BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001O22

Length=490
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009606207.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    181   9e-50   Nicotiana tomentosiformis
ref|XP_009788524.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    179   5e-49   Nicotiana sylvestris
ref|XP_006352881.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    179   6e-49   
ref|XP_004245918.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    176   1e-47   Solanum lycopersicum
ref|XP_011070302.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    172   2e-46   Sesamum indicum [beniseed]
ref|XP_010245191.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    164   1e-43   
ref|XP_002277503.2|  PREDICTED: alpha,alpha-trehalose-phosphate s...    161   2e-42   Vitis vinifera
emb|CAN61971.1|  hypothetical protein VITISV_016593                     161   2e-42   Vitis vinifera
ref|XP_006432795.1|  hypothetical protein CICLE_v10000247mg             158   9e-42   
ref|XP_002527658.1|  trehalose-6-phosphate synthase, putative           158   1e-41   
ref|XP_006432796.1|  hypothetical protein CICLE_v10000247mg             158   1e-41   
ref|XP_008238210.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    157   4e-41   Prunus mume [ume]
ref|XP_007210367.1|  hypothetical protein PRUPE_ppa001305mg             157   4e-41   Prunus persica
ref|XP_009401244.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    156   9e-41   
ref|XP_004300232.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    155   1e-40   Fragaria vesca subsp. vesca
gb|EYU33434.1|  hypothetical protein MIMGU_mgv1a001209mg                155   2e-40   Erythranthe guttata [common monkey flower]
gb|AJO70167.1|  alpha,alpha-trehalose-phosphate synthase 5              155   2e-40   Camellia sinensis [black tea]
ref|XP_009371197.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    152   2e-39   Pyrus x bretschneideri [bai li]
ref|XP_002304347.1|  glycosyl transferase family 20 family protein      151   6e-39   
ref|XP_010096957.1|  Alpha,alpha-trehalose-phosphate synthase [UD...    150   8e-39   Morus notabilis
gb|KDP26189.1|  hypothetical protein JCGZ_22685                         150   8e-39   Jatropha curcas
ref|XP_007040645.1|  Trehalose phosphatase/synthase 5 isoform 3         148   5e-38   
ref|XP_007040643.1|  Trehalose phosphatase/synthase 5 isoform 1         148   7e-38   
gb|KHN42432.1|  Alpha,alpha-trehalose-phosphate synthase [UDP-for...    147   2e-37   Glycine soja [wild soybean]
ref|XP_006605933.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    147   2e-37   Glycine max [soybeans]
ref|XP_011028149.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    144   4e-37   Populus euphratica
ref|XP_011028148.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    144   4e-37   Populus euphratica
ref|XP_008800104.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    145   6e-37   
ref|XP_010908489.1|  PREDICTED: LOW QUALITY PROTEIN: alpha,alpha-...    145   9e-37   Elaeis guineensis
ref|XP_006589670.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    145   1e-36   Glycine max [soybeans]
gb|KHN06692.1|  Alpha,alpha-trehalose-phosphate synthase [UDP-for...    145   1e-36   Glycine soja [wild soybean]
ref|XP_011028143.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    145   1e-36   Populus euphratica
gb|KCW71761.1|  hypothetical protein EUGRSUZ_E00259                     143   2e-36   Eucalyptus grandis [rose gum]
gb|KJB39837.1|  hypothetical protein B456_007G033200                    144   2e-36   Gossypium raimondii
gb|KCW71760.1|  hypothetical protein EUGRSUZ_E00259                     143   2e-36   Eucalyptus grandis [rose gum]
gb|KHG14108.1|  Alpha,alpha-trehalose-phosphate synthase [UDP-for...    143   3e-36   Gossypium arboreum [tree cotton]
gb|KEH44193.1|  trehalose-6-phosphate synthase domain protein           142   6e-36   Medicago truncatula
ref|XP_010055292.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    142   6e-36   Eucalyptus grandis [rose gum]
ref|XP_006854042.1|  hypothetical protein AMTR_s00048p00069850          142   7e-36   Amborella trichopoda
gb|AAX16014.1|  trehalose-6-phosphate synthase                          140   4e-35   Ginkgo biloba [ginkgo]
ref|XP_004497053.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    140   4e-35   
ref|XP_006368376.1|  hypothetical protein POPTR_0001s02190g             140   4e-35   Populus trichocarpa [western balsam poplar]
ref|XP_004497050.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    140   4e-35   Cicer arietinum [garbanzo]
gb|KHG01348.1|  Alpha,alpha-trehalose-phosphate synthase [UDP-for...    139   1e-34   Gossypium arboreum [tree cotton]
gb|KJB25286.1|  hypothetical protein B456_004G183400                    137   3e-34   Gossypium raimondii
gb|KJB25285.1|  hypothetical protein B456_004G183400                    137   4e-34   Gossypium raimondii
ref|XP_011018523.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    136   1e-33   Populus euphratica
ref|XP_010677331.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    134   6e-33   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004148747.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    134   9e-33   Cucumis sativus [cucumbers]
ref|XP_008448661.1|  PREDICTED: LOW QUALITY PROTEIN: alpha,alpha-...    133   1e-32   Cucumis melo [Oriental melon]
ref|XP_006849789.1|  hypothetical protein AMTR_s00176p00032980          132   3e-32   Amborella trichopoda
ref|XP_004293972.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    132   3e-32   Fragaria vesca subsp. vesca
ref|XP_010242150.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    130   1e-31   
ref|XP_007214619.1|  hypothetical protein PRUPE_ppa001324mg             130   1e-31   Prunus persica
ref|XP_009351624.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    130   2e-31   Pyrus x bretschneideri [bai li]
ref|XP_008371505.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    130   2e-31   
ref|XP_008383601.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    128   6e-31   
ref|XP_004233035.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    128   8e-31   Solanum lycopersicum
ref|XP_010276860.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    128   9e-31   Nelumbo nucifera [Indian lotus]
ref|XP_010518663.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    127   1e-30   Tarenaya hassleriana [spider flower]
emb|CAB10557.1|  trehalose-6-phosphate synthase like protein            127   2e-30   Arabidopsis thaliana [mouse-ear cress]
gb|KDP21135.1|  hypothetical protein JCGZ_21606                         127   2e-30   Jatropha curcas
ref|XP_011039387.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    127   2e-30   Populus euphratica
ref|XP_002317392.1|  hypothetical protein POPTR_0011s06910g             127   2e-30   Populus trichocarpa [western balsam poplar]
gb|ABD65165.1|  trehalose-6-phosphate synthase, putative                127   2e-30   Brassica oleracea
emb|CDX90449.1|  BnaA03g43320D                                          127   2e-30   
ref|XP_002522255.1|  trehalose-6-phosphate synthase, putative           126   3e-30   Ricinus communis
ref|XP_010439943.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    126   4e-30   Camelina sativa [gold-of-pleasure]
ref|XP_002870086.1|  ATTPS5                                             126   4e-30   Arabidopsis lyrata subsp. lyrata
ref|NP_567538.1|  putative trehalose phosphatase/synthase 5             126   4e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010671073.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    126   4e-30   Beta vulgaris subsp. vulgaris [field beet]
gb|KHG01703.1|  putative alpha,alpha-trehalose-phosphate synthase...    126   4e-30   Gossypium arboreum [tree cotton]
ref|XP_010449561.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    125   6e-30   Camelina sativa [gold-of-pleasure]
ref|XP_010106616.1|  putative alpha,alpha-trehalose-phosphate syn...    125   6e-30   Morus notabilis
ref|XP_010434619.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    125   6e-30   Camelina sativa [gold-of-pleasure]
ref|XP_006358103.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    125   7e-30   Solanum tuberosum [potatoes]
ref|XP_010043976.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    125   7e-30   Eucalyptus grandis [rose gum]
ref|XP_004171547.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    124   7e-30   
ref|XP_010449562.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    125   7e-30   
ref|XP_010449559.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    125   8e-30   
gb|KJB57382.1|  hypothetical protein B456_009G160400                    125   1e-29   Gossypium raimondii
ref|XP_002527520.1|  trehalose-6-phosphate synthase, putative           124   1e-29   
ref|XP_009136870.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    125   1e-29   Brassica rapa
ref|XP_004134569.1|  PREDICTED: LOW QUALITY PROTEIN: probable alp...    124   1e-29   
ref|XP_008439718.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    124   1e-29   Cucumis melo [Oriental melon]
gb|KGN49325.1|  Trehalose-6-phosphate synthase                          124   2e-29   Cucumis sativus [cucumbers]
ref|XP_006283097.1|  hypothetical protein CARUB_v10004115mg             124   3e-29   Capsella rubella
ref|XP_006414189.1|  hypothetical protein EUTSA_v10024381mg             124   3e-29   Eutrema salsugineum [saltwater cress]
emb|CBI30721.3|  unnamed protein product                                123   4e-29   Vitis vinifera
emb|CAN71202.1|  hypothetical protein VITISV_006369                     123   4e-29   Vitis vinifera
ref|XP_002268174.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    123   4e-29   Vitis vinifera
ref|XP_010271238.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    123   5e-29   Nelumbo nucifera [Indian lotus]
gb|KDP38139.1|  hypothetical protein JCGZ_04782                         122   7e-29   Jatropha curcas
ref|XP_011021750.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    122   7e-29   Populus euphratica
ref|XP_011021751.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    122   8e-29   Populus euphratica
ref|XP_009804181.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    122   8e-29   Nicotiana sylvestris
ref|XP_009804180.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    122   9e-29   Nicotiana sylvestris
ref|XP_009804177.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    122   1e-28   Nicotiana sylvestris
ref|XP_007142959.1|  hypothetical protein PHAVU_007G031800g             122   1e-28   Phaseolus vulgaris [French bean]
ref|XP_009351564.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    121   2e-28   
ref|XP_010999788.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    121   2e-28   Populus euphratica
gb|KJB69686.1|  hypothetical protein B456_011G037000                    121   2e-28   Gossypium raimondii
gb|KJB69685.1|  hypothetical protein B456_011G037000                    121   2e-28   Gossypium raimondii
gb|ACD56638.1|  trehalose synthase-like protein                         121   2e-28   Gossypioides kirkii
gb|KHG11600.1|  putative alpha,alpha-trehalose-phosphate synthase...    121   2e-28   Gossypium arboreum [tree cotton]
ref|XP_008381762.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    121   3e-28   
ref|XP_008775883.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    120   3e-28   Phoenix dactylifera
ref|XP_008220922.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    120   3e-28   Prunus mume [ume]
ref|XP_002314777.2|  hypothetical protein POPTR_0010s11510g             120   4e-28   Populus trichocarpa [western balsam poplar]
ref|XP_006378432.1|  hypothetical protein POPTR_0010s11510g             120   4e-28   
ref|XP_002305726.1|  hypothetical protein POPTR_0004s06000g             120   5e-28   Populus trichocarpa [western balsam poplar]
ref|XP_010650494.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    120   5e-28   Vitis vinifera
ref|XP_009595830.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    120   7e-28   Nicotiana tomentosiformis
ref|XP_002281386.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    119   7e-28   Vitis vinifera
gb|AJO70168.1|  alpha,alpha-trehalose-phosphate synthase 7              119   1e-27   Camellia sinensis [black tea]
emb|CAN67058.1|  hypothetical protein VITISV_036715                     119   1e-27   Vitis vinifera
ref|XP_003633255.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    119   1e-27   Vitis vinifera
gb|AAG52003.1|AC012563_13  putative trehalose-6-phosphate synthas...    119   1e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010052171.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    118   2e-27   Eucalyptus grandis [rose gum]
gb|KJB68366.1|  hypothetical protein B456_010G241200                    117   3e-27   Gossypium raimondii
ref|XP_004228746.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    118   3e-27   Solanum lycopersicum
gb|KJB68367.1|  hypothetical protein B456_010G241200                    117   4e-27   Gossypium raimondii
ref|XP_006364054.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    117   5e-27   Solanum tuberosum [potatoes]
gb|KJB68365.1|  hypothetical protein B456_010G241200                    117   8e-27   Gossypium raimondii
ref|XP_002312472.1|  hypothetical protein POPTR_0008s13590g             116   1e-26   
ref|XP_010052859.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    116   1e-26   Eucalyptus grandis [rose gum]
ref|XP_010052868.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    116   1e-26   Eucalyptus grandis [rose gum]
ref|XP_011463160.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    116   1e-26   Fragaria vesca subsp. vesca
emb|CBI22022.3|  unnamed protein product                                116   1e-26   Vitis vinifera
ref|XP_009778367.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    116   1e-26   Nicotiana sylvestris
ref|NP_564918.1|  alpha,alpha-trehalose-phosphate synthase [UDP-f...    115   2e-26   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011024382.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    116   2e-26   Populus euphratica
ref|XP_009624608.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    115   2e-26   
ref|XP_004503340.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    115   2e-26   Cicer arietinum [garbanzo]
ref|XP_008455290.1|  PREDICTED: LOW QUALITY PROTEIN: probable alp...    115   2e-26   
ref|XP_009624607.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    115   2e-26   
ref|XP_009624606.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    115   2e-26   Nicotiana tomentosiformis
ref|XP_004136836.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    115   2e-26   
emb|CBI32507.3|  unnamed protein product                                114   2e-26   Vitis vinifera
ref|NP_974105.1|  alpha,alpha-trehalose-phosphate synthase [UDP-f...    115   3e-26   Arabidopsis thaliana [mouse-ear cress]
gb|KGN43637.1|  hypothetical protein Csa_7G049190                       115   3e-26   Cucumis sativus [cucumbers]
gb|AHL29280.1|  trehalose-phosphate synthase 6                          114   5e-26   Camellia sinensis [black tea]
ref|XP_008225229.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    114   6e-26   Prunus mume [ume]
ref|XP_010511780.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    114   7e-26   
ref|XP_010511784.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    114   7e-26   Camelina sativa [gold-of-pleasure]
ref|XP_006391193.1|  hypothetical protein EUTSA_v10018111mg             114   7e-26   Eutrema salsugineum [saltwater cress]
ref|XP_003630977.1|  Alpha,alpha-trehalose-phosphate synthase           114   8e-26   Medicago truncatula
ref|XP_006843713.1|  hypothetical protein AMTR_s00007p00214170          114   8e-26   Amborella trichopoda
ref|XP_009416430.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    113   2e-25   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004505467.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    113   2e-25   Cicer arietinum [garbanzo]
ref|XP_010557135.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    113   2e-25   Tarenaya hassleriana [spider flower]
ref|XP_003540002.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    112   2e-25   Glycine max [soybeans]
ref|XP_009411218.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    112   2e-25   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDO77921.1|  hypothetical protein CISIN_1g003025mg                   112   3e-25   Citrus sinensis [apfelsine]
ref|XP_003607607.1|  Trehalose synthase-like protein                    112   3e-25   Medicago truncatula
ref|XP_006467609.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    112   3e-25   Citrus sinensis [apfelsine]
ref|XP_006449548.1|  hypothetical protein CICLE_v10014248mg             112   4e-25   
ref|XP_010415412.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    112   4e-25   Camelina sativa [gold-of-pleasure]
emb|CDY07404.1|  BnaA07g24830D                                          111   5e-25   Brassica napus [oilseed rape]
ref|XP_002888643.1|  predicted protein                                  111   7e-25   Arabidopsis lyrata subsp. lyrata
emb|CDY04199.1|  BnaC06g26160D                                          111   7e-25   
emb|CDP15959.1|  unnamed protein product                                110   1e-24   Coffea canephora [robusta coffee]
ref|XP_006300724.1|  hypothetical protein CARUB_v10019781mg             110   2e-24   Capsella rubella
ref|XP_010093315.1|  Alpha,alpha-trehalose-phosphate synthase [UD...    110   2e-24   Morus notabilis
ref|XP_007025310.1|  Trehalose-phosphatase/synthase 7 isoform 4         109   2e-24   
ref|XP_006654654.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    110   2e-24   
ref|XP_007025309.1|  Trehalose-phosphatase/synthase 7 isoform 3         109   2e-24   
ref|XP_007025308.1|  Trehalose-phosphatase/synthase 7 isoform 2         109   2e-24   Theobroma cacao [chocolate]
gb|EPS71188.1|  hypothetical protein M569_03569                         109   2e-24   Genlisea aurea
ref|XP_007025307.1|  Trehalose-phosphatase/synthase 7 isoform 1         109   3e-24   
ref|XP_006417924.1|  hypothetical protein EUTSA_v10006783mg             109   3e-24   Eutrema salsugineum [saltwater cress]
emb|CBI33857.3|  unnamed protein product                                104   3e-24   Vitis vinifera
gb|KFK41224.1|  hypothetical protein AALP_AA2G101500                    109   4e-24   Arabis alpina [alpine rockcress]
ref|XP_009409100.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    108   5e-24   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003529226.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    108   6e-24   Glycine max [soybeans]
gb|KDO60795.1|  hypothetical protein CISIN_1g044635mg                   108   9e-24   Citrus sinensis [apfelsine]
ref|XP_006448141.1|  hypothetical protein CICLE_v10014251mg             108   9e-24   Citrus clementina [clementine]
emb|CDM84185.1|  unnamed protein product                                108   1e-23   Triticum aestivum [Canadian hard winter wheat]
ref|XP_003569812.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    108   1e-23   Brachypodium distachyon [annual false brome]
ref|XP_008381189.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    107   1e-23   
ref|XP_008228949.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    107   1e-23   Prunus mume [ume]
ref|XP_009782523.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    107   1e-23   Nicotiana sylvestris
ref|XP_009628927.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    107   1e-23   Nicotiana tomentosiformis
ref|XP_003568093.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    107   2e-23   Brachypodium distachyon [annual false brome]
ref|XP_010522084.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    107   2e-23   Tarenaya hassleriana [spider flower]
tpg|DAA57653.1|  TPA: putative trehalose phosphatase/synthase fam...    106   3e-23   
dbj|BAJ87235.1|  predicted protein                                      106   3e-23   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010276900.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    106   3e-23   Nelumbo nucifera [Indian lotus]
gb|EPS68578.1|  hypothetical protein M569_06190                         106   4e-23   Genlisea aurea
tpg|DAA57651.1|  TPA: putative trehalose phosphatase/synthase fam...    106   4e-23   
ref|XP_002458490.1|  hypothetical protein SORBIDRAFT_03g034640          106   4e-23   Sorghum bicolor [broomcorn]
ref|XP_007045541.1|  UDP-Glycosyltransferase / trehalose-phosphat...    106   5e-23   
ref|XP_007045543.1|  UDP-Glycosyltransferase / trehalose-phosphat...    105   5e-23   
gb|KHN15462.1|  Alpha,alpha-trehalose-phosphate synthase [UDP-for...    106   5e-23   Glycine soja [wild soybean]
ref|XP_011082978.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    106   5e-23   Sesamum indicum [beniseed]
gb|ACD56625.1|  trehalose synthase/phosphatase-like protein             106   5e-23   Gossypium raimondii
gb|ACJ61506.1|  trehalose-6-phosphate synthase                          105   5e-23   Glycine max [soybeans]
ref|XP_011070555.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    105   8e-23   Sesamum indicum [beniseed]
ref|XP_007214959.1|  hypothetical protein PRUPE_ppa001387mg             105   8e-23   Prunus persica
gb|KHG01704.1|  putative alpha,alpha-trehalose-phosphate synthase...    105   8e-23   Gossypium arboreum [tree cotton]
gb|EYU30761.1|  hypothetical protein MIMGU_mgv1a001183mg                105   1e-22   Erythranthe guttata [common monkey flower]
gb|EEE64369.1|  hypothetical protein OsJ_19211                          105   1e-22   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001056050.1|  Os05g0517200                                       105   1e-22   
ref|XP_009365280.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    104   1e-22   
dbj|BAJ94322.1|  predicted protein                                      104   1e-22   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008775639.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    104   2e-22   Phoenix dactylifera
gb|EMT14980.1|  Putative alpha,alpha-trehalose-phosphate synthase...    104   2e-22   
ref|XP_007132825.1|  hypothetical protein PHAVU_011G127700g             104   2e-22   Phaseolus vulgaris [French bean]
ref|XP_010916659.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    103   3e-22   Elaeis guineensis
ref|XP_009105068.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    103   4e-22   Brassica rapa
ref|XP_009768217.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    103   4e-22   Nicotiana sylvestris
ref|XP_004969951.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    103   4e-22   Setaria italica
ref|XP_009595385.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    103   5e-22   Nicotiana tomentosiformis
ref|XP_009415178.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    103   5e-22   Musa acuminata subsp. malaccensis [pisang utan]
gb|ACA62945.1|  trehalose-6-phosphate synthase                          103   5e-22   Zostera marina
ref|XP_010531642.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    103   5e-22   Tarenaya hassleriana [spider flower]
gb|KJB30628.1|  hypothetical protein B456_005G152400                    102   5e-22   Gossypium raimondii
ref|XP_010916234.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    103   6e-22   Elaeis guineensis
ref|XP_004248198.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    103   6e-22   Solanum lycopersicum
ref|XP_006364095.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    102   6e-22   Solanum tuberosum [potatoes]
ref|XP_010556235.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...    102   6e-22   
gb|KJB30627.1|  hypothetical protein B456_005G152400                    102   6e-22   Gossypium raimondii
ref|XP_003527335.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    102   7e-22   Glycine max [soybeans]
gb|KJB30625.1|  hypothetical protein B456_005G152400                    102   8e-22   Gossypium raimondii
ref|XP_010924709.1|  PREDICTED: LOW QUALITY PROTEIN: probable alp...    102   8e-22   
gb|ADN34028.1|  trehalose-6-phosphate synthase                          102   8e-22   Cucumis melo subsp. melo
gb|EYU37347.1|  hypothetical protein MIMGU_mgv1a001197mg                102   1e-21   Erythranthe guttata [common monkey flower]
gb|EMT15117.1|  Putative alpha,alpha-trehalose-phosphate synthase...    102   1e-21   
ref|XP_007153644.1|  hypothetical protein PHAVU_003G053000g             102   1e-21   Phaseolus vulgaris [French bean]
ref|XP_002440081.1|  hypothetical protein SORBIDRAFT_09g025660          101   2e-21   Sorghum bicolor [broomcorn]
emb|CDO96859.1|  unnamed protein product                                100   3e-21   Coffea canephora [robusta coffee]
ref|NP_001044248.1|  Os01g0749400                                       100   3e-21   
gb|EEC71477.1|  hypothetical protein OsI_03737                          100   4e-21   Oryza sativa Indica Group [Indian rice]
gb|AEB53178.1|  trehalose-6-phosphate synthase 2                        100   4e-21   Oryza sativa Indica Group [Indian rice]
ref|NP_001288502.1|  uncharacterized protein LOC103636651               100   4e-21   Zea mays [maize]
gb|KHN24134.1|  Putative alpha,alpha-trehalose-phosphate synthase...    100   5e-21   Glycine soja [wild soybean]
gb|AAL91978.1|AF483209_1  putative trehalose synthase                   100   5e-21   Solanum tuberosum [potatoes]
ref|XP_004243268.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    100   5e-21   Solanum lycopersicum
ref|XP_006644707.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    100   5e-21   Oryza brachyantha
ref|XP_003532016.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    100   5e-21   Glycine max [soybeans]
ref|XP_006348895.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    100   5e-21   Solanum tuberosum [potatoes]
ref|XP_003552011.1|  PREDICTED: probable alpha,alpha-trehalose-ph...    100   5e-21   Glycine max [soybeans]
gb|KHN10606.1|  Putative alpha,alpha-trehalose-phosphate synthase...    100   5e-21   Glycine soja [wild soybean]
ref|XP_010932535.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...  99.0    1e-20   Elaeis guineensis
gb|KEH40650.1|  trehalose-6-phosphate synthase domain protein         99.0    2e-20   Medicago truncatula
gb|AEQ54916.1|  trehalose-6-phosphate synthase                        98.2    2e-20   Salvia miltiorrhiza [Chinese salvia]
ref|XP_008789260.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...  98.2    3e-20   Phoenix dactylifera
ref|XP_008789265.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...  97.8    3e-20   
gb|KHG14143.1|  Alpha,alpha-trehalose-phosphate synthase [UDP-for...  97.8    4e-20   Gossypium arboreum [tree cotton]
gb|ACA62946.1|  trehalose-6-phosphate synthase                        97.8    4e-20   Zostera marina
ref|XP_010926098.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...  97.4    5e-20   
gb|KJB31282.1|  hypothetical protein B456_005G183800                  96.7    6e-20   Gossypium raimondii
emb|CBI26812.3|  unnamed protein product                              96.7    6e-20   Vitis vinifera
gb|KHG20430.1|  putative alpha,alpha-trehalose-phosphate synthase...  97.1    6e-20   Gossypium arboreum [tree cotton]
gb|KJB31285.1|  hypothetical protein B456_005G183800                  96.3    9e-20   Gossypium raimondii
ref|XP_004509840.1|  PREDICTED: probable alpha,alpha-trehalose-ph...  96.7    1e-19   Cicer arietinum [garbanzo]
ref|XP_002889602.1|  hypothetical protein ARALYDRAFT_470660           96.7    1e-19   
gb|KJB31283.1|  hypothetical protein B456_005G183800                  96.3    1e-19   Gossypium raimondii
gb|KJB31284.1|  hypothetical protein B456_005G183800                  96.3    1e-19   Gossypium raimondii
gb|EYU30144.1|  hypothetical protein MIMGU_mgv1a001255mg              96.3    1e-19   Erythranthe guttata [common monkey flower]
ref|XP_002521023.1|  trehalose-6-phosphate synthase, putative         96.3    1e-19   Ricinus communis
gb|AEB53179.1|  trehalose-6-phosphate synthase 3                      95.9    2e-19   Oryza sativa Indica Group [Indian rice]
gb|EEC71425.1|  hypothetical protein OsI_03616                        95.9    2e-19   Oryza sativa Indica Group [Indian rice]
gb|EAZ13427.1|  hypothetical protein OsJ_03344                        95.9    2e-19   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001044141.1|  Os01g0730300                                     95.9    2e-19   
gb|ACI62866.1|  trehalose 6-phosphate synthase                        95.5    2e-19   Gossypium arboreum [tree cotton]
ref|NP_172129.1|  putative alpha,alpha-trehalose-phosphate syntha...  95.5    2e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006306755.1|  hypothetical protein CARUB_v10008292mg           95.5    2e-19   Capsella rubella
ref|XP_010475368.1|  PREDICTED: probable alpha,alpha-trehalose-ph...  95.5    3e-19   Camelina sativa [gold-of-pleasure]
ref|XP_010486072.1|  PREDICTED: probable alpha,alpha-trehalose-ph...  95.1    3e-19   Camelina sativa [gold-of-pleasure]
gb|EEC79533.1|  hypothetical protein OsI_20637                        94.7    4e-19   Oryza sativa Indica Group [Indian rice]
ref|XP_004305452.1|  PREDICTED: probable alpha,alpha-trehalose-ph...  94.4    6e-19   Fragaria vesca subsp. vesca
ref|XP_003578837.1|  PREDICTED: probable alpha,alpha-trehalose-ph...  94.0    8e-19   Brachypodium distachyon [annual false brome]
emb|CDX86523.1|  BnaC08g01800D                                        93.6    1e-18   
ref|XP_009110992.1|  PREDICTED: probable alpha,alpha-trehalose-ph...  93.6    1e-18   Brassica rapa
emb|CDY15577.1|  BnaA08g28610D                                        93.6    1e-18   Brassica napus [oilseed rape]
emb|CDY06638.1|  BnaA10g04170D                                        91.3    1e-18   
gb|KDP21328.1|  hypothetical protein JCGZ_21799                       93.6    1e-18   Jatropha curcas
ref|XP_008446229.1|  PREDICTED: probable alpha,alpha-trehalose-ph...  93.2    1e-18   Cucumis melo [Oriental melon]
dbj|BAJ94864.1|  predicted protein                                    93.2    2e-18   
ref|XP_002989114.1|  trehalose phosphate synthase                     93.2    2e-18   
gb|EPS59044.1|  hypothetical protein M569_15766                       92.8    2e-18   
ref|XP_007044571.1|  Trehalose-phosphatase/synthase 9                 92.8    2e-18   
ref|XP_008812813.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...  92.8    2e-18   
ref|XP_008348581.1|  PREDICTED: probable alpha,alpha-trehalose-ph...  92.4    2e-18   
gb|KDP31124.1|  hypothetical protein JCGZ_11500                       92.4    2e-18   
ref|XP_004969834.1|  PREDICTED: probable alpha,alpha-trehalose-ph...  92.4    3e-18   
ref|XP_002511428.1|  trehalose-6-phosphate synthase, putative         92.0    3e-18   
ref|XP_002322159.2|  glycosyl transferase family 20 family protein    91.7    4e-18   
gb|AAV65494.1|  trehalose 6-phosphate synthase                        91.3    6e-18   
ref|XP_006416048.1|  hypothetical protein EUTSA_v10006773mg           91.3    6e-18   
emb|CDY01487.1|  BnaC07g34770D                                        91.3    6e-18   
ref|XP_004135234.1|  PREDICTED: probable alpha,alpha-trehalose-ph...  91.3    7e-18   
ref|XP_010682587.1|  PREDICTED: probable alpha,alpha-trehalose-ph...  91.3    7e-18   
ref|XP_009365279.1|  PREDICTED: probable alpha,alpha-trehalose-ph...  90.5    1e-17   
ref|XP_002318643.1|  glycosyl transferase family 20 family protein    90.5    1e-17   
ref|XP_007153210.1|  hypothetical protein PHAVU_003G016300g           90.5    1e-17   
ref|XP_010268366.1|  PREDICTED: probable alpha,alpha-trehalose-ph...  89.7    2e-17   
ref|XP_002963442.1|  trehalose phosphate synthase                     89.7    2e-17   
gb|AAV65495.1|  trehalose 6-phosphate synthase                        89.7    2e-17   
ref|XP_010917511.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...  89.4    3e-17   
ref|XP_010542724.1|  PREDICTED: probable alpha,alpha-trehalose-ph...  89.4    3e-17   
ref|XP_004498234.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...  89.4    3e-17   
ref|XP_006306746.1|  hypothetical protein CARUB_v10008281mg           89.4    3e-17   
ref|XP_011028589.1|  PREDICTED: probable alpha,alpha-trehalose-ph...  89.0    3e-17   
ref|XP_011044324.1|  PREDICTED: probable alpha,alpha-trehalose-ph...  89.0    4e-17   
emb|CDY10196.1|  BnaC05g04390D                                        86.7    5e-17   
ref|XP_002456290.1|  hypothetical protein SORBIDRAFT_03g033590        87.8    9e-17   
ref|NP_173799.1|  putative alpha,alpha-trehalose-phosphate syntha...  87.8    9e-17   
ref|XP_006340112.1|  PREDICTED: probable alpha,alpha-trehalose-ph...  87.8    9e-17   
ref|NP_001288476.1|  uncharacterized protein LOC103651208             87.8    1e-16   
ref|XP_006826657.1|  hypothetical protein AMTR_s00137p00018220        87.4    1e-16   
ref|XP_002890598.1|  hypothetical protein ARALYDRAFT_889930           87.4    1e-16   
ref|XP_002983300.1|  trehalose phosphate synthase                     87.0    2e-16   
ref|XP_010477691.1|  PREDICTED: probable alpha,alpha-trehalose-ph...  86.7    2e-16   
ref|XP_010045326.1|  PREDICTED: probable alpha,alpha-trehalose-ph...  86.3    3e-16   
ref|XP_010251315.1|  PREDICTED: probable alpha,alpha-trehalose-ph...  86.3    3e-16   
gb|KCW87490.1|  hypothetical protein EUGRSUZ_B03950                   85.9    3e-16   
dbj|BAJ97342.1|  predicted protein                                    85.9    4e-16   
ref|XP_010415706.1|  PREDICTED: probable alpha,alpha-trehalose-ph...  85.9    4e-16   
ref|XP_009110077.1|  PREDICTED: probable alpha,alpha-trehalose-ph...  85.9    4e-16   
emb|CDY57320.1|  BnaA08g20280D                                        85.9    5e-16   
ref|XP_010471024.1|  PREDICTED: probable alpha,alpha-trehalose-ph...  85.5    5e-16   
ref|XP_010427800.1|  PREDICTED: probable alpha,alpha-trehalose-ph...  85.5    6e-16   
ref|XP_008792314.1|  PREDICTED: probable alpha,alpha-trehalose-ph...  85.5    6e-16   
ref|XP_004237260.1|  PREDICTED: probable alpha,alpha-trehalose-ph...  84.7    1e-15   
gb|AJO70169.1|  alpha,alpha-trehalose-phosphate synthase 10           84.7    1e-15   
emb|CBH32509.1|  trehalose synthase, putative, expressed              84.3    1e-15   
ref|XP_008353109.1|  PREDICTED: LOW QUALITY PROTEIN: probable alp...  82.0    1e-15   
ref|XP_010547901.1|  PREDICTED: probable alpha,alpha-trehalose-ph...  84.3    1e-15   
ref|NP_177186.2|  putative alpha,alpha-trehalose-phosphate syntha...  84.3    2e-15   
ref|NP_001061805.1|  Os08g0414700                                     84.3    2e-15   
gb|EEE68684.1|  hypothetical protein OsJ_27312                        84.3    2e-15   
ref|XP_007036166.1|  Trehalose-phosphatase/synthase 9 isoform 1       84.0    2e-15   
ref|XP_007036167.1|  Trehalose-phosphatase/synthase 9 isoform 2       84.0    2e-15   
ref|XP_006390900.1|  hypothetical protein EUTSA_v10018114mg           84.0    2e-15   
ref|XP_004297647.1|  PREDICTED: probable alpha,alpha-trehalose-ph...  84.0    2e-15   
ref|XP_008793857.1|  PREDICTED: probable alpha,alpha-trehalose-ph...  84.0    2e-15   
ref|XP_010913569.1|  PREDICTED: probable alpha,alpha-trehalose-ph...  83.6    2e-15   
ref|XP_008781991.1|  PREDICTED: probable alpha,alpha-trehalose-ph...  83.6    3e-15   
ref|XP_009605902.1|  PREDICTED: probable alpha,alpha-trehalose-ph...  83.6    3e-15   
ref|XP_010271971.1|  PREDICTED: probable alpha,alpha-trehalose-ph...  83.2    3e-15   
ref|XP_006659396.1|  PREDICTED: probable alpha,alpha-trehalose-ph...  83.2    4e-15   
gb|ACJ86290.1|  unknown                                               79.0    4e-15   
ref|XP_009785713.1|  PREDICTED: probable alpha,alpha-trehalose-ph...  82.8    5e-15   
ref|XP_010460163.1|  PREDICTED: probable alpha,alpha-trehalose-ph...  82.4    6e-15   
gb|KEH19955.1|  trehalose-6-phosphate synthase domain protein         82.0    8e-15   
emb|CAN78769.1|  hypothetical protein VITISV_024248                   82.0    9e-15   
ref|XP_003578083.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...  82.0    9e-15   
emb|CDP00187.1|  unnamed protein product                              82.0    9e-15   
dbj|BAF01061.1|  putative trehalose-6-phosphate synthase              82.0    9e-15   
ref|NP_176221.1|  putative alpha,alpha-trehalose-phosphate syntha...  82.0    1e-14   
ref|XP_002264873.1|  PREDICTED: probable alpha,alpha-trehalose-ph...  81.6    1e-14   
ref|XP_002886635.1|  ATTPS10                                          81.6    1e-14   
tpg|DAA44158.1|  TPA: putative trehalose phosphatase/synthase fam...  81.3    1e-14   
ref|XP_010498895.1|  PREDICTED: probable alpha,alpha-trehalose-ph...  81.6    1e-14   
ref|XP_008678555.1|  PREDICTED: probable alpha,alpha-trehalose-ph...  81.6    1e-14   
gb|KDO69720.1|  hypothetical protein CISIN_1g045882mg                 81.3    1e-14   
ref|XP_010028137.1|  PREDICTED: probable alpha,alpha-trehalose-ph...  81.3    1e-14   
ref|XP_008340008.1|  PREDICTED: probable alpha,alpha-trehalose-ph...  81.3    1e-14   
gb|ADA67991.1|  trehalose-6-phosphate synthase                        81.3    2e-14   
ref|XP_006476751.1|  PREDICTED: probable alpha,alpha-trehalose-ph...  81.3    2e-14   
ref|XP_006439780.1|  hypothetical protein CICLE_v10018842mg           81.3    2e-14   
gb|EEC83577.1|  hypothetical protein OsI_29236                        80.9    2e-14   
ref|XP_002283215.1|  PREDICTED: probable alpha,alpha-trehalose-ph...  80.9    2e-14   
ref|XP_010100492.1|  putative alpha,alpha-trehalose-phosphate syn...  80.5    3e-14   
ref|XP_010102124.1|  putative alpha,alpha-trehalose-phosphate syn...  80.5    3e-14   
ref|XP_009604621.1|  PREDICTED: probable alpha,alpha-trehalose-ph...  80.5    3e-14   
gb|KFK40813.1|  trehalose-phosphate synthase                          80.1    4e-14   
ref|XP_010417957.1|  PREDICTED: probable alpha,alpha-trehalose-ph...  80.1    4e-14   
ref|XP_010928594.1|  PREDICTED: probable alpha,alpha-trehalose-ph...  80.1    4e-14   
ref|XP_004238680.1|  PREDICTED: probable alpha,alpha-trehalose-ph...  80.1    4e-14   
ref|XP_002888764.1|  hypothetical protein ARALYDRAFT_894829           79.3    7e-14   
emb|CDP02920.1|  unnamed protein product                              79.3    8e-14   
ref|XP_010278047.1|  PREDICTED: probable alpha,alpha-trehalose-ph...  79.3    8e-14   
ref|XP_010510971.1|  PREDICTED: probable alpha,alpha-trehalose-ph...  79.0    9e-14   
ref|XP_010511782.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...  79.0    1e-13   
gb|EYU29720.1|  hypothetical protein MIMGU_mgv1a001271mg              79.0    1e-13   
ref|XP_011070304.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...  79.0    1e-13   
ref|XP_006300393.1|  hypothetical protein CARUB_v10019782mg           78.6    1e-13   
ref|XP_002445486.1|  hypothetical protein SORBIDRAFT_07g020270        78.6    1e-13   
ref|XP_007157471.1|  hypothetical protein PHAVU_002G072400g           78.6    1e-13   
ref|XP_006392184.1|  hypothetical protein EUTSA_v10023265mg           78.6    1e-13   
gb|AIN39848.1|  hypothetical protein                                  78.2    2e-13   
gb|KHN34483.1|  Putative alpha,alpha-trehalose-phosphate synthase...  78.2    2e-13   
gb|KDO53157.1|  hypothetical protein CISIN_1g002958mg                 78.2    2e-13   
ref|XP_009414014.1|  PREDICTED: probable alpha,alpha-trehalose-ph...  77.8    2e-13   
ref|XP_010473203.1|  PREDICTED: probable alpha,alpha-trehalose-ph...  77.8    2e-13   
ref|XP_009119065.1|  PREDICTED: LOW QUALITY PROTEIN: probable alp...  77.8    2e-13   
ref|XP_008664697.1|  PREDICTED: probable alpha,alpha-trehalose-ph...  77.8    2e-13   
ref|XP_002460185.1|  hypothetical protein SORBIDRAFT_02g024140        77.4    3e-13   
tpg|DAA61345.1|  TPA: putative trehalose phosphatase/synthase fam...  77.0    4e-13   
tpg|DAA61344.1|  TPA: putative trehalose phosphatase/synthase fam...  77.0    5e-13   
ref|XP_004973427.1|  PREDICTED: probable alpha,alpha-trehalose-ph...  76.3    7e-13   
ref|XP_004973426.1|  PREDICTED: probable alpha,alpha-trehalose-ph...  76.3    7e-13   
ref|XP_010533498.1|  PREDICTED: probable alpha,alpha-trehalose-ph...  76.3    9e-13   
ref|XP_004298929.1|  PREDICTED: probable alpha,alpha-trehalose-ph...  76.3    9e-13   
gb|EYU34289.1|  hypothetical protein MIMGU_mgv1a0016701mg             75.5    1e-12   
ref|XP_008374461.1|  PREDICTED: probable alpha,alpha-trehalose-ph...  75.5    1e-12   
ref|XP_007154820.1|  hypothetical protein PHAVU_003G150400g           75.5    1e-12   
ref|XP_006355973.1|  PREDICTED: probable alpha,alpha-trehalose-ph...  75.1    2e-12   
ref|XP_007210899.1|  hypothetical protein PRUPE_ppa001397mg           75.1    2e-12   
ref|XP_006573047.1|  PREDICTED: probable alpha,alpha-trehalose-ph...  75.1    2e-12   
ref|XP_003527027.1|  PREDICTED: probable alpha,alpha-trehalose-ph...  75.1    2e-12   
ref|XP_011079327.1|  PREDICTED: probable alpha,alpha-trehalose-ph...  75.1    2e-12   
ref|XP_002465620.1|  hypothetical protein SORBIDRAFT_01g042380        74.7    3e-12   
ref|XP_006578621.1|  PREDICTED: probable alpha,alpha-trehalose-ph...  74.7    3e-12   
ref|XP_011069859.1|  PREDICTED: probable alpha,alpha-trehalose-ph...  74.7    3e-12   
ref|XP_003519705.1|  PREDICTED: probable alpha,alpha-trehalose-ph...  74.7    3e-12   
ref|XP_009783894.1|  PREDICTED: probable alpha,alpha-trehalose-ph...  74.3    3e-12   
ref|XP_004985151.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...  73.9    4e-12   
ref|XP_010268369.1|  PREDICTED: probable alpha,alpha-trehalose-ph...  73.9    5e-12   
ref|XP_007225259.1|  hypothetical protein PRUPE_ppa001556mg           73.9    5e-12   
ref|XP_009391250.1|  PREDICTED: probable alpha,alpha-trehalose-ph...  73.9    5e-12   
ref|NP_001063104.1|  Os09g0397300                                     73.2    8e-12   
gb|AEO13239.1|  trehalose-6-phosphate synthase                        72.8    1e-11   
emb|CDX91726.1|  BnaC08g06450D                                        72.8    1e-11   
ref|XP_010107455.1|  putative alpha,alpha-trehalose-phosphate syn...  72.4    2e-11   
gb|AGD98700.1|  trehalose-6-phosphate synthase                        72.4    2e-11   
emb|CDY62994.1|  BnaCnng41250D                                        72.0    2e-11   
ref|XP_007155406.1|  hypothetical protein PHAVU_003G198800g           72.0    2e-11   
ref|XP_009768810.1|  PREDICTED: probable alpha,alpha-trehalose-ph...  71.6    2e-11   
ref|XP_009615328.1|  PREDICTED: probable alpha,alpha-trehalose-ph...  71.2    4e-11   
ref|XP_009391422.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...  71.2    4e-11   
gb|EYU22478.1|  hypothetical protein MIMGU_mgv1a001235mg              70.9    5e-11   
gb|EMT31860.1|  Alpha,alpha-trehalose-phosphate synthase (UDP-for...  70.9    5e-11   
ref|XP_008239739.1|  PREDICTED: probable alpha,alpha-trehalose-ph...  70.5    6e-11   
ref|XP_009615327.1|  PREDICTED: probable alpha,alpha-trehalose-ph...  70.1    8e-11   
ref|XP_003574481.1|  PREDICTED: probable alpha,alpha-trehalose-ph...  70.1    9e-11   
gb|KHN17551.1|  Putative alpha,alpha-trehalose-phosphate synthase...  69.7    1e-10   
gb|KDO82521.1|  hypothetical protein CISIN_1g002979mg                 69.3    1e-10   
gb|EEC74792.1|  hypothetical protein OsI_10580                        69.3    2e-10   
gb|KDO82516.1|  hypothetical protein CISIN_1g002979mg                 69.3    2e-10   
gb|AAN52740.1|  Putative trehalose-6-phosphate synthase               69.3    2e-10   
ref|XP_006438435.1|  hypothetical protein CICLE_v10030691mg           69.3    2e-10   
ref|XP_011010033.1|  PREDICTED: probable alpha,alpha-trehalose-ph...  68.9    2e-10   
ref|XP_007225309.1|  hypothetical protein PRUPE_ppa001295mg           68.6    3e-10   
gb|KJB08195.1|  hypothetical protein B456_001G070500                  68.6    3e-10   
ref|XP_009103647.1|  PREDICTED: probable alpha,alpha-trehalose-ph...  68.2    3e-10   
ref|XP_009417681.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...  68.2    3e-10   
emb|CDY24516.1|  BnaA01g22200D                                        68.2    3e-10   
ref|XP_003525494.1|  PREDICTED: probable alpha,alpha-trehalose-ph...  67.8    5e-10   
ref|XP_011086535.1|  PREDICTED: probable alpha,alpha-trehalose-ph...  67.8    6e-10   
gb|EEC84539.1|  hypothetical protein OsI_31278                        67.8    6e-10   
gb|AEB53185.1|  trehalose-6-phosphate synthase 10                     67.8    6e-10   
ref|XP_009127784.1|  PREDICTED: LOW QUALITY PROTEIN: probable alp...  67.4    6e-10   
ref|XP_011071074.1|  PREDICTED: probable alpha,alpha-trehalose-ph...  67.4    7e-10   
gb|EPS67351.1|  hypothetical protein M569_07419                       67.0    8e-10   
gb|KJB08196.1|  hypothetical protein B456_001G070500                  67.0    9e-10   
ref|XP_006660589.1|  PREDICTED: probable alpha,alpha-trehalose-ph...  67.0    1e-09   
gb|EYU42464.1|  hypothetical protein MIMGU_mgv1a001200mg              67.0    1e-09   
ref|XP_010913570.1|  PREDICTED: probable alpha,alpha-trehalose-ph...  67.0    1e-09   
ref|XP_004501945.1|  PREDICTED: probable alpha,alpha-trehalose-ph...  67.0    1e-09   
ref|XP_008223545.1|  PREDICTED: probable alpha,alpha-trehalose-ph...  66.6    1e-09   
tpg|DAA61259.1|  TPA: putative trehalose phosphatase/synthase fam...  63.5    1e-09   
emb|CDY31598.1|  BnaA03g54540D                                        65.9    2e-09   
emb|CDY54952.1|  BnaC01g43070D                                        65.9    2e-09   
ref|XP_009138560.1|  PREDICTED: probable alpha,alpha-trehalose-ph...  65.1    4e-09   
ref|XP_002308438.1|  glycosyl transferase family 20 family protein    64.7    4e-09   
ref|XP_010228946.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...  64.7    5e-09   
ref|XP_003558453.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...  64.7    5e-09   
ref|XP_008221778.1|  PREDICTED: probable alpha,alpha-trehalose-ph...  64.3    6e-09   
ref|XP_007227009.1|  hypothetical protein PRUPE_ppa001301mg           63.5    1e-08   
ref|XP_009363520.1|  PREDICTED: probable alpha,alpha-trehalose-ph...  63.2    2e-08   
ref|XP_008779630.1|  PREDICTED: probable alpha,alpha-trehalose-ph...  63.2    2e-08   
ref|XP_006300612.1|  hypothetical protein CARUB_v10019802mg           62.8    2e-08   
ref|XP_004138116.1|  PREDICTED: probable alpha,alpha-trehalose-ph...  62.4    3e-08   
ref|XP_004166499.1|  PREDICTED: LOW QUALITY PROTEIN: probable alp...  62.4    3e-08   
ref|XP_002462305.1|  hypothetical protein SORBIDRAFT_02g023610        62.4    3e-08   
ref|XP_006453464.1|  hypothetical protein CICLE_v10007428mg           61.6    4e-08   
ref|XP_009788844.1|  PREDICTED: probable alpha,alpha-trehalose-ph...  61.6    5e-08   
ref|XP_008389621.1|  PREDICTED: LOW QUALITY PROTEIN: probable alp...  61.6    5e-08   
ref|XP_006453465.1|  hypothetical protein CICLE_v10007428mg           61.6    5e-08   
ref|NP_001063045.1|  Os09g0376800                                     60.5    9e-08   
ref|XP_008393046.1|  PREDICTED: probable alpha,alpha-trehalose-ph...  60.5    1e-07   
gb|AEB53186.1|  trehalose-6-phosphate synthase 11                     60.5    1e-07   
gb|EEC84489.1|  hypothetical protein OsI_31155                        60.5    1e-07   
gb|KDO62387.1|  hypothetical protein CISIN_1g003042mg                 60.1    1e-07   
ref|XP_008453107.1|  PREDICTED: probable alpha,alpha-trehalose-ph...  60.1    2e-07   
gb|KDO62386.1|  hypothetical protein CISIN_1g003042mg                 60.1    2e-07   
ref|XP_011018125.1|  PREDICTED: probable alpha,alpha-trehalose-ph...  60.1    2e-07   
gb|KDO62385.1|  hypothetical protein CISIN_1g003042mg                 60.1    2e-07   
ref|XP_002325087.2|  hypothetical protein POPTR_0018s10680g           60.1    2e-07   
ref|XP_010913571.1|  PREDICTED: probable alpha,alpha-trehalose-ph...  59.3    3e-07   
ref|XP_004956710.1|  PREDICTED: probable alpha,alpha-trehalose-ph...  59.3    3e-07   
ref|NP_001241723.1|  trehalose 6-phosphate synthase                   58.9    3e-07   
ref|XP_009625114.1|  PREDICTED: probable alpha,alpha-trehalose-ph...  58.9    4e-07   
ref|XP_004498235.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...  58.9    4e-07   
ref|XP_008667005.1|  PREDICTED: uncharacterized protein LOC100191...  58.9    4e-07   
ref|XP_007138100.1|  hypothetical protein PHAVU_009G180300g           58.9    4e-07   
gb|AAC18810.1|  Strong similarity to trehalose-6-phosphate syntha...  58.5    4e-07   
ref|XP_010678736.1|  PREDICTED: probable alpha,alpha-trehalose-ph...  58.5    5e-07   
emb|CBI15059.3|  unnamed protein product                              58.2    6e-07   
ref|XP_010477693.1|  PREDICTED: probable alpha,alpha-trehalose-ph...  58.2    6e-07   
gb|KDP34244.1|  hypothetical protein JCGZ_07815                       58.2    7e-07   
ref|XP_006844250.1|  hypothetical protein AMTR_s00006p00269110        57.8    9e-07   
emb|CDP17241.1|  unnamed protein product                              53.1    1e-06   
emb|CDY03758.1|  BnaA02g14790D                                        57.4    1e-06   
ref|XP_006651181.1|  PREDICTED: alpha,alpha-trehalose-phosphate s...  57.4    1e-06   
emb|CDY43001.1|  BnaC02g19750D                                        57.4    1e-06   



