKKSLNPPSDMGW--SGQDPC---KWNHVGC  299
            +FL I   +LF NAV      DD  ++   +  L+    + W   G DPC    W HV C
Sbjct  15   IFLAIILPTLFFNAVLGTTNQDDFKILDDFRNGLDNADLLKWPAKGNDPCGPPAWPHVFC  74

Query  300  SDDRRVIRIQIGHNSLQGTLPPDLSKLTQLQRLELQWNNIsgplpslnglsslRVLMLSN  479
            S  R V +IQ+ +  L GTLP +L++L +LQ + LQ NN  G LPS +GLS L+   L N
Sbjct  75   SGGR-VTQIQVQNMGLSGTLPQNLNQLAKLQNVGLQKNNFKGKLPSFSGLSDLQFAYLDN  133

Query  480  NHFTSIPSDFFVGMSSLQ  533
            N F +IPSDFF G+ S++
Sbjct  134  NKFDTIPSDFFHGLGSVR  151



>ref|XP_011042599.1| PREDICTED: probable receptor protein kinase TMK1 [Populus euphratica]
 ref|XP_011042600.1| PREDICTED: probable receptor protein kinase TMK1 [Populus euphratica]
Length=952

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 57/127 (45%), Positives = 78/127 (61%), Gaps = 5/127 (4%)
 Frame = +3

Query  165  FVNAVSQAGQNDDASVMFALKKSLNPPSDMGW--SGQDPC--KWNHVGCSDDRRVIRIQI  332
             V  V     ++D +++ A ++ L  P  + W   G DPC   W HV CS  R V +IQ+
Sbjct  15   LVTVVFSVTDSNDFAILKAFREGLENPGLLEWPADGDDPCGQSWKHVFCSGSR-VTQIQV  73

Query  333  GHNSLQGTLPPDLSKLTQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFTSIPSDFF  512
             + SL+GTLP +L+KL++LQRL LQ N  +G LPSL GLS L+ + L  N F SIPS+ F
Sbjct  74   QNMSLKGTLPQNLNKLSKLQRLGLQRNQFTGALPSLGGLSELQYVYLDFNQFDSIPSNCF  133

Query  513  VGMSSLQ  533
             G+ SLQ
Sbjct  134  DGLVSLQ  140



>ref|XP_009767007.1| PREDICTED: probable receptor protein kinase TMK1 [Nicotiana sylvestris]
Length=964

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 57/138 (41%), Positives = 79/138 (57%), Gaps = 6/138 (4%)
 Frame = +3

Query  135  LVFLGIFASLFVNAVSQAGQNDDASVMFALKKSLNPPSDMGW--SGQDPC---KWNHVGC  299
            +V+L  FA + VN V      +D  ++   +  L  P  + W   G DPC    W HV C
Sbjct  12   VVYLCTFAVILVNVVFCVTNPNDFKILNDFRNGLKNPELLQWPSKGNDPCGPPAWPHVFC  71

Query  300  SDDRRVIRIQIGHNSLQGTLPPDLSKLTQLQRLELQWNNIsgplpslnglsslRVLMLSN  479
            S DR V +IQ+    L+G LP +L++L +LQ L LQ N  SG LP+ +GLS L+   L  
Sbjct  72   SSDR-VTQIQVQSLGLKGPLPQNLNELDKLQNLGLQKNGFSGKLPTFSGLSELKYAYLDW  130

Query  480  NHFTSIPSDFFVGMSSLQ  533
            N F +IP+DFF G+SS+Q
Sbjct  131  NQFDTIPADFFNGLSSVQ  148



>gb|KHN21189.1| Putative receptor protein kinase TMK1-like protein [Glycine soja]
Length=968

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 55/143 (38%), Positives = 86/143 (60%), Gaps = 9/143 (6%)
 Frame = +3

Query  120  LKLPALVFLGIFASLFVNAVSQAGQNDDASVMFALKKSLNPPSDMGW--SGQDPC---KW  284
            +K+   VFL +  ++    V+     +D  ++   +K L  P  + W  +G DPC    W
Sbjct  5    MKVSIFVFLTLMITMGCYGVTNP---NDLRILNDFRKGLKNPKLLKWPDNGNDPCGPPSW  61

Query  285  NHVGCSDDRRVIRIQIGHNSLQGTLPPDLSKLTQLQRLELQWNNIsgplpslnglsslRV  464
            ++V CS  R V +IQ  +  L+G+LPP+ ++L++LQ L LQ NN+SG LP+ +GLS L+ 
Sbjct  62   SYVYCSGGR-VTQIQTKNLGLEGSLPPNFNQLSELQNLGLQRNNLSGRLPTFSGLSKLQY  120

Query  465  LMLSNNHFTSIPSDFFVGMSSLQ  533
              L  N F SIPSDFF G++S++
Sbjct  121  AFLDYNEFDSIPSDFFNGLNSIK  143



>gb|KJB09134.1| hypothetical protein B456_001G125200 [Gossypium raimondii]
 gb|KJB09135.1| hypothetical protein B456_001G125200 [Gossypium raimondii]
Length=979

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 58/136 (43%), Positives = 79/136 (58%), Gaps = 7/136 (5%)
 Frame = +3

Query  141  FLGIFASLFVNAVSQAGQNDDASVMFALKKSLNPPSDMGW--SGQDPC---KWNHVGCSD  305
            +LG+F  LF   V  A   +D  ++   KK L  P  + W  +G DPC    W HV CS 
Sbjct  22   YLGVFLGLFT-VVYGATDPNDLKILNDFKKGLENPELLKWPEAGDDPCGPPPWPHVFCSG  80

Query  306  DRRVIRIQIGHNSLQGTLPPDLSKLTQLQRLELQWNNIsgplpslnglsslRVLMLSNNH  485
            DR V +IQ+ +  L+G LP  L+ L +L  L LQ N+ +G LPS +GLS L    L NN 
Sbjct  81   DR-VTQIQVQNLGLKGPLPQTLNHLPKLFNLGLQKNHFNGKLPSFSGLSELEFAYLDNNE  139

Query  486  FTSIPSDFFVGMSSLQ  533
            F +IP+DFF G+SS++
Sbjct  140  FDTIPADFFDGLSSVR  155



>ref|XP_002980529.1| hypothetical protein SELMODRAFT_233539 [Selaginella moellendorffii]
 gb|EFJ18180.1| hypothetical protein SELMODRAFT_233539 [Selaginella moellendorffii]
Length=935

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 49/124 (40%), Positives = 74/124 (60%), Gaps = 5/124 (4%)
 Frame = +3

Query  177  VSQAGQND--DASVMFALKKSLNPPSDMGWSGQDPC--KWNHVGCSDDRRVIRIQIGHNS  344
            VS A + D  DA  + + +K L+    + WSG DPC   W HV C   + V  I +    
Sbjct  17   VSAAAETDPVDAEALQSFQKGLSNGEILQWSGTDPCGAAWKHVQCRG-KSVTGIDVAFLG  75

Query  345  LQGTLPPDLSKLTQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFTSIPSDFFVGMS  524
            LQG + P L++L+ L+ L +Q N +SG +PSL G+++L++    NN F+SIP DFF G+ 
Sbjct  76   LQGIVSPSLNRLSNLEYLGMQGNALSGSMPSLAGMANLKIAYFDNNDFSSIPGDFFAGLE  135

