BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001O21

Length=780
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_007205619.1|  hypothetical protein PRUPE_ppa009116mg             420   6e-146   
ref|XP_007211606.1|  hypothetical protein PRUPE_ppa005503mg             421   6e-145   
ref|XP_002872805.1|  hypothetical protein ARALYDRAFT_490270             419   2e-144   
gb|AEZ49160.1|  polyubiquitin                                           417   4e-144   Wolffia australiana
ref|XP_003626479.1|  Ubiquitin-like protein                             417   5e-144   
gb|AEW46688.1|  polyubiquitin                                           415   5e-144   Ulva linza
ref|XP_010931017.1|  PREDICTED: polyubiquitin 11 isoform X1             415   8e-144   Elaeis guineensis
gb|AFW66442.1|  putative ubiquitin family protein                       414   9e-144   
ref|XP_008358804.1|  PREDICTED: LOW QUALITY PROTEIN: polyubiquiti...    416   9e-144   
gb|AET06143.1|  ubiquitin                                               414   9e-144   Papaver somniferum
gb|KJB36627.1|  hypothetical protein B456_006G167800                    414   9e-144   Gossypium raimondii
ref|XP_002317213.1|  polyubiquitin family protein                       414   1e-143   Populus trichocarpa [western balsam poplar]
dbj|BAC57955.1|  polyubiquitin                                          414   1e-143   Tripolium pannonicum [sea starwort]
ref|XP_004968120.1|  PREDICTED: polyubiquitin-like                      414   1e-143   Setaria italica
ref|XP_006370634.1|  hypothetical protein POPTR_0001s44440g             416   1e-143   
ref|XP_002438839.1|  hypothetical protein SORBIDRAFT_10g027030          414   1e-143   Sorghum bicolor [broomcorn]
gb|EYU33610.1|  hypothetical protein MIMGU_mgv1a004315mg                414   1e-143   Erythranthe guttata [common monkey flower]
ref|XP_003570150.1|  PREDICTED: polyubiquitin 11 isoform X2             415   1e-143   Brachypodium distachyon [annual false brome]
ref|XP_010490793.1|  PREDICTED: polyubiquitin 11-like                   414   1e-143   Camelina sativa [gold-of-pleasure]
gb|ACJ85618.1|  unknown                                                 414   1e-143   Medicago truncatula
ref|NP_567286.1|  ubiquitin 11                                          414   1e-143   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010235843.1|  PREDICTED: polyubiquitin 11 isoform X1             416   1e-143   Brachypodium distachyon [annual false brome]
ref|XP_006288299.1|  hypothetical protein CARUB_v10001544mg             414   1e-143   
gb|AAP31578.1|  ubiquitin                                               414   1e-143   Hevea brasiliensis [jebe]
gb|ACD31680.1|  ubiquitin                                               417   1e-143   Gossypium hirsutum [American cotton]
gb|KDO51109.1|  hypothetical protein CISIN_1g026973mg                   414   1e-143   Citrus sinensis [apfelsine]
emb|CBI22349.3|  unnamed protein product                                417   1e-143   Vitis vinifera
ref|XP_006428779.1|  hypothetical protein CICLE_v10012654mg             414   1e-143   Citrus clementina [clementine]
gb|AGV54749.1|  ubiquitin 11                                            416   2e-143   Phaseolus vulgaris [French bean]
ref|XP_003590494.1|  Ubiquitin                                          417   2e-143   
gb|KDO51955.1|  hypothetical protein CISIN_1g026932mg                   414   2e-143   Citrus sinensis [apfelsine]
gb|AAO43307.1|  putative polyubiquitin                                  415   2e-143   Arabidopsis thaliana [mouse-ear cress]
emb|CAH59739.1|  polyubiquitin                                          414   3e-143   Plantago major [cart-track plant]
gb|AFK41706.1|  unknown                                                 414   3e-143   Medicago truncatula
gb|KJB62484.1|  hypothetical protein B456_009G418900                    413   3e-143   Gossypium raimondii
ref|XP_003627152.1|  Ubiquitin                                          414   4e-143   
gb|ACJ85643.1|  unknown                                                 413   4e-143   Medicago truncatula
ref|XP_006377830.1|  hypothetical protein POPTR_0011s13770g             415   5e-143   