>ref|XP_009606207.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5 [Nicotiana tomentosiformis]
 ref|XP_009606214.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5 [Nicotiana tomentosiformis]
Length=862

 Score =   181 bits (459),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 91/101 (90%), Positives = 94/101 (93%), Gaps = 1/101 (1%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  364
            MVSRSYSNLLDL SG+S TFGR G+KLSRVATVAGVLSELDDE+RSN  SD PSSISQER
Sbjct  1    MVSRSYSNLLDLTSGDSPTFGRGGRKLSRVATVAGVLSELDDENRSNA-SDAPSSISQER  59

Query  365  MIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            MIIVGNQLPLRAHRRTDGEEGWNF WDEDSLLLQLKDGLGE
Sbjct  60   MIIVGNQLPLRAHRRTDGEEGWNFSWDEDSLLLQLKDGLGE  100



>ref|XP_009788524.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5 [Nicotiana sylvestris]
 ref|XP_009788525.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5 [Nicotiana sylvestris]
 ref|XP_009788526.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5 [Nicotiana sylvestris]
Length=862

 Score =   179 bits (454),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 90/101 (89%), Positives = 95/101 (94%), Gaps = 1/101 (1%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  364
            MVSRSYSNLLDL SG+S TFGR+G+KLSRVATVAGVLSELDDE+RSN  SD PSSISQER
Sbjct  1    MVSRSYSNLLDLTSGDSPTFGRSGRKLSRVATVAGVLSELDDENRSNA-SDAPSSISQER  59

Query  365  MIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            MIIVGNQLPLRA+RRTDGEEGWNF WDEDSLLLQLKDGLGE
Sbjct  60   MIIVGNQLPLRAYRRTDGEEGWNFSWDEDSLLLQLKDGLGE  100



>ref|XP_006352881.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5-like isoform X1 [Solanum tuberosum]
 ref|XP_006352882.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5-like isoform X2 [Solanum tuberosum]
Length=862

 Score =   179 bits (453),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 89/101 (88%), Positives = 93/101 (92%), Gaps = 1/101 (1%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  364
            MVSRSYSNLLDL SG+S TFGR G+KLSRVATVAGVLSELDDESRSN  SD PSS++QER
Sbjct  1    MVSRSYSNLLDLTSGDSPTFGRGGRKLSRVATVAGVLSELDDESRSNA-SDAPSSVTQER  59

Query  365  MIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            MIIVGNQLPLRAHRR DGEEGWNF WDEDSLLLQLKDGLGE
Sbjct  60   MIIVGNQLPLRAHRRKDGEEGWNFSWDEDSLLLQLKDGLGE  100



>ref|XP_004245918.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5 [Solanum lycopersicum]
 ref|XP_010325563.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5 [Solanum lycopersicum]
Length=862

 Score =   176 bits (445),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 88/101 (87%), Positives = 92/101 (91%), Gaps = 1/101 (1%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  364
            MVSRSYSNLLDL S +S TFGR G+KLSRVATVAGVLSELDDESRSN  SD PSS++QER
Sbjct  1    MVSRSYSNLLDLISDDSPTFGRGGRKLSRVATVAGVLSELDDESRSNA-SDAPSSVTQER  59

Query  365  MIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            MIIVGNQLPLRAHRR DGEEGWNF WDEDSLLLQLKDGLGE
Sbjct  60   MIIVGNQLPLRAHRRQDGEEGWNFSWDEDSLLLQLKDGLGE  100



>ref|XP_011070302.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5 isoform X1 [Sesamum indicum]
 ref|XP_011070303.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5 isoform X1 [Sesamum indicum]
Length=864

 Score =   172 bits (435),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 86/102 (84%), Positives = 92/102 (90%), Gaps = 1/102 (1%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  364
            MVSRSYSNLLDL SG S TF R GKK  RVATVAGVLS+LDDE+RSNGGSD PSSISQER
Sbjct  1    MVSRSYSNLLDLTSGGSPTFSRGGKKFPRVATVAGVLSDLDDENRSNGGSDAPSSISQER  60

Query  365  MIIVGNQLPLRAHRR-TDGEEGWNFXWDEDSLLLQLKDGLGE  487
            MIIVGNQLPLRAHRR +DG++GW+F WDEDSLLLQLKDGLGE
Sbjct  61   MIIVGNQLPLRAHRRESDGDKGWDFSWDEDSLLLQLKDGLGE  102



>ref|XP_010245191.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5-like [Nelumbo nucifera]
 ref|XP_010245192.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5-like [Nelumbo nucifera]
 ref|XP_010245193.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5-like [Nelumbo nucifera]
 ref|XP_010245194.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5-like [Nelumbo nucifera]
Length=856

 Score =   164 bits (415),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 76/101 (75%), Positives = 91/101 (90%), Gaps = 0/101 (0%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  364
            MVSRSYSNLL+LASG+S TFG+ GK+L RV TVAG++SELDDE+ ++  SD PSS++QER
Sbjct  1    MVSRSYSNLLELASGDSPTFGKVGKRLPRVMTVAGIISELDDENSNSASSDAPSSVTQER  60

Query  365  MIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            +IIVGNQLP+RAHRR+DG+ GWNF WDEDSLLLQLKDGLGE
Sbjct  61   IIIVGNQLPIRAHRRSDGDGGWNFSWDEDSLLLQLKDGLGE  101



>ref|XP_002277503.2| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5 [Vitis vinifera]
 ref|XP_010663329.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5 [Vitis vinifera]
 ref|XP_010663335.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5 [Vitis vinifera]
Length=864

 Score =   161 bits (407),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 80/101 (79%), Positives = 88/101 (87%), Gaps = 0/101 (0%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  364
            MVSRSYSNLLDL SG+S TFGR GKK+SRVATVAGVLSELDDE+ ++  SD PSS+SQ+R
Sbjct  1    MVSRSYSNLLDLVSGDSPTFGRGGKKISRVATVAGVLSELDDETSNSVTSDAPSSVSQDR  60

Query  365  MIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            MIIVGNQLPLRAHR +DG   W F WDEDSLLLQLKDGLGE
Sbjct  61   MIIVGNQLPLRAHRSSDGSGEWCFSWDEDSLLLQLKDGLGE  101



>emb|CAN61971.1| hypothetical protein VITISV_016593 [Vitis vinifera]
Length=859

 Score =   161 bits (407),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 80/101 (79%), Positives = 88/101 (87%), Gaps = 0/101 (0%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  364
            MVSRSYSNLLDL SG+S TFGR GKK+SRVATVAGVLSELDDE+ ++  SD PSS+SQ+R
Sbjct  1    MVSRSYSNLLDLVSGDSPTFGRGGKKISRVATVAGVLSELDDETSNSVTSDAPSSVSQDR  60

Query  365  MIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            MIIVGNQLPLRAHR +DG   W F WDEDSLLLQLKDGLGE
Sbjct  61   MIIVGNQLPLRAHRSSDGSGEWCFSWDEDSLLLQLKDGLGE  101



>ref|XP_006432795.1| hypothetical protein CICLE_v10000247mg [Citrus clementina]
 gb|ESR46035.1| hypothetical protein CICLE_v10000247mg [Citrus clementina]
Length=757

 Score =   158 bits (400),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 78/101 (77%), Positives = 86/101 (85%), Gaps = 0/101 (0%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  364
            MVSRSYSNLLDLASG+   F R  K+L RVATVAGVLSE+DDE+ ++ GSD PSS+SQER
Sbjct  1    MVSRSYSNLLDLASGDFPNFSREKKRLPRVATVAGVLSEIDDENSNSVGSDAPSSVSQER  60

Query  365  MIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            MIIVGNQLPLRAHR +DG  GW F WDEDSLLLQLKDGLGE
Sbjct  61   MIIVGNQLPLRAHRSSDGSGGWTFSWDEDSLLLQLKDGLGE  101



>ref|XP_002527658.1| trehalose-6-phosphate synthase, putative [Ricinus communis]
 gb|EEF34729.1| trehalose-6-phosphate synthase, putative [Ricinus communis]
Length=814

 Score =   158 bits (400),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 80/101 (79%), Positives = 85/101 (84%), Gaps = 0/101 (0%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  364
            MVSRSYSNLLDL SG   TFGR  K+L RVATVAGVLSELDDE+ ++ GSD PSS+SQER
Sbjct  1    MVSRSYSNLLDLTSGGIPTFGREKKRLPRVATVAGVLSELDDENSNSVGSDAPSSVSQER  60

Query  365  MIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            MIIVGNQLPLRAHR  DG E W F WDEDSLLLQLKDGLGE
Sbjct  61   MIIVGNQLPLRAHRSPDGSEEWCFSWDEDSLLLQLKDGLGE  101



>ref|XP_006432796.1| hypothetical protein CICLE_v10000247mg [Citrus clementina]
 ref|XP_006432797.1| hypothetical protein CICLE_v10000247mg [Citrus clementina]
 ref|XP_006432798.1| hypothetical protein CICLE_v10000247mg [Citrus clementina]
 ref|XP_006432799.1| hypothetical protein CICLE_v10000247mg [Citrus clementina]
 ref|XP_006471585.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5-like isoform X1 [Citrus sinensis]
 ref|XP_006471586.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5-like isoform X2 [Citrus sinensis]
 ref|XP_006471587.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5-like isoform X3 [Citrus sinensis]
 ref|XP_006471588.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5-like isoform X4 [Citrus sinensis]
 ref|XP_006471589.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5-like isoform X5 [Citrus sinensis]
 ref|XP_006471590.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5-like isoform X6 [Citrus sinensis]
 gb|ESR46036.1| hypothetical protein CICLE_v10000247mg [Citrus clementina]
 gb|ESR46037.1| hypothetical protein CICLE_v10000247mg [Citrus clementina]
 gb|ESR46038.1| hypothetical protein CICLE_v10000247mg [Citrus clementina]
 gb|ESR46039.1| hypothetical protein CICLE_v10000247mg [Citrus clementina]
 gb|KDO53149.1| hypothetical protein CISIN_1g002958mg [Citrus sinensis]
 gb|KDO53150.1| hypothetical protein CISIN_1g002958mg [Citrus sinensis]
 gb|KDO53151.1| hypothetical protein CISIN_1g002958mg [Citrus sinensis]
 gb|KDO53152.1| hypothetical protein CISIN_1g002958mg [Citrus sinensis]
 gb|KDO53153.1| hypothetical protein CISIN_1g002958mg [Citrus sinensis]
 gb|KDO53154.1| hypothetical protein CISIN_1g002958mg [Citrus sinensis]
 gb|KDO53155.1| hypothetical protein CISIN_1g002958mg [Citrus sinensis]
 gb|KDO53156.1| hypothetical protein CISIN_1g002958mg [Citrus sinensis]
Length=863

 Score =   158 bits (400),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 78/101 (77%), Positives = 86/101 (85%), Gaps = 0/101 (0%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  364
            MVSRSYSNLLDLASG+   F R  K+L RVATVAGVLSE+DDE+ ++ GSD PSS+SQER
Sbjct  1    MVSRSYSNLLDLASGDFPNFSREKKRLPRVATVAGVLSEIDDENSNSVGSDAPSSVSQER  60

Query  365  MIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            MIIVGNQLPLRAHR +DG  GW F WDEDSLLLQLKDGLGE
Sbjct  61   MIIVGNQLPLRAHRSSDGSGGWTFSWDEDSLLLQLKDGLGE  101



>ref|XP_008238210.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5 [Prunus mume]
Length=858

 Score =   157 bits (397),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 79/101 (78%), Positives = 87/101 (86%), Gaps = 2/101 (2%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  364
            MVSRSYSNLLDL SG+S TFGR  K+  RVATVAGVLSELDD++ ++ GSD PSSI+QER
Sbjct  1    MVSRSYSNLLDLTSGDSPTFGREKKRFPRVATVAGVLSELDDDNSNSVGSDAPSSIAQER  60

Query  365  MIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            MIIVGNQLP+RAHRR DGE  W F WDEDSLLLQLKDGLGE
Sbjct  61   MIIVGNQLPIRAHRRDDGE--WYFSWDEDSLLLQLKDGLGE  99



>ref|XP_007210367.1| hypothetical protein PRUPE_ppa001305mg [Prunus persica]
 gb|EMJ11566.1| hypothetical protein PRUPE_ppa001305mg [Prunus persica]
Length=858

 Score =   157 bits (397),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 79/101 (78%), Positives = 87/101 (86%), Gaps = 2/101 (2%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  364
            MVSRSYSNLLDL SG+S TFGR  K+  RVATVAGVLSELDD++ ++ GSD PSSI+QER
Sbjct  1    MVSRSYSNLLDLTSGDSPTFGREKKRFPRVATVAGVLSELDDDNSNSVGSDAPSSIAQER  60

Query  365  MIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            MIIVGNQLP+RAHRR DGE  W F WDEDSLLLQLKDGLGE
Sbjct  61   MIIVGNQLPIRAHRRDDGE--WYFSWDEDSLLLQLKDGLGE  99



>ref|XP_009401244.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5 [Musa acuminata subsp. malaccensis]
 ref|XP_009401245.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5 [Musa acuminata subsp. malaccensis]
 ref|XP_009401247.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5 [Musa acuminata subsp. malaccensis]
 ref|XP_009401248.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5 [Musa acuminata subsp. malaccensis]
Length=857

 Score =   156 bits (394),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 77/101 (76%), Positives = 88/101 (87%), Gaps = 1/101 (1%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  364
            MVSRSYSNLLDLASGE   FGR GKKL RV TVAG++S+LD+E+ ++  SD PSS+SQ+R
Sbjct  1    MVSRSYSNLLDLASGEFPAFGRTGKKLPRVMTVAGIISDLDEENTNSMTSDGPSSVSQDR  60

Query  365  MIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            MIIVGNQLP+RAHRR DG +GWNF WDEDSLLLQLKDGLGE
Sbjct  61   MIIVGNQLPIRAHRRPDG-KGWNFSWDEDSLLLQLKDGLGE  100



>ref|XP_004300232.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5 [Fragaria vesca subsp. vesca]
Length=861

 Score =   155 bits (393),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 81/102 (79%), Positives = 87/102 (85%), Gaps = 3/102 (3%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNG-GSDVPSSISQE  361
            MVSRSYSNLLDL SG+SLTFGR  K+  RVATVAGVLSELDD++ +N  GSD PSSISQ+
Sbjct  1    MVSRSYSNLLDLTSGDSLTFGREKKRFPRVATVAGVLSELDDDASNNSVGSDAPSSISQD  60

Query  362  RMIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            RMIIVGNQLPLRAHR  DGE  W F WDEDSLLLQLKDGLGE
Sbjct  61   RMIIVGNQLPLRAHRSDDGE--WCFSWDEDSLLLQLKDGLGE  100



>gb|EYU33434.1| hypothetical protein MIMGU_mgv1a001209mg [Erythranthe guttata]
Length=866

 Score =   155 bits (393),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 81/104 (78%), Positives = 89/104 (86%), Gaps = 3/104 (3%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGE-SLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQE  361
            MVSRSYSNLLDL SG  S TFGR GKK  RVATVAGVLSEL+DE+RSN GS+ PSSISQ+
Sbjct  1    MVSRSYSNLLDLTSGSGSPTFGREGKKFPRVATVAGVLSELEDENRSNLGSETPSSISQD  60

Query  362  RMIIVGNQLPLRAHRR--TDGEEGWNFXWDEDSLLLQLKDGLGE  487
            RMIIVGNQLPLRAHR   +DG++ W F WDEDSLLLQLKDGLG+
Sbjct  61   RMIIVGNQLPLRAHRTESSDGKKHWTFSWDEDSLLLQLKDGLGD  104



>gb|AJO70167.1| alpha,alpha-trehalose-phosphate synthase 5 [Camellia sinensis]
Length=863

 Score =   155 bits (393),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 75/101 (74%), Positives = 88/101 (87%), Gaps = 0/101 (0%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  364
            MVSRSYSNLLDL SG S  FGR G+K SRVATVAGVLSELDD++ ++ GSD PSS+SQ+R
Sbjct  1    MVSRSYSNLLDLTSGGSPNFGRGGRKFSRVATVAGVLSELDDDNCNSVGSDAPSSVSQDR  60