Query  525  SLQS  536
            SL++
Sbjct  136  SLEA  139



>ref|XP_009625585.1| PREDICTED: probable receptor protein kinase TMK1 [Nicotiana tomentosiformis]
Length=963

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 56/138 (41%), Positives = 79/138 (57%), Gaps = 6/138 (4%)
 Frame = +3

Query  135  LVFLGIFASLFVNAVSQAGQNDDASVMFALKKSLNPPSDMGW--SGQDPC---KWNHVGC  299
            +V+L  FA + VN V      +D  ++   +  L  P  + W   G DPC    W HV C
Sbjct  11   VVYLCTFAVILVNVVFCVTNPNDFKILNDFRNGLENPELLKWPSKGNDPCGPPAWPHVFC  70

Query  300  SDDRRVIRIQIGHNSLQGTLPPDLSKLTQLQRLELQWNNIsgplpslnglsslRVLMLSN  479
            S DR V +IQ+    L+G LP +L++L +LQ L LQ N  +G LP+ +GLS L+   L  
Sbjct  71   SSDR-VTQIQVQSLGLKGPLPQNLNELDKLQNLGLQKNGFNGKLPTFSGLSELKYGYLDW  129

Query  480  NHFTSIPSDFFVGMSSLQ  533
            N F +IP+DFF G+SS+Q
Sbjct  130  NQFDTIPADFFNGLSSVQ  147



>emb|CAA69028.1| TMK [Oryza sativa Indica Group]
Length=962

 Score = 74.7 bits (182),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 50/99 (51%), Positives = 64/99 (65%), Gaps = 4/99 (4%)
 Frame = +3

Query  252  MGWSGQDPCK----WNHVGCSDDRRVIRIQIGHNSLQGTLPPDLSKLTQLQRLELQWNNI  419
            +GWS  DPC     W  V C    RV  +Q+G+ SL G L P++  LT L RLEL  N+I
Sbjct  57   LGWSTGDPCSSPRAWAGVTCDSAGRVTAVQVGNRSLTGRLAPEVRNLTALARLELFDNSI  116

Query  420  sgplpslnglsslRVLMLSNNHFTSIPSDFFVGMSSLQS  536
            SG LPSL GLSSL+ L++ NN FT IP DFF G+++L +
Sbjct  117  SGELPSLAGLSSLQYLLVHNNGFTRIPPDFFKGLTALAA  155



>gb|ABF98558.1| Protein kinase domain containing protein, expressed [Oryza sativa 
Japonica Group]
Length=962

 Score = 74.7 bits (182),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 50/99 (51%), Positives = 64/99 (65%), Gaps = 4/99 (4%)
 Frame = +3

Query  252  MGWSGQDPCK----WNHVGCSDDRRVIRIQIGHNSLQGTLPPDLSKLTQLQRLELQWNNI  419
            +GWS  DPC     W  V C    RV  +Q+G+ SL G L P++  LT L RLEL  N+I
Sbjct  57   LGWSTGDPCSSPRAWAGVTCDSAGRVTAVQVGNRSLTGRLAPEVRNLTALARLELFDNSI  116

Query  420  sgplpslnglsslRVLMLSNNHFTSIPSDFFVGMSSLQS  536
            SG LPSL GLSSL+ L++ NN FT IP DFF G+++L +
Sbjct  117  SGELPSLAGLSSLQYLLVHNNGFTRIPPDFFKGLTALAA  155



>ref|XP_010673234.1| PREDICTED: BRASSINOSTEROID INSENSITIVE 1-associated receptor 
kinase 1-like [Beta vulgaris subsp. vulgaris]
Length=218

 Score = 71.6 bits (174),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 41/106 (39%), Positives = 58/106 (55%), Gaps = 5/106 (5%)
 Frame = +3

Query  114  LGLKLPALVFLGIFASLFVNAVSQAGQNDDASVMFALKKSLNPPSDM--GWSGQ--DPCK  281
            +G K  +L  L I+  L ++ V     N +   +FAL+KSL  P ++   W      PC 
Sbjct  2    VGFKASSLCLL-IWVCLSMDLVKWVSGNSEGDALFALRKSLKDPDNVLESWDPNLVSPCT  60

Query  282  WNHVGCSDDRRVIRIQIGHNSLQGTLPPDLSKLTQLQRLELQWNNI  419
            W H+ C+ D  V R+ +G+++L G L PDL KL  LQ LEL  NNI
Sbjct  61   WFHITCNSDNHVTRVDLGNSNLSGHLVPDLGKLEHLQYLELYKNNI  106



>ref|XP_009380072.1| PREDICTED: probable receptor protein kinase TMK1 [Musa acuminata 
subsp. malaccensis]
Length=964

 Score = 74.7 bits (182),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 75/114 (66%), Gaps = 3/114 (3%)
 Frame = +3

Query  201  DASVMFALKKSLNPPSDMGWS-GQDPC-KWNHVGCSDDRRVIRIQIGHNSLQGTLPPDLS  374
            D + M A+  +L     + WS   DPC  W  V CS  R V  IQ+G+ +L G+LP D+ 
Sbjct  43   DLAAMLAVANALGADRALDWSPSADPCSDWAGVACSGGR-VTTIQVGNRNLAGSLPADVR  101

Query  375  KLTQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFTSIPSDFFVGMSSLQS  536
             LT L RLELQ N +SGPLPSL GLSSL+ L+L +N F+SIP DFF G+SSLQS
Sbjct  102  NLTSLSRLELQNNRLSGPLPSLAGLSSLQSLLLHHNLFSSIPPDFFSGLSSLQS  155


 Score = 49.3 bits (116),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 41/84 (49%), Gaps = 3/84 (4%)
 Frame = +3

Query  177  VSQAGQNDD-ASVMFALKKSLNPPSDMG--WSGQDPCKWNHVGCSDDRRVIRIQIGHNSL  347
            ++ AG+ D   +++ ++ KS   PS     W G +PC W  + C     +  I      L
Sbjct  334  LNTAGECDHRVTILLSIAKSFRYPSGFAENWKGNNPCGWLGISCDAGGNITVINFSRMDL  393

Query  348  QGTLPPDLSKLTQLQRLELQWNNI  419
             GT+ PD S  T LQR+ L  NN+
Sbjct  394  NGTISPDFSLFTTLQRMMLSNNNL  417



>emb|CDY17632.1| BnaA06g34510D [Brassica napus]
Length=315

 Score = 72.4 bits (176),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 44/115 (38%), Positives = 67/115 (58%), Gaps = 0/115 (0%)
 Frame = +3

Query  186  AGQNDDASVMFALKKSLNPPSDMGWSGQDPCKWNHVGCSDDRRVIRIQIGHNSLQGTLPP  365
            A   DDA++M ++K  LN  SD+ WS  DPCKW+ + C +  R+IRI +    + GT P 
Sbjct  19   AASQDDATIMQSIKSYLNLTSDVHWSDPDPCKWDGIICGESNRIIRILLTGKDIVGTFPQ  78

Query  366  DLSKLTQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFTSIPSDFFVGMSSL  530
            DL KL+ L  ++L  N  +G +P L+GL +L +  + +N  T +    F G+ SL
Sbjct  79   DLGKLSDLVMVDLHGNGFTGLIPDLSGLQNLVLFNVEHNKLTGVVPPSFTGLKSL  133