ref|XP_007512209.1|  polyubiquitin                                      418   5e-143   Bathycoccus prasinos
ref|NP_001147027.1|  polyubiquitin containing 7 ubiquitin monomers      416   5e-143   
gb|AES89865.2|  polyubiquitin 3                                         414   6e-143   Medicago truncatula
ref|XP_008784557.1|  PREDICTED: LOW QUALITY PROTEIN: polyubiquiti...    412   6e-143   
gb|ABY60454.1|  putative polyubiquitin                                  414   7e-143   Adonis aestivalis var. palaestina
ref|XP_006428822.1|  hypothetical protein CICLE_v10012652mg             412   7e-143   Citrus clementina [clementine]
gb|EJU04700.1|  polyubiquitin UbiD/Ubi4                                 412   7e-143   Dacryopinax primogenitus
gb|KDP38838.1|  hypothetical protein JCGZ_04995                         415   8e-143   Jatropha curcas
gb|KIM78989.1|  hypothetical protein PILCRDRAFT_573034                  412   8e-143   Piloderma croceum F 1598
ref|XP_003574865.1|  PREDICTED: polyubiquitin-like                      416   8e-143   Brachypodium distachyon [annual false brome]
gb|KIM78981.1|  hypothetical protein PILCRDRAFT_10644                   412   9e-143   Piloderma croceum F 1598
gb|AAQ84316.1|  fiber polyubiquitin                                     412   9e-143   Gossypium barbadense [Egyptian cotton]
gb|KJA26171.1|  hypothetical protein HYPSUDRAFT_354705                  412   9e-143   Hypholoma sublateritium FD-334 SS-4
ref|XP_011110054.1|  hypothetical protein H072_4094                     412   1e-142   
gb|AFK43392.1|  unknown                                                 412   1e-142   Medicago truncatula
ref|XP_009114489.1|  PREDICTED: polyubiquitin-like                      415   1e-142   Brassica rapa
gb|KJB81824.1|  hypothetical protein B456_013G163500                    418   1e-142   Gossypium raimondii
emb|CDP08567.1|  unnamed protein product                                417   1e-142   Coffea canephora [robusta coffee]
dbj|BAJ85978.1|  predicted protein                                      415   1e-142   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002456845.1|  hypothetical protein SORBIDRAFT_03g043940          415   1e-142   Sorghum bicolor [broomcorn]
ref|XP_006654612.1|  PREDICTED: polyubiquitin-like                      415   1e-142   Oryza brachyantha
emb|CAA40323.1|  polyubiquitin protein                                  416   1e-142   Helianthus annuus
ref|XP_007154495.1|  hypothetical protein PHAVU_003G1236001g            413   1e-142   Phaseolus vulgaris [French bean]
ref|XP_011468094.1|  PREDICTED: polyubiquitin                           415   1e-142   Fragaria vesca subsp. vesca
emb|CAH59740.1|  polyubiquitin                                          414   1e-142   Plantago major [cart-track plant]
ref|XP_010258950.1|  PREDICTED: polyubiquitin                           415   1e-142   Nelumbo nucifera [Indian lotus]
gb|AAM64530.1|  ubiquitin homolog                                       412   1e-142   Arabidopsis thaliana [mouse-ear cress]
prf||1604470A  poly-ubiquitin                                           413   1e-142
ref|XP_007014924.1|  Polyubiquitin 3                                    414   1e-142   Theobroma cacao [chocolate]
ref|XP_006428821.1|  hypothetical protein CICLE_v10012292mg             414   1e-142   Citrus clementina [clementine]
gb|AES89866.2|  polyubiquitin 3                                         414   1e-142   Medicago truncatula
gb|ABK94002.1|  unknown                                                 414   1e-142   Populus trichocarpa [western balsam poplar]
gb|KDP39203.1|  hypothetical protein JCGZ_00960                         415   1e-142   Jatropha curcas
emb|CDR41572.1|  RHTO0S06e03070g1_1                                     411   2e-142   Rhodotorula toruloides
ref|NP_851029.1|  polyubiquitin 3                                       414   2e-142   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009112898.1|  PREDICTED: polyubiquitin                           414   2e-142   Brassica rapa
ref|NP_849292.1|  polyubiquitin 14                                      414   2e-142   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006396611.1|  hypothetical protein EUTSA_v10028730mg             414   2e-142   