Query  365  MIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            +IIVGNQLPL+AH+ +D + GWNF WDEDSLLLQLKDGLG+
Sbjct  61   IIIVGNQLPLKAHKSSDNDGGWNFSWDEDSLLLQLKDGLGD  101



>ref|XP_009371197.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5 [Pyrus x bretschneideri]
 ref|XP_009371198.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5 [Pyrus x bretschneideri]
 ref|XP_009371199.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5 [Pyrus x bretschneideri]
Length=860

 Score =   152 bits (385),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 77/101 (76%), Positives = 85/101 (84%), Gaps = 2/101 (2%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  364
            MVSRSYS+LLDL S +S TFGR  K+  RVATVAGVLSE DD++ ++ GSD PSSI+QER
Sbjct  1    MVSRSYSSLLDLTSSDSPTFGREKKRFPRVATVAGVLSEFDDDNSNSVGSDAPSSIAQER  60

Query  365  MIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            MIIVGNQLPLRAHRR DGE  W F WDEDSLLLQLKDGLGE
Sbjct  61   MIIVGNQLPLRAHRRDDGE--WYFSWDEDSLLLQLKDGLGE  99



>ref|XP_002304347.1| glycosyl transferase family 20 family protein [Populus trichocarpa]
 gb|EEE79326.1| glycosyl transferase family 20 family protein [Populus trichocarpa]
Length=861

 Score =   151 bits (381),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 76/101 (75%), Positives = 85/101 (84%), Gaps = 2/101 (2%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  364
            MVSRSYSNLLDLASG++  FGR  K+L RVATVAG+L++LDDE+  +  SD PSS+SQER
Sbjct  1    MVSRSYSNLLDLASGDAPNFGRERKRLPRVATVAGILTDLDDEN--SVSSDAPSSVSQER  58

Query  365  MIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            MIIVGNQLPLRAHR  DG  GW F WDEDSLLLQLKDGLGE
Sbjct  59   MIIVGNQLPLRAHRSPDGSGGWCFSWDEDSLLLQLKDGLGE  99



>ref|XP_010096957.1| Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 5 [Morus 
notabilis]
 gb|EXB66534.1| Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 5 [Morus 
notabilis]
Length=857

 Score =   150 bits (380),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 76/101 (75%), Positives = 87/101 (86%), Gaps = 2/101 (2%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  364
            MVSRSYSNLLDLASG S TFGR  K+L RVATVAGVLSE+DD++ ++ GSD PSS+SQER
Sbjct  1    MVSRSYSNLLDLASGGSPTFGRERKRLPRVATVAGVLSEIDDDNTNSVGSDAPSSVSQER  60

Query  365  MIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            MIIVGNQLPL+  RR +G+  W+F WDEDSLLLQLKDGLGE
Sbjct  61   MIIVGNQLPLKVQRRENGD--WDFSWDEDSLLLQLKDGLGE  99



>gb|KDP26189.1| hypothetical protein JCGZ_22685 [Jatropha curcas]
Length=865

 Score =   150 bits (380),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 77/101 (76%), Positives = 84/101 (83%), Gaps = 0/101 (0%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  364
            MVSRSYSNLLDLASG+S T  R  K+L RVATVAGVLSELDDE+ ++  SD PSSISQER
Sbjct  1    MVSRSYSNLLDLASGQSPTLSRERKRLPRVATVAGVLSELDDENSNSVSSDAPSSISQER  60

Query  365  MIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            MIIVGNQLPLRA++  DG   W F WDEDSLLLQLKDGLGE
Sbjct  61   MIIVGNQLPLRAYKSPDGSGEWCFSWDEDSLLLQLKDGLGE  101



>ref|XP_007040645.1| Trehalose phosphatase/synthase 5 isoform 3, partial [Theobroma 
cacao]
 gb|EOY25146.1| Trehalose phosphatase/synthase 5 isoform 3, partial [Theobroma 
cacao]
Length=761

 Score =   148 bits (373),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 75/101 (74%), Positives = 85/101 (84%), Gaps = 1/101 (1%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  364
            MVSRSYSNLLDLASG+S TFGR  K+  RVATV G+LSE+DD++ ++ GSD PSS+SQER
Sbjct  1    MVSRSYSNLLDLASGDSPTFGREKKRFPRVATVPGLLSEVDDDNCNSVGSDAPSSVSQER  60

Query  365  MIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            MIIVGNQLPLR+HR  D  E W F WDEDSLLLQLKDGLGE
Sbjct  61   MIIVGNQLPLRSHRNADDGE-WCFSWDEDSLLLQLKDGLGE  100



>ref|XP_007040643.1| Trehalose phosphatase/synthase 5 isoform 1 [Theobroma cacao]
 ref|XP_007040644.1| Trehalose phosphatase/synthase 5 isoform 1 [Theobroma cacao]
 gb|EOY25144.1| Trehalose phosphatase/synthase 5 isoform 1 [Theobroma cacao]
 gb|EOY25145.1| Trehalose phosphatase/synthase 5 isoform 1 [Theobroma cacao]
Length=862

 Score =   148 bits (374),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 75/101 (74%), Positives = 85/101 (84%), Gaps = 1/101 (1%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  364
            MVSRSYSNLLDLASG+S TFGR  K+  RVATV G+LSE+DD++ ++ GSD PSS+SQER
Sbjct  1    MVSRSYSNLLDLASGDSPTFGREKKRFPRVATVPGLLSEVDDDNCNSVGSDAPSSVSQER  60

Query  365  MIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            MIIVGNQLPLR+HR  D  E W F WDEDSLLLQLKDGLGE
Sbjct  61   MIIVGNQLPLRSHRNADDGE-WCFSWDEDSLLLQLKDGLGE  100



>gb|KHN42432.1| Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 5 [Glycine 
soja]
Length=852

 Score =   147 bits (371),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 75/101 (74%), Positives = 84/101 (83%), Gaps = 2/101 (2%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  364
            MVSRSYSNLLDL S  S TFGR  K+L RVATVAGVLSELDDE+ ++  SD PSS+SQER
Sbjct  1    MVSRSYSNLLDLTSCGSPTFGREKKRLPRVATVAGVLSELDDETSNSVCSDTPSSVSQER  60

Query  365  MIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            MIIVGNQLPL+AHR+ +G   W F WDEDSLLLQLKDGLG+
Sbjct  61   MIIVGNQLPLKAHRKDNG--TWEFTWDEDSLLLQLKDGLGD  99



>ref|XP_006605933.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5-like isoform X1 [Glycine max]
 ref|XP_006605934.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5-like isoform X2 [Glycine max]
 ref|XP_006605935.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5-like isoform X3 [Glycine max]
 ref|XP_006605936.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5-like isoform X4 [Glycine max]
Length=852

 Score =   147 bits (370),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 75/101 (74%), Positives = 84/101 (83%), Gaps = 2/101 (2%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  364
            MVSRSYSNLLDL S  S TFGR  K+L RVATVAGVLSELDDE+ ++  SD PSS+SQER
Sbjct  1    MVSRSYSNLLDLTSCGSPTFGREKKRLPRVATVAGVLSELDDETSNSVCSDTPSSVSQER  60

Query  365  MIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            MIIVGNQLPL+AHR+ +G   W F WDEDSLLLQLKDGLG+
Sbjct  61   MIIVGNQLPLKAHRKDNG--TWEFTWDEDSLLLQLKDGLGD  99



>ref|XP_011028149.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5-like isoform X3 [Populus euphratica]
Length=667

 Score =   144 bits (364),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 74/101 (73%), Positives = 83/101 (82%), Gaps = 2/101 (2%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  364
            MVSRSYSNLLDLASG++  FGR  K+L RVATVAG+L++LDDE+  +  SD PSS+SQER
Sbjct  1    MVSRSYSNLLDLASGDAPNFGRERKRLPRVATVAGILTDLDDEN--SVSSDAPSSVSQER  58

Query  365  MIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            MIIVGNQLPLRA R   G  GW F WDEDSLLLQLKDGLGE
Sbjct  59   MIIVGNQLPLRARRSPGGSGGWCFSWDEDSLLLQLKDGLGE  99



>ref|XP_011028148.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5-like isoform X2 [Populus euphratica]
Length=673

 Score =   144 bits (364),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 74/101 (73%), Positives = 83/101 (82%), Gaps = 2/101 (2%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  364
            MVSRSYSNLLDLASG++  FGR  K+L RVATVAG+L++LDDE+  +  SD PSS+SQER
Sbjct  1    MVSRSYSNLLDLASGDAPNFGRERKRLPRVATVAGILTDLDDEN--SVSSDAPSSVSQER  58

Query  365  MIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            MIIVGNQLPLRA R   G  GW F WDEDSLLLQLKDGLGE
Sbjct  59   MIIVGNQLPLRARRSPGGSGGWCFSWDEDSLLLQLKDGLGE  99



>ref|XP_008800104.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5 [Phoenix dactylifera]
 ref|XP_008800105.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5 [Phoenix dactylifera]
 ref|XP_008800106.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5 [Phoenix dactylifera]
 ref|XP_008800107.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5 [Phoenix dactylifera]
 ref|XP_008800109.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5 [Phoenix dactylifera]
 ref|XP_008800110.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5 [Phoenix dactylifera]
 ref|XP_008800111.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5 [Phoenix dactylifera]
Length=859

 Score =   145 bits (366),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 72/101 (71%), Positives = 86/101 (85%), Gaps = 1/101 (1%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  364
            MVSRSYSNLLDL +G S T+GR GK+L RV TVAG++ +LD+E+ ++ GS+  SS+SQER
Sbjct  1    MVSRSYSNLLDLVTGGSPTYGRLGKRLPRVMTVAGIICDLDEENSNSVGSEALSSVSQER  60

Query  365  MIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            +IIVGNQLPLRAHRR D + GWNF WDEDSLLLQLKDGLGE
Sbjct  61   VIIVGNQLPLRAHRRPD-DSGWNFSWDEDSLLLQLKDGLGE  100



>ref|XP_010908489.1| PREDICTED: LOW QUALITY PROTEIN: alpha,alpha-trehalose-phosphate 
synthase [UDP-forming] 5-like [Elaeis guineensis]
Length=857

 Score =   145 bits (365),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 74/101 (73%), Positives = 86/101 (85%), Gaps = 3/101 (3%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  364
            MVSRSYSNLLDL SG+S TFGR GK+L RV TVAG++S+LD+E  ++ GS+  SS+ QER
Sbjct  1    MVSRSYSNLLDLVSGDSPTFGRVGKRLPRVMTVAGIISDLDEE--NSVGSEALSSVCQER  58

Query  365  MIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            +IIVGNQLPLRAHRR D + GWNF WDEDSLLLQLKDGLGE
Sbjct  59   VIIVGNQLPLRAHRRPD-DSGWNFSWDEDSLLLQLKDGLGE  98



>ref|XP_006589670.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5-like isoform X1 [Glycine max]
 ref|XP_006589671.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5-like isoform X2 [Glycine max]
 ref|XP_006589672.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5-like isoform X3 [Glycine max]
 ref|XP_006589673.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5-like isoform X4 [Glycine max]
 ref|XP_006589674.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5-like isoform X5 [Glycine max]
 ref|XP_006589675.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5-like isoform X6 [Glycine max]
Length=853

 Score =   145 bits (365),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 74/101 (73%), Positives = 83/101 (82%), Gaps = 2/101 (2%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  364
            MVSRSYSNLLDL S  S TF R  K+L RVATVAGVLSELDDE+ ++  SD PSS+SQER
Sbjct  1    MVSRSYSNLLDLTSCGSPTFSREKKRLPRVATVAGVLSELDDETSNSVCSDTPSSVSQER  60

Query  365  MIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            MIIVGNQLPL+AHR+ +G   W F WDEDSLLLQLKDGLG+
Sbjct  61   MIIVGNQLPLKAHRKDNG--TWEFTWDEDSLLLQLKDGLGD  99



>gb|KHN06692.1| Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 5 [Glycine 
soja]
Length=853

 Score =   145 bits (365),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 74/101 (73%), Positives = 83/101 (82%), Gaps = 2/101 (2%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  364
            MVSRSYSNLLDL S  S TF R  K+L RVATVAGVLSELDDE+ ++  SD PSS+SQER
Sbjct  1    MVSRSYSNLLDLTSCGSPTFSREKKRLPRVATVAGVLSELDDETSNSVCSDTPSSVSQER  60

Query  365  MIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            MIIVGNQLPL+AHR+ +G   W F WDEDSLLLQLKDGLG+
Sbjct  61   MIIVGNQLPLKAHRKDNG--TWEFTWDEDSLLLQLKDGLGD  99



>ref|XP_011028143.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5-like isoform X1 [Populus euphratica]
 ref|XP_011028145.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5-like isoform X1 [Populus euphratica]
 ref|XP_011028146.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5-like isoform X1 [Populus euphratica]
 ref|XP_011028147.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5-like isoform X1 [Populus euphratica]
Length=861

 Score =   145 bits (365),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 74/101 (73%), Positives = 83/101 (82%), Gaps = 2/101 (2%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  364
            MVSRSYSNLLDLASG++  FGR  K+L RVATVAG+L++LDDE+  +  SD PSS+SQER
Sbjct  1    MVSRSYSNLLDLASGDAPNFGRERKRLPRVATVAGILTDLDDEN--SVSSDAPSSVSQER  58

Query  365  MIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            MIIVGNQLPLRA R   G  GW F WDEDSLLLQLKDGLGE
Sbjct  59   MIIVGNQLPLRARRSPGGSGGWCFSWDEDSLLLQLKDGLGE  99



>gb|KCW71761.1| hypothetical protein EUGRSUZ_E00259 [Eucalyptus grandis]
Length=686

 Score =   143 bits (360),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 70/101 (69%), Positives = 85/101 (84%), Gaps = 2/101 (2%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  364
            MVSRSYSNLLDL SGE+L FGR  ++ SRVATV+G LSELDD++ ++ GSD PSS+SQER
Sbjct  1    MVSRSYSNLLDLTSGEALGFGRERRRFSRVATVSGPLSELDDDNSNSVGSDAPSSLSQER  60

Query  365  MIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            MIIVGNQLP+R+H+R +GE  W F WDEDSLL QLKDG+ +
Sbjct  61   MIIVGNQLPIRSHKRDNGE--WYFSWDEDSLLYQLKDGIAQ  99



>gb|KJB39837.1| hypothetical protein B456_007G033200 [Gossypium raimondii]
 gb|KJB39838.1| hypothetical protein B456_007G033200 [Gossypium raimondii]
 gb|KJB39839.1| hypothetical protein B456_007G033200 [Gossypium raimondii]
Length=864

 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 74/101 (73%), Positives = 84/101 (83%), Gaps = 1/101 (1%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  364
            MVSRSYSNLLDLASG+S +FG   K+  RVATV G+LSE+DDE+ ++ GS+ PSS+SQER
Sbjct  1    MVSRSYSNLLDLASGDSPSFGGERKRFPRVATVPGLLSEVDDETCNSVGSEAPSSVSQER  60

Query  365  MIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            MIIVGNQLPLRAHR  D  E W F WDEDSLLLQLKDGLGE
Sbjct  61   MIIVGNQLPLRAHRNEDNGE-WCFSWDEDSLLLQLKDGLGE  100



>gb|KCW71760.1| hypothetical protein EUGRSUZ_E00259 [Eucalyptus grandis]
Length=681

 Score =   143 bits (360),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 70/101 (69%), Positives = 85/101 (84%), Gaps = 2/101 (2%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  364
            MVSRSYSNLLDL SGE+L FGR  ++ SRVATV+G LSELDD++ ++ GSD PSS+SQER
Sbjct  1    MVSRSYSNLLDLTSGEALGFGRERRRFSRVATVSGPLSELDDDNSNSVGSDAPSSLSQER  60

Query  365  MIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            MIIVGNQLP+R+H+R +GE  W F WDEDSLL QLKDG+ +
Sbjct  61   MIIVGNQLPIRSHKRDNGE--WYFSWDEDSLLYQLKDGIAQ  99



>gb|KHG14108.1| Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 5 -like 
protein [Gossypium arboreum]
Length=756

 Score =   143 bits (360),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 73/101 (72%), Positives = 84/101 (83%), Gaps = 1/101 (1%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  364
            MVSRSYSNLLDLASG+S +FG   K+  RVATV G+LSE+DDE+ ++ GS+ PSS+SQER
Sbjct  1    MVSRSYSNLLDLASGDSPSFGGERKRFPRVATVPGLLSEVDDETCNSVGSEAPSSVSQER  60

Query  365  MIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            MIIVGNQLPLRAHR  D  + W F WDEDSLLLQLKDGLGE
Sbjct  61   MIIVGNQLPLRAHRNEDNGD-WCFSWDEDSLLLQLKDGLGE  100



>gb|KEH44193.1| trehalose-6-phosphate synthase domain protein [Medicago truncatula]
Length=855

 Score =   142 bits (359),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 73/101 (72%), Positives = 83/101 (82%), Gaps = 1/101 (1%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  364
            M SRSYSNLLDL S  S +FGR  K+L RVATVAGVLSELDDE+ ++ GSD PSSISQER
Sbjct  1    MASRSYSNLLDLTSCGSPSFGREKKRLPRVATVAGVLSELDDETNNSVGSDAPSSISQER  60

Query  365  MIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            MIIVGNQLPL+A R+ +  + W F WDEDSLLLQLKDGLG+
Sbjct  61   MIIVGNQLPLKAQRKEENGK-WEFTWDEDSLLLQLKDGLGD  100



>ref|XP_010055292.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5 [Eucalyptus grandis]
 ref|XP_010055293.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5 [Eucalyptus grandis]
 gb|KCW71759.1| hypothetical protein EUGRSUZ_E00259 [Eucalyptus grandis]
Length=864

 Score =   142 bits (359),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 70/101 (69%), Positives = 85/101 (84%), Gaps = 2/101 (2%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  364
            MVSRSYSNLLDL SGE+L FGR  ++ SRVATV+G LSELDD++ ++ GSD PSS+SQER
Sbjct  1    MVSRSYSNLLDLTSGEALGFGRERRRFSRVATVSGPLSELDDDNSNSVGSDAPSSLSQER  60

Query  365  MIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            MIIVGNQLP+R+H+R +GE  W F WDEDSLL QLKDG+ +
Sbjct  61   MIIVGNQLPIRSHKRDNGE--WYFSWDEDSLLYQLKDGIAQ  99



>ref|XP_006854042.1| hypothetical protein AMTR_s00048p00069850 [Amborella trichopoda]
 gb|ERN15509.1| hypothetical protein AMTR_s00048p00069850 [Amborella trichopoda]
Length=852

 Score =   142 bits (359),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 71/101 (70%), Positives = 83/101 (82%), Gaps = 1/101 (1%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  364
            M SRSYSNLLDL SG S +F R GK+L RV TVAG+LSE+DDE  ++ GS+ PSSI QER
Sbjct  1    MASRSYSNLLDLTSGNSPSFNRVGKRLPRVMTVAGLLSEIDDEGSNSVGSEGPSSICQER  60

Query  365  MIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            +IIVGNQLPLRAHRR + +  W+F WDEDSLLLQL+DGLGE
Sbjct  61   IIIVGNQLPLRAHRRPN-QSSWDFSWDEDSLLLQLRDGLGE  100



>gb|AAX16014.1| trehalose-6-phosphate synthase [Ginkgo biloba]
 gb|AAX16015.1| trehalose-6-phosphate synthase [Ginkgo biloba]
Length=868

 Score =   140 bits (353),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 69/101 (68%), Positives = 80/101 (79%), Gaps = 1/101 (1%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  364
            M+SRSY+NL+DLA+G    FGRA K+L RV TV G++SELDD++ ++  SDVPSSI QER
Sbjct  1    MMSRSYTNLMDLATGNFPAFGRATKRLPRVMTVPGIISELDDDNSNSVSSDVPSSICQER  60

Query  365  MIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            MIIV NQLPLRA RR D   GW F WDEDSLLLQLKDGL E
Sbjct  61   MIIVANQLPLRAQRRPDN-RGWAFSWDEDSLLLQLKDGLAE  100



>ref|XP_004497053.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5-like isoform X4 [Cicer arietinum]
Length=841

 Score =   140 bits (353),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 73/101 (72%), Positives = 81/101 (80%), Gaps = 1/101 (1%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  364
            MVSRSYSNLLDL S  S  F R  K+L RVATVAGVLSELDDE+ ++ GSD PSSISQER
Sbjct  1    MVSRSYSNLLDLTSCGSPCFSREKKRLPRVATVAGVLSELDDETSNSVGSDAPSSISQER  60

Query  365  MIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            MIIVGNQLPL+A R+ +    W F WDEDSLLLQLKDGLG+
Sbjct  61   MIIVGNQLPLKAQRK-ENNGMWEFTWDEDSLLLQLKDGLGD  100



>ref|XP_006368376.1| hypothetical protein POPTR_0001s02190g [Populus trichocarpa]
 gb|ERP64945.1| hypothetical protein POPTR_0001s02190g [Populus trichocarpa]
Length=862

 Score =   140 bits (353),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 74/103 (72%), Positives = 83/103 (81%), Gaps = 4/103 (4%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESL--TFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQ  358
            MVSRSYSNLLDLASG++   +FGR  K+  RVATVAG+L++LDDE+  N GSD PSS+S 
Sbjct  1    MVSRSYSNLLDLASGDAPIPSFGRERKRFPRVATVAGILTDLDDEN--NVGSDSPSSVSL  58

Query  359  ERMIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
             RMIIVGNQLPLRAHR  D   GW F WDEDSLLLQLKDGLGE
Sbjct  59   GRMIIVGNQLPLRAHRSPDSSGGWCFSWDEDSLLLQLKDGLGE  101



>ref|XP_004497050.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5-like isoform X1 [Cicer arietinum]
 ref|XP_004497051.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5-like isoform X2 [Cicer arietinum]
 ref|XP_004497052.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5-like isoform X3 [Cicer arietinum]
Length=855

 Score =   140 bits (353),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 73/101 (72%), Positives = 81/101 (80%), Gaps = 1/101 (1%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  364
            MVSRSYSNLLDL S  S  F R  K+L RVATVAGVLSELDDE+ ++ GSD PSSISQER
Sbjct  1    MVSRSYSNLLDLTSCGSPCFSREKKRLPRVATVAGVLSELDDETSNSVGSDAPSSISQER  60

Query  365  MIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            MIIVGNQLPL+A R+ +    W F WDEDSLLLQLKDGLG+
Sbjct  61   MIIVGNQLPLKAQRK-ENNGMWEFTWDEDSLLLQLKDGLGD  100



>gb|KHG01348.1| Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 5 -like 
protein [Gossypium arboreum]
Length=862

 Score =   139 bits (350),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 70/101 (69%), Positives = 83/101 (82%), Gaps = 1/101 (1%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  364
            MVSRSYSNLLDLA G + T  +  K+  RVATV G+LSE++D++ ++  SD PSS+SQER
Sbjct  1    MVSRSYSNLLDLAYGGTPTLSQEKKRFPRVATVPGLLSEVEDDNCNSVSSDAPSSVSQER  60

Query  365  MIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            MIIVGNQLPLRAH+ TD +EGW F WDEDSLLLQLKDGLGE
Sbjct  61   MIIVGNQLPLRAHQNTD-DEGWCFSWDEDSLLLQLKDGLGE  100



>gb|KJB25286.1| hypothetical protein B456_004G183400 [Gossypium raimondii]
Length=760

 Score =   137 bits (345),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 69/101 (68%), Positives = 82/101 (81%), Gaps = 1/101 (1%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  364
            MVSRSYSNLLDLA G + T  +  K+  RVATV G+LSE++D++ ++  SD PSS+SQER
Sbjct  1    MVSRSYSNLLDLAYGGTPTLSQEKKRFPRVATVPGLLSEVEDDNCNSVSSDAPSSVSQER  60

Query  365  MIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            MIIVGNQLPLR H+ TD +EGW F WDEDSLLLQLKDGLGE
Sbjct  61   MIIVGNQLPLRVHQNTD-DEGWCFSWDEDSLLLQLKDGLGE  100



>gb|KJB25285.1| hypothetical protein B456_004G183400 [Gossypium raimondii]
 gb|KJB25287.1| hypothetical protein B456_004G183400 [Gossypium raimondii]
Length=862

 Score =   137 bits (346),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 69/101 (68%), Positives = 82/101 (81%), Gaps = 1/101 (1%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  364
            MVSRSYSNLLDLA G + T  +  K+  RVATV G+LSE++D++ ++  SD PSS+SQER
Sbjct  1    MVSRSYSNLLDLAYGGTPTLSQEKKRFPRVATVPGLLSEVEDDNCNSVSSDAPSSVSQER  60

Query  365  MIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            MIIVGNQLPLR H+ TD +EGW F WDEDSLLLQLKDGLGE
Sbjct  61   MIIVGNQLPLRVHQNTD-DEGWCFSWDEDSLLLQLKDGLGE  100



>ref|XP_011018523.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5 [Populus euphratica]
 ref|XP_011018524.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5 [Populus euphratica]
Length=863

 Score =   136 bits (343),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 73/104 (70%), Positives = 83/104 (80%), Gaps = 5/104 (5%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESL--TFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSIS-  355
            MVS+SYSNLLDLASG++   +FGR  K+  RVATVAG+L++LDDE+  N GSD PSS+S 
Sbjct  1    MVSKSYSNLLDLASGDAPIPSFGRERKRFPRVATVAGILTDLDDEN--NVGSDAPSSVSL  58

Query  356  QERMIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
              RMIIVGNQLPLRAHR  D   GW F WDEDSLLLQLKDGLGE
Sbjct  59   GRRMIIVGNQLPLRAHRSPDSSGGWCFNWDEDSLLLQLKDGLGE  102



>ref|XP_010677331.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5 [Beta vulgaris subsp. vulgaris]
 ref|XP_010677332.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5 [Beta vulgaris subsp. vulgaris]
Length=866

 Score =   134 bits (337),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 69/102 (68%), Positives = 81/102 (79%), Gaps = 1/102 (1%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  364
            MVSRSYSNLLDLASG+  +  R  ++  RV TVAGVLSELDDE+ ++  SD PSSI+QER
Sbjct  1    MVSRSYSNLLDLASGQFPSICRGERRFPRVKTVAGVLSELDDETSNSVSSDAPSSITQER  60

Query  365  MIIVGNQLPLRAHRRTDGEE-GWNFXWDEDSLLLQLKDGLGE  487
            +IIVGNQLPLR H ++D E+ G  F WDEDSLLLQLKDGL E
Sbjct  61   VIIVGNQLPLRVHHKSDDEKVGRYFSWDEDSLLLQLKDGLAE  102



>ref|XP_004148747.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5-like [Cucumis sativus]
 ref|XP_004165051.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5-like [Cucumis sativus]
 gb|KGN55736.1| hypothetical protein Csa_3G009420 [Cucumis sativus]
Length=864

 Score =   134 bits (336),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 72/104 (69%), Positives = 84/104 (81%), Gaps = 5/104 (5%)
 Frame = +2

Query  185  MVSRSYSNLLDLASG---ESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSIS  355
            MVSRSYSNLL+LASG    +   GR  K+L RVATVAGVLSELDD+S ++ GSD PSS+S
Sbjct  1    MVSRSYSNLLELASGGCSPTFGLGRERKRLPRVATVAGVLSELDDDSCNSTGSDAPSSVS  60

Query  356  QERMIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            Q+RMIIVGNQLP+RA+R  +G+  W F  DEDSLLLQLKDGLGE
Sbjct  61   QDRMIIVGNQLPIRANRDENGD--WEFSMDEDSLLLQLKDGLGE  102



>ref|XP_008448661.1| PREDICTED: LOW QUALITY PROTEIN: alpha,alpha-trehalose-phosphate 
synthase [UDP-forming] 5-like [Cucumis melo]
Length=864

 Score =   133 bits (334),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 71/104 (68%), Positives = 84/104 (81%), Gaps = 5/104 (5%)
 Frame = +2

Query  185  MVSRSYSNLLDLASG---ESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSIS  355
            MVSRSYSNLL+LASG    +   GR  K+L RVATVAGVLSELDD+S ++ GSD PSS++
Sbjct  1    MVSRSYSNLLELASGGCSPTFGLGRERKRLPRVATVAGVLSELDDDSCNSTGSDAPSSVA  60

Query  356  QERMIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            Q+RMIIVGNQLP+RA+R  +G+  W F  DEDSLLLQLKDGLGE
Sbjct  61   QDRMIIVGNQLPIRANRNENGD--WEFSMDEDSLLLQLKDGLGE  102



>ref|XP_006849789.1| hypothetical protein AMTR_s00176p00032980 [Amborella trichopoda]
 gb|ERN11370.1| hypothetical protein AMTR_s00176p00032980 [Amborella trichopoda]
Length=859

 Score =   132 bits (332),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 68/103 (66%), Positives = 81/103 (79%), Gaps = 3/103 (3%)
 Frame = +2

Query  185  MVSRSYSNLLDLASG-ESLTFGRAGKKLSRVATVAGVLSELDD-ESRSNGGSDVPSSISQ  358
            MVSRSYSNLLDL SG    +FGR G++L RV TV G++S+ DD  S  + GSD PSS++Q
Sbjct  1    MVSRSYSNLLDLVSGGTPPSFGRMGRRLPRVMTVPGIISDFDDGASVHSTGSDPPSSVTQ  60

Query  359  ERMIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            +R IIV NQLP+RAHRR DG +GW F WDED+LLLQLKDGLGE
Sbjct  61   DRTIIVANQLPIRAHRRDDG-KGWLFSWDEDALLLQLKDGLGE  102



>ref|XP_004293972.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 [Fragaria vesca subsp. vesca]
Length=856

 Score =   132 bits (331),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 66/101 (65%), Positives = 81/101 (80%), Gaps = 1/101 (1%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  364
            M+S+SY+NLLDLASG     GR  K+L RV TVAGV+SELDD++ ++  SDVPSSI Q+R
Sbjct  1    MMSKSYTNLLDLASGNFPIMGRERKRLPRVMTVAGVISELDDDNANSVSSDVPSSIVQDR  60

Query  365  MIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            +IIV NQLP++A RR D  +GW+F WDEDSLLLQLKDGL E
Sbjct  61   IIIVANQLPVKAKRRPDN-KGWSFSWDEDSLLLQLKDGLPE  100



>ref|XP_010242150.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 [Nelumbo nucifera]
 ref|XP_010242151.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 [Nelumbo nucifera]
Length=848

 Score =   130 bits (328),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 65/101 (64%), Positives = 78/101 (77%), Gaps = 1/101 (1%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  364
            M+SRSY+NLLDLASG     GR  K+L RV TV G++SELDD+  ++  SDVPSSI Q+R
Sbjct  1    MLSRSYTNLLDLASGNFPALGREKKRLPRVMTVPGIVSELDDDQANSVSSDVPSSIIQDR  60

Query  365  MIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            +IIV NQLP++A RR D   GW+F WDEDSLLLQLKDGL E
Sbjct  61   IIIVANQLPVKAKRRPDN-NGWSFSWDEDSLLLQLKDGLPE  100



>ref|XP_007214619.1| hypothetical protein PRUPE_ppa001324mg [Prunus persica]
 gb|EMJ15818.1| hypothetical protein PRUPE_ppa001324mg [Prunus persica]
Length=854

 Score =   130 bits (327),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 65/101 (64%), Positives = 80/101 (79%), Gaps = 1/101 (1%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  364
            M+S+SY+NLLDLASG     GR  ++L RV TVAGV+SELDD+  ++  SDVPSSI Q+R
Sbjct  1    MMSKSYTNLLDLASGNFPIMGRERRRLPRVMTVAGVISELDDDQANSVSSDVPSSIMQDR  60

Query  365  MIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            +IIV NQLP++A RR D  +GW+F WDEDSLLLQLKDGL E
Sbjct  61   IIIVANQLPVKAKRRPDN-KGWSFSWDEDSLLLQLKDGLPE  100



>ref|XP_009351624.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 [Pyrus x bretschneideri]
Length=854

 Score =   130 bits (326),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 65/101 (64%), Positives = 79/101 (78%), Gaps = 1/101 (1%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  364
            M+S+SY+NLLDLASG     GR  ++L RV TVAGV+SELDD+   +  SDVPSSI Q+R
Sbjct  1    MMSKSYTNLLDLASGNFPVMGRERRRLPRVMTVAGVISELDDDQAGSVSSDVPSSIVQDR  60

Query  365  MIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            +IIV NQLP++A RR D  +GW+F WDEDSLLLQLKDGL E
Sbjct  61   IIIVANQLPVKAKRRPDN-KGWSFSWDEDSLLLQLKDGLPE  100



>ref|XP_008371505.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 [Malus domestica]
Length=854

 Score =   130 bits (326),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 65/101 (64%), Positives = 79/101 (78%), Gaps = 1/101 (1%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  364
            M+S+SY+NLLDLASG     GR  ++L RV TVAGV+SELDD+   +  SDVPSSI Q+R
Sbjct  1    MMSKSYTNLLDLASGNFPVMGRERRRLPRVMTVAGVISELDDDQAGSVSSDVPSSIVQDR  60