>ref|XP_010543834.1| PREDICTED: probable receptor protein kinase TMK1 [Tarenaya hassleriana]
 ref|XP_010543835.1| PREDICTED: probable receptor protein kinase TMK1 [Tarenaya hassleriana]
Length=962

 Score = 74.7 bits (182),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 60/150 (40%), Positives = 82/150 (55%), Gaps = 10/150 (7%)
 Frame = +3

Query  102  MRVHLGLKLPALVFLGIFASLFVNAVSQAGQNDDASVMFALKKSLNPPSDMGW--SGQDP  275
            M+ HL  KL  L  +   AS+  +A       +D  ++   +K L  P  + W  +G DP
Sbjct  1    MKTHLKTKLFVLPLVCCIASVVFSATDP----NDLDILNEFRKGLQNPELLQWPENGDDP  56

Query  276  C---KWNHVGCSDDRRVIRIQIGHNSLQGTLPPDLSKLTQLQRLELQWNNIsgplpslng  446
            C    W HV C ++ RV +IQ+    L+G LP +L+KLT+L  + LQ N  SG LPS  G
Sbjct  57   CGPPSWKHVFC-ENTRVTQIQVQGLGLKGPLPQNLNKLTELINVGLQRNQFSGKLPSFRG  115

Query  447  lsslRVLMLSNNHFTSIPSDFFVGMSSLQS  536
            L  L+   L  N F SIP DFF G+SSLQ+
Sbjct  116  LGKLQFAYLDYNAFDSIPGDFFDGLSSLQA  145



>gb|KCW85997.1| hypothetical protein EUGRSUZ_B02701 [Eucalyptus grandis]
Length=281

 Score = 72.0 bits (175),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 46/75 (61%), Positives = 57/75 (76%), Gaps = 0/75 (0%)
 Frame = +3

Query  312  RVIRIQIGHNSLQGTLPPDLSKLTQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFT  491
            RV+RIQIG   + GTLPPD+SKLT L R E+  +  SGPLPS  GL+ L+VL L+ N+FT
Sbjct  6    RVVRIQIGMRGVSGTLPPDISKLTALTRFEVMDSQFSGPLPSFAGLAQLQVLFLNRNNFT  65

Query  492  SIPSDFFVGMSSLQS  536
             IP+DFF GMSSLQ+
Sbjct  66   FIPADFFTGMSSLQA  80



>ref|XP_009101657.1| PREDICTED: probable receptor protein kinase TMK1 [Brassica rapa]
Length=315

 Score = 72.4 bits (176),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 44/115 (38%), Positives = 67/115 (58%), Gaps = 0/115 (0%)
 Frame = +3

Query  186  AGQNDDASVMFALKKSLNPPSDMGWSGQDPCKWNHVGCSDDRRVIRIQIGHNSLQGTLPP  365
            A   DDA++M ++K  LN  SD+ WS  DPCKW+ + C +  R+IRI +    + GT P 
Sbjct  19   AASQDDATIMQSIKSYLNLTSDVHWSDPDPCKWDGIICGESNRIIRILLTGKDIVGTFPQ  78

Query  366  DLSKLTQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFTSIPSDFFVGMSSL  530
            DL KL+ L  ++L  N  +G +P L+GL +L +  + +N  T +    F G+ SL
Sbjct  79   DLGKLSDLVMVDLHGNGFTGLIPDLSGLQNLVLFNVEHNKLTGVVPPSFTGLKSL  133



>ref|XP_002322788.2| hypothetical protein POPTR_0016s07120g [Populus trichocarpa]
 gb|EEF04549.2| hypothetical protein POPTR_0016s07120g [Populus trichocarpa]
Length=930

 Score = 74.3 bits (181),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 57/127 (45%), Positives = 77/127 (61%), Gaps = 5/127 (4%)
 Frame = +3

Query  165  FVNAVSQAGQNDDASVMFALKKSLNPPSDMGW--SGQDPC--KWNHVGCSDDRRVIRIQI  332
             V  V     ++D +++ A ++ L  P  + W   G DPC   W HV CS   RV +IQ+
Sbjct  15   LVTVVFSVTDSNDFAILKAFREGLENPGLLEWPADGDDPCGQSWKHVFCSG-SRVTQIQV  73

Query  333  GHNSLQGTLPPDLSKLTQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFTSIPSDFF  512
             + SL+GTLP +L+KLT+LQRL LQ N  +G LPSL GLS L+ + L  N F SIPS+ F
Sbjct  74   QNMSLKGTLPQNLNKLTKLQRLGLQRNQFTGALPSLGGLSELQYVYLDFNQFDSIPSNCF  133

Query  513  VGMSSLQ  533
              + SLQ
Sbjct  134  DDLVSLQ  140



>gb|KDP36118.1| hypothetical protein JCGZ_08762 [Jatropha curcas]
Length=967

 Score = 74.3 bits (181),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 59/137 (43%), Positives = 83/137 (61%), Gaps = 5/137 (4%)
 Frame = +3

Query  135  LVFLGIFASLFVNAVSQAGQNDDASVMFALKKSLNPPSDMGW--SGQDPC--KWNHVGCS  302
            LVF  +    +V+ VS     +D +++ A +  L  P+ + W  +G DPC   W HV CS
Sbjct  16   LVFFALQLLCYVSLVSSDTDPNDLAILKAFRDGLENPALLEWPANGDDPCGQSWKHVYCS  75

Query  303  DDRRVIRIQIGHNSLQGTLPPDLSKLTQLQRLELQWNNIsgplpslnglsslRVLMLSNN  482
              R V +IQ+ + SL+G LP +L++L  L+ L LQ N  +GPLPS NGLS+L+   L  N
Sbjct  76   GSR-VSQIQVQNMSLKGPLPQNLNQLIMLENLGLQRNQFTGPLPSFNGLSNLKYAYLDYN  134

Query  483  HFTSIPSDFFVGMSSLQ  533
             F SIPSDFF G+ +LQ
Sbjct  135  QFDSIPSDFFDGLVNLQ  151



>gb|EYU40639.1| hypothetical protein MIMGU_mgv1a027041mg [Erythranthe guttata]
Length=874

 Score = 74.3 bits (181),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 47/108 (44%), Positives = 67/108 (62%), Gaps = 1/108 (1%)
 Frame = +3

Query  213  MFALKKSLNPPSDMGWSGQDPCKWNHVGCSDDRRVIRIQIGHNSLQGTLPPDLSKLTQLQ  392
            M AL KS+ PP    W+G   CKW  V C    +V  I +   SL GT+PP++++L+ L+
Sbjct  1    MAALAKSITPPPPT-WTGAAFCKWQGVSCDPAGKVTSINLSSKSLSGTIPPEINQLSALR  59

Query  393  RLELQWNNIsgplpslnglsslRVLMLSNNHFTSIPSDFFVGMSSLQS  536
             L LQ N+ SGPLP L+ + +L  + L  N F SIP++F  G++SLQS
Sbjct  60   SLSLQRNHFSGPLPPLSNMPTLEQVYLDENAFDSIPANFLSGLTSLQS  107