Query  365  MIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            +IIV NQLP++A RR D  +GW+F WDEDSLLLQLKDGL E
Sbjct  61   IIIVANQLPVKAKRRPDN-KGWSFSWDEDSLLLQLKDGLPE  100



>ref|XP_008383601.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 [Malus domestica]
Length=854

 Score =   128 bits (322),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 64/101 (63%), Positives = 79/101 (78%), Gaps = 1/101 (1%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  364
            M+S+SY+NLLDLASG     GR  ++L RV TVAGV+SELDD+   +  SDVPSSI Q+R
Sbjct  1    MMSKSYTNLLDLASGNFPVMGRERRRLPRVMTVAGVISELDDDQAGSVSSDVPSSIIQDR  60

Query  365  MIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            +IIV NQLP++A RR D  +GW+F WDEDSL+LQLKDGL E
Sbjct  61   IIIVANQLPVKAKRRPDN-KGWSFSWDEDSLVLQLKDGLPE  100



>ref|XP_004233035.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 [Solanum lycopersicum]
 ref|XP_010316843.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 [Solanum lycopersicum]
Length=851

 Score =   128 bits (321),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 63/101 (62%), Positives = 79/101 (78%), Gaps = 1/101 (1%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  364
            M+S+SY+NLLDLASG     GR  K+L RV TVAGV+SELDD+  ++  SDVPSSI  +R
Sbjct  1    MMSKSYTNLLDLASGNFPVMGREKKRLPRVMTVAGVISELDDDQANSVTSDVPSSIIVDR  60

Query  365  MIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            +IIV NQLP++A RR+D  +GWNF WDEDSLLL +KDGL +
Sbjct  61   IIIVANQLPVKAKRRSDN-KGWNFSWDEDSLLLHIKDGLPD  100



>ref|XP_010276860.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5-like [Nelumbo nucifera]
 ref|XP_010276862.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5-like [Nelumbo nucifera]
 ref|XP_010276863.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5-like [Nelumbo nucifera]
 ref|XP_010276864.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5-like [Nelumbo nucifera]
 ref|XP_010276865.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5-like [Nelumbo nucifera]
Length=860

 Score =   128 bits (321),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 77/105 (73%), Positives = 89/105 (85%), Gaps = 4/105 (4%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  364
            MVSRSYSNLLDL SG+S +FGR GK+L RV TVAG++SELDD++ ++  SDVPSS+SQER
Sbjct  1    MVSRSYSNLLDLVSGDSPSFGRVGKRLPRVMTVAGIMSELDDDNSNSVSSDVPSSVSQER  60

Query  365  MIIVGNQLPLRAHRRT----DGEEGWNFXWDEDSLLLQLKDGLGE  487
            MIIVGNQLPLR HRR+    DG+ G NF WDEDSLLLQLKDGLGE
Sbjct  61   MIIVGNQLPLRVHRRSDGDGDGDGGLNFSWDEDSLLLQLKDGLGE  105



>ref|XP_010518663.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5 [Tarenaya hassleriana]
 ref|XP_010518664.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5 [Tarenaya hassleriana]
Length=848

 Score =   127 bits (320),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 64/101 (63%), Positives = 77/101 (76%), Gaps = 2/101 (2%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  364
            M SRSYSNLLDLASG S T  R  K+  RVATV GVLSELD+E  +   SD PSS+ QER
Sbjct  1    MASRSYSNLLDLASGGSPTISREKKRFPRVATVPGVLSELDNEIGNGADSDAPSSVLQER  60

Query  365  MIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            +IIVGNQLP++A + +DG+  WNF WD +SLL+QLKDG+ E
Sbjct  61   LIIVGNQLPIKAQQNSDGK--WNFSWDNNSLLVQLKDGVRE  99



>emb|CAB10557.1| trehalose-6-phosphate synthase like protein [Arabidopsis thaliana]
 emb|CAB78780.1| trehalose-6-phosphate synthase like protein [Arabidopsis thaliana]
Length=865

 Score =   127 bits (319),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 69/113 (61%), Positives = 85/113 (75%), Gaps = 8/113 (7%)
 Frame = +2

Query  161  CIY---CGESTMVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNG-  328
            CIY   C +  MVSRSYSNLLDLASG   +F R  K+  RVATV GVLSELDD++ SN  
Sbjct  9    CIYFTCCRD--MVSRSYSNLLDLASGNFHSFSREKKRFPRVATVTGVLSELDDDNNSNSV  66

Query  329  GSDVPSSISQERMIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
             SD PSS++Q+R+IIVGNQLP+++HR + G+   +F WD DSLLLQLKDG+ E
Sbjct  67   CSDAPSSVTQDRIIIVGNQLPIKSHRNSAGK--LSFSWDNDSLLLQLKDGMRE  117



>gb|KDP21135.1| hypothetical protein JCGZ_21606 [Jatropha curcas]
Length=857

 Score =   127 bits (318),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 64/103 (62%), Positives = 79/103 (77%), Gaps = 3/103 (3%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFG--RAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQ  358
            M+SRSY+NLLDLASG     G  R  K+L RV TV GV+SELDD+  ++  SDVPSS+ Q
Sbjct  1    MMSRSYTNLLDLASGNFPAMGQPREKKRLPRVMTVPGVISELDDDQANSVASDVPSSVVQ  60

Query  359  ERMIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            +R+IIV NQLP++A RR D  +GW+F WDED+LLLQLKDGL E
Sbjct  61   DRIIIVANQLPVKAKRRPD-NKGWSFSWDEDALLLQLKDGLPE  102



>ref|XP_011039387.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 [Populus euphratica]
 ref|XP_011039388.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 [Populus euphratica]
Length=853

 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 66/103 (64%), Positives = 80/103 (78%), Gaps = 3/103 (3%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFG--RAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQ  358
            M+SRSY+NLLDLASG     G  R  K+L RV TV GV+SELDD+  ++  SDVPSS+ Q
Sbjct  1    MMSRSYTNLLDLASGNFPAMGQPRERKRLPRVMTVPGVISELDDDVANSVTSDVPSSVVQ  60

Query  359  ERMIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            +R+IIVGNQLP++A RR D  +GW+F WDEDSLLLQLKDGL E
Sbjct  61   DRIIIVGNQLPVKAKRRPDN-KGWSFSWDEDSLLLQLKDGLPE  102



>ref|XP_002317392.1| hypothetical protein POPTR_0011s06910g [Populus trichocarpa]
 ref|XP_006377536.1| glycosyl transferase family 20 family protein [Populus trichocarpa]
 ref|XP_006377537.1| hypothetical protein POPTR_0011s06910g [Populus trichocarpa]
 gb|EEE98004.1| hypothetical protein POPTR_0011s06910g [Populus trichocarpa]
 gb|ERP55333.1| glycosyl transferase family 20 family protein [Populus trichocarpa]
 gb|ERP55334.1| hypothetical protein POPTR_0011s06910g [Populus trichocarpa]
Length=853

 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 66/103 (64%), Positives = 80/103 (78%), Gaps = 3/103 (3%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFG--RAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQ  358
            M+SRSY+NLLDLASG     G  R  K+L RV TV GV+SELDD+  ++  SDVPSS+ Q
Sbjct  1    MMSRSYTNLLDLASGNFPAMGQPRERKRLPRVMTVPGVISELDDDVANSVTSDVPSSVVQ  60

Query  359  ERMIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            +R+IIVGNQLP++A RR D  +GW+F WDEDSLLLQLKDGL E
Sbjct  61   DRIIIVGNQLPVKAKRRPDN-KGWSFSWDEDSLLLQLKDGLPE  102



>gb|ABD65165.1| trehalose-6-phosphate synthase, putative [Brassica oleracea]
Length=857

 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 66/102 (65%), Positives = 78/102 (76%), Gaps = 3/102 (3%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNG-GSDVPSSISQE  361
            MVSRSYSNLLDLASG   +F R  K+  RVATV GVLSELDD++ SN   SD PSSI+Q+
Sbjct  1    MVSRSYSNLLDLASGNFHSFSREKKRFPRVATVTGVLSELDDDANSNSVCSDAPSSIAQD  60

Query  362  RMIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            R+IIVGNQLP+++HR   G+    F WD DSLLLQLKDG+ E
Sbjct  61   RIIIVGNQLPIKSHRNPSGK--LTFTWDNDSLLLQLKDGMRE  100



>emb|CDX90449.1| BnaA03g43320D [Brassica napus]
Length=857

 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 65/102 (64%), Positives = 79/102 (77%), Gaps = 3/102 (3%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNG-GSDVPSSISQE  361
            MVSRSYSNLLDLASG   +F R  K+  RVATV GVLSELDD++ SN   SD PSS++Q+
Sbjct  1    MVSRSYSNLLDLASGNFHSFSREKKRFPRVATVTGVLSELDDDTNSNSVCSDAPSSVAQD  60

Query  362  RMIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            R+IIVGNQLP+++HR + G+    F WD DSLLLQLKDG+ E
Sbjct  61   RIIIVGNQLPIKSHRTSSGK--LTFTWDNDSLLLQLKDGMRE  100



>ref|XP_002522255.1| trehalose-6-phosphate synthase, putative [Ricinus communis]
 gb|EEF40113.1| trehalose-6-phosphate synthase, putative [Ricinus communis]
Length=853

 Score =   126 bits (317),  Expect = 3e-30, Method: Composition-based stats.
 Identities = 64/103 (62%), Positives = 79/103 (77%), Gaps = 3/103 (3%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFG--RAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQ  358
            M+SRSY+NLLDLASG     G  R  K+L RV TV GV+SELDD+  ++  SDVPSS+ Q
Sbjct  1    MMSRSYTNLLDLASGNFPVMGQPREKKRLPRVMTVPGVISELDDDQANSVASDVPSSLVQ  60

Query  359  ERMIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            +R+IIV NQLP++A RR D  +GW+F WD+DSLLLQLKDGL E
Sbjct  61   DRIIIVANQLPVKAKRRPD-NKGWSFSWDDDSLLLQLKDGLPE  102



>ref|XP_010439943.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5 [Camelina sativa]
 ref|XP_010439944.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5 [Camelina sativa]
Length=862

 Score =   126 bits (316),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 65/102 (64%), Positives = 80/102 (78%), Gaps = 3/102 (3%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNG-GSDVPSSISQE  361
            MVSRSYSNLLDLASG   +F R  K+  RVATV GVLSELDD++ SN   SD PSS++Q+
Sbjct  1    MVSRSYSNLLDLASGNFHSFSREKKRFPRVATVTGVLSELDDDNNSNSVCSDAPSSVTQD  60

Query  362  RMIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            R+IIVGNQLP+++HR + G+   +F WD DSLLLQLKDG+ E
Sbjct  61   RIIIVGNQLPIKSHRNSAGK--LSFSWDNDSLLLQLKDGMRE  100



>ref|XP_002870086.1| ATTPS5 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH46345.1| ATTPS5 [Arabidopsis lyrata subsp. lyrata]
Length=862

 Score =   126 bits (316),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 65/102 (64%), Positives = 80/102 (78%), Gaps = 3/102 (3%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNG-GSDVPSSISQE  361
            MVSRSYSNLLDLASG   +F R  K+  RVATV GVLSELDD++ SN   SD PSS++Q+
Sbjct  1    MVSRSYSNLLDLASGNFHSFSREKKRFPRVATVTGVLSELDDDNNSNSVCSDAPSSVTQD  60

Query  362  RMIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            R+IIVGNQLP+++HR + G+   +F WD DSLLLQLKDG+ E
Sbjct  61   RIIIVGNQLPIKSHRNSAGK--LSFSWDNDSLLLQLKDGMRE  100



>ref|NP_567538.1| putative trehalose phosphatase/synthase 5 [Arabidopsis thaliana]
 sp|O23617.2|TPS5_ARATH RecName: Full=Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5; AltName: Full=Trehalose-6-phosphate synthase 5; Short=AtTPS5 
[Arabidopsis thaliana]
 dbj|BAC43297.1| putative trehalose-6-phosphate synthase [Arabidopsis thaliana]
 gb|AAO64902.1| At4g17770 [Arabidopsis thaliana]
 gb|AEE83948.1| putative trehalose phosphatase/synthase 5 [Arabidopsis thaliana]
 gb|AHL38687.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=862

 Score =   126 bits (316),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 65/102 (64%), Positives = 80/102 (78%), Gaps = 3/102 (3%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNG-GSDVPSSISQE  361
            MVSRSYSNLLDLASG   +F R  K+  RVATV GVLSELDD++ SN   SD PSS++Q+
Sbjct  1    MVSRSYSNLLDLASGNFHSFSREKKRFPRVATVTGVLSELDDDNNSNSVCSDAPSSVTQD  60

Query  362  RMIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            R+IIVGNQLP+++HR + G+   +F WD DSLLLQLKDG+ E
Sbjct  61   RIIIVGNQLPIKSHRNSAGK--LSFSWDNDSLLLQLKDGMRE  100



>ref|XP_010671073.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 [Beta vulgaris subsp. vulgaris]
 ref|XP_010671074.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 [Beta vulgaris subsp. vulgaris]
Length=857

 Score =   126 bits (316),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 64/103 (62%), Positives = 80/103 (78%), Gaps = 3/103 (3%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGE--SLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQ  358
            M+SRSY+NLLDLASG   ++  GR  ++L RV TVAGV+SE+DD+  ++  SDVPSSI Q
Sbjct  1    MMSRSYTNLLDLASGNFPAMEMGREKRRLPRVMTVAGVISEMDDDQANSVSSDVPSSIVQ  60

Query  359  ERMIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            +R+IIV NQLP+RA RR D  +GW+F WDEDSLLL LK GL E
Sbjct  61   DRIIIVANQLPVRAKRRPDN-KGWSFSWDEDSLLLHLKHGLPE  102



>gb|KHG01703.1| putative alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
7 [Gossypium arboreum]
Length=857

 Score =   126 bits (316),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 65/103 (63%), Positives = 79/103 (77%), Gaps = 3/103 (3%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFG--RAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQ  358
            M+SRSY+NLLDLASG     G  R  K+L RV TV GV+SELDD+  ++  SDVPSSI Q
Sbjct  1    MMSRSYTNLLDLASGNFPVMGQPREKKRLPRVMTVPGVISELDDDQANSVASDVPSSIIQ  60

Query  359  ERMIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            +R+IIV NQLP++A RR D  +GW+F WD+DSLLLQLKDGL E
Sbjct  61   DRIIIVANQLPVKAKRRPDN-KGWSFSWDDDSLLLQLKDGLPE  102



>ref|XP_010449561.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5-like isoform X2 [Camelina sativa]
Length=858

 Score =   125 bits (315),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 64/102 (63%), Positives = 80/102 (78%), Gaps = 3/102 (3%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNG-GSDVPSSISQE  361
            MVSRSYSNLLDLASG   +F R  K+  RVATV GVLSELDD++ SN   SD PSS++Q+
Sbjct  1    MVSRSYSNLLDLASGNFHSFSREKKRFPRVATVTGVLSELDDDNNSNSVCSDAPSSVTQD  60

Query  362  RMIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            R+I+VGNQLP+++HR + G+   +F WD DSLLLQLKDG+ E
Sbjct  61   RIIVVGNQLPIKSHRNSAGK--LSFSWDNDSLLLQLKDGMRE  100



>ref|XP_010106616.1| putative alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
7 [Morus notabilis]
 gb|EXC10946.1| putative alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
7 [Morus notabilis]
Length=856

 Score =   125 bits (315),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 63/101 (62%), Positives = 78/101 (77%), Gaps = 1/101 (1%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  364
            M+SRSY+NLLDLASG      R  K+L RV TV G++SELDD+  ++  SDVPSSI Q+R
Sbjct  1    MMSRSYTNLLDLASGNFPIMIREKKRLPRVMTVPGIISELDDDQANSVSSDVPSSIIQDR  60

Query  365  MIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            +IIVGNQLP++A RR D  +GW+F WDEDSLLLQLK GL +
Sbjct  61   IIIVGNQLPVKAKRRPDN-KGWSFSWDEDSLLLQLKSGLPD  100



>ref|XP_010434619.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5-like [Camelina sativa]
 ref|XP_010434620.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5-like [Camelina sativa]
Length=862

 Score =   125 bits (315),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 64/102 (63%), Positives = 80/102 (78%), Gaps = 3/102 (3%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNG-GSDVPSSISQE  361
            MVSRSYSNLLDLASG   +F R  K+  RVATV GVLSELDD++ SN   SD PSS++Q+
Sbjct  1    MVSRSYSNLLDLASGNFHSFSREKKRFPRVATVTGVLSELDDDNNSNSVCSDAPSSVTQD  60

Query  362  RMIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            R+I+VGNQLP+++HR + G+   +F WD DSLLLQLKDG+ E
Sbjct  61   RIIVVGNQLPIKSHRNSAGK--LSFSWDNDSLLLQLKDGMRE  100



>ref|XP_006358103.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7-like [Solanum tuberosum]
Length=850

 Score =   125 bits (315),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 62/101 (61%), Positives = 79/101 (78%), Gaps = 1/101 (1%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  364
            M+S+SY+NLLDLASG     GR  K+L RV TVAGV+SELDD+  ++  SDVPSSI  +R
Sbjct  1    MMSKSYTNLLDLASGNFPVMGREKKRLPRVMTVAGVISELDDDQANSVTSDVPSSIIVDR  60

Query  365  MIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            +IIV NQLP++A RR+D  +GW+F WDEDSLLL +KDGL +
Sbjct  61   IIIVANQLPVKAKRRSDN-KGWSFSWDEDSLLLHIKDGLPD  100



>ref|XP_010043976.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6 [Eucalyptus grandis]
 gb|KCW85984.1| hypothetical protein EUGRSUZ_B02686 [Eucalyptus grandis]
Length=856

 Score =   125 bits (314),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 61/104 (59%), Positives = 82/104 (79%), Gaps = 3/104 (3%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSS--ISQ  358
            MVSRSYSNLL+LASGES +F R  +++ R+ TV G++S++DD++RS G    PSS    +
Sbjct  1    MVSRSYSNLLELASGESPSFSRMSRRIPRIMTVPGIISDVDDDNRSEGSCSDPSSSTTQR  60

Query  359  ERMIIVGNQLPLRAHRRTDGE-EGWNFXWDEDSLLLQLKDGLGE  487
            +R+IIV NQLP+RA R++DG  +GW F WDE+SLLLQLKDGLG+
Sbjct  61   DRIIIVANQLPIRAQRKSDGNGKGWIFNWDENSLLLQLKDGLGD  104



>ref|XP_004171547.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7-like, partial [Cucumis sativus]
Length=654

 Score =   124 bits (312),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 62/101 (61%), Positives = 78/101 (77%), Gaps = 1/101 (1%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  364
            M+S+SY+NLLDLASG     GR  K+L RV TVAGV+SELDD+  ++  S+ PSS+ Q+R
Sbjct  1    MMSKSYTNLLDLASGNFPIMGREKKRLPRVMTVAGVISELDDDQANSVTSEGPSSVVQDR  60

Query  365  MIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            +IIV NQLP++A RR D  +GW+F WDEDSLL QLKDGL E
Sbjct  61   IIIVANQLPIKAKRRPDN-KGWSFSWDEDSLLWQLKDGLPE  100



>ref|XP_010449562.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5-like isoform X3 [Camelina sativa]
Length=844

 Score =   125 bits (314),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 64/102 (63%), Positives = 80/102 (78%), Gaps = 3/102 (3%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNG-GSDVPSSISQE  361
            MVSRSYSNLLDLASG   +F R  K+  RVATV GVLSELDD++ SN   SD PSS++Q+
Sbjct  1    MVSRSYSNLLDLASGNFHSFSREKKRFPRVATVTGVLSELDDDNNSNSVCSDAPSSVTQD  60

Query  362  RMIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            R+I+VGNQLP+++HR + G+   +F WD DSLLLQLKDG+ E
Sbjct  61   RIIVVGNQLPIKSHRNSAGK--LSFSWDNDSLLLQLKDGMRE  100



>ref|XP_010449559.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5-like isoform X1 [Camelina sativa]
 ref|XP_010449560.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5-like isoform X1 [Camelina sativa]
Length=859

 Score =   125 bits (314),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 64/102 (63%), Positives = 80/102 (78%), Gaps = 3/102 (3%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNG-GSDVPSSISQE  361
            MVSRSYSNLLDLASG   +F R  K+  RVATV GVLSELDD++ SN   SD PSS++Q+
Sbjct  1    MVSRSYSNLLDLASGNFHSFSREKKRFPRVATVTGVLSELDDDNNSNSVCSDAPSSVTQD  60

Query  362  RMIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            R+I+VGNQLP+++HR + G+   +F WD DSLLLQLKDG+ E
Sbjct  61   RIIVVGNQLPIKSHRNSAGK--LSFSWDNDSLLLQLKDGMRE  100



>gb|KJB57382.1| hypothetical protein B456_009G160400 [Gossypium raimondii]
Length=857

 Score =   125 bits (313),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 64/103 (62%), Positives = 79/103 (77%), Gaps = 3/103 (3%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFG--RAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQ  358
            M+S+SY+NLLDLASG     G  R  K+L RV TV GV+SELDD+  ++  SDVPSSI Q
Sbjct  1    MMSKSYTNLLDLASGNFPVMGQPREKKRLPRVMTVPGVISELDDDQANSVASDVPSSIIQ  60

Query  359  ERMIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            +R+IIV NQLP++A RR D  +GW+F WD+DSLLLQLKDGL E
Sbjct  61   DRIIIVANQLPVKAKRRPDN-KGWSFSWDDDSLLLQLKDGLPE  102



>ref|XP_002527520.1| trehalose-6-phosphate synthase, putative [Ricinus communis]
 gb|EEF34829.1| trehalose-6-phosphate synthase, putative [Ricinus communis]
Length=753

 Score =   124 bits (312),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 62/103 (60%), Positives = 82/103 (80%), Gaps = 2/103 (2%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPS-SISQE  361
            MVSRSYSNLL+LASGES +FGR  +++ R+ TVAG++S+LDD+   +  SD  S SI ++
Sbjct  1    MVSRSYSNLLELASGESPSFGRMNRRIPRIMTVAGIISDLDDDPSESVCSDPSSASIQKD  60

Query  362  RMIIVGNQLPLRAHRRTDG-EEGWNFXWDEDSLLLQLKDGLGE  487
            R+IIV NQLP+RA R++DG  + W F WDE+SLLLQLKDGLG+
Sbjct  61   RIIIVANQLPIRAQRKSDGSNKSWIFTWDENSLLLQLKDGLGD  103



>ref|XP_009136870.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5 [Brassica rapa]
 ref|XP_009136871.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
5 [Brassica rapa]
Length=857

 Score =   125 bits (313),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 64/102 (63%), Positives = 78/102 (76%), Gaps = 3/102 (3%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNG-GSDVPSSISQE  361
            MVSRSYSNLLDLASG   +F R  K+  RVAT  GVLSELDD++ SN   SD PSS++Q+
Sbjct  1    MVSRSYSNLLDLASGNFHSFSREKKRFPRVATFTGVLSELDDDTNSNSVCSDAPSSVAQD  60

Query  362  RMIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            R+IIVGNQLP+++HR + G+    F WD DSLLLQLKDG+ E
Sbjct  61   RIIIVGNQLPIKSHRTSSGK--LTFTWDNDSLLLQLKDGMRE  100



>ref|XP_004134569.1| PREDICTED: LOW QUALITY PROTEIN: probable alpha,alpha-trehalose-phosphate 
synthase [UDP-forming] 7-like [Cucumis sativus]
Length=838

 Score =   124 bits (312),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 62/101 (61%), Positives = 78/101 (77%), Gaps = 1/101 (1%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  364
            M+S+SY+NLLDLASG     GR  K+L RV TVAGV+SELDD+  ++  S+ PSS+ Q+R
Sbjct  1    MMSKSYTNLLDLASGNFPIMGREKKRLPRVMTVAGVISELDDDQANSVTSEGPSSVVQDR  60

Query  365  MIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            +IIV NQLP++A RR D  +GW+F WDEDSLL QLKDGL E
Sbjct  61   IIIVANQLPIKAKRRPDN-KGWSFSWDEDSLLWQLKDGLPE  100



>ref|XP_008439718.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 [Cucumis melo]
 ref|XP_008439720.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 [Cucumis melo]
Length=850

 Score =   124 bits (312),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 62/101 (61%), Positives = 78/101 (77%), Gaps = 1/101 (1%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  364
            M+S+SY+NLLDLASG     GR  K+L RV TVAGV+SELDD+  ++  S+ PSS+ Q+R
Sbjct  1    MMSKSYTNLLDLASGNFPIMGREKKRLPRVMTVAGVISELDDDQANSVTSEGPSSVVQDR  60

Query  365  MIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            +IIV NQLP++A RR D  +GW+F WDEDSLL QLKDGL E
Sbjct  61   IIIVANQLPIKAKRRPDN-KGWSFSWDEDSLLWQLKDGLPE  100



>gb|KGN49325.1| Trehalose-6-phosphate synthase [Cucumis sativus]
Length=850

 Score =   124 bits (311),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 62/101 (61%), Positives = 78/101 (77%), Gaps = 1/101 (1%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  364
            M+S+SY+NLLDLASG     GR  K+L RV TVAGV+SELDD+  ++  S+ PSS+ Q+R
Sbjct  1    MMSKSYTNLLDLASGNFPIMGREKKRLPRVMTVAGVISELDDDQANSVTSEGPSSVVQDR  60

Query  365  MIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            +IIV NQLP++A RR D  +GW+F WDEDSLL QLKDGL E
Sbjct  61   IIIVANQLPIKAKRRPDN-KGWSFSWDEDSLLWQLKDGLPE  100



>ref|XP_006283097.1| hypothetical protein CARUB_v10004115mg [Capsella rubella]
 gb|EOA15995.1| hypothetical protein CARUB_v10004115mg [Capsella rubella]
Length=862

 Score =   124 bits (310),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 64/102 (63%), Positives = 80/102 (78%), Gaps = 3/102 (3%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNG-GSDVPSSISQE  361
            MVSRSYSNLLDLASG   +F R  K+  RVATV GVLSELDD++ SN   SD PSS++Q+
Sbjct  1    MVSRSYSNLLDLASGNFHSFSREKKRFPRVATVTGVLSELDDDNNSNSVCSDAPSSVTQD  60

Query  362  RMIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            R+IIVGNQLP++++R + G+   +F WD DSLLLQLKDG+ E
Sbjct  61   RIIIVGNQLPIKSYRNSAGK--LSFSWDNDSLLLQLKDGMRE  100



>ref|XP_006414189.1| hypothetical protein EUTSA_v10024381mg [Eutrema salsugineum]
 gb|ESQ55642.1| hypothetical protein EUTSA_v10024381mg [Eutrema salsugineum]
Length=862

 Score =   124 bits (310),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 64/102 (63%), Positives = 79/102 (77%), Gaps = 3/102 (3%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNG-GSDVPSSISQE  361
            MVSRSYSNLLDLASG   +F R  K+  RV+TV GVLSELDD++ SN   SD PSS++Q+
Sbjct  1    MVSRSYSNLLDLASGNFHSFSREKKRFPRVSTVTGVLSELDDDNNSNSVCSDAPSSVTQD  60

Query  362  RMIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            R+IIVGNQLP+++HR + G+    F WD DSLLLQLKDG+ E
Sbjct  61   RIIIVGNQLPIKSHRNSAGK--LIFSWDNDSLLLQLKDGMRE  100



>emb|CBI30721.3| unnamed protein product [Vitis vinifera]
Length=784

 Score =   123 bits (309),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 64/101 (63%), Positives = 79/101 (78%), Gaps = 2/101 (2%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  364
            M+SRSY+NLLDLASG     G+  K+L RV TV GV+SELDD+  ++  SDVPSSI Q+R
Sbjct  1    MMSRSYTNLLDLASGNFPLMGQR-KRLPRVMTVPGVISELDDDQANSVTSDVPSSIVQDR  59

Query  365  MIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            +IIV NQLP++A RR D  +GW+F WDEDSLLLQLKDGL +
Sbjct  60   VIIVANQLPVKAKRRPDN-KGWSFSWDEDSLLLQLKDGLPD  99



>emb|CAN71202.1| hypothetical protein VITISV_006369 [Vitis vinifera]
Length=733

 Score =   123 bits (308),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 64/101 (63%), Positives = 79/101 (78%), Gaps = 2/101 (2%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  364
            M+SRSY+NLLDLASG     G+  K+L RV TV GV+SELDD+  ++  SDVPSSI Q+R
Sbjct  1    MMSRSYTNLLDLASGNFPLMGQR-KRLPRVMTVPGVISELDDDQANSVTSDVPSSIVQDR  59

Query  365  MIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            +IIV NQLP++A RR D  +GW+F WDEDSLLLQLKDGL +
Sbjct  60   VIIVANQLPVKAKRRPDN-KGWSFSWDEDSLLLQLKDGLPD  99



>ref|XP_002268174.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 [Vitis vinifera]
Length=853

 Score =   123 bits (309),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 64/101 (63%), Positives = 79/101 (78%), Gaps = 2/101 (2%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  364
            M+SRSY+NLLDLASG     G+  K+L RV TV GV+SELDD+  ++  SDVPSSI Q+R
Sbjct  1    MMSRSYTNLLDLASGNFPLMGQR-KRLPRVMTVPGVISELDDDQANSVTSDVPSSIVQDR  59

Query  365  MIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            +IIV NQLP++A RR D  +GW+F WDEDSLLLQLKDGL +
Sbjct  60   VIIVANQLPVKAKRRPDN-KGWSFSWDEDSLLLQLKDGLPD  99



>ref|XP_010271238.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6-like [Nelumbo nucifera]
 ref|XP_010271239.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6-like [Nelumbo nucifera]
Length=853

 Score =   123 bits (308),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 62/101 (61%), Positives = 81/101 (80%), Gaps = 1/101 (1%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  364
            MVSRSYSNLL+LASGES +FGR  +++ R+ TVAG++S+LDD+   +  SD  SS  +ER
Sbjct  1    MVSRSYSNLLELASGESPSFGRMSRRIPRIMTVAGIISDLDDDPADSVSSDPSSSAPRER  60

Query  365  MIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            +IIV NQLP+RAH++ D  +GW F WD+DSLLLQLKDGLG+
Sbjct  61   IIIVANQLPIRAHKKPDN-KGWTFSWDDDSLLLQLKDGLGD  100



>gb|KDP38139.1| hypothetical protein JCGZ_04782 [Jatropha curcas]
Length=855

 Score =   122 bits (307),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 61/102 (60%), Positives = 81/102 (79%), Gaps = 1/102 (1%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDE-SRSNGGSDVPSSISQE  361
            MVSRSYSNLL+LASGES +FGR  +++ R+ TVAG++S+LDD+ S S       SS+ ++
Sbjct  1    MVSRSYSNLLELASGESPSFGRMSRRIPRIMTVAGIISDLDDDPSESVCSDPSSSSVQKD  60

Query  362  RMIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            R+IIV NQLP+RA R++DG + W F WDE+SLLLQLKDGLG+
Sbjct  61   RIIIVANQLPIRAQRKSDGSKSWIFTWDENSLLLQLKDGLGD  102



>ref|XP_011021750.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6 isoform X1 [Populus euphratica]
Length=854

 Score =   122 bits (307),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 61/102 (60%), Positives = 81/102 (79%), Gaps = 1/102 (1%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDE-SRSNGGSDVPSSISQE  361
            MVSRSYSNLL+LASGES +FGR  +++ R+ TVAG++S++DD+ S S       SSI ++
Sbjct  1    MVSRSYSNLLELASGESPSFGRMSRRIPRIMTVAGIMSDIDDDPSESVCSDPSSSSIPKD  60

Query  362  RMIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            R+IIV NQLP+RA R++DG + W F WDE+SLLLQLKDGLG+
Sbjct  61   RIIIVANQLPIRAQRKSDGSKSWIFSWDENSLLLQLKDGLGD  102



>ref|XP_011021751.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6 isoform X2 [Populus euphratica]
Length=832

 Score =   122 bits (306),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 61/102 (60%), Positives = 81/102 (79%), Gaps = 1/102 (1%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDE-SRSNGGSDVPSSISQE  361
            MVSRSYSNLL+LASGES +FGR  +++ R+ TVAG++S++DD+ S S       SSI ++
Sbjct  1    MVSRSYSNLLELASGESPSFGRMSRRIPRIMTVAGIMSDIDDDPSESVCSDPSSSSIPKD  60

Query  362  RMIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            R+IIV NQLP+RA R++DG + W F WDE+SLLLQLKDGLG+
Sbjct  61   RIIIVANQLPIRAQRKSDGSKSWIFSWDENSLLLQLKDGLGD  102



>ref|XP_009804181.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 isoform X3 [Nicotiana sylvestris]
Length=757

 Score =   122 bits (306),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 60/101 (59%), Positives = 78/101 (77%), Gaps = 1/101 (1%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  364
            M+S+SY+NLLDLASG     GR  ++L RV TVAGV+SELDD+  ++  SDVPSSI  +R
Sbjct  1    MLSKSYTNLLDLASGNFPVMGREKRRLPRVMTVAGVISELDDDQANSVTSDVPSSIIVDR  60

Query  365  MIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            +IIV NQLP++A RR D  +GW+F WD+DSLLL +KDGL +
Sbjct  61   IIIVANQLPVKAKRRPDN-KGWSFSWDDDSLLLHIKDGLPD  100