>ref|XP_006592356.1| PREDICTED: probable receptor protein kinase TMK1-like [Glycine 
max]
Length=968

 Score = 74.3 bits (181),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 55/143 (38%), Positives = 85/143 (59%), Gaps = 9/143 (6%)
 Frame = +3

Query  120  LKLPALVFLGIFASLFVNAVSQAGQNDDASVMFALKKSLNPPSDMGW--SGQDPC---KW  284
            +K+   VFL +  ++    V+     +D  ++   +K L  P  + W  +G DPC    W
Sbjct  5    MKVSIFVFLTLMITMGCYGVTNP---NDLRILNDFRKGLKNPELLKWPDNGNDPCGPPSW  61

Query  285  NHVGCSDDRRVIRIQIGHNSLQGTLPPDLSKLTQLQRLELQWNNIsgplpslnglsslRV  464
            ++V CS  R V +IQ  +  L+G+LPP+ ++L +LQ L LQ NN+SG LP+ +GLS L+ 
Sbjct  62   SYVYCSGGR-VTQIQTKNLGLEGSLPPNFNQLYELQNLGLQRNNLSGRLPTFSGLSKLQY  120

Query  465  LMLSNNHFTSIPSDFFVGMSSLQ  533
              L  N F SIPSDFF G++S++
Sbjct  121  AFLDYNEFDSIPSDFFNGLNSIK  143



>ref|XP_002976801.1| hypothetical protein SELMODRAFT_268021 [Selaginella moellendorffii]
 gb|EFJ21911.1| hypothetical protein SELMODRAFT_268021 [Selaginella moellendorffii]
Length=945

 Score = 73.9 bits (180),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 49/124 (40%), Positives = 73/124 (59%), Gaps = 5/124 (4%)
 Frame = +3

Query  177  VSQAGQND--DASVMFALKKSLNPPSDMGWSGQDPC--KWNHVGCSDDRRVIRIQIGHNS  344
            VS A + D  DA  + + +K L+    + WSG DPC   W HV C   + V  I +    
Sbjct  17   VSAAAETDPVDAEALQSFQKGLSNGEILQWSGTDPCGAAWKHVQCRG-KSVTGIDVAFLG  75

Query  345  LQGTLPPDLSKLTQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFTSIPSDFFVGMS  524
            LQG + P L++L+ L+ L +Q N +SG +PSL G+++L++    NN F+SIP DFF G+ 
Sbjct  76   LQGIVSPSLNRLSNLEYLGMQGNALSGSMPSLAGMANLKIAYFDNNDFSSIPGDFFAGLE  135

Query  525  SLQS  536
            SL +
Sbjct  136  SLAA  139



>ref|XP_004241337.1| PREDICTED: probable receptor protein kinase TMK1 [Solanum lycopersicum]
Length=976

 Score = 73.9 bits (180),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 54/138 (39%), Positives = 76/138 (55%), Gaps = 6/138 (4%)
 Frame = +3

Query  135  LVFLGIFASLFVNAVSQAGQNDDASVMFALKKSLNPPSDMGW--SGQDPC---KWNHVGC  299
            +++L       VN V      +D  ++   +  L  P  + W   G DPC    W HV C
Sbjct  15   VIYLCTLGVFLVNVVFGVTNLNDFKILSDFRNGLENPELLKWPSKGNDPCGPPAWPHVFC  74

Query  300  SDDRRVIRIQIGHNSLQGTLPPDLSKLTQLQRLELQWNNIsgplpslnglsslRVLMLSN  479
            S DR V +IQ+    L+GTLP + ++L +LQ L LQ N  SG LP+ +GLS L+   L N
Sbjct  75   SSDR-VTQIQVQSLGLKGTLPHNFNQLDKLQNLGLQGNGFSGKLPTFSGLSDLKYAYLDN  133

Query  480  NHFTSIPSDFFVGMSSLQ  533
            N F +IP+DFF G+S +Q
Sbjct  134  NQFDTIPADFFDGLSGVQ  151



>ref|XP_011101591.1| PREDICTED: probable receptor protein kinase TMK1 [Sesamum indicum]
Length=931

 Score = 73.9 bits (180),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 48/114 (42%), Positives = 74/114 (65%), Gaps = 3/114 (3%)
 Frame = +3

Query  198  DDASVMFALKKSLNPPSDMGWSGQDP-CKWNHVGC-SDDRRVIRIQIGHNSLQGTLPPDL  371
            DD++VM     SL+P +  GWS   P C W +V C S    V  I +   S+ G+LPP+L
Sbjct  32   DDSAVMLKFLSSLSP-APSGWSSSTPFCNWTNVNCDSTSTYVTAINLNSASVSGSLPPEL  90

Query  372  SKLTQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFTSIPSDFFVGMSSLQ  533
            ++L+QL+ L +Q N++SG LPS   ++SL  + L NN FTS+P++F +G+++LQ
Sbjct  91   NQLSQLKSLAVQKNSLSGTLPSFENMTSLEQIYLDNNGFTSVPNNFLLGLTNLQ  144



>ref|XP_004293117.1| PREDICTED: probable receptor protein kinase TMK1 [Fragaria vesca 
subsp. vesca]
Length=969

 Score = 73.9 bits (180),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 53/119 (45%), Positives = 72/119 (61%), Gaps = 5/119 (4%)
 Frame = +3

Query  186  AGQNDDASVMFALKKSLNPPSDMGW--SGQDPC--KWNHVGCSDDRRVIRIQIGHNSLQG  353
            A   DD  ++   +K L  P  + W  +G DPC  KW HV CS DR V +IQ+    L+G
Sbjct  22   ATNPDDMKILNDFRKGLENPELLEWPENGDDPCGSKWPHVFCSGDR-VSQIQVQGMGLKG  80

Query  354  TLPPDLSKLTQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFTSIPSDFFVGMSSL  530
             LP + ++L+QL  L LQ N  +G LP+ +GLS L+   L +N F +IPSDFF G+SSL
Sbjct  81   PLPQNFNQLSQLSNLGLQRNKFNGKLPTFSGLSELKYAYLGDNDFDTIPSDFFNGLSSL  139



>ref|NP_001131017.1| uncharacterized LOC100192365 precursor [Zea mays]
 ref|XP_008661349.1| PREDICTED: uncharacterized LOC100192365 isoform X1 [Zea mays]
 gb|ACG27980.1| receptor protein kinase TMK1 precursor [Zea mays]
 gb|ACL53091.1| unknown [Zea mays]
 gb|AFW59978.1| putative leucine-rich repeat protein kinase [Zea mays]
Length=958

 Score = 73.9 bits (180),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 47/111 (42%), Positives = 65/111 (59%), Gaps = 1/111 (1%)
 Frame = +3

Query  201  DASVMFALKKSLNPPSDMGWSGQ-DPCKWNHVGCSDDRRVIRIQIGHNSLQGTLPPDLSK  377
            D + +  L+KSL  P  +GW    D C W HV C    RV  + + +  L GTLPP L  
Sbjct  30   DQAALEDLRKSLTNPDALGWPDDGDACAWPHVSCDRTGRVDNLDLKNAGLAGTLPPSLPS  89

Query  378  LTQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFTSIPSDFFVGMSSL  530
            L  L+ L LQ N++SG LPS  G++SL+   L++N F +IP DFF G++ L
Sbjct  90   LAALRDLSLQGNSLSGALPSFRGMASLQRAFLNDNDFDAIPPDFFDGLADL  140



>ref|XP_007203232.1| hypothetical protein PRUPE_ppa000956mg [Prunus persica]
 gb|EMJ04431.1| hypothetical protein PRUPE_ppa000956mg [Prunus persica]
Length=951

 Score = 73.6 bits (179),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 54/120 (45%), Positives = 77/120 (64%), Gaps = 5/120 (4%)
 Frame = +3

Query  186  AGQNDDASVMFALKKSLNPPSDMGW--SGQDPC--KWNHVGCSDDRRVIRIQIGHNSLQG  353
            A   +D +++   +K++  P  + W  +G+DPC  KW HV C DD RV +IQ+ +  L+G
Sbjct  24   ATDPNDLAILNQFRKNMENPELLKWPENGEDPCGDKWEHVFC-DDERVSQIQVQNLGLKG  82

Query  354  TLPPDLSKLTQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFTSIPSDFFVGMSSLQ  533
             LP +L++LT+L  + LQ N  SGPLPSL GLS LR   L  N F+SIP DFF G+ +L+
Sbjct  83   PLPQNLNQLTELTNIGLQRNKFSGPLPSLKGLSQLRYAYLDFNDFSSIPVDFFDGLDALE  142



>ref|XP_009399943.1| PREDICTED: somatic embryogenesis receptor kinase 1-like [Musa 
acuminata subsp. malaccensis]
Length=218

 Score = 70.5 bits (171),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 34/96 (35%), Positives = 57/96 (59%), Gaps = 4/96 (4%)
 Frame = +3

Query  144  LGIFASLFVNAVSQAGQNDDASVMFALKKSLNPPSDM--GWSGQ--DPCKWNHVGCSDDR  311
            + +FA + + +++    N +   ++AL+KSL+ P ++   W     +PC W H+ C+ D 
Sbjct  12   VSVFAVVALLSLTLVSSNSEGDALYALRKSLSDPGNVLESWDPTLVNPCTWFHITCNQDN  71

Query  312  RVIRIQIGHNSLQGTLPPDLSKLTQLQRLELQWNNI  419
            RV R+ +G++ L G L PD+ +L  LQ LEL  NNI
Sbjct  72   RVTRVDLGNSKLSGHLVPDIGRLEHLQYLELYKNNI  107



>gb|KHG10644.1| Somatic embryogenesis receptor kinase 1 -like protein [Gossypium 
arboreum]
Length=217

 Score = 70.5 bits (171),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 54/94 (57%), Gaps = 4/94 (4%)
 Frame = +3

Query  150  IFASLFVNAVSQAGQNDDASVMFALKKSLNPPSDM--GWSGQ--DPCKWNHVGCSDDRRV  317
            +F ++  N ++    N +   ++AL++S+  P ++   W     DPC W HV C  D RV
Sbjct  11   VFVAVSFNTLAPTVANVEGDALYALRRSVKDPKNVLKSWDPTLVDPCTWFHVTCDADNRV  70

Query  318  IRIQIGHNSLQGTLPPDLSKLTQLQRLELQWNNI  419
             R+ +G+  L+G L P+L KL +LQ LEL  NN+
Sbjct  71   TRLDLGNAKLKGRLVPELGKLERLQYLELYMNNL  104



>ref|XP_009373574.1| PREDICTED: probable receptor protein kinase TMK1 [Pyrus x bretschneideri]
Length=924

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 51/113 (45%), Positives = 68/113 (60%), Gaps = 2/113 (2%)
 Frame = +3

Query  198  DDASVMFALKKSLNPPSDMGWSGQDP-CKWNHVGCSDDRRVIRIQIGHNSLQGTLPPDLS  374
            DD+ VM  L   L P +  GWS     C W+ V C   +RV  I +    L G+LP +L+
Sbjct  28   DDSDVMSKLAAGLRP-APKGWSTSTAYCSWDGVNCDTSKRVTSINLASKGLSGSLPSNLN  86

Query  375  KLTQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFTSIPSDFFVGMSSLQ  533
             L+QL  L LQ N++SG  PSL  LSSL+ + L  N+FTSIP+  F+G+SSLQ
Sbjct  87   SLSQLTTLSLQSNSLSGAFPSLANLSSLQEVYLDTNNFTSIPAGCFMGLSSLQ  139



>gb|KDO70607.1| hypothetical protein CISIN_1g002150mg [Citrus sinensis]
 gb|KDO70608.1| hypothetical protein CISIN_1g002150mg [Citrus sinensis]
Length=959

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 59/155 (38%), Positives = 86/155 (55%), Gaps = 14/155 (9%)
 Frame = +3

Query  81   KSNLFTEMRVHLGLKLPALVFLGIFASLFVNAVSQAGQNDDASVMFALKKSLNPPSDMGW  260
            KS   + MR HL   + A+V        FV  V  A    D  ++   +K+L  P  + W
Sbjct  9    KSERSSAMRTHL---VSAIVLA------FVTLVLSATDPGDIDILNQFRKNLENPELLQW  59

Query  261  -SGQDPCK---WNHVGCSDDRRVIRIQIGHNSLQGTLPPDLSKLTQLQRLELQWNNIsgp  428
                DPC    W HV CS+ R V +IQ+    L+GTLP +L++L++L+ + LQ N   G 
Sbjct  60   PKSGDPCGPPCWKHVFCSNSR-VTQIQVSSVGLKGTLPQNLNQLSKLENIGLQKNQFRGE  118

Query  429  lpslnglsslRVLMLSNNHFTSIPSDFFVGMSSLQ  533
            LPS +GLS+L+   L  N+F +IP+DFF G+ +LQ
Sbjct  119  LPSFSGLSNLKYAYLDGNNFDTIPADFFDGLENLQ  153



>ref|XP_006481595.1| PREDICTED: probable receptor protein kinase TMK1-like [Citrus 
sinensis]
Length=959

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 59/155 (38%), Positives = 86/155 (55%), Gaps = 14/155 (9%)
 Frame = +3

Query  81   KSNLFTEMRVHLGLKLPALVFLGIFASLFVNAVSQAGQNDDASVMFALKKSLNPPSDMGW  260
            KS   + MR HL   + A+V        FV  V  A    D  ++   +K+L  P  + W
Sbjct  9    KSERSSAMRTHL---VSAIVLA------FVTLVLSATDPGDIDILNQFRKNLENPELLQW  59

Query  261  -SGQDPCK---WNHVGCSDDRRVIRIQIGHNSLQGTLPPDLSKLTQLQRLELQWNNIsgp  428
                DPC    W HV CS+ R V +IQ+    L+GTLP +L++L++L+ + LQ N   G 
Sbjct  60   PKSGDPCGPPCWKHVFCSNSR-VTQIQVSSVGLKGTLPQNLNQLSKLENIGLQKNQFRGE  118

Query  429  lpslnglsslRVLMLSNNHFTSIPSDFFVGMSSLQ  533
            LPS +GLS+L+   L  N+F +IP+DFF G+ +LQ
Sbjct  119  LPSFSGLSNLKYAYLDGNNFDTIPADFFDGLENLQ  153