>ref|XP_009804180.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 isoform X2 [Nicotiana sylvestris]
Length=758

 Score =   122 bits (305),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 60/101 (59%), Positives = 78/101 (77%), Gaps = 1/101 (1%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  364
            M+S+SY+NLLDLASG     GR  ++L RV TVAGV+SELDD+  ++  SDVPSSI  +R
Sbjct  1    MLSKSYTNLLDLASGNFPVMGREKRRLPRVMTVAGVISELDDDQANSVTSDVPSSIIVDR  60

Query  365  MIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            +IIV NQLP++A RR D  +GW+F WD+DSLLL +KDGL +
Sbjct  61   IIIVANQLPVKAKRRPDN-KGWSFSWDDDSLLLHIKDGLPD  100



>ref|XP_009804177.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 isoform X1 [Nicotiana sylvestris]
 ref|XP_009804178.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 isoform X1 [Nicotiana sylvestris]
 ref|XP_009804179.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 isoform X1 [Nicotiana sylvestris]
Length=849

 Score =   122 bits (306),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 60/101 (59%), Positives = 78/101 (77%), Gaps = 1/101 (1%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  364
            M+S+SY+NLLDLASG     GR  ++L RV TVAGV+SELDD+  ++  SDVPSSI  +R
Sbjct  1    MLSKSYTNLLDLASGNFPVMGREKRRLPRVMTVAGVISELDDDQANSVTSDVPSSIIVDR  60

Query  365  MIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            +IIV NQLP++A RR D  +GW+F WD+DSLLL +KDGL +
Sbjct  61   IIIVANQLPVKAKRRPDN-KGWSFSWDDDSLLLHIKDGLPD  100



>ref|XP_007142959.1| hypothetical protein PHAVU_007G031800g [Phaseolus vulgaris]
 ref|XP_007142960.1| hypothetical protein PHAVU_007G031800g [Phaseolus vulgaris]
 gb|ESW14953.1| hypothetical protein PHAVU_007G031800g [Phaseolus vulgaris]
 gb|ESW14954.1| hypothetical protein PHAVU_007G031800g [Phaseolus vulgaris]
Length=853

 Score =   122 bits (306),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 62/88 (70%), Positives = 70/88 (80%), Gaps = 2/88 (2%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  364
            M SRSYSNLLDL S  S +FGR  K+L RVATVAGVLSELDDES ++ GSD PSS+SQER
Sbjct  1    MASRSYSNLLDLTSCGSPSFGREKKRLPRVATVAGVLSELDDESSNSVGSDTPSSVSQER  60

Query  365  MIIVGNQLPLRAHRRTDGEEGWNFXWDE  448
            MIIVGNQLPL+A R+ +G   W F WDE
Sbjct  61   MIIVGNQLPLKARRKDNG--SWEFTWDE  86



>ref|XP_009351564.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6 [Pyrus x bretschneideri]
 ref|XP_009351565.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6 [Pyrus x bretschneideri]
Length=848

 Score =   121 bits (304),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 59/101 (58%), Positives = 79/101 (78%), Gaps = 5/101 (5%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  364
            MVS+SYSNLL+LASGE  +FGR G+++ RV  VAGV+S++DDE  ++      SS  ++R
Sbjct  1    MVSKSYSNLLELASGEGDSFGRIGRRIPRVMNVAGVMSDVDDEGYTSS-----SSSQRDR  55

Query  365  MIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            +IIV NQLP++A R+TD  +GW F WDE+SLLLQLKDGLG+
Sbjct  56   IIIVANQLPIKAQRKTDDSKGWIFSWDENSLLLQLKDGLGD  96



>ref|XP_010999788.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 [Populus euphratica]
Length=849

 Score =   121 bits (304),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 65/103 (63%), Positives = 77/103 (75%), Gaps = 7/103 (7%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFG--RAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQ  358
            MVSRSY+NLLDLASG     G  R  K+L RV TV GV+SELDD++     SDVPSS+ Q
Sbjct  1    MVSRSYTNLLDLASGNFPAMGQPRERKQLPRVMTVPGVISELDDDA----ASDVPSSVVQ  56

Query  359  ERMIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            +RMIIV NQLP++A RR D  +GW+F WD+DSLLL LKDGL E
Sbjct  57   DRMIIVANQLPVKAKRRPDN-KGWSFSWDDDSLLLHLKDGLPE  98



>gb|KJB69686.1| hypothetical protein B456_011G037000 [Gossypium raimondii]
Length=758

 Score =   121 bits (303),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 63/103 (61%), Positives = 77/103 (75%), Gaps = 3/103 (3%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFG--RAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQ  358
            M+SRSY+NLLDLASG     G  R  K+L RV TV GV+SELDD+  ++  SD PSS  Q
Sbjct  1    MMSRSYTNLLDLASGNFPAMGQPREKKRLPRVMTVPGVISELDDDQANSVTSDAPSSAIQ  60

Query  359  ERMIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            +R+IIV NQLP++A RR D  +GW+F WD+DSLLLQLKDGL E
Sbjct  61   DRIIIVANQLPVKAKRRPDN-KGWSFSWDDDSLLLQLKDGLPE  102



>gb|KJB69685.1| hypothetical protein B456_011G037000 [Gossypium raimondii]
Length=857

 Score =   121 bits (304),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 63/103 (61%), Positives = 77/103 (75%), Gaps = 3/103 (3%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFG--RAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQ  358
            M+SRSY+NLLDLASG     G  R  K+L RV TV GV+SELDD+  ++  SD PSS  Q
Sbjct  1    MMSRSYTNLLDLASGNFPAMGQPREKKRLPRVMTVPGVISELDDDQANSVTSDAPSSAIQ  60

Query  359  ERMIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            +R+IIV NQLP++A RR D  +GW+F WD+DSLLLQLKDGL E
Sbjct  61   DRIIIVANQLPVKAKRRPDN-KGWSFSWDDDSLLLQLKDGLPE  102



>gb|ACD56638.1| trehalose synthase-like protein [Gossypioides kirkii]
Length=857

 Score =   121 bits (304),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 63/103 (61%), Positives = 77/103 (75%), Gaps = 3/103 (3%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFG--RAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQ  358
            M+SRSY+NLLDLASG     G  R  K+L RV TV GV+SELDD+  ++  SD PSS  Q
Sbjct  1    MMSRSYTNLLDLASGNFPAMGQPREKKRLPRVMTVPGVISELDDDQANSVTSDAPSSAIQ  60

Query  359  ERMIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            +R+IIV NQLP++A RR D  +GW+F WD+DSLLLQLKDGL E
Sbjct  61   DRIIIVANQLPVKAKRRPDN-KGWSFSWDDDSLLLQLKDGLPE  102



>gb|KHG11600.1| putative alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
7 -like protein [Gossypium arboreum]
Length=857

 Score =   121 bits (303),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 63/103 (61%), Positives = 77/103 (75%), Gaps = 3/103 (3%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFG--RAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQ  358
            M+SRSY+NLLDLASG     G  R  K+L RV TV GV+SELDD+  ++  SD PSS  Q
Sbjct  1    MMSRSYTNLLDLASGNFPAMGQPREKKRLPRVMTVPGVISELDDDQANSVTSDAPSSAIQ  60

Query  359  ERMIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            +R+IIV NQLP++A RR D  +GW+F WD+DSLLLQLKDGL E
Sbjct  61   DRIIIVANQLPVKAKRRPDN-KGWSFSWDDDSLLLQLKDGLPE  102



>ref|XP_008381762.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6 [Malus domestica]
 ref|XP_008381764.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6 [Malus domestica]
 ref|XP_008381765.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6 [Malus domestica]
Length=848

 Score =   121 bits (303),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 59/101 (58%), Positives = 78/101 (77%), Gaps = 5/101 (5%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  364
            MVS+SYSNLL+LASGE  +FGR G+++ RV  VAGV+S++DDE  ++      SS  ++R
Sbjct  1    MVSKSYSNLLELASGEGDSFGRIGRRIPRVMNVAGVMSDVDDEGYTSS-----SSSQRDR  55

Query  365  MIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            +IIV NQLP+RA R+ D  +GW F WDE+SLLLQLKDGLG+
Sbjct  56   IIIVANQLPIRAQRKADDSKGWIFSWDENSLLLQLKDGLGD  96



>ref|XP_008775883.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 [Phoenix dactylifera]
 ref|XP_008775884.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 [Phoenix dactylifera]
Length=864

 Score =   120 bits (302),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 65/107 (61%), Positives = 82/107 (77%), Gaps = 7/107 (7%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGE--SLTFGRAG---KKLSRVATVAGVLSELDDESRSNG-GSDVPS  346
            M+SRSY+NLLDLASG   +L+ G  G   +++ RV T+ G L+ELD+E R+    SDVPS
Sbjct  1    MMSRSYTNLLDLASGNFAALSVGSQGASRRRMPRVMTMPGALAELDEEDRAGSVSSDVPS  60

Query  347  SISQERMIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            SI+Q+R+IIV NQLP+RA RR DG  GW+F WDEDSLLLQLKDGL +
Sbjct  61   SIAQDRIIIVANQLPVRAKRRPDG-RGWSFSWDEDSLLLQLKDGLPD  106



>ref|XP_008220922.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6 [Prunus mume]
Length=855

 Score =   120 bits (302),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 56/103 (54%), Positives = 81/103 (79%), Gaps = 2/103 (2%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSD--VPSSISQ  358
            MVS+SYSNLL+L SGE+ +FGR G+++ R+ TVA ++S++DD+   +  S+    SS+ +
Sbjct  1    MVSKSYSNLLELTSGEAPSFGRIGRRIPRIMTVASLISDVDDDPSESACSEDMSSSSVQR  60

Query  359  ERMIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            +R+IIV NQLP+RA R++D  +GW F WDE+SLLLQLKDGLG+
Sbjct  61   DRIIIVANQLPIRAQRKSDTSKGWIFNWDENSLLLQLKDGLGD  103



>ref|XP_002314777.2| hypothetical protein POPTR_0010s11510g [Populus trichocarpa]
 gb|EEF00948.2| hypothetical protein POPTR_0010s11510g [Populus trichocarpa]
Length=854

 Score =   120 bits (302),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 60/102 (59%), Positives = 80/102 (78%), Gaps = 1/102 (1%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDE-SRSNGGSDVPSSISQE  361
            MVSRSYSNLL+LASGES +FGR  +++ R+ TVAG++S++DD+ S S       SS  ++
Sbjct  1    MVSRSYSNLLELASGESPSFGRMSRRIPRIMTVAGIMSDIDDDPSESVCSDPSSSSTPKD  60

Query  362  RMIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            R+IIV NQLP+RA R++DG + W F WDE+SLLLQLKDGLG+
Sbjct  61   RIIIVANQLPIRAQRKSDGSKSWIFSWDENSLLLQLKDGLGD  102



>ref|XP_006378432.1| hypothetical protein POPTR_0010s11510g [Populus trichocarpa]
 gb|ERP56229.1| hypothetical protein POPTR_0010s11510g [Populus trichocarpa]
Length=815

 Score =   120 bits (301),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 60/102 (59%), Positives = 80/102 (78%), Gaps = 1/102 (1%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDE-SRSNGGSDVPSSISQE  361
            MVSRSYSNLL+LASGES +FGR  +++ R+ TVAG++S++DD+ S S       SS  ++
Sbjct  1    MVSRSYSNLLELASGESPSFGRMSRRIPRIMTVAGIMSDIDDDPSESVCSDPSSSSTPKD  60

Query  362  RMIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            R+IIV NQLP+RA R++DG + W F WDE+SLLLQLKDGLG+
Sbjct  61   RIIIVANQLPIRAQRKSDGSKSWIFSWDENSLLLQLKDGLGD  102



>ref|XP_002305726.1| hypothetical protein POPTR_0004s06000g [Populus trichocarpa]
 gb|EEE86237.1| hypothetical protein POPTR_0004s06000g [Populus trichocarpa]
Length=849

 Score =   120 bits (301),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 65/103 (63%), Positives = 76/103 (74%), Gaps = 7/103 (7%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFG--RAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQ  358
            MVSRSY+NLLDLASG     G  R  K+L RV TV GV+SELDD++     SDVPSS+ Q
Sbjct  1    MVSRSYTNLLDLASGNFPAMGQPRERKQLPRVMTVPGVISELDDDA----ASDVPSSVVQ  56

Query  359  ERMIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            +RMIIV NQLP++A R  D + GW+F WDEDSLLL LKDGL E
Sbjct  57   DRMIIVANQLPVKAKRMPDNK-GWSFSWDEDSLLLHLKDGLPE  98



>ref|XP_010650494.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6 [Vitis vinifera]
 emb|CAN76185.1| hypothetical protein VITISV_023086 [Vitis vinifera]
Length=854

 Score =   120 bits (300),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 60/102 (59%), Positives = 80/102 (78%), Gaps = 1/102 (1%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDE-SRSNGGSDVPSSISQE  361
            MVSRSYSNLL+LASGES +FGR  +++ R+ TVAG++S+LDD+ S S       SS+ ++
Sbjct  1    MVSRSYSNLLELASGESPSFGRMSRRIPRIMTVAGIISDLDDDPSESVCSDPSSSSVQRD  60

Query  362  RMIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            R+IIV NQLP+RA R+++   GW F WDE+SLLLQLKDGLG+
Sbjct  61   RLIIVANQLPIRAQRKSENNNGWIFSWDENSLLLQLKDGLGD  102



>ref|XP_009595830.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6 [Nicotiana tomentosiformis]
Length=856

 Score =   120 bits (300),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 64/104 (62%), Positives = 83/104 (80%), Gaps = 3/104 (3%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGE--SLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQ  358
            MVSRSYSNLL+LASGE  S +FGR  +++ R+ TVAG++S+LDD+   +  SD  SS +Q
Sbjct  1    MVSRSYSNLLELASGEAPSPSFGRMSRRIPRIMTVAGIMSDLDDDGSESVCSDPSSSSAQ  60

Query  359  -ERMIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
             +R+IIVGNQLP+R  R+TDG +GW F WDE+SLLLQLKDGLG+
Sbjct  61   KDRIIIVGNQLPIRVQRKTDGSKGWLFSWDENSLLLQLKDGLGD  104



>ref|XP_002281386.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 [Vitis vinifera]
Length=705

 Score =   119 bits (298),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 59/101 (58%), Positives = 77/101 (76%), Gaps = 1/101 (1%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  364
            M+SRSY+NLLDLA+G     GR  K+L RV TV G + ELDD+  ++  SD PSS++Q+R
Sbjct  1    MMSRSYTNLLDLATGNFPAIGRERKRLPRVMTVPGNVYELDDDQANSVSSDNPSSVAQDR  60

Query  365  MIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            +IIV NQLP++A+RR D + GW F W+EDSLLLQLK+GL E
Sbjct  61   LIIVANQLPVKANRRAD-DRGWVFSWNEDSLLLQLKEGLPE  100



>gb|AJO70168.1| alpha,alpha-trehalose-phosphate synthase 7 [Camellia sinensis]
Length=855

 Score =   119 bits (298),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 60/101 (59%), Positives = 76/101 (75%), Gaps = 1/101 (1%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  364
            M+SRSY+NLLDLASG     GR  K+L RV TV GV+SELDD+  ++  SDV SS+  +R
Sbjct  1    MMSRSYTNLLDLASGNFPVMGREKKRLPRVMTVPGVISELDDDQANSVTSDVQSSLVVDR  60

Query  365  MIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            +IIV NQLP++A RR D  +GW+F WDEDSLLL +KDGL +
Sbjct  61   VIIVANQLPVKAKRRPDN-KGWSFSWDEDSLLLHIKDGLPD  100



>emb|CAN67058.1| hypothetical protein VITISV_036715 [Vitis vinifera]
Length=886

 Score =   119 bits (298),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 59/101 (58%), Positives = 77/101 (76%), Gaps = 1/101 (1%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  364
            M+SRSY+NLLDLA+G     GR  K+L RV TV G + ELDD+  ++  SD PSS++Q+R
Sbjct  1    MMSRSYTNLLDLATGNFPAIGRERKRLPRVMTVPGNVYELDDDQANSVSSDNPSSVAQDR  60

Query  365  MIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            +IIV NQLP++A+RR D + GW F W+EDSLLLQLK+GL E
Sbjct  61   LIIVANQLPVKANRRAD-DRGWVFSWNEDSLLLQLKEGLPE  100



>ref|XP_003633255.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 [Vitis vinifera]
Length=855

 Score =   119 bits (298),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 59/101 (58%), Positives = 77/101 (76%), Gaps = 1/101 (1%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  364
            M+SRSY+NLLDLA+G     GR  K+L RV TV G + ELDD+  ++  SD PSS++Q+R
Sbjct  1    MMSRSYTNLLDLATGNFPAIGRERKRLPRVMTVPGNVYELDDDQANSVSSDNPSSVAQDR  60

Query  365  MIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            +IIV NQLP++A+RR D + GW F W+EDSLLLQLK+GL E
Sbjct  61   LIIVANQLPVKANRRAD-DRGWVFSWNEDSLLLQLKEGLPE  100



>gb|AAG52003.1|AC012563_13 putative trehalose-6-phosphate synthase; 46897-44149 [Arabidopsis 
thaliana]
Length=847

 Score =   119 bits (298),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 58/101 (57%), Positives = 77/101 (76%), Gaps = 7/101 (7%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  364
            MVSRSYSNLL+LASG+S TFGR  +++ R+  VAG++S +D++S+    S       ++R
Sbjct  1    MVSRSYSNLLELASGDSPTFGRMNRQIPRIMAVAGIMSNIDNDSKDTDLS------PKDR  54

Query  365  MIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            +IIV N+LP+RA RR DG  GWNF WDE+SLLLQLKDGLG+
Sbjct  55   IIIVANELPIRAQRRVDG-NGWNFSWDENSLLLQLKDGLGD  94



>ref|XP_010052171.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 [Eucalyptus grandis]
 gb|KCW76087.1| hypothetical protein EUGRSUZ_D00465 [Eucalyptus grandis]
Length=864

 Score =   118 bits (296),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 60/101 (59%), Positives = 75/101 (74%), Gaps = 1/101 (1%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  364
            M+S+SY+NLLDLASG     GR  K+L RV TV   +SELDD+  ++  SDVPSSI Q+R
Sbjct  1    MLSKSYTNLLDLASGNFPVMGREKKRLPRVMTVPVDISELDDDQANSVSSDVPSSIIQDR  60

Query  365  MIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            +IIV NQLP++A RR D  +GW   WD+DSLLLQLKDGL +
Sbjct  61   IIIVANQLPVKAKRRPDN-KGWALSWDDDSLLLQLKDGLPD  100



>gb|KJB68366.1| hypothetical protein B456_010G241200 [Gossypium raimondii]
Length=690

 Score =   117 bits (294),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 61/103 (59%), Positives = 78/103 (76%), Gaps = 3/103 (3%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFG--RAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQ  358
            M+SRSY+NLLDLASG     G  R  K+L+RV TV GV+SELDD+  ++  SDV SS++Q
Sbjct  1    MMSRSYTNLLDLASGNFPVMGPVRERKRLTRVMTVPGVVSELDDDQANSVNSDVHSSVNQ  60

Query  359  ERMIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            +R+IIV NQLP++A R  D  +GW+F WD+ SLLLQLKDGL E
Sbjct  61   DRIIIVANQLPVKAKRGPD-NKGWSFNWDDYSLLLQLKDGLPE  102



>ref|XP_004228746.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6 [Solanum lycopersicum]
 ref|XP_010316481.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6 [Solanum lycopersicum]
Length=857

 Score =   118 bits (295),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 63/104 (61%), Positives = 82/104 (79%), Gaps = 3/104 (3%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGE--SLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQ  358
            MVSRSYSNLL+LASGE  S +FGR  +++ RV TVAG++S+LDD+   +  SD  SS +Q
Sbjct  1    MVSRSYSNLLELASGEAPSPSFGRMSRRIPRVMTVAGIMSDLDDDGSESVCSDPSSSSAQ  60

Query  359  -ERMIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
             +R+I+V NQLP+R  R+TDG +GW F WDE+SLLLQLKDGLG+
Sbjct  61   KDRIIVVANQLPIRVQRKTDGSKGWLFSWDENSLLLQLKDGLGD  104



>gb|KJB68367.1| hypothetical protein B456_010G241200 [Gossypium raimondii]
Length=710

 Score =   117 bits (293),  Expect = 4e-27, Method: Composition-based stats.
 Identities = 61/103 (59%), Positives = 78/103 (76%), Gaps = 3/103 (3%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFG--RAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQ  358
            M+SRSY+NLLDLASG     G  R  K+L+RV TV GV+SELDD+  ++  SDV SS++Q
Sbjct  1    MMSRSYTNLLDLASGNFPVMGPVRERKRLTRVMTVPGVVSELDDDQANSVNSDVHSSVNQ  60

Query  359  ERMIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            +R+IIV NQLP++A R  D  +GW+F WD+ SLLLQLKDGL E
Sbjct  61   DRIIIVANQLPVKAKRGPD-NKGWSFNWDDYSLLLQLKDGLPE  102



>ref|XP_006364054.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6-like [Solanum tuberosum]
Length=857

 Score =   117 bits (293),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 62/104 (60%), Positives = 82/104 (79%), Gaps = 3/104 (3%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGE--SLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQ  358
            MVSRSYSNLL+LASGE  S +FGR  +++ R+ TVAG++S+LDD+   +  SD  SS +Q
Sbjct  1    MVSRSYSNLLELASGEAPSPSFGRMSQRIPRIMTVAGIMSDLDDDGSESVCSDPSSSSAQ  60

Query  359  -ERMIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
             +R+I+V NQLP+R  R+TDG +GW F WDE+SLLLQLKDGLG+
Sbjct  61   KDRIIVVANQLPIRVQRKTDGSKGWLFSWDENSLLLQLKDGLGD  104



>gb|KJB68365.1| hypothetical protein B456_010G241200 [Gossypium raimondii]
Length=857

 Score =   117 bits (292),  Expect = 8e-27, Method: Composition-based stats.
 Identities = 61/103 (59%), Positives = 78/103 (76%), Gaps = 3/103 (3%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFG--RAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQ  358
            M+SRSY+NLLDLASG     G  R  K+L+RV TV GV+SELDD+  ++  SDV SS++Q
Sbjct  1    MMSRSYTNLLDLASGNFPVMGPVRERKRLTRVMTVPGVVSELDDDQANSVNSDVHSSVNQ  60

Query  359  ERMIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            +R+IIV NQLP++A R  D  +GW+F WD+ SLLLQLKDGL E
Sbjct  61   DRIIIVANQLPVKAKRGPD-NKGWSFNWDDYSLLLQLKDGLPE  102



>ref|XP_002312472.1| hypothetical protein POPTR_0008s13590g [Populus trichocarpa]
 gb|EEE89839.1| hypothetical protein POPTR_0008s13590g [Populus trichocarpa]
Length=851

 Score =   116 bits (291),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 59/102 (58%), Positives = 78/102 (76%), Gaps = 1/102 (1%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDE-SRSNGGSDVPSSISQE  361
            MVSRSYSNLL+LASGES +F R  +++ R+ TVAG++S++DD+ S S       SS+   
Sbjct  1    MVSRSYSNLLELASGESPSFERMNRRIPRIMTVAGIMSDIDDDPSESVCSDPSSSSVQMC  60

Query  362  RMIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            R+IIV NQLP+RA R++DG + W F WDE+SLLLQLKDGLG+
Sbjct  61   RIIIVANQLPIRAQRKSDGSKSWIFNWDENSLLLQLKDGLGD  102



>ref|XP_010052859.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 isoform X1 [Eucalyptus grandis]
Length=876

 Score =   116 bits (291),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 56/101 (55%), Positives = 74/101 (73%), Gaps = 1/101 (1%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  364
            M+SRSY+NL+DLA+G     GR  K+  R  TV G ++ELDD+   +  S+ PSS++ +R
Sbjct  15   MMSRSYTNLVDLATGNFPAMGREKKRFPRTMTVPGNIAELDDDQAYSVTSENPSSVTSDR  74

Query  365  MIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            MIIVGNQLPL+A RR D + GW+F W+EDSLLLQLKDG  +
Sbjct  75   MIIVGNQLPLKATRRPD-DTGWSFSWNEDSLLLQLKDGFAD  114



>ref|XP_010052868.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 isoform X2 [Eucalyptus grandis]
 gb|KCW89661.1| hypothetical protein EUGRSUZ_A01931 [Eucalyptus grandis]
Length=862

 Score =   116 bits (291),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 56/101 (55%), Positives = 74/101 (73%), Gaps = 1/101 (1%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  364
            M+SRSY+NL+DLA+G     GR  K+  R  TV G ++ELDD+   +  S+ PSS++ +R
Sbjct  1    MMSRSYTNLVDLATGNFPAMGREKKRFPRTMTVPGNIAELDDDQAYSVTSENPSSVTSDR  60

Query  365  MIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            MIIVGNQLPL+A RR D + GW+F W+EDSLLLQLKDG  +
Sbjct  61   MIIVGNQLPLKATRRPD-DTGWSFSWNEDSLLLQLKDGFAD  100



>ref|XP_011463160.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6 [Fragaria vesca subsp. vesca]
Length=855

 Score =   116 bits (291),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 62/103 (60%), Positives = 83/103 (81%), Gaps = 2/103 (2%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGES-LTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQ-  358
            MVS+SYSNLL+LASGES  TFGR G+++ R+ TVAG++S++DD+   +  S+V SS  Q 
Sbjct  1    MVSKSYSNLLELASGESSPTFGRIGRRMPRIMTVAGLISDVDDDKPESVCSEVSSSSVQR  60

Query  359  ERMIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            +R+IIV NQLP+RA R++D  +GW F WDE+SLLLQLKDGLG+
Sbjct  61   DRIIIVANQLPIRAQRKSDTSKGWIFSWDENSLLLQLKDGLGD  103



>emb|CBI22022.3| unnamed protein product [Vitis vinifera]
Length=782

 Score =   116 bits (290),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 57/98 (58%), Positives = 75/98 (77%), Gaps = 1/98 (1%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  364
            M+SRSY+NLLDLA+G     GR  K+L RV TV G + ELDD+  ++  SD PSS++Q+R
Sbjct  1    MMSRSYTNLLDLATGNFPAIGRERKRLPRVMTVPGNVYELDDDQANSVSSDNPSSVAQDR  60

Query  365  MIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDG  478
            +IIV NQLP++A+RR D + GW F W+EDSLLLQLK+G
Sbjct  61   LIIVANQLPVKANRRAD-DRGWVFSWNEDSLLLQLKEG  97



>ref|XP_009778367.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6 [Nicotiana sylvestris]
Length=856

 Score =   116 bits (290),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 62/104 (60%), Positives = 81/104 (78%), Gaps = 3/104 (3%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGE--SLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQ  358
            MVSRSYSNLL+LASGE  S +FGR  +++ R+ TVAG++S+LDD+   +  SD  SS +Q
Sbjct  1    MVSRSYSNLLELASGEAPSPSFGRMSRRIPRIMTVAGIMSDLDDDGSESVCSDPSSSSAQ  60

Query  359  -ERMIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
             +R+IIV NQLP+R  R+ DG +GW F WDE+SLLLQLKDGLG+
Sbjct  61   KDRIIIVANQLPIRVQRKNDGSKGWLFSWDENSLLLQLKDGLGD  104



>ref|NP_564918.1| alpha,alpha-trehalose-phosphate synthase [UDP-forming] 6 [Arabidopsis 
thaliana]
 gb|AAK76702.1| putative trehalose-6-phosphate synthase [Arabidopsis thaliana]
 gb|AEE34737.1| alpha,alpha-trehalose-phosphate synthase [UDP-forming] 6 [Arabidopsis 
thaliana]
 gb|AHL38889.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=700

 Score =   115 bits (288),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 58/113 (51%), Positives = 78/113 (69%), Gaps = 18/113 (16%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  364
            MVSRSYSNLL+LASG+S TFGR  +++ R+  VAG++S +D++S+    S       ++R
Sbjct  1    MVSRSYSNLLELASGDSPTFGRMNRQIPRIMAVAGIMSNIDNDSKDTDLS------PKDR  54

Query  365  MIIVGNQLPLRAHRRTDGE------------EGWNFXWDEDSLLLQLKDGLGE  487
            +IIV N+LP+RA RR DG             +GWNF WDE+SLLLQLKDGLG+
Sbjct  55   IIIVANELPIRAQRRVDGNGSGSSSSSTCCSKGWNFSWDENSLLLQLKDGLGD  107



>ref|XP_011024382.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6-like [Populus euphratica]
 ref|XP_011024390.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6-like [Populus euphratica]
 ref|XP_011024395.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6-like [Populus euphratica]
Length=854

 Score =   116 bits (290),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 60/102 (59%), Positives = 79/102 (77%), Gaps = 1/102 (1%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQE-  361
            MVSRSYSNLL+LASGES +F R  +++ R+ TVAG++S++DD+   +  SD  SS  Q  
Sbjct  1    MVSRSYSNLLELASGESPSFERMNRRIPRIMTVAGIMSDIDDDPSESVCSDPSSSSGQMY  60

Query  362  RMIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            R+IIV NQLP+RA R++DG + W F WDE+SLLLQLKDGLG+
Sbjct  61   RIIIVANQLPIRAQRKSDGSKSWIFSWDENSLLLQLKDGLGD  102



>ref|XP_009624608.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 isoform X3 [Nicotiana tomentosiformis]
Length=754

 Score =   115 bits (289),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 59/101 (58%), Positives = 77/101 (76%), Gaps = 4/101 (4%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  364
            M+S+SY+NLLDLASG    F    ++L RV TVAGV+SELDD+  ++  SDVPSSI  +R
Sbjct  1    MLSKSYTNLLDLASG---NFPVMKRRLPRVMTVAGVISELDDDQANSVTSDVPSSIIVDR  57

Query  365  MIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            +IIV NQLP++A RR D  +GW+F WD+DSLLL +KDGL +
Sbjct  58   IIIVANQLPVKAKRRPDN-KGWSFSWDDDSLLLHIKDGLPD  97



>ref|XP_004503340.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6-like [Cicer arietinum]
Length=854

 Score =   115 bits (289),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 58/103 (56%), Positives = 78/103 (76%), Gaps = 2/103 (2%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDES--RSNGGSDVPSSISQ  358
            MVSRSYSNLL+LASGES +F    +++ R+ TVAG++S++DD+    S       SS+ +
Sbjct  1    MVSRSYSNLLELASGESPSFEHMNRRIPRIMTVAGLISDVDDDDPLESICSDPSSSSVQR  60

Query  359  ERMIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            ER+IIV NQLP++AHR+ DG + W F WDE+SLLLQLKDGLG+
Sbjct  61   ERIIIVANQLPIKAHRKQDGNKNWFFSWDENSLLLQLKDGLGD  103



>ref|XP_008455290.1| PREDICTED: LOW QUALITY PROTEIN: probable alpha,alpha-trehalose-phosphate 
synthase [UDP-forming] 7 [Cucumis melo]
Length=856

 Score =   115 bits (289),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 60/101 (59%), Positives = 72/101 (71%), Gaps = 1/101 (1%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  364
            M+SRSY+NLLDLASG         K+  RV TV G ++ELDD+   +  S+ PSSIS +R
Sbjct  1    MISRSYTNLLDLASGNFPAMEVKKKRFPRVMTVPGNVAELDDDQAYSVTSENPSSISSDR  60

Query  365  MIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            MIIV NQLPLRA RR D +  W+F W+EDSLLLQLKDGL E
Sbjct  61   MIIVANQLPLRAKRRED-DNSWSFSWNEDSLLLQLKDGLPE  100



>ref|XP_009624607.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 isoform X2 [Nicotiana tomentosiformis]
Length=755

 Score =   115 bits (288),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 59/101 (58%), Positives = 77/101 (76%), Gaps = 4/101 (4%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  364
            M+S+SY+NLLDLASG    F    ++L RV TVAGV+SELDD+  ++  SDVPSSI  +R
Sbjct  1    MLSKSYTNLLDLASG---NFPVMKRRLPRVMTVAGVISELDDDQANSVTSDVPSSIIVDR  57

Query  365  MIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            +IIV NQLP++A RR D  +GW+F WD+DSLLL +KDGL +
Sbjct  58   IIIVANQLPVKAKRRPDN-KGWSFSWDDDSLLLHIKDGLPD  97



>ref|XP_009624606.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 isoform X1 [Nicotiana tomentosiformis]
Length=851

 Score =   115 bits (289),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 59/101 (58%), Positives = 77/101 (76%), Gaps = 4/101 (4%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  364
            M+S+SY+NLLDLASG    F    ++L RV TVAGV+SELDD+  ++  SDVPSSI  +R
Sbjct  1    MLSKSYTNLLDLASG---NFPVMKRRLPRVMTVAGVISELDDDQANSVTSDVPSSIIVDR  57

Query  365  MIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            +IIV NQLP++A RR D  +GW+F WD+DSLLL +KDGL +
Sbjct  58   IIIVANQLPVKAKRRPDN-KGWSFSWDDDSLLLHIKDGLPD  97



>ref|XP_004136836.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7-like [Cucumis sativus]
 ref|XP_004170435.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7-like [Cucumis sativus]
Length=856