>ref|XP_002309250.1| hypothetical protein POPTR_0006s22000g [Populus trichocarpa]
 gb|EEE92773.1| hypothetical protein POPTR_0006s22000g [Populus trichocarpa]
Length=948

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 61/131 (47%), Positives = 79/131 (60%), Gaps = 7/131 (5%)
 Frame = +3

Query  159  SLFVNAVSQAGQNDDASVMFALKKSLNPPSDMGWSGQ---DPC--KWNHVGCSDDRRVIR  323
            SLF    S    ND A ++ A ++ L  P  + W      DPC   W HV CS  R V +
Sbjct  14   SLFTVVFSATDPNDFA-IIKAFREGLENPELLEWPADGDDDPCGQSWKHVFCSGSR-VTQ  71

Query  324  IQIGHNSLQGTLPPDLSKLTQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFTSIPS  503
            IQ+ + SL+GTLP +L++LT+LQRL LQ N  +G LPSL+GLS L+ + L  N F SIPS
Sbjct  72   IQVQNMSLKGTLPQNLNQLTKLQRLGLQRNQFTGALPSLSGLSELQSVYLDFNQFDSIPS  131

Query  504  DFFVGMSSLQS  536
            D F  + SLQS
Sbjct  132  DCFDRLVSLQS  142



>emb|CAH68356.1| H0723C07.6 [Oryza sativa Indica Group]
 gb|EAY96121.1| hypothetical protein OsI_17999 [Oryza sativa Indica Group]
Length=939

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 57/124 (46%), Positives = 74/124 (60%), Gaps = 6/124 (5%)
 Frame = +3

Query  177  VSQAGQN-DDASVMFALKKSL-NPPSDMGW---SGQDPCK-WNHVGCSDDRRVIRIQIGH  338
            VS A  N  D SV+  L++SL N  + +GW   +  DPC  W H+ C    RV  I + +
Sbjct  13   VSDAAINPGDLSVLHDLRRSLTNADAVLGWGDPNAADPCAAWPHISCDRAGRVNNIDLKN  72

Query  339  NSLQGTLPPDLSKLTQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFTSIPSDFFVG  518
              L GTLP   + L  LQ L LQ NN+SG LPS  G++SLR   L+NN F SIP+DFF G
Sbjct  73   AGLSGTLPSTFAALDALQDLSLQNNNLSGDLPSFRGMASLRHAFLNNNSFRSIPADFFSG  132

Query  519  MSSL  530
            ++SL
Sbjct  133  LTSL  136



>dbj|BAF79934.1| receptor-like kinase [Marchantia polymorpha]
Length=974

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 55/121 (45%), Positives = 73/121 (60%), Gaps = 7/121 (6%)
 Frame = +3

Query  186  AGQND--DASVMFALKKSLNPPSD--MGWSGQDPC--KWNHVGCSDDRRVIRIQIGHNSL  347
            A Q D  D  ++ +L + L   S   +GWSG D C  KW H+ C    +V  IQIG   L
Sbjct  30   AAQTDPADQQILESLLQGLTSASQATLGWSGGDACGGKWAHIQCLG-TKVSAIQIGKLGL  88

Query  348  QGTLPPDLSKLTQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFTSIPSDFFVGMSS  527
            +GT+P  +++L QL RLELQ N+ +G LPSL+GL+ L V    NN F  IP DFF G++S
Sbjct  89   EGTIPSTINQLQQLTRLELQDNSFTGSLPSLSGLAKLDVGYFQNNKFDVIPGDFFDGLTS  148

Query  528  L  530
            L
Sbjct  149  L  149



>ref|NP_001054323.1| Os04g0685900 [Oryza sativa Japonica Group]
 emb|CAD41925.1| OSJNBa0070M12.3 [Oryza sativa Japonica Group]
 emb|CAE03463.1| OSJNBa0088H09.21 [Oryza sativa Japonica Group]
 dbj|BAF16237.1| Os04g0685900 [Oryza sativa Japonica Group]
 gb|EAZ32481.1| hypothetical protein OsJ_16698 [Oryza sativa Japonica Group]
 dbj|BAH00734.1| unnamed protein product [Oryza sativa Japonica Group]
Length=938

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 57/124 (46%), Positives = 74/124 (60%), Gaps = 6/124 (5%)
 Frame = +3

Query  177  VSQAGQN-DDASVMFALKKSL-NPPSDMGW---SGQDPCK-WNHVGCSDDRRVIRIQIGH  338
            VS A  N  D SV+  L++SL N  + +GW   +  DPC  W H+ C    RV  I + +
Sbjct  12   VSDAAINPGDLSVLHDLRRSLTNADAVLGWGDPNAADPCAAWPHISCDRAGRVNNIDLKN  71

Query  339  NSLQGTLPPDLSKLTQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFTSIPSDFFVG  518
              L GTLP   + L  LQ L LQ NN+SG LPS  G++SLR   L+NN F SIP+DFF G
Sbjct  72   AGLAGTLPSTFAALDALQDLSLQNNNLSGDLPSFRGMASLRHAFLNNNSFRSIPADFFSG  131

Query  519  MSSL  530
            ++SL
Sbjct  132  LTSL  135



>emb|CAN69461.1| hypothetical protein VITISV_043132 [Vitis vinifera]
Length=921

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 56/142 (39%), Positives = 83/142 (58%), Gaps = 12/142 (8%)
 Frame = +3

Query  126  LPALVFLGIFASLFVNAVSQAGQNDDASVMFALKKSLN-PPSDMGWSGQDPCKWNHVGCS  302
            + +LV L +  SL  +A++     DDA+VM  L+K L+  PS  GW+G D C W  + C 
Sbjct  1    MASLVSLCLLFSLLTSALA-----DDAAVMDNLRKGLSXTPS--GWTGSDFCSWEGINCG  53

Query  303  D----DRRVIRIQIGHNSLQGTLPPDLSKLTQLQRLELQWNNIsgplpslnglsslRVLM  470
            +    +  V  I +    L GTLP DL++L+QL  L  Q N++ G LPSL  L  L+ + 
Sbjct  54   NTGDSNGXVTAINMASKGLSGTLPSDLNQLSQLVTLSFQSNSLXGSLPSLANLQFLQBIY  113

Query  471  LSNNHFTSIPSDFFVGMSSLQS  536
            L++N+F SI  DFF  ++SLQ+
Sbjct  114  LNSNNFXSIDKDFFTNLTSLQT  135



>ref|XP_008241052.1| PREDICTED: probable receptor protein kinase TMK1 [Prunus mume]
Length=951

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 52/116 (45%), Positives = 76/116 (66%), Gaps = 5/116 (4%)
 Frame = +3

Query  198  DDASVMFALKKSLNPPSDMGW--SGQDPC--KWNHVGCSDDRRVIRIQIGHNSLQGTLPP  365
            +D +++   +K++  P  + W  +G+DPC  KW HV C DD+RV +IQ+ +  L+G LP 
Sbjct  28   NDLAILNQFRKNMENPELLKWPENGEDPCGDKWEHVFC-DDQRVSQIQVQNLGLKGPLPQ  86

Query  366  DLSKLTQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFTSIPSDFFVGMSSLQ  533
            + ++LT+L  + LQ N  SGPLPSL GLS LR   L  N F+SIP DFF G+ +L+
Sbjct  87   NFNQLTELTNIGLQRNKFSGPLPSLKGLSKLRYAYLDFNDFSSIPVDFFDGLDALE  142



>ref|XP_007139094.1| hypothetical protein PHAVU_008G000600g [Phaseolus vulgaris]
 gb|ESW11088.1| hypothetical protein PHAVU_008G000600g [Phaseolus vulgaris]
Length=220

 Score = 69.3 bits (168),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/96 (38%), Positives = 54/96 (56%), Gaps = 5/96 (5%)
 Frame = +3

Query  144  LGIFASLFVNAVSQAGQNDDASVMFALKKSLNPPSDM--GWSGQ--DPCKWNHVGCSDDR  311
            L IF  L  +  +    N +   +FA ++++  PS++   W     DPC W HV C DD+
Sbjct  12   LAIFL-LLSDPFAVVNANSEGDALFAFRRAVKDPSNVLQSWDPTLVDPCTWFHVTCDDDK  70

Query  312  RVIRIQIGHNSLQGTLPPDLSKLTQLQRLELQWNNI  419
            RV R+ +GH  L G L P+L +L +LQ LEL  N++
Sbjct  71   RVTRLDLGHAKLSGHLVPELGRLQRLQFLELYKNDL  106



>gb|KCW51007.1| hypothetical protein EUGRSUZ_J00633 [Eucalyptus grandis]
Length=191

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 37/105 (35%), Positives = 58/105 (55%), Gaps = 4/105 (4%)
 Frame = +3

Query  117  GLKLPALVFLGIFASLFVNAVSQAGQNDDASVMFALKKSLNPPSDM--GWSGQ--DPCKW  284
            GL+  +   L   +SL +     AG N +   ++  ++SL+ P ++   W     +PC W
Sbjct  4    GLRSFSFFLLFCASSLTLAPFRLAGANSEGDALYTFRRSLSDPDNVLQSWDPTLVNPCTW  63

Query  285  NHVGCSDDRRVIRIQIGHNSLQGTLPPDLSKLTQLQRLELQWNNI  419
             H+ C+ D RV R+ +G+++L G L P+L KL  LQ LEL  NNI
Sbjct  64   FHITCNQDNRVTRVDLGNSNLSGHLVPELGKLEHLQYLELYKNNI  108



>ref|XP_006438831.1| hypothetical protein CICLE_v10032710mg [Citrus clementina]
 ref|XP_006483027.1| PREDICTED: somatic embryogenesis receptor kinase 2-like [Citrus 
sinensis]
 gb|ESR52071.1| hypothetical protein CICLE_v10032710mg [Citrus clementina]
 gb|KDO83143.1| hypothetical protein CISIN_1g027850mg [Citrus sinensis]
Length=218

 Score = 69.3 bits (168),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 52/94 (55%), Gaps = 4/94 (4%)
 Frame = +3

Query  150  IFASLFVNAVSQAGQNDDASVMFALKKSLNPPSDM--GWSGQ--DPCKWNHVGCSDDRRV  317
            + A +  N ++ +  N +   +FAL++++  P  +   W     DPC W HV C  D RV
Sbjct  12   LVALVLSNTIATSNANVEGDALFALRRAVKDPQGVLQSWDPTLVDPCTWFHVTCDADNRV  71

Query  318  IRIQIGHNSLQGTLPPDLSKLTQLQRLELQWNNI  419
             R+ +G+  L G L P+L KL +LQ LEL  NN+
Sbjct  72   TRLDLGNGKLSGNLVPELGKLERLQYLELYMNNL  105



>ref|XP_010535762.1| PREDICTED: somatic embryogenesis receptor kinase 2-like [Tarenaya 
hassleriana]
Length=218

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/100 (38%), Positives = 57/100 (57%), Gaps = 11/100 (11%)
 Frame = +3

Query  153  FASLFVNA-------VSQAGQNDDASVMFALKKSLNPPSDM--GWSGQ--DPCKWNHVGC  299
            F  LFV +       +  A  N +   ++AL++SL+ P+++   W     +PC W HV C
Sbjct  7    FRELFVASLTLALALIRMAEANSEGDALYALRRSLSDPNNVLQSWDPTLVNPCTWFHVTC  66

Query  300  SDDRRVIRIQIGHNSLQGTLPPDLSKLTQLQRLELQWNNI  419
            + D RV R+ +G+++L G L P+L KL  LQ LEL  NNI
Sbjct  67   NQDSRVTRVDLGNSNLSGHLVPELGKLEHLQYLELYKNNI  106



>ref|XP_003629623.1| Receptor-like kinase [Medicago truncatula]
 gb|AET04099.1| LRR receptor-like kinase [Medicago truncatula]
Length=916

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 55/115 (48%), Positives = 74/115 (64%), Gaps = 2/115 (2%)
 Frame = +3

Query  195  NDDASVMFALKKSLNPPSDMGWSGQDP-CKWNHVGCSDDRRVIRIQIGHNSLQGTLPPDL  371
            +DD +VM +L++SL P S  GWS     C+W+ V CS D RV  I +    L GTLP +L
Sbjct  20   DDDGTVMQSLRQSLKP-SPNGWSSNTSFCQWSGVKCSSDNRVTSINLSDQKLAGTLPDNL  78

Query  372  SKLTQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFTSIPSDFFVGMSSLQS  536
            + LTQL  L LQ N +SGPLPSL  LSSL  + L +N+F+S+    F G++SLQ+
Sbjct  79   NSLTQLTTLYLQNNALSGPLPSLANLSSLTDVNLGSNNFSSVTPGAFSGLNSLQT  133



>ref|XP_006844558.1| hypothetical protein AMTR_s00016p00184680 [Amborella trichopoda]
 gb|ERN06233.1| hypothetical protein AMTR_s00016p00184680 [Amborella trichopoda]
Length=210

 Score = 68.9 bits (167),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 38/98 (39%), Positives = 59/98 (60%), Gaps = 12/98 (12%)
 Frame = +3

Query  138  VFLGIFASLFVNAVSQAGQNDDASVMFALKKSLNPPSDM--GWSGQ--DPCKWNHVGCSD  305
            +F  IF+  FVNA      N +   ++AL+++L+ P+++   W     +PC W HV C++
Sbjct  9    LFCAIFS--FVNA------NTEGDALYALRRTLHDPANVLQSWDPTLVNPCTWFHVTCNN  60

Query  306  DRRVIRIQIGHNSLQGTLPPDLSKLTQLQRLELQWNNI  419
            D RV R+ +G+  L GTL P+L +L  LQ LEL  NN+
Sbjct  61   DNRVTRLDLGNARLIGTLVPELGRLESLQYLELYKNNL  98



>ref|XP_009383147.1| PREDICTED: probable receptor protein kinase TMK1 [Musa acuminata 
subsp. malaccensis]
Length=1020

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 54/116 (47%), Positives = 71/116 (61%), Gaps = 6/116 (5%)
 Frame = +3

Query  201  DASVMFALKKSLNPPSDMGW--SGQDPC---KWNHVGCSDDRRVIRIQIGHNSLQGTLPP  365
            D  V+   +K L+    + W  + QDPC    W +V C+  R V +IQ     L GTLPP
Sbjct  134  DYQVLDEFRKGLSNAELLKWPKNNQDPCGSPPWPYVFCAGSR-VAQIQAKDLGLVGTLPP  192