 Score =   115 bits (288),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 60/101 (59%), Positives = 72/101 (71%), Gaps = 1/101 (1%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  364
            M+SRSY+NLLDLASG         K+  RV TV G ++ELDD+   +  S+ PSSIS +R
Sbjct  1    MISRSYTNLLDLASGNFPAMEVKKKRFPRVMTVPGNVAELDDDQAYSVTSENPSSISSDR  60

Query  365  MIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            MIIV NQLPLRA RR D +  W+F W+EDSLLLQLKDGL E
Sbjct  61   MIIVANQLPLRAKRRED-DNSWSFSWNEDSLLLQLKDGLPE  100



>emb|CBI32507.3| unnamed protein product [Vitis vinifera]
Length=577

 Score =   114 bits (285),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 56/97 (58%), Positives = 74/97 (76%), Gaps = 1/97 (1%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  364
            M+SRSY+NLLDLA+G     GR  K+L RV TV G + ELDD+  ++  SD PSS++Q+R
Sbjct  1    MMSRSYTNLLDLATGNFPAIGRERKRLPRVMTVPGNVYELDDDQANSVSSDNPSSVAQDR  60

Query  365  MIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKD  475
            +IIV NQLP++A+RR D + GW F W+EDSLLLQLK+
Sbjct  61   LIIVANQLPVKANRRAD-DRGWVFSWNEDSLLLQLKE  96



>ref|NP_974105.1| alpha,alpha-trehalose-phosphate synthase [UDP-forming] 6 [Arabidopsis 
thaliana]
 sp|Q94AH8.2|TPS6_ARATH RecName: Full=Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6; AltName: Full=Trehalose-6-phosphate synthase 6; Short=AtTPS6 
[Arabidopsis thaliana]
 gb|AEE34738.1| alpha,alpha-trehalose-phosphate synthase [UDP-forming] 6 [Arabidopsis 
thaliana]
Length=860

 Score =   115 bits (288),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 58/113 (51%), Positives = 78/113 (69%), Gaps = 18/113 (16%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  364
            MVSRSYSNLL+LASG+S TFGR  +++ R+  VAG++S +D++S+    S       ++R
Sbjct  1    MVSRSYSNLLELASGDSPTFGRMNRQIPRIMAVAGIMSNIDNDSKDTDLS------PKDR  54

Query  365  MIIVGNQLPLRAHRRTDGE------------EGWNFXWDEDSLLLQLKDGLGE  487
            +IIV N+LP+RA RR DG             +GWNF WDE+SLLLQLKDGLG+
Sbjct  55   IIIVANELPIRAQRRVDGNGSGSSSSSTCCSKGWNFSWDENSLLLQLKDGLGD  107



>gb|KGN43637.1| hypothetical protein Csa_7G049190 [Cucumis sativus]
Length=971

 Score =   115 bits (288),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 60/102 (59%), Positives = 72/102 (71%), Gaps = 1/102 (1%)
 Frame = +2

Query  182  TMVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQE  361
             M+SRSY+NLLDLASG         K+  RV TV G ++ELDD+   +  S+ PSSIS +
Sbjct  115  NMISRSYTNLLDLASGNFPAMEVKKKRFPRVMTVPGNVAELDDDQAYSVTSENPSSISSD  174

Query  362  RMIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            RMIIV NQLPLRA RR D +  W+F W+EDSLLLQLKDGL E
Sbjct  175  RMIIVANQLPLRAKRRED-DNSWSFSWNEDSLLLQLKDGLPE  215



>gb|AHL29280.1| trehalose-phosphate synthase 6 [Camellia sinensis]
Length=856

 Score =   114 bits (286),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 60/104 (58%), Positives = 80/104 (77%), Gaps = 3/104 (3%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESL--TFGRAGKKLSRVATVAGVLSELDDE-SRSNGGSDVPSSIS  355
            MVSRSYSNLL+LASGES   +F R G+++ R+ TVAG++S+LDD+ S S       SS+ 
Sbjct  1    MVSRSYSNLLELASGESPVPSFSRMGRRIPRIMTVAGIMSDLDDDPSESVCSDRSSSSVH  60

Query  356  QERMIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            ++R+IIV NQLP+R  R+T+  +GW F WDE+SLLLQLKDGLG+
Sbjct  61   RDRIIIVANQLPIRVQRKTENGKGWIFTWDENSLLLQLKDGLGD  104



>ref|XP_008225229.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 [Prunus mume]
Length=854

 Score =   114 bits (285),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 64/101 (63%), Positives = 80/101 (79%), Gaps = 1/101 (1%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  364
            M+S+SY+NLLDLASG     GR  ++L RV TVAGV+SELDD+  ++  SDVPSS+ Q+R
Sbjct  1    MMSKSYTNLLDLASGNFPIMGRERRRLPRVMTVAGVISELDDDQANSVSSDVPSSVMQDR  60

Query  365  MIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            +IIV NQLP++A RR D  +GW+F WDEDSLLLQLKDGL E
Sbjct  61   IIIVANQLPVKAKRRPDN-KGWSFSWDEDSLLLQLKDGLPE  100



>ref|XP_010511780.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6-like isoform X1 [Camelina sativa]
 ref|XP_010511781.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6-like isoform X2 [Camelina sativa]
 ref|XP_010511783.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6-like isoform X4 [Camelina sativa]
Length=862

 Score =   114 bits (285),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 57/114 (50%), Positives = 78/114 (68%), Gaps = 19/114 (17%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  364
            MVSRSYSNLL+LASG+S TFGR  +++ R+  VAG++S +D+E++    S       ++R
Sbjct  1    MVSRSYSNLLELASGDSPTFGRMNRQIPRIMAVAGIMSNIDNETKETDLS------PKDR  54

Query  365  MIIVGNQLPLRAHRRTDGE-------------EGWNFXWDEDSLLLQLKDGLGE  487
            +IIV N+LP+RA RR DG              +GWNF WD++SLLLQLKDGLG+
Sbjct  55   IIIVANELPIRAQRRVDGNGSSSSSTSSICCSKGWNFSWDKNSLLLQLKDGLGD  108



>ref|XP_010511784.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6-like isoform X5 [Camelina sativa]
Length=863

 Score =   114 bits (285),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 57/114 (50%), Positives = 78/114 (68%), Gaps = 19/114 (17%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  364
            MVSRSYSNLL+LASG+S TFGR  +++ R+  VAG++S +D+E++    S       ++R
Sbjct  1    MVSRSYSNLLELASGDSPTFGRMNRQIPRIMAVAGIMSNIDNETKETDLS------PKDR  54

Query  365  MIIVGNQLPLRAHRRTDGE-------------EGWNFXWDEDSLLLQLKDGLGE  487
            +IIV N+LP+RA RR DG              +GWNF WD++SLLLQLKDGLG+
Sbjct  55   IIIVANELPIRAQRRVDGNGSSSSSTSSICCSKGWNFSWDKNSLLLQLKDGLGD  108



>ref|XP_006391193.1| hypothetical protein EUTSA_v10018111mg [Eutrema salsugineum]
 gb|ESQ28479.1| hypothetical protein EUTSA_v10018111mg [Eutrema salsugineum]
Length=863

 Score =   114 bits (285),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 58/114 (51%), Positives = 82/114 (72%), Gaps = 17/114 (15%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSIS-QE  361
            MVSRSYSNLL+LASG+S TFGR  +++ R+  VAG++S +D++S+ +    VPS +S ++
Sbjct  1    MVSRSYSNLLELASGDSPTFGRMNRQIPRIMAVAGIMSNIDNDSKES----VPSDLSPKD  56

Query  362  RMIIVGNQLPLRAHRRTDGE------------EGWNFXWDEDSLLLQLKDGLGE  487
            R+IIV N+LP+RA R+ +              +GWNF WDE+SLLLQLKDGLG+
Sbjct  57   RIIIVANELPIRAQRKLESNIGSTSTSSSCCSKGWNFSWDENSLLLQLKDGLGD  110



>ref|XP_003630977.1| Alpha,alpha-trehalose-phosphate synthase [Medicago truncatula]
 gb|AET05453.1| trehalose-6-phosphate synthase domain protein [Medicago truncatula]
Length=853

 Score =   114 bits (284),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 57/104 (55%), Positives = 77/104 (74%), Gaps = 3/104 (3%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDV-PSSISQE  361
            MVSRSYSNLL+L SG+S TF    +++ R+ TVAG++S++DD+    G S+   SS+ +E
Sbjct  1    MVSRSYSNLLELVSGDSPTFENINRRIPRIMTVAGLISDVDDDPLETGCSEPSSSSVQRE  60

Query  362  RMIIVGNQLPLRAHRRTDGE--EGWNFXWDEDSLLLQLKDGLGE  487
            R+IIV NQLP++A R+ DG     W F WDE+SLLLQLKDGLG+
Sbjct  61   RIIIVANQLPIKAQRKQDGNNMNKWFFSWDENSLLLQLKDGLGD  104



>ref|XP_006843713.1| hypothetical protein AMTR_s00007p00214170 [Amborella trichopoda]
 gb|ERN05388.1| hypothetical protein AMTR_s00007p00214170 [Amborella trichopoda]
Length=846

 Score =   114 bits (284),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 66/101 (65%), Positives = 79/101 (78%), Gaps = 1/101 (1%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  364
            M SRSY+NLLDLA+G      R+GK+L RV TV GV+SELDD++ ++  SDVPSS+SQER
Sbjct  1    MTSRSYTNLLDLATGNFPAPTRSGKRLPRVMTVPGVISELDDDNANSVSSDVPSSVSQER  60

Query  365  MIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            +IIV NQLPLRA RR D   GW F WD+DSLLLQLKDGL +
Sbjct  61   IIIVANQLPLRARRRPDN-RGWIFSWDDDSLLLQLKDGLPD  100



>ref|XP_009416430.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 [Musa acuminata subsp. malaccensis]
 ref|XP_009416432.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 [Musa acuminata subsp. malaccensis]
Length=874

 Score =   113 bits (282),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 63/107 (59%), Positives = 80/107 (75%), Gaps = 7/107 (7%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGE----SLTFGRAGKKLSRVATVAGVLSEL-DDESRSNG-GSDVPS  346
            M+SRSY+NLLDLASG     SL  GRA ++L RV TV G L++L ++E R+N   SDV S
Sbjct  1    MMSRSYTNLLDLASGNFSALSLGGGRAPRRLPRVMTVPGTLADLQEEEERANSVASDVQS  60

Query  347  SISQERMIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            S +Q+R+IIV NQLP+RA RR D + GW F WD+DSL+LQLKDGL +
Sbjct  61   SQAQDRIIIVANQLPVRARRRPD-DRGWTFAWDDDSLILQLKDGLPD  106



>ref|XP_004505467.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7-like [Cicer arietinum]
Length=860

 Score =   113 bits (282),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 58/106 (55%), Positives = 77/106 (73%), Gaps = 6/106 (6%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFG-----RAGKKLSRVATVAGVLSELDDESRSNGGSDVPSS  349
            M+SRSY+NLLDLASG     G     +  ++L RV +V G++SELDD+   +  SD PS+
Sbjct  1    MMSRSYTNLLDLASGNFPAMGSGREFKERRRLPRVMSVPGIVSELDDDQAVSVSSDNPST  60

Query  350  ISQERMIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            IS +R+IIV NQLPL+A RR D ++GW+F W+ED+LLLQLKDG  E
Sbjct  61   ISTDRIIIVANQLPLKAKRRED-DKGWSFSWNEDALLLQLKDGFPE  105



>ref|XP_010557135.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 isoform X1 [Tarenaya hassleriana]
 ref|XP_010557136.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 isoform X2 [Tarenaya hassleriana]
Length=851

 Score =   113 bits (282),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 58/101 (57%), Positives = 71/101 (70%), Gaps = 3/101 (3%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  364
            M+SRSY+NLLDLASG     GR  ++L RV TV G +SE D++   +  SD PSSIS +R
Sbjct  1    MISRSYTNLLDLASGNFPVMGRERRRLPRVMTVPGNVSEFDEDQAYSVSSDNPSSISTDR  60

Query  365  MIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            MIIV N+LPL+A RR      WNF W++DSL LQLKDGL E
Sbjct  61   MIIVANRLPLKAERRNG---SWNFSWNQDSLYLQLKDGLPE  98



>ref|XP_003540002.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7-like [Glycine max]
 gb|KHN34247.1| Putative alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
7 [Glycine soja]
Length=862

 Score =   112 bits (281),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 57/105 (54%), Positives = 76/105 (72%), Gaps = 5/105 (5%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFG----RAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSI  352
            M+SRSY+NLLDLASG     G    R  K++ RV +V G L+E+DD+   +  SD PS++
Sbjct  1    MMSRSYTNLLDLASGNFPAMGGRETRERKRMPRVMSVPGFLTEVDDDQAVSVSSDNPSTV  60

Query  353  SQERMIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            + +RMIIV NQLPL+A R+ D  +GW+F W+EDSLLLQLKDGL +
Sbjct  61   TTDRMIIVANQLPLKAKRKEDN-KGWSFSWNEDSLLLQLKDGLPD  104



>ref|XP_009411218.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 [Musa acuminata subsp. malaccensis]
Length=873

 Score =   112 bits (281),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 63/105 (60%), Positives = 80/105 (76%), Gaps = 5/105 (5%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGE--SLTFGRAGKKLSRVATVAGVLSELD-DESRS-NGGSDVPSSI  352
            M+SRSY+NLLDLASG   +L+ G   +++SR  TV G LS LD D+ R+ +  SDVPSSI
Sbjct  1    MMSRSYTNLLDLASGNFSALSLGGRSRRMSRTMTVPGSLSGLDEDDDRAISVSSDVPSSI  60

Query  353  SQERMIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            +Q+R+IIV NQLP+RA RR DG  GW+F WD+DSLLLQLK GL +
Sbjct  61   AQDRVIIVANQLPVRARRRPDG-HGWSFAWDDDSLLLQLKGGLPD  104



>gb|KDO77921.1| hypothetical protein CISIN_1g003025mg [Citrus sinensis]
Length=761

 Score =   112 bits (279),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 64/103 (62%), Positives = 80/103 (78%), Gaps = 3/103 (3%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFG--RAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQ  358
            M+S+SY+NLLDLASG     G  R  K+L RV TV GV+SELDD+  ++  SDVPSS++Q
Sbjct  1    MMSKSYTNLLDLASGNFPAMGPSREKKRLPRVMTVPGVISELDDDQANSVSSDVPSSVAQ  60

Query  359  ERMIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            +R+IIV NQLP++A RR D  +GW+F WDEDSLLLQLKDGL E
Sbjct  61   DRVIIVANQLPVKAKRRPD-NKGWSFSWDEDSLLLQLKDGLPE  102



>ref|XP_003607607.1| Trehalose synthase-like protein [Medicago truncatula]
 gb|AES89804.1| trehalose-6-phosphate synthase domain protein [Medicago truncatula]
Length=861

 Score =   112 bits (280),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 56/108 (52%), Positives = 77/108 (71%), Gaps = 8/108 (7%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFG-------RAGKKLSRVATVAGVLSELDDESRSNGGSDVP  343
            M+SRSY+NLLDLASG     G       +  +++ RV +V G++SE+DD+   +  SD P
Sbjct  1    MMSRSYTNLLDLASGNFPAMGSGSGREFKERRRMPRVMSVPGIVSEVDDDQAVSVSSDNP  60

Query  344  SSISQERMIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            S+I+ +R+IIV NQLPL+A++R D  +GWNF W+EDSLLLQLKDG  E
Sbjct  61   STITTDRIIIVANQLPLKANKREDN-KGWNFSWNEDSLLLQLKDGFPE  107



>ref|XP_006467609.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7-like [Citrus sinensis]
 gb|KDO77917.1| hypothetical protein CISIN_1g003025mg [Citrus sinensis]
 gb|KDO77918.1| hypothetical protein CISIN_1g003025mg [Citrus sinensis]
 gb|KDO77919.1| hypothetical protein CISIN_1g003025mg [Citrus sinensis]
 gb|KDO77920.1| hypothetical protein CISIN_1g003025mg [Citrus sinensis]
Length=856

 Score =   112 bits (279),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 64/103 (62%), Positives = 80/103 (78%), Gaps = 3/103 (3%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFG--RAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQ  358
            M+S+SY+NLLDLASG     G  R  K+L RV TV GV+SELDD+  ++  SDVPSS++Q
Sbjct  1    MMSKSYTNLLDLASGNFPAMGPSREKKRLPRVMTVPGVISELDDDQANSVSSDVPSSVAQ  60

Query  359  ERMIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            +R+IIV NQLP++A RR D  +GW+F WDEDSLLLQLKDGL E
Sbjct  61   DRVIIVANQLPVKAKRRPD-NKGWSFSWDEDSLLLQLKDGLPE  102



>ref|XP_006449548.1| hypothetical protein CICLE_v10014248mg [Citrus clementina]
 ref|XP_006449549.1| hypothetical protein CICLE_v10014248mg [Citrus clementina]
 gb|ESR62788.1| hypothetical protein CICLE_v10014248mg [Citrus clementina]
 gb|ESR62789.1| hypothetical protein CICLE_v10014248mg [Citrus clementina]
Length=856

 Score =   112 bits (279),  Expect = 4e-25, Method: Composition-based stats.
 Identities = 64/103 (62%), Positives = 80/103 (78%), Gaps = 3/103 (3%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFG--RAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQ  358
            M+S+SY+NLLDLASG     G  R  K+L RV TV GV+SELDD+  ++  SDVPSS++Q
Sbjct  1    MMSKSYTNLLDLASGNFPAMGPSREKKRLPRVMTVPGVISELDDDQANSVSSDVPSSVAQ  60

Query  359  ERMIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            +R+IIV NQLP++A RR D  +GW+F WDEDSLLLQLKDGL E
Sbjct  61   DRVIIVANQLPVKAKRRPD-NKGWSFSWDEDSLLLQLKDGLPE  102



>ref|XP_010415412.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6 [Camelina sativa]
Length=859

 Score =   112 bits (279),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 56/112 (50%), Positives = 77/112 (69%), Gaps = 17/112 (15%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  364
            MVSRSYSNLL+LASG+S TFGR  +++ R+  VAG++S +D+E++    S       ++R
Sbjct  1    MVSRSYSNLLELASGDSPTFGRMNRQIPRIMAVAGIMSNIDNETKETDLS------PKDR  54

Query  365  MIIVGNQLPLRAHRRTD-----------GEEGWNFXWDEDSLLLQLKDGLGE  487
            +IIV N+LP+RA RR D             +GWNF WD++SLLLQLKDGLG+
Sbjct  55   IIIVANELPIRAQRRVDGSTSGSTSSTCCSKGWNFSWDKNSLLLQLKDGLGD  106



>emb|CDY07404.1| BnaA07g24830D [Brassica napus]
Length=852

 Score =   111 bits (278),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 54/101 (53%), Positives = 76/101 (75%), Gaps = 4/101 (4%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  364
            MVSRSYSNLL+LASG+S TFGR  +++ R+  VAG++S +D++S+ +  SD+P    ++R
Sbjct  1    MVSRSYSNLLELASGDSPTFGRMNRQIPRIMAVAGIMSNIDNDSKESPSSDLP---PKDR  57

Query  365  MIIVGNQLPLRAHRRTD-GEEGWNFXWDEDSLLLQLKDGLG  484
            +IIV N+LP+RA R+ +     W F  DE+SLLLQLKDGLG
Sbjct  58   IIIVANELPIRAQRKLETSSTSWTFSLDENSLLLQLKDGLG  98



>ref|XP_002888643.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64902.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=857

 Score =   111 bits (277),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 56/110 (51%), Positives = 77/110 (70%), Gaps = 15/110 (14%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  364
            MVSRSYSNLL+LASG+S TFGR  +++ R+  VAG++S +D++S+    S       ++R
Sbjct  1    MVSRSYSNLLELASGDSPTFGRMNRQIPRIMAVAGIMSNIDNDSKETDLS------PKDR  54

Query  365  MIIVGNQLPLRAHRRTD---------GEEGWNFXWDEDSLLLQLKDGLGE  487
            +IIV N+LP+RA RR +           +GWNF WDE+SLLLQLKDGLG+
Sbjct  55   IIIVANELPIRAQRRLEGSGSSTSTCCSKGWNFSWDENSLLLQLKDGLGD  104



>emb|CDY04199.1| BnaC06g26160D [Brassica napus]
Length=851

 Score =   111 bits (277),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 53/100 (53%), Positives = 75/100 (75%), Gaps = 3/100 (3%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  364
            MVSRSYSNLL+LASG+S TFGR  +++ R+  VAG++S +D++S+ +  SD+     ++R
Sbjct  1    MVSRSYSNLLELASGDSPTFGRMNRQIPRIMAVAGIMSNIDNDSKESLSSDLS---PKDR  57

Query  365  MIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLG  484
            +IIV N+LP+RA R+ +    W F  DE+SLLLQLKDGLG
Sbjct  58   IIIVANELPIRAQRKLESSTSWTFSLDENSLLLQLKDGLG  97



>emb|CDP15959.1| unnamed protein product [Coffea canephora]
Length=793

 Score =   110 bits (275),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 57/100 (57%), Positives = 72/100 (72%), Gaps = 3/100 (3%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAG--KKLSRVATVAGVLSELDDESRSNGGSDVPSSISQ  358
            M+SRSY+NLLDLASG     GR    ++  RV TV G + ELDD+   +  SD PSSI+ 
Sbjct  1    MLSRSYTNLLDLASGNIPVMGREKERRRFPRVMTVPGSICELDDDQAHSVASDNPSSIAG  60

Query  359  ERMIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDG  478
            +RMI+V NQLPL+A RR D  +GW+F W+EDSLLL+LKDG
Sbjct  61   DRMIVVSNQLPLKAKRRPDN-KGWSFTWNEDSLLLRLKDG  99



>ref|XP_006300724.1| hypothetical protein CARUB_v10019781mg [Capsella rubella]
 gb|EOA33622.1| hypothetical protein CARUB_v10019781mg [Capsella rubella]
Length=863

 Score =   110 bits (275),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 56/115 (49%), Positives = 77/115 (67%), Gaps = 20/115 (17%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  364
            MVSRSYSNLL+LASG+S TFGR  +++ R+  VAG++S +D++S+    S       ++R
Sbjct  1    MVSRSYSNLLELASGDSPTFGRMNRQIPRIMAVAGIMSNIDNDSKETDLS------PKDR  54

Query  365  MIIVGNQLPLRAHRRTD--------------GEEGWNFXWDEDSLLLQLKDGLGE  487
            +IIV N+LP+RA RR D                +GWNF WD++SLLLQLKDGLG+
Sbjct  55   IIIVANELPIRAQRRVDGSSGSTSGGSTSTCCSKGWNFSWDKNSLLLQLKDGLGD  109



>ref|XP_010093315.1| Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 6 [Morus 
notabilis]
 gb|EXB53854.1| Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 6 [Morus 
notabilis]
Length=855

 Score =   110 bits (274),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 57/102 (56%), Positives = 76/102 (75%), Gaps = 1/102 (1%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELD-DESRSNGGSDVPSSISQE  361
            MVS+SYSNLL+LASGE  +FGR   ++ R+ TV+G++SE+D D S S       SSI ++
Sbjct  1    MVSKSYSNLLELASGEPPSFGRISGRIPRLMTVSGLISEIDEDPSESVCSDWSSSSIHRD  60

Query  362  RMIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            R+I+V NQLP+RA RR D  +GW F WD+ SLLLQ+KDGLG+
Sbjct  61   RIIMVANQLPIRAQRRLDCSKGWLFNWDDTSLLLQMKDGLGD  102



>ref|XP_007025310.1| Trehalose-phosphatase/synthase 7 isoform 4 [Theobroma cacao]
 gb|EOY27932.1| Trehalose-phosphatase/synthase 7 isoform 4 [Theobroma cacao]
Length=754

 Score =   109 bits (273),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 64/103 (62%), Positives = 80/103 (78%), Gaps = 3/103 (3%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRA--GKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQ  358
            M+SRSY+NLLDLASG     G+A   K+L RV TV GV+SELDD+  ++  SDVPSS+ Q
Sbjct  1    MMSRSYTNLLDLASGNFPVMGQAREKKRLPRVMTVPGVISELDDDQANSVSSDVPSSVIQ  60

Query  359  ERMIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            +R+IIV NQLP++A RR D  +GW+F WD+DSLLLQLKDGL E
Sbjct  61   DRIIIVANQLPVKAKRRPDN-KGWSFSWDDDSLLLQLKDGLPE  102



>ref|XP_006654654.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7-like [Oryza brachyantha]
Length=893

 Score =   110 bits (274),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 59/112 (53%), Positives = 73/112 (65%), Gaps = 12/112 (11%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAG-----------KKLSRVATVAGVLSELDDESRSNGG  331
            M+SRSY+NLLDLA+G     G AG           K+++RV TV G LSELDDE      
Sbjct  1    MMSRSYTNLLDLAAGNFAALGPAGGGRRRSGSFGAKRMTRVMTVPGTLSELDDEDDEPVA  60

Query  332  SDVPSSISQERMIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            SDVPSS   ER+I+V NQLP+ A RR DG  GW   WD+DSLLL+L+DG+ +
Sbjct  61   SDVPSSAVCERLIVVANQLPVVARRRADG-RGWTVSWDDDSLLLRLRDGVPD  111



>ref|XP_007025309.1| Trehalose-phosphatase/synthase 7 isoform 3 [Theobroma cacao]
 gb|EOY27931.1| Trehalose-phosphatase/synthase 7 isoform 3 [Theobroma cacao]
Length=764

 Score =   109 bits (273),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 64/103 (62%), Positives = 80/103 (78%), Gaps = 3/103 (3%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRA--GKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQ  358
            M+SRSY+NLLDLASG     G+A   K+L RV TV GV+SELDD+  ++  SDVPSS+ Q
Sbjct  1    MMSRSYTNLLDLASGNFPVMGQAREKKRLPRVMTVPGVISELDDDQANSVSSDVPSSVIQ  60

Query  359  ERMIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            +R+IIV NQLP++A RR D  +GW+F WD+DSLLLQLKDGL E
Sbjct  61   DRIIIVANQLPVKAKRRPDN-KGWSFSWDDDSLLLQLKDGLPE  102



>ref|XP_007025308.1| Trehalose-phosphatase/synthase 7 isoform 2 [Theobroma cacao]
 gb|EOY27930.1| Trehalose-phosphatase/synthase 7 isoform 2 [Theobroma cacao]
Length=857

 Score =   109 bits (273),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 64/103 (62%), Positives = 80/103 (78%), Gaps = 3/103 (3%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRA--GKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQ  358
            M+SRSY+NLLDLASG     G+A   K+L RV TV GV+SELDD+  ++  SDVPSS+ Q
Sbjct  1    MMSRSYTNLLDLASGNFPVMGQAREKKRLPRVMTVPGVISELDDDQANSVSSDVPSSVIQ  60

Query  359  ERMIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            +R+IIV NQLP++A RR D  +GW+F WD+DSLLLQLKDGL E
Sbjct  61   DRIIIVANQLPVKAKRRPDN-KGWSFSWDDDSLLLQLKDGLPE  102



>gb|EPS71188.1| hypothetical protein M569_03569, partial [Genlisea aurea]
Length=861

 Score =   109 bits (273),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 58/103 (56%), Positives = 74/103 (72%), Gaps = 3/103 (3%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFG--RAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQ  358
            M+SRSY+NLLDLASG     G  +  K+  RV TV G + ELDDE  S+  S+ PSS++ 
Sbjct  8    MLSRSYTNLLDLASGNFPVMGTEKEKKRFPRVMTVPGNIVELDDEQASSVTSENPSSVAG  67

Query  359  ERMIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            +RMIIV N LPL+A RR D  +GW+F W+EDSLLL++KDGL E
Sbjct  68   DRMIIVSNLLPLKAKRRPDN-KGWSFSWNEDSLLLRVKDGLPE  109



>ref|XP_007025307.1| Trehalose-phosphatase/synthase 7 isoform 1 [Theobroma cacao]
 gb|EOY27929.1| Trehalose-phosphatase/synthase 7 isoform 1 [Theobroma cacao]
Length=888

 Score =   109 bits (272),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 64/103 (62%), Positives = 80/103 (78%), Gaps = 3/103 (3%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRA--GKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQ  358
            M+SRSY+NLLDLASG     G+A   K+L RV TV GV+SELDD+  ++  SDVPSS+ Q
Sbjct  1    MMSRSYTNLLDLASGNFPVMGQAREKKRLPRVMTVPGVISELDDDQANSVSSDVPSSVIQ  60

Query  359  ERMIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            +R+IIV NQLP++A RR D  +GW+F WD+DSLLLQLKDGL E
Sbjct  61   DRIIIVANQLPVKAKRRPDN-KGWSFSWDDDSLLLQLKDGLPE  102



>ref|XP_006417924.1| hypothetical protein EUTSA_v10006783mg [Eutrema salsugineum]
 ref|XP_006417925.1| hypothetical protein EUTSA_v10006783mg [Eutrema salsugineum]
 ref|XP_006417926.1| hypothetical protein EUTSA_v10006783mg [Eutrema salsugineum]
 gb|ESQ36277.1| hypothetical protein EUTSA_v10006783mg [Eutrema salsugineum]
 gb|ESQ36278.1| hypothetical protein EUTSA_v10006783mg [Eutrema salsugineum]
 gb|ESQ36279.1| hypothetical protein EUTSA_v10006783mg [Eutrema salsugineum]
Length=851

 Score =   109 bits (272),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 56/101 (55%), Positives = 71/101 (70%), Gaps = 3/101 (3%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  364
            M+SRSY+NLLDLASG     GR  ++L RV TV G +SE D++   +  SD PSS+S +R
Sbjct  1    MISRSYTNLLDLASGNFPVMGRERRRLPRVMTVPGNVSEFDEDQAYSVSSDNPSSVSCDR  60

Query  365  MIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            MIIV N+LPL+A RR      W+F WD+D+L LQLKDGL E
Sbjct  61   MIIVANRLPLKAERRNG---CWSFSWDQDALYLQLKDGLPE  98



>emb|CBI33857.3| unnamed protein product [Vitis vinifera]
Length=223

 Score =   104 bits (260),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 58/101 (57%), Positives = 64/101 (63%), Gaps = 27/101 (27%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  364
            MVSRSYSNLLDL                           LDDE+ ++  SD PSS+SQ+R
Sbjct  1    MVSRSYSNLLDL---------------------------LDDETSNSVTSDAPSSVSQDR  33

Query  365  MIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            MIIVGNQLPLRAHR +DG   W F WDEDSLLLQLKDGLGE
Sbjct  34   MIIVGNQLPLRAHRSSDGSGEWCFSWDEDSLLLQLKDGLGE  74



>gb|KFK41224.1| hypothetical protein AALP_AA2G101500 [Arabis alpina]
Length=857

 Score =   109 bits (272),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 54/110 (49%), Positives = 76/110 (69%), Gaps = 16/110 (15%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  364
            MVSRSYSNLL+LASG+S TFGR  +++ R+  VAG++S +D++S+            ++R
Sbjct  1    MVSRSYSNLLELASGDSPTFGRMNRQIPRIMAVAGIMSNIDNDSKETLS-------PKDR  53

Query  365  MIIVGNQLPLRAHRRTDGE---------EGWNFXWDEDSLLLQLKDGLGE  487
            +IIV N+LP+RA R+ +           +GWNF WDE+SLLLQLKDGLG+
Sbjct  54   IIIVANELPIRAQRKLETNIGTSSSSTSKGWNFSWDENSLLLQLKDGLGD  103



>ref|XP_009409100.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6-like [Musa acuminata subsp. malaccensis]
Length=862

 Score =   108 bits (271),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 59/101 (58%), Positives = 79/101 (78%), Gaps = 1/101 (1%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  364
            MVSRSYSNLL+LASGE  +  +  +++ RV TVAG++S+LD +S S+G +  PSS +++R
Sbjct  1    MVSRSYSNLLELASGEPPSISQIRRRIPRVMTVAGIISDLDSDSDSDGSATGPSSTTRDR  60

Query  365  MIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
             I+V NQLP+RA RR DG  GW+F WDEDSLLLQLKD +G+
Sbjct  61   TIVVANQLPIRARRRPDG-RGWDFSWDEDSLLLQLKDAIGD  100



>ref|XP_003529226.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6-like [Glycine max]
 gb|KHN19098.1| Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 6 [Glycine 
soja]
Length=853

 Score =   108 bits (270),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 55/103 (53%), Positives = 79/103 (77%), Gaps = 3/103 (3%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSIS-QE  361
            MVS+SYSNLL+LASGE+ +FG   +++ R+ TVAG++S++DD+   +  SD  SS + ++
Sbjct  1    MVSKSYSNLLELASGEAPSFGYMNRRIPRIMTVAGLISDVDDDPVESVCSDPSSSTAHRD  60

Query  362  RMIIVGNQLPLRAHRRTDGEEG-WNFXWDEDSLLLQLKDGLGE  487
            R+I+V NQLP+RA RR DG    W+F WDE++ LLQLKDGLG+
Sbjct  61   RIIMVANQLPIRAQRRPDGNRSCWSFEWDENA-LLQLKDGLGD  102



>gb|KDO60795.1| hypothetical protein CISIN_1g044635mg [Citrus sinensis]
Length=831

 Score =   108 bits (269),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 60/102 (59%), Positives = 81/102 (79%), Gaps = 1/102 (1%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQ-E  361
            MVS+SYSNLL+LASGE+ +FGR  +++ R+ TVAG++S+LDD+   +  SD  SS  Q +
Sbjct  1    MVSKSYSNLLELASGEAPSFGRMRRRIPRIMTVAGIISDLDDDPADSVCSDPSSSSVQRD  60

Query  362  RMIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            R+IIV NQLP+RA R++D  +GW F WDE+SLLLQLKDGLG+
Sbjct  61   RIIIVANQLPIRAQRKSDNSKGWIFSWDENSLLLQLKDGLGD  102



>ref|XP_006448141.1| hypothetical protein CICLE_v10014251mg [Citrus clementina]
 ref|XP_006448142.1| hypothetical protein CICLE_v10014251mg [Citrus clementina]
 ref|XP_006469268.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6-like [Citrus sinensis]
 gb|ESR61381.1| hypothetical protein CICLE_v10014251mg [Citrus clementina]
 gb|ESR61382.1| hypothetical protein CICLE_v10014251mg [Citrus clementina]
Length=854

 Score =   108 bits (269),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 60/102 (59%), Positives = 81/102 (79%), Gaps = 1/102 (1%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQ-E  361
            MVS+SYSNLL+LASGE+ +FGR  +++ R+ TVAG++S+LDD+   +  SD  SS  Q +
Sbjct  1    MVSKSYSNLLELASGEAPSFGRMRRRIPRIMTVAGIISDLDDDPADSVCSDPSSSSVQRD  60

Query  362  RMIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            R+IIV NQLP+RA R++D  +GW F WDE+SLLLQLKDGLG+
Sbjct  61   RIIIVANQLPIRAQRKSDNSKGWIFSWDENSLLLQLKDGLGD  102



>emb|CDM84185.1| unnamed protein product [Triticum aestivum]
Length=913

 Score =   108 bits (269),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 61/119 (51%), Positives = 75/119 (63%), Gaps = 19/119 (16%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAG------------KKLSRVATVAGVLSELDDESRSNG  328
            M+SRSY+NLLDLA G     G A             K++SRV TV G LSELD E  S  
Sbjct  1    MMSRSYTNLLDLAEGNFAALGPASGGARRRSGSFGMKRMSRVMTVPGTLSELDGEDESEP  60

Query  329  G------SDVPSSISQERMIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
                   SDVPSS+S ER+++V NQLP+ A RR DG  GW+F WD+DSLLLQL+DG+ +
Sbjct  61   AATNSVASDVPSSVSGERLLVVSNQLPIVARRRPDG-RGWSFSWDDDSLLLQLRDGIPD  118



>ref|XP_003569812.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 [Brachypodium distachyon]
Length=909

 Score =   108 bits (269),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 63/119 (53%), Positives = 77/119 (65%), Gaps = 21/119 (18%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGE------------SLTFGRAGKKLSRVATVAGVLSELDDESRSNG  328
            M+SRSY+NLLDLA G               +FG   K++SRV TV G LSELD E  S  
Sbjct  1    MMSRSYTNLLDLAEGNFAALGPAGGGGRRRSFGM--KRMSRVMTVPGTLSELDGEDDSEP  58

Query  329  G------SDVPSSISQERMIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            G      SDVPSS+S ER+I+V NQLP+ A RR DG  GW+F WD+DSLLLQL+DG+ +
Sbjct  59   GATNSVASDVPSSVSGERLIVVSNQLPIVARRRPDG-RGWSFSWDDDSLLLQLRDGIPD  116



>ref|XP_008381189.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 [Malus domestica]
Length=854

 Score =   107 bits (268),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 56/100 (56%), Positives = 70/100 (70%), Gaps = 1/100 (1%)
 Frame = +2

Query  188  VSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQERM  367
            +S+SY NLLDLASG   T     ++  RV T  G LS+LDD+   +  SD PSSI+ +R+
Sbjct  1    MSQSYINLLDLASGNFPTMEGKRRRFPRVNTAPGNLSDLDDDQARSVSSDQPSSIASDRV  60

Query  368  IIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            IIV NQLP++A RR D  +GW F W+EDSLLLQLKDGL E
Sbjct  61   IIVANQLPVKAKRREDN-KGWTFSWNEDSLLLQLKDGLPE  99



>ref|XP_008228949.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 [Prunus mume]
Length=856

 Score =   107 bits (268),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 55/100 (55%), Positives = 70/100 (70%), Gaps = 1/100 (1%)
 Frame = +2

Query  188  VSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQERM  367
            +S+SY NLLDLASG   T     ++  RV T  G LS+LDD+   +  SD PSSI+ +RM
Sbjct  1    MSKSYVNLLDLASGNFPTMEGKRRRFPRVNTAPGNLSDLDDDQARSVSSDQPSSIASDRM  60

Query  368  IIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            IIV NQLP++A RR D  +GW+F W+ED+LLL LKDGL E
Sbjct  61   IIVANQLPVKAKRREDN-KGWSFSWNEDALLLHLKDGLPE  99



>ref|XP_009782523.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 [Nicotiana sylvestris]
Length=857

 Score =   107 bits (267),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 58/103 (56%), Positives = 76/103 (74%), Gaps = 3/103 (3%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKK--LSRVATVAGVLSELDDESRSNGGSDVPSSISQ  358
            M+SRSY+NLLDLASG   T GR  ++  + RV TV G + ELDD+  ++  S+ PSS++ 
Sbjct  1    MISRSYTNLLDLASGNFPTMGRERERRRMPRVMTVPGSICELDDDQANSVSSENPSSLAG  60

Query  359  ERMIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            +RMIIV N LPL+A RR D  +GW+F W+EDSLLL+LKDGL E
Sbjct  61   DRMIIVANLLPLKAKRRPDN-KGWSFSWNEDSLLLRLKDGLPE  102



>ref|XP_009628927.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 [Nicotiana tomentosiformis]
Length=857

 Score =   107 bits (267),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 58/103 (56%), Positives = 76/103 (74%), Gaps = 3/103 (3%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKK--LSRVATVAGVLSELDDESRSNGGSDVPSSISQ  358
            M+SRSY+NLLDLASG   T GR  ++  + RV TV G + ELDD+  ++  S+ PSS++ 
Sbjct  1    MISRSYTNLLDLASGNFPTMGRERERRRMPRVMTVPGSICELDDDQANSVSSENPSSLAG  60

Query  359  ERMIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            +RMIIV N LPL+A RR D  +GW+F W+EDSLLL+LKDGL E
Sbjct  61   DRMIIVANLLPLKAKRRPDN-KGWSFSWNEDSLLLRLKDGLPE  102



>ref|XP_003568093.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 [Brachypodium distachyon]
Length=902

 Score =   107 bits (267),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 76/117 (65%), Gaps = 17/117 (15%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAG-----------KKLSRVATVAGVLSELDDE-----S  316
            M+SRSY+NLLDLA+G     G AG           K++ RV TV G LSELDDE     +
Sbjct  1    MMSRSYTNLLDLAAGNFAALGPAGGGRRRSGSFAAKRMPRVMTVPGTLSELDDEDDELAA  60

Query  317  RSNGGSDVPSSISQERMIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
             S+  SDVPSS   ER+I+V NQLP+ A RR DG  GW F WD+DSLLL+L+DG+ +
Sbjct  61   TSSIASDVPSSAVGERLIVVANQLPVVARRRPDG-RGWLFSWDDDSLLLRLRDGVPD  116



>ref|XP_010522084.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 [Tarenaya hassleriana]
Length=845

 Score =   107 bits (266),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 55/101 (54%), Positives = 69/101 (68%), Gaps = 3/101 (3%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  364
            M+SRSY+NLLDLASG     GR  ++L RV TV   + ELD++   +  SD PSSI  +R
Sbjct  1    MISRSYTNLLDLASGNFPVMGRERRRLPRVMTVPSNVCELDEDQAYSVSSDNPSSIPTDR  60

Query  365  MIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            MIIV N+LPL+A RR      W+F W++DSL LQLKDGL E
Sbjct  61   MIIVANRLPLKAERRNG---SWSFSWNQDSLYLQLKDGLPE  98



>tpg|DAA57653.1| TPA: putative trehalose phosphatase/synthase family protein [Zea 
mays]
Length=912

 Score =   106 bits (265),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 60/119 (50%), Positives = 77/119 (65%), Gaps = 19/119 (16%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAG------------KKLSRVATVAGVLSELDDE-----  313
            M+SRSY+NLLDLA G     G AG            +++SRV TV G LSELD E     
Sbjct  1    MMSRSYTNLLDLAEGNFAALGPAGGSGRQRHGSFGLRRMSRVMTVPGTLSELDGEDESEP  60

Query  314  -SRSNGGSDVPSSISQERMIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
             + S+  SDVPSS++ +R+I+V NQLP+ A RR DG  GW+F WD DSLLLQL+DG+ +
Sbjct  61   AATSSVASDVPSSVAVDRLIVVSNQLPIVARRRPDG-RGWSFSWDGDSLLLQLRDGIPD  118



>dbj|BAJ87235.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=902

 Score =   106 bits (265),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 76/117 (65%), Gaps = 17/117 (15%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAG-----------KKLSRVATVAGVLSELDDE-----S  316
            M+SRSY+NLLDLA+G     G AG           +++ RV TV G LSELDDE     +
Sbjct  1    MMSRSYTNLLDLAAGNFAALGPAGGGRRRSGSFASRRMPRVMTVPGTLSELDDEDDERAA  60

Query  317  RSNGGSDVPSSISQERMIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
             S+  SDVPSS   ER+I+V NQLP+ A RR DG  GW F WD+DSLLL+L+DG+ +
Sbjct  61   TSSVASDVPSSAICERLIVVANQLPVVARRRPDG-RGWVFSWDDDSLLLRLRDGVPD  116



>ref|XP_010276900.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6-like isoform X1 [Nelumbo nucifera]
 ref|XP_010276976.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6-like isoform X1 [Nelumbo nucifera]
Length=853

 Score =   106 bits (265),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 59/101 (58%), Positives = 76/101 (75%), Gaps = 1/101 (1%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  364
            MVSR YSNLL+LASGES +FGR  +++ R+ TVAG++S+LDD+   +  SD  S   +ER
Sbjct  1    MVSRPYSNLLELASGESPSFGRMSRRIPRIMTVAGIISDLDDDPDDSVSSDPSSPAPRER  60

Query  365  MIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
             IIV NQLP+R HR+ D  +GW F W+EDSLLLQLKD LG+
Sbjct  61   TIIVANQLPIRVHRKPDN-KGWTFSWEEDSLLLQLKDRLGD  100



>gb|EPS68578.1| hypothetical protein M569_06190 [Genlisea aurea]
Length=762

 Score =   106 bits (264),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 56/103 (54%), Positives = 71/103 (69%), Gaps = 3/103 (3%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAG--KKLSRVATVAGVLSELDDESRSNGGSDVPSSISQ  358
            M+SRSY+NLLDLASG     GR    K+  RV TV G + ELDDE  S+  SD PSS++ 
Sbjct  1    MLSRSYTNLLDLASGNFPVMGRDKERKRFPRVNTVPGNIGELDDEQTSSFASDNPSSVAG  60

Query  359  ERMIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            +R+IIV N LPL+  RR D  + W+F W+EDSLLL++KDG  E
Sbjct  61   DRIIIVSNLLPLKVKRRPDN-KSWSFSWNEDSLLLRVKDGFPE  102



>tpg|DAA57651.1| TPA: putative trehalose phosphatase/synthase family protein [Zea 
mays]
Length=912

 Score =   106 bits (265),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 58/119 (49%), Positives = 77/119 (65%), Gaps = 19/119 (16%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAG------------KKLSRVATVAGVLSELDDE-----  313
            M+SRSY+NLLDLA G     G  G            +++SRV TV G L+ELD E     
Sbjct  1    MMSRSYTNLLDLAEGNFAALGPVGGSGRQRHGSFGLRRMSRVMTVPGTLTELDGEDESEP  60

Query  314  -SRSNGGSDVPSSISQERMIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
             + S+  SDVPSS++ +R+I+V NQLP+ A RR DG  GW+F WD+DSLLLQL+DG+ +
Sbjct  61   AATSSVASDVPSSVAADRLIVVSNQLPIVARRRPDG-RGWSFSWDDDSLLLQLRDGIPD  118



>ref|XP_002458490.1| hypothetical protein SORBIDRAFT_03g034640 [Sorghum bicolor]
 gb|EES03610.1| hypothetical protein SORBIDRAFT_03g034640 [Sorghum bicolor]
Length=910

 Score =   106 bits (264),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 59/119 (50%), Positives = 75/119 (63%), Gaps = 19/119 (16%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAG------------KKLSRVATVAGVLSELDDESRSNG  328
            M+SRSY+NLLDLA G     G AG            +++SRV TV G LSELD E  S  
Sbjct  1    MMSRSYTNLLDLAEGNFAALGPAGGSGRQRQGSFGMRRMSRVMTVPGTLSELDGEDESEP  60

Query  329  G------SDVPSSISQERMIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
                   SD PSS++ +R+I+V NQLP+ A RR DG  GW+F WD+DSLLLQL+DG+ +
Sbjct  61   AATNSVASDAPSSLAADRVIVVSNQLPIVARRRPDG-RGWSFSWDDDSLLLQLRDGIPD  118



>ref|XP_007045541.1| UDP-Glycosyltransferase / trehalose-phosphatase family protein 
isoform 1 [Theobroma cacao]
 ref|XP_007045542.1| UDP-Glycosyltransferase / trehalose-phosphatase family protein 
isoform 1 [Theobroma cacao]
 gb|EOY01373.1| UDP-Glycosyltransferase / trehalose-phosphatase family protein 
isoform 1 [Theobroma cacao]
 gb|EOY01374.1| UDP-Glycosyltransferase / trehalose-phosphatase family protein 
isoform 1 [Theobroma cacao]
Length=862

 Score =   106 bits (264),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 79/110 (72%), Gaps = 9/110 (8%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDE-SRSNGGSDVPSSISQE  361
            MVSRSYSNLL+LASGE+ +FGR  +++ R+ TV G++S++DD+ S S       SS+ ++
Sbjct  1    MVSRSYSNLLELASGEAPSFGRMSRRIPRIMTVPGIISDIDDDPSESVCSDPSSSSVQRD  60

Query  362  RMIIVGNQLPLRAHRR--------TDGEEGWNFXWDEDSLLLQLKDGLGE  487
            R+I+V NQLP+RA R+        +   +GW F WDE+SLLLQ+KDGLG+
Sbjct  61   RIIMVANQLPIRAQRKSDSTNNGSSSSSKGWIFSWDENSLLLQMKDGLGD  110



>ref|XP_007045543.1| UDP-Glycosyltransferase / trehalose-phosphatase family protein 
isoform 3 [Theobroma cacao]
 gb|EOY01375.1| UDP-Glycosyltransferase / trehalose-phosphatase family protein 
isoform 3 [Theobroma cacao]
Length=777

 Score =   105 bits (263),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 79/110 (72%), Gaps = 9/110 (8%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDE-SRSNGGSDVPSSISQE  361
            MVSRSYSNLL+LASGE+ +FGR  +++ R+ TV G++S++DD+ S S       SS+ ++
Sbjct  1    MVSRSYSNLLELASGEAPSFGRMSRRIPRIMTVPGIISDIDDDPSESVCSDPSSSSVQRD  60

Query  362  RMIIVGNQLPLRAHRR--------TDGEEGWNFXWDEDSLLLQLKDGLGE  487
            R+I+V NQLP+RA R+        +   +GW F WDE+SLLLQ+KDGLG+
Sbjct  61   RIIMVANQLPIRAQRKSDSTNNGSSSSSKGWIFSWDENSLLLQMKDGLGD  110



>gb|KHN15462.1| Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 6 [Glycine 
soja]
Length=870

 Score =   106 bits (264),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 54/104 (52%), Positives = 79/104 (76%), Gaps = 4/104 (4%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSIS-QE  361
            MVS+SYSNLL+LASGE+ +FG   +++ R+ TVAG++S++DD+   +  SD  SS + ++
Sbjct  1    MVSKSYSNLLELASGEAPSFGYMNRRIPRIMTVAGLISDVDDDPVESVCSDPSSSTAHRD  60

Query  362  RMIIVGNQLPLRAHRRTDGEE--GWNFXWDEDSLLLQLKDGLGE  487
            R+I+V NQLP+RA RR +G     W+F WDE++ LLQLKDGLG+
Sbjct  61   RIIMVANQLPIRAQRRPNGNNRSCWSFEWDENA-LLQLKDGLGD  103



>ref|XP_011082978.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 [Sesamum indicum]
 ref|XP_011082980.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 [Sesamum indicum]
Length=867

 Score =   106 bits (264),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 55/103 (53%), Positives = 73/103 (71%), Gaps = 3/103 (3%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAG--KKLSRVATVAGVLSELDDESRSNGGSDVPSSISQ  358
            M+SRSY+NLL+LASG     GR    K+  RV TV G + ELDDE  ++  S+ PSS++ 
Sbjct  1    MMSRSYTNLLELASGNFPVMGREKERKRFPRVMTVPGNIVELDDEQANSVTSENPSSVAG  60

Query  359  ERMIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            +RMIIV N LPL+A RR D  +GW+F W+EDSL+L++KDG  E
Sbjct  61   DRMIIVSNLLPLKAKRRPDN-KGWSFSWNEDSLILRVKDGFPE  102



>gb|ACD56625.1| trehalose synthase/phosphatase-like protein [Gossypium raimondii]
Length=1000

 Score =   106 bits (264),  Expect = 5e-23, Method: Composition-based stats.
 Identities = 55/93 (59%), Positives = 67/93 (72%), Gaps = 3/93 (3%)
 Frame = +2

Query  215  DLASGESLTFG--RAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQERMIIVGNQL  388
            DLASG     G  R  K+L RV TV GV+SELDD+  ++  SD PSS  Q+R+IIV NQL
Sbjct  154  DLASGNFPAMGQPREKKRLPRVMTVPGVISELDDDQANSVTSDAPSSAIQDRIIIVANQL  213

Query  389  PLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            P++A RR D  +GW+F WD+DSLLLQLKDGL E
Sbjct  214  PVKAKRRPD-NKGWSFSWDDDSLLLQLKDGLPE  245



>gb|ACJ61506.1| trehalose-6-phosphate synthase [Glycine max]
Length=842

 Score =   105 bits (263),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 54/104 (52%), Positives = 79/104 (76%), Gaps = 4/104 (4%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSIS-QE  361
            MVS+SYSNLL+LASGE+ +FG   +++ R+ TVAG++S++DD+   +  SD  SS + ++
Sbjct  1    MVSKSYSNLLELASGEAPSFGYMNRRIPRIMTVAGLISDVDDDPVESVCSDPSSSTAHRD  60

Query  362  RMIIVGNQLPLRAHRRTDGEE--GWNFXWDEDSLLLQLKDGLGE  487
            R+I+V NQLP+RA RR +G     W+F WDE++ LLQLKDGLG+
Sbjct  61   RIIMVANQLPIRAQRRPNGNNRSCWSFEWDENA-LLQLKDGLGD  103



>ref|XP_011070555.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6 [Sesamum indicum]
Length=856

 Score =   105 bits (262),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 61/104 (59%), Positives = 80/104 (77%), Gaps = 3/104 (3%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGE--SLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQ  358
            MVSRSYSNLL+LASGE  S +F R  ++L R+ TVAG++S++DD+   +  SD  SS +Q
Sbjct  1    MVSRSYSNLLELASGEAPSPSFSRMRRRLPRIMTVAGIMSDIDDDGSDSVSSDPSSSTAQ  60

Query  359  -ERMIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
             +R+IIV NQLP++ HR+TD   GW F WDE+SLLLQLKDGLG+
Sbjct  61   RDRIIIVANQLPIKVHRKTDESRGWTFSWDENSLLLQLKDGLGD  104



>ref|XP_007214959.1| hypothetical protein PRUPE_ppa001387mg [Prunus persica]
 gb|EMJ16158.1| hypothetical protein PRUPE_ppa001387mg [Prunus persica]
Length=840

 Score =   105 bits (262),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 54/100 (54%), Positives = 69/100 (69%), Gaps = 1/100 (1%)
 Frame = +2

Query  188  VSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQERM  367
            +S+SY NLLDLASG   T     ++  RV T  G LS++DD+   +  SD PSSI+ +RM
Sbjct  1    MSKSYVNLLDLASGNFPTMEGKRRRFPRVNTAPGNLSDVDDDQARSVSSDQPSSIASDRM  60

Query  368  IIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            IIV NQLP++A RR D  +GW F W+ED+LLL LKDGL E
Sbjct  61   IIVANQLPVKAKRREDN-KGWIFSWNEDALLLHLKDGLPE  99



>gb|KHG01704.1| putative alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
7 [Gossypium arboreum]
Length=838

 Score =   105 bits (262),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 63/80 (79%), Gaps = 1/80 (1%)
 Frame = +2

Query  248  RAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQERMIIVGNQLPLRAHRRTDGEEG  427
            R  K+L RV TV GV+SELDD+  ++  SDVPSSI Q+R+IIV NQLP++A RR D  +G
Sbjct  5    REKKRLPRVMTVPGVISELDDDQANSVASDVPSSIIQDRIIIVANQLPVKAKRRPDN-KG  63

Query  428  WNFXWDEDSLLLQLKDGLGE  487
            W+F WD+DSLLLQLKDGL E
Sbjct  64   WSFSWDDDSLLLQLKDGLPE  83



>gb|EYU30761.1| hypothetical protein MIMGU_mgv1a001183mg [Erythranthe guttata]
Length=871

 Score =   105 bits (261),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 55/103 (53%), Positives = 72/103 (70%), Gaps = 3/103 (3%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAG--KKLSRVATVAGVLSELDDESRSNGGSDVPSSISQ  358
            M+SRSY+NLLDLASG     GR    K+  RV TV G + ELDDE  S+  S+ PS+++ 
Sbjct  1    MMSRSYTNLLDLASGNFPLTGREKERKRFPRVMTVPGNILELDDEQASSVTSENPSTVAG  60

Query  359  ERMIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            +R+I+V N LPL+A RR D  +GW F W+EDSLLL++KDG  E
Sbjct  61   DRIIVVANLLPLKAKRRPDN-KGWTFSWNEDSLLLRIKDGFPE  102



>gb|EEE64369.1| hypothetical protein OsJ_19211 [Oryza sativa Japonica Group]
Length=899

 Score =   105 bits (261),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 59/116 (51%), Positives = 76/116 (66%), Gaps = 15/116 (13%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAG---------KKLSRVATVAGVLSELDDE-----SRS  322
            M+SRSY+NLLDLA+G     G AG         K+++RV TV G LSELDDE     + S
Sbjct  1    MMSRSYTNLLDLAAGNFEALGPAGGGRRRSFGAKRMTRVMTVPGTLSELDDEDDEPAATS  60

Query  323  NGGSDVPSSISQERMIIVGNQLPLRAHRRTDGEE-GWNFXWDEDSLLLQLKDGLGE  487
            +  SDVPSS + ER+I+V NQLP+ A RR      GW F WD+DSLLL+L+DG+ +
Sbjct  61   SVASDVPSSAACERLIVVANQLPVVARRRPGAAAGGWAFSWDDDSLLLRLRDGVPD  116



>ref|NP_001056050.1| Os05g0517200 [Oryza sativa Japonica Group]
 gb|AAT01318.1| putative trehalose-6-phosphate synthase [Oryza sativa Japonica 
Group]
 dbj|BAF17964.1| Os05g0517200 [Oryza sativa Japonica Group]
 dbj|BAG92809.1| unnamed protein product [Oryza sativa Japonica Group]
Length=899

 Score =   105 bits (261),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 59/116 (51%), Positives = 76/116 (66%), Gaps = 15/116 (13%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAG---------KKLSRVATVAGVLSELDDE-----SRS  322
            M+SRSY+NLLDLA+G     G AG         K+++RV TV G LSELDDE     + S
Sbjct  1    MMSRSYTNLLDLAAGNFEALGPAGGGRRRSFGAKRMTRVMTVPGTLSELDDEDDEPAATS  60

Query  323  NGGSDVPSSISQERMIIVGNQLPLRAHRRTDGEE-GWNFXWDEDSLLLQLKDGLGE  487
            +  SDVPSS + ER+I+V NQLP+ A RR      GW F WD+DSLLL+L+DG+ +
Sbjct  61   SVASDVPSSAACERLIVVANQLPVVARRRPGAAAGGWAFSWDDDSLLLRLRDGVPD  116



>ref|XP_009365280.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 isoform X2 [Pyrus x bretschneideri]
Length=856

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 57/102 (56%), Positives = 70/102 (69%), Gaps = 3/102 (3%)
 Frame = +2

Query  188  VSRSYSNLLDLASGESLTFGRAGKK--LSRVATVAGVLSELDDESRSNGGSDVPSSISQE  361
            +S+SY NLLDLASG        GK+    RV T  G LS+LDD+   +  SD PSSI+ +
Sbjct  1    MSQSYINLLDLASGNFPXXXMEGKRRRFPRVNTAPGNLSDLDDDQARSVSSDQPSSIASD  60

Query  362  RMIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            R+IIV NQLP++A RR D  +GW F W+EDSLLLQLKDGL E
Sbjct  61   RVIIVANQLPVKAKRREDN-KGWTFSWNEDSLLLQLKDGLPE  101



>dbj|BAJ94322.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=908

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 62/121 (51%), Positives = 77/121 (64%), Gaps = 23/121 (19%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGE--------------SLTFGRAGKKLSRVATVAGVLSELDDESRS  322
            M+SRSY+NLLDLA G               S +FG   K++SRV TV G LSELD E  S
Sbjct  1    MMSRSYTNLLDLAEGNFAALGPAGGGARRRSGSFGM--KRMSRVMTVPGTLSELDGEDES  58

Query  323  NGG------SDVPSSISQERMIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLG  484
                     SDVPSS+S ER+++V NQLP+ A RR DG  GW+F WD+DSLLLQL+DG+ 
Sbjct  59   EPAATNSVASDVPSSVSGERLLVVSNQLPIVARRRPDG-RGWSFSWDDDSLLLQLRDGIP  117

Query  485  E  487
            +
Sbjct  118  D  118



>ref|XP_008775639.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6-like [Phoenix dactylifera]
 ref|XP_008775645.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6-like [Phoenix dactylifera]
Length=856

 Score =   104 bits (260),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 59/101 (58%), Positives = 76/101 (75%), Gaps = 2/101 (2%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  364
            MVSRSYSNLL+L SGE  + GR  +++ RV TVAG++S+LDD+S S+  +  PSS   +R
Sbjct  1    MVSRSYSNLLELTSGEPPSVGRIRRRIPRVMTVAGIISDLDDDSDSDTSAG-PSSSPGDR  59

Query  365  MIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
             I+V N LP+RAHRR DG  GW F WD+DSLLLQLKD +G+
Sbjct  60   TIVVANHLPIRAHRRPDG-RGWTFSWDKDSLLLQLKDAIGD  99



>gb|EMT14980.1| Putative alpha,alpha-trehalose-phosphate synthase (UDP-forming) 
7 [Aegilops tauschii]
Length=840

 Score =   104 bits (259),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 59/116 (51%), Positives = 75/116 (65%), Gaps = 17/116 (15%)
 Frame = +2

Query  188  VSRSYSNLLDLASGESLTFGRAG-----------KKLSRVATVAGVLSELDDE-----SR  319
            +SRSY+NLLDLA+G     G AG           +++ RV TV G LSELDDE     + 
Sbjct  1    MSRSYTNLLDLAAGNFAALGPAGGGRRRSGSFAPRRMPRVMTVPGTLSELDDEDDERAAT  60

Query  320  SNGGSDVPSSISQERMIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            S+  SDVPSS   ER+I+V NQLP+ A RR DG  GW F WD+DSLLL+L+DG+ +
Sbjct  61   SSVASDVPSSAICERLIVVANQLPVVARRRPDG-RGWVFSWDDDSLLLRLRDGVPD  115



>ref|XP_007132825.1| hypothetical protein PHAVU_011G127700g [Phaseolus vulgaris]
 ref|XP_007132826.1| hypothetical protein PHAVU_011G127700g [Phaseolus vulgaris]
 gb|ESW04819.1| hypothetical protein PHAVU_011G127700g [Phaseolus vulgaris]
 gb|ESW04820.1| hypothetical protein PHAVU_011G127700g [Phaseolus vulgaris]
Length=862

 Score =   104 bits (259),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 57/105 (54%), Positives = 76/105 (72%), Gaps = 5/105 (5%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFG----RAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSI  352
            M+SRSY+NLLDLASG     G    R  +++ RV +V G L+E+DD+   +  SD PS++
Sbjct  1    MMSRSYTNLLDLASGNFPAMGGRESRERRRMPRVMSVPGFLTEVDDDQAVSVSSDNPSTV  60

Query  353  SQERMIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            + +RMIIV NQLPL+A RR D  +GW+F W+EDSLLLQLKDGL +
Sbjct  61   TTDRMIIVANQLPLKAKRREDN-KGWSFSWNEDSLLLQLKDGLPD  104



>ref|XP_010916659.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 [Elaeis guineensis]
Length=871

 Score =   103 bits (258),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 60/107 (56%), Positives = 77/107 (72%), Gaps = 7/107 (7%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGE--SLTFGRAG---KKLSRVATVAGVLSELDDESRSNGGSDVPSS  349
            M+SRSY+NLLDLA+G   +L+ G  G   +++ RV T+ G L+ELDDE R+   S    S
Sbjct  1    MMSRSYTNLLDLATGNFAALSVGGPGGSRRRMPRVMTMPGTLTELDDEDRAGSVSSDVPS  60

Query  350  -ISQERMIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
             ++Q+R+IIV NQLP+RA RR DG  GW F WDEDSLLLQLKDGL +
Sbjct  61   SVAQDRIIIVANQLPVRAKRRPDG-RGWCFSWDEDSLLLQLKDGLPD  106



>ref|XP_009105068.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6 [Brassica rapa]
Length=863

 Score =   103 bits (257),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 55/112 (49%), Positives = 78/112 (70%), Gaps = 15/112 (13%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESR-SNGGSDVPSSISQE  361
            MVSRSYSNLL+LASG+S TFGR  +++ R+  VAG++S +D++S+ S+  SD+     ++
Sbjct  1    MVSRSYSNLLELASGDSPTFGRMNRQIPRIMAVAGIMSNIDNDSKESSPSSDLS---PKD  57

Query  362  RMIIVGNQLPLRAHRRTD-----------GEEGWNFXWDEDSLLLQLKDGLG  484
            R+IIV N+LP+RA R+ +             +GW F  DE+SLLLQLKDGLG
Sbjct  58   RIIIVANELPIRAQRKLETSSTSTSTTHCSSKGWTFSLDENSLLLQLKDGLG  109



>ref|XP_009768217.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 [Nicotiana sylvestris]
Length=858

 Score =   103 bits (256),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 57/104 (55%), Positives = 73/104 (70%), Gaps = 4/104 (4%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKK---LSRVATVAGVLSELDDESRSNGGSDVPSSIS  355
            M+SRSY+NLLDLASG     GR  ++   + RV TV G + ELDD+   +  SD  SS++
Sbjct  1    MMSRSYTNLLDLASGNFPVMGRERERPRMMPRVMTVPGSICELDDDLAHSVSSDNLSSLA  60

Query  356  QERMIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
             +RMIIV N LPL+A RR D  +GW+F W+EDSLLL+LKDGL E
Sbjct  61   GDRMIIVANLLPLKAKRRPDN-KGWSFSWNEDSLLLRLKDGLPE  103



>ref|XP_004969951.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7-like [Setaria italica]
Length=905

 Score =   103 bits (257),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 61/121 (50%), Positives = 76/121 (63%), Gaps = 23/121 (19%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESL--------------TFGRAGKKLSRVATVAGVLSELDDESRS  322
            M+SRSY+NLLDLA G                 +FG   K++SRV TV G LSELD E  S
Sbjct  1    MMSRSYTNLLDLAEGNFAALGPAAGGGRRRQGSFGT--KRMSRVMTVPGTLSELDGEDDS  58

Query  323  NGG------SDVPSSISQERMIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLG  484
                     SDVPSS++ +RMI+V NQLP+ A RR DG  GW+F WD+DSLLLQL+DG+ 
Sbjct  59   EPAATNSVASDVPSSLAADRMIVVSNQLPVVARRRPDG-RGWSFSWDDDSLLLQLRDGIP  117

Query  485  E  487
            +
Sbjct  118  D  118



>ref|XP_009595385.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 [Nicotiana tomentosiformis]
Length=858

 Score =   103 bits (256),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 57/104 (55%), Positives = 73/104 (70%), Gaps = 4/104 (4%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKK---LSRVATVAGVLSELDDESRSNGGSDVPSSIS  355
            M+SRSY+NLLDLASG     GR  ++   + RV TV G + ELDD+   +  SD  SS++
Sbjct  1    MMSRSYTNLLDLASGNFPVMGRERERPRMMPRVMTVPGSICELDDDLAHSVSSDNLSSLA  60