Query  366  DLSKLTQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFTSIPSDFFVGMSSLQ  533
            DL+KL+ L  + LQ NN++G LPS  GLSSL+   L NN F +IP+DFFVG+ SLQ
Sbjct  193  DLNKLSMLVNVGLQGNNLTGALPSFKGLSSLQYAFLGNNRFDTIPADFFVGLDSLQ  248



>ref|XP_010090693.1| hypothetical protein L484_017499 [Morus notabilis]
 gb|EXB40357.1| hypothetical protein L484_017499 [Morus notabilis]
Length=198

 Score = 68.9 bits (167),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 40/102 (39%), Positives = 59/102 (58%), Gaps = 8/102 (8%)
 Frame = +3

Query  126  LPALVFLGIFASLFVNAVSQAGQNDDASVMFALKKSLNPPSDM--GWSGQ--DPCKWNHV  293
            L ALV   I  S  +  ++ A    DA  ++AL++++  P+++   W     DPC W HV
Sbjct  11   LSALVV--ILLSWPLTPITNANVEGDA--LYALRRAMKDPNNVLESWDPTLVDPCTWFHV  66

Query  294  GCSDDRRVIRIQIGHNSLQGTLPPDLSKLTQLQRLELQWNNI  419
             C  D RV R+ +G+ +L G+L PDL KL +LQ LEL  NN+
Sbjct  67   TCDSDNRVTRLDLGNTNLSGSLVPDLGKLERLQYLELYMNNL  108



>gb|ABD96567.1| Rhg4-like receptor kinase I [Glycine max]
Length=920

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 50/114 (44%), Positives = 71/114 (62%), Gaps = 2/114 (2%)
 Frame = +3

Query  198  DDASVMFALKKSLNPPSDMGWSGQDP-CKWNHVGCSDDRRVIRIQIGHNSLQGTLPPDLS  374
            DDA+VM    KSL PP   GWS   P C+W  + C     V  I +  +SL GTLP DL+
Sbjct  22   DDAAVMSNFLKSLTPPPS-GWSETTPFCQWKGIQCDSSSHVTSISLASHSLTGTLPSDLN  80

Query  375  KLTQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFTSIPSDFFVGMSSLQS  536
             L+QL+ L LQ N+++G LPSL+ LS L+ + L+ N+F+S+    F  ++SLQ+
Sbjct  81   SLSQLRTLFLQDNSLTGTLPSLSNLSFLQTVYLNRNNFSSVSPTAFASLTSLQT  134



>ref|XP_009414792.1| PREDICTED: probable receptor protein kinase TMK1 [Musa acuminata 
subsp. malaccensis]
Length=955

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 53/97 (55%), Positives = 63/97 (65%), Gaps = 3/97 (3%)
 Frame = +3

Query  252  MGWS-GQDPCK-WNHVGCSDDRRVIRIQIGHNSLQGTLPPDLSKLTQLQRLELQWNNIsg  425
            + WS   DPC  W  V CSD R V  IQ G   L G+L P +  LT L RLELQ N ++G
Sbjct  49   LAWSLSADPCAAWAGVSCSDGR-VTAIQAGKCGLSGSLSPAVRNLTALVRLELQQNRLAG  107

Query  426  plpslnglsslRVLMLSNNHFTSIPSDFFVGMSSLQS  536
            PLPSL  LSSL+VL+L  N F+S+P  FF G+SSLQS
Sbjct  108  PLPSLADLSSLQVLLLHGNRFSSLPDGFFAGLSSLQS  144


 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/73 (33%), Positives = 37/73 (51%), Gaps = 2/73 (3%)
 Frame = +3

Query  207  SVMFALKKSLNPPSDMG--WSGQDPCKWNHVGCSDDRRVIRIQIGHNSLQGTLPPDLSKL  380
            +V+ A+ K L  P+     W G DPC W  + C+D+  +  I      L GT+ P+   +
Sbjct  335  NVLLAVAKDLGYPARFAENWKGNDPCGWLGISCNDNGNITVINFQRMGLNGTISPEFGSI  394

Query  381  TQLQRLELQWNNI  419
              LQ+L L  NN+
Sbjct  395  VSLQKLLLSNNNL  407



>gb|ABD96565.1| Rhg4-like receptor kinase I [Glycine max]
Length=920

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 49/114 (43%), Positives = 69/114 (61%), Gaps = 2/114 (2%)
 Frame = +3

Query  198  DDASVMFALKKSLNPPSDMGWSGQDP-CKWNHVGCSDDRRVIRIQIGHNSLQGTLPPDLS  374
            DDA+VM    KSL PP   GWS   P C+W  + C     V  I +   SL GTLP DL+
Sbjct  22   DDAAVMSNFLKSLTPPPS-GWSETTPFCQWKGIQCDSSSHVTSISLASQSLTGTLPSDLN  80

Query  375  KLTQLQRLELQWNNIsgplpslnglsslRVLMLSNNHFTSIPSDFFVGMSSLQS  536
             L+QL+ L LQ N+++G LPSL+ LS L+ +  + N+F+S+    F  ++SLQ+
Sbjct  81   SLSQLRTLSLQDNSLTGTLPSLSNLSFLQTVYFNRNNFSSVSPTAFASLTSLQT  134



>ref|XP_002530200.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
 gb|EEF32190.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
Length=223

 Score = 68.9 bits (167),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 40/102 (39%), Positives = 60/102 (59%), Gaps = 9/102 (9%)
 Frame = +3

Query  126  LPALVFLGIFASLFVNAVSQAGQNDDASVMFALKKSLNPPSDM--GWSGQ--DPCKWNHV  293
            +P LVFL    ++FV   S A  N +   ++ L++SL+ P ++   W     +PC W H+
Sbjct  15   VPPLVFL--ILTVFV---SLAYANSEGDALYTLRRSLSDPDNVLQSWDPTLVNPCTWFHI  69

Query  294  GCSDDRRVIRIQIGHNSLQGTLPPDLSKLTQLQRLELQWNNI  419
             C+ D RV R+ +G+++L G L P+L KL  LQ LEL  NNI
Sbjct  70   TCNQDNRVTRLDLGNSNLSGHLVPELGKLEHLQYLELYKNNI  111



>ref|XP_010904696.1| PREDICTED: somatic embryogenesis receptor kinase 2-like [Elaeis 
guineensis]
Length=217

 Score = 68.9 bits (167),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 37/96 (39%), Positives = 55/96 (57%), Gaps = 7/96 (7%)
 Frame = +3

Query  144  LGIFASLFVNAVSQAGQNDDASVMFALKKSLNPPSDM--GWSGQ--DPCKWNHVGCSDDR  311
            LG+   L     S A  N +   +FAL++SL+ P ++   W     +PC W H+ C+ D 
Sbjct  14   LGVAVVLLA---SLAASNSEGDALFALRRSLSDPDNVLESWDPTLVNPCTWFHITCNQDN  70

Query  312  RVIRIQIGHNSLQGTLPPDLSKLTQLQRLELQWNNI  419
            RV R+ +G+++L G L P+L +L  LQ LEL  NNI
Sbjct  71   RVTRVDLGNSNLSGHLVPELGRLEHLQYLELYKNNI  106



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 565229601645