Query  356  QERMIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
             +RMIIV N LPL+A RR D  +GW+F W+EDSLLL+LKDGL E
Sbjct  61   GDRMIIVANLLPLKAKRRPDN-KGWSFSWNEDSLLLRLKDGLPE  103



>ref|XP_009415178.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 [Musa acuminata subsp. malaccensis]
Length=881

 Score =   103 bits (256),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 62/111 (56%), Positives = 77/111 (69%), Gaps = 11/111 (10%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGE--------SLTFGRAGKKLSRVATVAGVLSEL-DDESRSNG-GS  334
            M+SRSY+NLLDLASG             GR  +++ RV TV G L++L ++E R+N   S
Sbjct  1    MMSRSYTNLLDLASGNFAALSLGAGGGGGRGLRRMPRVMTVPGTLADLQEEEERANSVAS  60

Query  335  DVPSSISQERMIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            DV SS +Q+R+IIV NQLP+RA RR DG  GW F WDEDSLLLQLKDGL +
Sbjct  61   DVQSSQAQDRIIIVANQLPVRARRRPDG-RGWTFAWDEDSLLLQLKDGLPD  110



>gb|ACA62945.1| trehalose-6-phosphate synthase [Zostera marina]
Length=870

 Score =   103 bits (256),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 58/109 (53%), Positives = 74/109 (68%), Gaps = 9/109 (8%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKK--------LSRVATVAGVLSELDDESRSNGGSDV  340
            M+SRSY+NLLDLASG        G+         + RV TV   ++EL+DE  S+  SDV
Sbjct  1    MMSRSYTNLLDLASGNFPVISGGGRDGRSGGMRRMPRVMTVPSNIAELEDEQASSVASDV  60

Query  341  PSSISQERMIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
             SSI Q+R+IIVGNQLP+ A RR+D   GW+F WD++SLLLQLKDGL +
Sbjct  61   QSSIIQDRLIIVGNQLPVVAKRRSDN-AGWDFSWDDESLLLQLKDGLPD  108



>ref|XP_010531642.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6-like [Tarenaya hassleriana]
Length=865

 Score =   103 bits (256),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 56/113 (50%), Positives = 74/113 (65%), Gaps = 12/113 (11%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDE-SRSNGGSDVPSSISQE  361
            MVSRSYSNLLDLASG+S +FGR  + + R+ TVAG +S +DD+ + S       S+  ++
Sbjct  1    MVSRSYSNLLDLASGDSPSFGRMSRGIPRIMTVAGFMSNIDDDPAESASSDPSSSTAHKD  60

Query  362  RMIIVGNQLPLRAHRRTDGE-----------EGWNFXWDEDSLLLQLKDGLGE  487
            R+IIV NQLP+RA +R+D               W F WDE+SLLLQLKD LG+
Sbjct  61   RLIIVANQLPIRAQKRSDKSSTSSSNNGGGCRNWIFNWDENSLLLQLKDALGK  113



>gb|KJB30628.1| hypothetical protein B456_005G152400 [Gossypium raimondii]
Length=681

 Score =   102 bits (255),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 53/115 (46%), Positives = 78/115 (68%), Gaps = 14/115 (12%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDE-SRSNGGSDVPSSISQE  361
            MVSRSYSNLL+LASGE+ + GR  +++ R+ TV G++S++DD+ S S       SS  ++
Sbjct  1    MVSRSYSNLLELASGEAPSLGRISRRIPRIMTVPGIISDIDDDPSESVCSDPSSSSSQKD  60

Query  362  RMIIVGNQLPLRAHRRTDGEE-------------GWNFXWDEDSLLLQLKDGLGE  487
            R+I+V NQLP+RAHR++D  +              W F WD++SLLLQ++DGLG+
Sbjct  61   RIIMVANQLPIRAHRKSDNNKNGSSSCSTTTTSNNWIFSWDDNSLLLQMRDGLGD  115



>ref|XP_010916234.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6 [Elaeis guineensis]
Length=856

 Score =   103 bits (256),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 58/101 (57%), Positives = 75/101 (74%), Gaps = 2/101 (2%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  364
            MVSRSYSNLL+L SGE  + GR  +++ RV TVAG++S+LD++S S+  +   SS   +R
Sbjct  1    MVSRSYSNLLELTSGEPPSVGRIRRRIPRVMTVAGLISDLDEDSDSDTSAGTSSS-PHDR  59

Query  365  MIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
             I+V N LP+RAHRR DG  GW F WDEDSLLLQLKD +G+
Sbjct  60   TIVVANHLPVRAHRRPDG-RGWTFSWDEDSLLLQLKDAIGD  99



>ref|XP_004248198.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 [Solanum lycopersicum]
Length=857

 Score =   103 bits (256),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 54/103 (52%), Positives = 74/103 (72%), Gaps = 3/103 (3%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKK--LSRVATVAGVLSELDDESRSNGGSDVPSSISQ  358
            M+SRSY+NLLDLASG   T GR   +  + RV T+ G + E+DD+   +  S+ PSS++ 
Sbjct  1    MISRSYTNLLDLASGNFPTMGRDRDRRRMPRVMTLPGSICEMDDDQAHSVSSENPSSLAG  60

Query  359  ERMIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            +RMI+V N LPL+A RR D  +GW+F W+EDSLLL+L+DGL E
Sbjct  61   DRMIVVANLLPLKAKRRPDN-KGWSFNWNEDSLLLRLRDGLPE  102



>ref|XP_006364095.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7-like isoform X1 [Solanum tuberosum]
Length=857

 Score =   102 bits (255),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 54/103 (52%), Positives = 74/103 (72%), Gaps = 3/103 (3%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKK--LSRVATVAGVLSELDDESRSNGGSDVPSSISQ  358
            M+SRSY+NLLDLASG   T GR   +  + RV T+ G + E+DD+   +  S+ PSS++ 
Sbjct  1    MISRSYTNLLDLASGNFPTMGRDRDRRRMPRVMTLPGSICEMDDDQAHSVSSENPSSLAG  60

Query  359  ERMIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            +RMI+V N LPL+A RR D  +GW+F W+EDSLLL+L+DGL E
Sbjct  61   DRMIVVANLLPLKAKRRPDN-KGWSFNWNEDSLLLRLRDGLPE  102



>ref|XP_010556235.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6 [Tarenaya hassleriana]
 ref|XP_010556236.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6 [Tarenaya hassleriana]
 ref|XP_010556237.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6 [Tarenaya hassleriana]
Length=866

 Score =   102 bits (255),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 55/113 (49%), Positives = 77/113 (68%), Gaps = 12/113 (11%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDE-SRSNGGSDVPSSISQE  361
            MVSRSYSNLLDLASG+S +FGR  +++ R+ TVAG +S +DD+ + S       S+  ++
Sbjct  1    MVSRSYSNLLDLASGDSPSFGRMSRQIPRIMTVAGFMSNIDDDPAESVSSDPSSSTARKD  60

Query  362  RMIIVGNQLPLRAHRRTD-----------GEEGWNFXWDEDSLLLQLKDGLGE  487
            R+IIV NQLP+R  +R++           G + W F WD++SLLLQLKDGLG+
Sbjct  61   RLIIVANQLPIRVQKRSENSSTSTSSSNIGYKNWIFTWDDNSLLLQLKDGLGD  113



>gb|KJB30627.1| hypothetical protein B456_005G152400 [Gossypium raimondii]
Length=800

 Score =   102 bits (255),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 53/115 (46%), Positives = 78/115 (68%), Gaps = 14/115 (12%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDE-SRSNGGSDVPSSISQE  361
            MVSRSYSNLL+LASGE+ + GR  +++ R+ TV G++S++DD+ S S       SS  ++
Sbjct  1    MVSRSYSNLLELASGEAPSLGRISRRIPRIMTVPGIISDIDDDPSESVCSDPSSSSSQKD  60

Query  362  RMIIVGNQLPLRAHRRTDGEE-------------GWNFXWDEDSLLLQLKDGLGE  487
            R+I+V NQLP+RAHR++D  +              W F WD++SLLLQ++DGLG+
Sbjct  61   RIIMVANQLPIRAHRKSDNNKNGSSSCSTTTTSNNWIFSWDDNSLLLQMRDGLGD  115



>ref|XP_003527335.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7-like [Glycine max]
 gb|KHN33938.1| Putative alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
7 [Glycine soja]
Length=862

 Score =   102 bits (255),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 56/105 (53%), Positives = 76/105 (72%), Gaps = 5/105 (5%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFG----RAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSI  352
            M+SRSY+NLLDLASG     G    R  ++L RV +V G ++E+DD+   +  SD PS++
Sbjct  1    MMSRSYTNLLDLASGNFPAMGGRETRERRRLPRVMSVPGFITEVDDDQAVSVSSDNPSTV  60

Query  353  SQERMIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            + +RMIIV NQLPL+A R+ D  +GW+F W+EDSLLLQLKDGL +
Sbjct  61   TTDRMIIVANQLPLKAKRKEDN-KGWSFSWNEDSLLLQLKDGLPD  104



>gb|KJB30625.1| hypothetical protein B456_005G152400 [Gossypium raimondii]
 gb|KJB30626.1| hypothetical protein B456_005G152400 [Gossypium raimondii]
Length=869

 Score =   102 bits (255),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 53/115 (46%), Positives = 78/115 (68%), Gaps = 14/115 (12%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDE-SRSNGGSDVPSSISQE  361
            MVSRSYSNLL+LASGE+ + GR  +++ R+ TV G++S++DD+ S S       SS  ++
Sbjct  1    MVSRSYSNLLELASGEAPSLGRISRRIPRIMTVPGIISDIDDDPSESVCSDPSSSSSQKD  60

Query  362  RMIIVGNQLPLRAHRRTDGEE-------------GWNFXWDEDSLLLQLKDGLGE  487
            R+I+V NQLP+RAHR++D  +              W F WD++SLLLQ++DGLG+
Sbjct  61   RIIMVANQLPIRAHRKSDNNKNGSSSCSTTTTSNNWIFSWDDNSLLLQMRDGLGD  115



>ref|XP_010924709.1| PREDICTED: LOW QUALITY PROTEIN: probable alpha,alpha-trehalose-phosphate 
synthase [UDP-forming] 7 [Elaeis guineensis]
Length=894

 Score =   102 bits (255),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 62/133 (47%), Positives = 81/133 (61%), Gaps = 12/133 (9%)
 Frame = +2

Query  119  FDFYHLLVLLIFE--------RCIYCGESTMVSRSYSNLLDLASGESLT-FGRAGKKLSR  271
            FD +  +V L F+        RC+  G + M SRSY+NL DL  G+S    G   K++SR
Sbjct  3    FDSWVWMVFLGFDLAFLGSAGRCL-LGTAKMTSRSYTNLQDLTLGDSTAQSGSKWKQMSR  61

Query  272  VATVAGVLSELDDESRS-NGGSDVPSSISQERMIIVGNQLPLRAHRRTDGEEGWNFXWDE  448
              TV G  S+LDDE       S+  S+ + +R+IIV N+LP+RA+RRT G  GWNF WD+
Sbjct  62   AMTVPGTPSKLDDEDPPGRSSSNATSTATHDRIIIVANELPVRANRRTGGC-GWNFSWDK  120

Query  449  DSLLLQLKDGLGE  487
            DSLL QLKDG  E
Sbjct  121  DSLLFQLKDGFPE  133



>gb|ADN34028.1| trehalose-6-phosphate synthase [Cucumis melo subsp. melo]
Length=831

 Score =   102 bits (254),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 50/82 (61%), Positives = 63/82 (77%), Gaps = 1/82 (1%)
 Frame = +2

Query  242  FGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQERMIIVGNQLPLRAHRRTDGE  421
             GR  K+L RV TVAGV+SELDD+  ++  S+ PSS+ Q+R+IIV NQLP++A RR D  
Sbjct  1    MGREKKRLPRVMTVAGVISELDDDQANSVTSEGPSSVVQDRIIIVANQLPIKAKRRPDN-  59

Query  422  EGWNFXWDEDSLLLQLKDGLGE  487
            +GW+F WDEDSLL QLKDGL E
Sbjct  60   KGWSFSWDEDSLLWQLKDGLPE  81



>gb|EYU37347.1| hypothetical protein MIMGU_mgv1a001197mg [Erythranthe guttata]
Length=868

 Score =   102 bits (254),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 56/103 (54%), Positives = 71/103 (69%), Gaps = 3/103 (3%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAG--KKLSRVATVAGVLSELDDESRSNGGSDVPSSISQ  358
            M+SRSY+NLL+LASG     GR    K+  RV TV G + E+DDE  ++  S+ PSSI+ 
Sbjct  1    MMSRSYTNLLELASGNFPVMGREKERKRFPRVMTVPGNIVEMDDEQDNSVTSENPSSIAG  60

Query  359  ERMIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            +RMIIV N LPL+A RR D  +GW F W+EDSLLL +K GL E
Sbjct  61   DRMIIVANLLPLKAKRRPDN-KGWVFSWNEDSLLLWVKVGLPE  102



>gb|EMT15117.1| Putative alpha,alpha-trehalose-phosphate synthase (UDP-forming) 
7 [Aegilops tauschii]
Length=911

 Score =   102 bits (254),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 60/120 (50%), Positives = 76/120 (63%), Gaps = 23/120 (19%)
 Frame = +2

Query  188  VSRSYSNLLDLASGE--------------SLTFGRAGKKLSRVATVAGVLSELDDESRSN  325
            +SRSY+NLLDLA G               + +FG   K++SRV TV G LSELD E  S 
Sbjct  1    MSRSYTNLLDLAEGNFAALGPAGGGARRRAGSFGM--KRMSRVMTVPGTLSELDGEDESE  58

Query  326  GG------SDVPSSISQERMIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
                    SDVPSS+S ER+++V NQLP+ A RR DG  GW+F WD+DSLLLQL+DG+ +
Sbjct  59   PAATNSVASDVPSSVSGERLLVVSNQLPILARRRPDG-RGWSFSWDDDSLLLQLRDGIPD  117



>ref|XP_007153644.1| hypothetical protein PHAVU_003G053000g [Phaseolus vulgaris]
 gb|ESW25638.1| hypothetical protein PHAVU_003G053000g [Phaseolus vulgaris]
Length=857

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 54/99 (55%), Positives = 68/99 (69%), Gaps = 1/99 (1%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  364
            M SRSY+NLLDLASG+ L   R  + L RV T+ G++S+LD    ++G SDV SS  +ER
Sbjct  1    MASRSYANLLDLASGDLLDIPRTPRALPRVMTIPGIISDLDGYGCNDGDSDVSSSGYRER  60

Query  365  MIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGL  481
             IIV N LPL+A R  +  + W F WDEDS+LLQLKDG 
Sbjct  61   KIIVANMLPLQAKRDIETAK-WVFSWDEDSILLQLKDGF  98



>ref|XP_002440081.1| hypothetical protein SORBIDRAFT_09g025660 [Sorghum bicolor]
 gb|EES18511.1| hypothetical protein SORBIDRAFT_09g025660 [Sorghum bicolor]
Length=906

 Score =   101 bits (252),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 57/117 (49%), Positives = 74/117 (63%), Gaps = 16/117 (14%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAG-----------KKLSRVATVAGVLSEL-----DDES  316
            M+SRSY+NLLDLA+G     G +G           K++ RV TV G LS+L     +  +
Sbjct  1    MMSRSYTNLLDLAAGNFAALGPSGGGRRRLGSFGAKRMPRVMTVPGTLSDLDDDDDEQAA  60

Query  317  RSNGGSDVPSSISQERMIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
             S+  SDVPSS   ER+I+V NQLP+ A RR DG  GW F WDEDSLLL+L+DG+ +
Sbjct  61   TSSVASDVPSSAVGERLIVVANQLPVVARRRPDGGRGWVFSWDEDSLLLRLRDGVPD  117



>emb|CDO96859.1| unnamed protein product [Coffea canephora]
Length=799

 Score =   100 bits (250),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 59/104 (57%), Positives = 75/104 (72%), Gaps = 4/104 (4%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAG---KKLSRVATVAGVLSELDDESRSNGGSDVPSSIS  355
            M+SRSY+NLLDLASG     GR     K+L RV TV GV+SELDD+  ++  SDV SS++
Sbjct  1    MMSRSYTNLLDLASGNFPVMGRERGERKRLPRVMTVPGVISELDDDQANSVSSDVQSSVA  60

Query  356  QERMIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
             +R+IIV NQLP++A RR D   GW+F WDEDSL L +KDGL +
Sbjct  61   VDRVIIVANQLPVKAKRRPDN-VGWSFSWDEDSLFLHIKDGLPD  103



>ref|NP_001044248.1| Os01g0749400 [Oryza sativa Japonica Group]
 dbj|BAD86973.1| putative trehalose-6-phosphate synthase/phosphatase [Oryza sativa 
Japonica Group]
 dbj|BAF06162.1| Os01g0749400 [Oryza sativa Japonica Group]
 dbj|BAG89312.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG90567.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96257.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE55382.1| hypothetical protein OsJ_03457 [Oryza sativa Japonica Group]
Length=913

 Score =   100 bits (250),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 60/120 (50%), Positives = 75/120 (63%), Gaps = 20/120 (17%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAG-------------KKLSRVATVAGVLSELDDESRSN  325
            M+SRSY+NLLDLA G     G  G             K++SRV TV G LSELD E  S 
Sbjct  1    MMSRSYTNLLDLAEGNFAALGPGGGGGGRRRSGSFGLKRMSRVMTVPGTLSELDGEDDSE  60

Query  326  GG------SDVPSSISQERMIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
                    SDVPSS++ +R+I+V NQLP+ A RR DG  GW+F WD+DSLLLQL+DG+ +
Sbjct  61   HAATNSVASDVPSSVAGDRVIVVSNQLPVVARRRPDG-RGWSFSWDDDSLLLQLRDGIPD  119



>gb|EEC71477.1| hypothetical protein OsI_03737 [Oryza sativa Indica Group]
Length=914

 Score =   100 bits (250),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 60/120 (50%), Positives = 75/120 (63%), Gaps = 20/120 (17%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAG-------------KKLSRVATVAGVLSELDDESRSN  325
            M+SRSY+NLLDLA G     G  G             K++SRV TV G LSELD E  S 
Sbjct  1    MMSRSYTNLLDLAEGNFAALGPGGGGGGRRRSGSFGLKRMSRVMTVPGTLSELDGEDDSE  60

Query  326  GG------SDVPSSISQERMIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
                    SDVPSS++ +R+I+V NQLP+ A RR DG  GW+F WD+DSLLLQL+DG+ +
Sbjct  61   HAATNSVASDVPSSVAGDRVIVVSNQLPVVARRRPDG-RGWSFSWDDDSLLLQLRDGIPD  119



>gb|AEB53178.1| trehalose-6-phosphate synthase 2 [Oryza sativa Indica Group]
Length=914

 Score =   100 bits (250),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 60/120 (50%), Positives = 75/120 (63%), Gaps = 20/120 (17%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAG-------------KKLSRVATVAGVLSELDDESRSN  325
            M+SRSY+NLLDLA G     G  G             K++SRV TV G LSELD E  S 
Sbjct  1    MMSRSYTNLLDLAEGNFAALGPGGGGGGRRRSGSFGLKRMSRVMTVPGTLSELDGEDDSE  60

Query  326  GG------SDVPSSISQERMIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
                    SDVPSS++ +R+I+V NQLP+ A RR DG  GW+F WD+DSLLLQL+DG+ +
Sbjct  61   HAATNSVASDVPSSVAGDRVIVVSNQLPVVARRRPDG-RGWSFSWDDDSLLLQLRDGIPD  119



>ref|NP_001288502.1| uncharacterized protein LOC103636651 [Zea mays]
 gb|ACN33296.1| unknown [Zea mays]
 gb|AFW85099.1| putative trehalose phosphatase/synthase family protein [Zea mays]
Length=912

 Score =   100 bits (249),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 59/122 (48%), Positives = 76/122 (62%), Gaps = 22/122 (18%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGE-----------SLTFGRAG----KKLSRVATVAGVLSELDDE--  313
            M+SRSY+NLLDLA G                 R G    +++SRV TV G LSELD E  
Sbjct  1    MMSRSYTNLLDLAEGNFAALGPAAGAGGGGRQRQGSFGLRRMSRVMTVPGTLSELDGEDE  60

Query  314  ----SRSNGGSDVPSSISQERMIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGL  481
                + S+  SD PSS++ +R+I+V NQLP+ A RR DG  GW+F WD+DSLLLQL+DG+
Sbjct  61   SEPAATSSVASDAPSSVAADRLIVVSNQLPIVARRRPDG-RGWSFVWDDDSLLLQLRDGI  119

Query  482  GE  487
             E
Sbjct  120  PE  121



>gb|KHN24134.1| Putative alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
10 [Glycine soja]
Length=861

 Score =   100 bits (249),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 53/99 (54%), Positives = 67/99 (68%), Gaps = 1/99 (1%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  364
            M SRSY+NL DLASG+ L F    + L RV TV G++S+LD    ++G SDV SS  +ER
Sbjct  1    MASRSYANLFDLASGDFLDFPCTPRALPRVMTVPGIISDLDGYGCNDGDSDVSSSGCRER  60

Query  365  MIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGL  481
             IIV N LP++A R  +  + W F WDEDS+LLQLKDG 
Sbjct  61   KIIVANMLPVQAKRDIETAK-WVFSWDEDSILLQLKDGF  98



>gb|AAL91978.1|AF483209_1 putative trehalose synthase [Solanum tuberosum]
Length=857

 Score =   100 bits (249),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 56/103 (54%), Positives = 71/103 (69%), Gaps = 3/103 (3%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSR--VATVAGVLSELDDESRSNGGSDVPSSISQ  358
            M+SRSY+NLLDLASG     GR   +     V TV G + ELDD+   +  SD  SS++ 
Sbjct  1    MMSRSYTNLLDLASGNFPVMGRERDRRRMSRVMTVPGSICELDDDQAVSVSSDNQSSLAG  60

Query  359  ERMIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            +RMI+V NQLPL+A RR D  +GW+F W+EDSLLL+LKDGL E
Sbjct  61   DRMIVVANQLPLKAKRRPDN-KGWSFSWNEDSLLLRLKDGLPE  102



>ref|XP_004243268.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7 [Solanum lycopersicum]
Length=858

 Score =   100 bits (248),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 56/103 (54%), Positives = 71/103 (69%), Gaps = 3/103 (3%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSR--VATVAGVLSELDDESRSNGGSDVPSSISQ  358
            M+SRSY+NLLDLASG     GR   +     V TV G + ELDD+   +  SD  SS++ 
Sbjct  1    MMSRSYTNLLDLASGNFPVMGRERDRRRMSRVMTVPGSICELDDDQAVSVSSDNQSSLAG  60

Query  359  ERMIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            +RMI+V NQLPL+A RR D  +GW+F W+EDSLLL+LKDGL E
Sbjct  61   DRMIVVANQLPLKAKRRPDN-KGWSFSWNEDSLLLRLKDGLPE  102



>ref|XP_006644707.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7-like [Oryza brachyantha]
Length=910

 Score =   100 bits (249),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 59/122 (48%), Positives = 74/122 (61%), Gaps = 22/122 (18%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAG---------------KKLSRVATVAGVLSELDDESR  319
            M+SRSY+NLLDLA G     G                  K++SRV TV G LSELD E  
Sbjct  1    MMSRSYTNLLDLAEGNFAALGPGAGGGGGGRRRSGSFGLKRMSRVMTVPGTLSELDGEED  60

Query  320  SNGG------SDVPSSISQERMIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGL  481
            S         SDVPSS++ +R+I+V NQLP+ A RR DG  GW+F WD+DSLLLQL+DG+
Sbjct  61   SEPAATNSIASDVPSSVAGDRVIVVSNQLPIVARRRPDG-RGWSFSWDDDSLLLQLRDGI  119

Query  482  GE  487
             +
Sbjct  120  PD  121



>ref|XP_003532016.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 10-like isoform X1 [Glycine max]
 ref|XP_006585958.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 10-like isoform X2 [Glycine max]
Length=861

 Score =   100 bits (248),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 53/99 (54%), Positives = 67/99 (68%), Gaps = 1/99 (1%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  364
            M SRSY+NL DLASG+ L F    + L RV TV G++S+LD    ++G SDV SS  +ER
Sbjct  1    MASRSYANLFDLASGDFLDFPCPPRALPRVMTVPGIISDLDGYGCNDGDSDVSSSGCRER  60

Query  365  MIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGL  481
             IIV N LP++A R  +  + W F WDEDS+LLQLKDG 
Sbjct  61   KIIVANMLPVQAKRDIETAK-WVFSWDEDSILLQLKDGF  98



>ref|XP_006348895.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 7-like [Solanum tuberosum]
Length=857

 Score =   100 bits (248),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 56/103 (54%), Positives = 71/103 (69%), Gaps = 3/103 (3%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSR--VATVAGVLSELDDESRSNGGSDVPSSISQ  358
            M+SRSY+NLLDLASG     GR   +     V TV G + ELDD+   +  SD  SS++ 
Sbjct  1    MMSRSYTNLLDLASGNFPVMGRERDRRRMSRVMTVPGSICELDDDQAVSVSSDNQSSLAG  60

Query  359  ERMIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            +RMI+V NQLPL+A RR D  +GW+F W+EDSLLL+LKDGL E
Sbjct  61   DRMIVVANQLPLKAKRRPDN-KGWSFSWNEDSLLLRLKDGLPE  102



>ref|XP_003552011.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 9-like isoform X1 [Glycine max]
 ref|XP_006602379.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase 
[UDP-forming] 9-like isoform X2 [Glycine max]
Length=861

 Score =   100 bits (248),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 53/99 (54%), Positives = 67/99 (68%), Gaps = 1/99 (1%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  364
            M SRSY+NL DLASG+ L F    + L RV TV G++S+LD    ++G SDV SS  +ER
Sbjct  1    MASRSYANLFDLASGDFLDFPCTPRALPRVMTVPGIISDLDGYGCNDGDSDVSSSGCRER  60

Query  365  MIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGL  481
             IIV N LP++A R  +  + W F WDEDS+LLQLKDG 
Sbjct  61   KIIVANMLPVQAKRDIETAK-WVFSWDEDSILLQLKDGF  98



>gb|KHN10606.1| Putative alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
10 [Glycine soja]
Length=857

 Score =   100 bits (248),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 53/99 (54%), Positives = 67/99 (68%), Gaps = 1/99 (1%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQER  364
            M SRSY+NL DLASG+ L F    + L RV TV G++S+LD    ++G SDV SS  +ER
Sbjct  1    MASRSYANLFDLASGDFLDFPCPPRALPRVMTVPGIISDLDGYGCNDGDSDVSSSGCRER  60

Query  365  MIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGL  481
             IIV N LP++A R  +  + W F WDEDS+LLQLKDG 
Sbjct  61   KIIVANMLPVQAKRDIETAK-WVFSWDEDSILLQLKDGF  98



>ref|XP_010932535.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6-like [Elaeis guineensis]
 ref|XP_010932536.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6-like [Elaeis guineensis]
 ref|XP_010932537.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6-like [Elaeis guineensis]
 ref|XP_010932538.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6-like [Elaeis guineensis]
 ref|XP_010932539.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6-like [Elaeis guineensis]
Length=859

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 53/103 (51%), Positives = 76/103 (74%), Gaps = 3/103 (3%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDD--ESRSNGGSDVPSSISQ  358
            MVS+SYSNLL+LASGES + GR G+++ RV T  G++ +LD+  ++ SN  S++ S   +
Sbjct  1    MVSKSYSNLLELASGESQSLGRIGRRIPRVVTAPGIVPDLDESDDAASNSSSELASPSPR  60

Query  359  ERMIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            +R IIV NQLP+RA R+  G  GW+F WD+DSLL Q+KD +G+
Sbjct  61   DRTIIVANQLPIRAARQP-GVGGWSFSWDQDSLLHQVKDSIGD  102



>gb|KEH40650.1| trehalose-6-phosphate synthase domain protein [Medicago truncatula]
Length=855

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 53/105 (50%), Positives = 76/105 (72%), Gaps = 5/105 (5%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSEL---DDESRSNGGSDVPSSIS  355
            MVSRSYSNL++LASGE+ +FG   +++ R+ TVAG++SE+   DD+  S       SS+ 
Sbjct  1    MVSRSYSNLVELASGETPSFGLMNRRIPRIMTVAGLISEVNIDDDQVESVASDLSSSSVH  60

Query  356  QERMIIVGNQLPLRAHRRTDGEEG-WNFXWDEDSLLLQLKDGLGE  487
            ++R+IIV NQLP++A +  DG    W+F WDE+S LLQLKDG+G+
Sbjct  61   RDRIIIVANQLPIKAQKNHDGNRSYWSFDWDENS-LLQLKDGIGD  104



>gb|AEQ54916.1| trehalose-6-phosphate synthase [Salvia miltiorrhiza]
Length=857

 Score = 98.2 bits (243),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 57/104 (55%), Positives = 79/104 (76%), Gaps = 3/104 (3%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGE--SLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQ  358
            MVSRSYSNLL+LASGE  S +F R  +++ R+ TVAG++S++DD+   +  SD  SS SQ
Sbjct  1    MVSRSYSNLLELASGEAPSPSFSRMSRRIPRIMTVAGIMSDIDDDGSDSVSSDPSSSSSQ  60

Query  359  -ERMIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
             +R+IIV NQLP++ H++TD  +GW F WD++SL LQLKD LG+
Sbjct  61   KDRIIIVANQLPIKVHKKTDNSKGWTFSWDDNSLYLQLKDCLGD  104



>ref|XP_008789260.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6-like isoform X1 [Phoenix dactylifera]
 ref|XP_008789262.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6-like isoform X1 [Phoenix dactylifera]
 ref|XP_008789263.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6-like isoform X1 [Phoenix dactylifera]
 ref|XP_008789264.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6-like isoform X1 [Phoenix dactylifera]
Length=859

 Score = 98.2 bits (243),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 50/103 (49%), Positives = 77/103 (75%), Gaps = 3/103 (3%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDD--ESRSNGGSDVPSSISQ  358
            MVS+SY+NLL++ASGES + GR G+++ RV T  G++ +LD+  ++ SN  S++ S   +
Sbjct  1    MVSKSYTNLLEVASGESPSLGRIGRRIPRVVTAPGIVPDLDESDDAASNSSSELASPSPR  60

Query  359  ERMIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            +R IIV NQLP+RA R+ +G  GW+F WD+DS+L Q+KD +G+
Sbjct  61   DRTIIVANQLPIRAARQPEG-GGWSFTWDQDSILHQVKDSIGD  102



>ref|XP_008789265.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
6-like isoform X2 [Phoenix dactylifera]
Length=766

 Score = 97.8 bits (242),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 50/103 (49%), Positives = 77/103 (75%), Gaps = 3/103 (3%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDD--ESRSNGGSDVPSSISQ  358
            MVS+SY+NLL++ASGES + GR G+++ RV T  G++ +LD+  ++ SN  S++ S   +
Sbjct  1    MVSKSYTNLLEVASGESPSLGRIGRRIPRVVTAPGIVPDLDESDDAASNSSSELASPSPR  60

Query  359  ERMIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
            +R IIV NQLP+RA R+ +G  GW+F WD+DS+L Q+KD +G+
Sbjct  61   DRTIIVANQLPIRAARQPEG-GGWSFTWDQDSILHQVKDSIGD  102



>gb|KHG14143.1| Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 6 -like 
protein [Gossypium arboreum]
Length=869

 Score = 97.8 bits (242),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 54/115 (47%), Positives = 78/115 (68%), Gaps = 14/115 (12%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKKLSRVATVAGVLSELDDESRSNGGSDVPSSISQ-E  361
            MVSRSYSNLL+LASGE+ + GR  +++ R+ TV G++S++DD+   +  SD  SS +Q +
Sbjct  1    MVSRSYSNLLELASGEAPSLGRISRRIPRIMTVPGIISDIDDDPSESVCSDPSSSSTQKD  60

Query  362  RMIIVGNQLPLRAHRR-------------TDGEEGWNFXWDEDSLLLQLKDGLGE  487
            R+I+V NQLP+RAHR+             T     W F WD++SLLLQ++DGLG+
Sbjct  61   RIIMVANQLPIRAHRKSDNNKNGSSSSSTTTTSNNWIFSWDDNSLLLQMRDGLGD  115



>gb|ACA62946.1| trehalose-6-phosphate synthase [Zostera marina]
Length=870

 Score = 97.8 bits (242),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 57/109 (52%), Positives = 73/109 (67%), Gaps = 9/109 (8%)
 Frame = +2

Query  185  MVSRSYSNLLDLASGESLTFGRAGKK--------LSRVATVAGVLSELDDESRSNGGSDV  340
            M+SRSY+NLLDLASG        G+         + RV TV   ++EL+DE  S+  SDV
Sbjct  1    MMSRSYTNLLDLASGNFPVISGGGRDGRSGGMRRMPRVMTVPSNIAELEDEQASSVASDV  60

Query  341  PSSISQERMIIVGNQLPLRAHRRTDGEEGWNFXWDEDSLLLQLKDGLGE  487
             SSI Q+R+IIVGNQLP+ A RR+D   G +F WD++SLLLQLKDGL +
Sbjct  61   QSSIIQDRLIIVGNQLPVVAKRRSDN-AGRDFSWDDESLLLQLKDGLPD  108



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 557548962370