ref|XP_006480631.1|  PREDICTED: polyubiquitin-like                      414   2e-142   Citrus sinensis [apfelsine]
ref|XP_007205620.1|  hypothetical protein PRUPE_ppa009116mg             414   2e-142   
ref|XP_006428820.1|  hypothetical protein CICLE_v10012290mg             414   2e-142   Citrus clementina [clementine]
gb|EYU33609.1|  hypothetical protein MIMGU_mgv1a004315mg                414   2e-142   Erythranthe guttata [common monkey flower]
ref|XP_002873083.1|  hypothetical protein ARALYDRAFT_487095             414   2e-142   
gb|KJB81823.1|  hypothetical protein B456_013G163500                    414   2e-142   Gossypium raimondii
ref|XP_006302387.1|  hypothetical protein CARUB_v10020456mg             414   2e-142   
gb|KIK28767.1|  hypothetical protein PISMIDRAFT_672939                  412   2e-142   Pisolithus microcarpus 441
ref|XP_003537278.1|  PREDICTED: polyubiquitin-like                      414   2e-142   Glycine max [soybeans]
emb|CDP08569.1|  unnamed protein product                                414   2e-142   Coffea canephora [robusta coffee]
emb|CAA48140.1|  ubiquitin                                              414   2e-142   Antirrhinum majus [garden snapdragon]
gb|AFY06654.1|  polyubiquitin                                           412   2e-142   Carica papaya [mamon]
gb|EPS72031.1|  polyubiquitin                                           413   2e-142   Genlisea aurea
ref|XP_006685644.1|  ubiquitin                                          411   2e-142   Yamadazyma tenuis ATCC 10573
gb|ABD96088.1|  polyubiquitin                                           412   2e-142   Malus domestica [apple tree]
ref|XP_006428925.1|  hypothetical protein CICLE_v10012291mg             414   2e-142   Citrus clementina [clementine]
ref|XP_011077812.1|  PREDICTED: polyubiquitin 3                         415   3e-142   
gb|AFW66439.1|  putative ubiquitin family protein                       414   3e-142   
gb|KIK92093.1|  hypothetical protein PAXRUDRAFT_830299                  410   3e-142   Paxillus rubicundulus Ve08.2h10
ref|XP_010227188.1|  PREDICTED: polyubiquitin isoform X1                415   3e-142   
emb|CBY46745.1|  polyubiquitin 10 protein                               414   3e-142   Lepidium appelianum [hairy whitetop]
gb|AAB95250.1|  ubiquitin                                               414   3e-142   Arabidopsis thaliana [mouse-ear cress]
gb|AAC35858.1|  polyubiquitin                                           412   3e-142   Capsicum chinense [bonnet pepper]
gb|KJB14874.1|  hypothetical protein B456_002G147600                    415   4e-142   Gossypium raimondii
gb|KIL68862.1|  hypothetical protein M378DRAFT_157997                   413   4e-142   Amanita muscaria Koide BX008
gb|EGO00904.1|  hypothetical protein SERLA73DRAFT_178893                414   4e-142   Serpula lacrymans var. lacrymans S7.3
emb|CAA54603.1|  pentameric polyubiquitin                               415   4e-142   Nicotiana tabacum [American tobacco]
ref|XP_010938693.1|  PREDICTED: polyubiquitin                           413   4e-142   Elaeis guineensis
ref|XP_002872746.1|  hypothetical protein ARALYDRAFT_911794             410   4e-142   
gb|KJB62487.1|  hypothetical protein B456_009G418900                    413   4e-142   Gossypium raimondii
ref|XP_007154496.1|  hypothetical protein PHAVU_003G1236001g            413   6e-142   Phaseolus vulgaris [French bean]
ref|XP_010453358.1|  PREDICTED: polyubiquitin-like                      413   6e-142   Camelina sativa [gold-of-pleasure]
emb|CCL99875.1|  predicted protein                                      413   6e-142   Fibroporia radiculosa
sp|P69315.2|UBIQP_LINUS  RecName: Full=Polyubiquitin; Contains: R...    413   6e-142   Linum usitatissimum
ref|XP_007154493.1|  hypothetical protein PHAVU_003G123500g             417   7e-142   Phaseolus vulgaris [French bean]
ref|XP_006288300.1|  hypothetical protein CARUB_v10001544mg             413   7e-142   Capsella rubella
ref|XP_010240636.1|  PREDICTED: polyubiquitin isoform X1                416   8e-142   
ref|XP_006287868.1|  hypothetical protein CARUB_v10001095mg             416   9e-142   
gb|EWZ40370.1|  ubiquitin C                                             409   1e-141   Fusarium oxysporum Fo47
gb|AAB36545.1|  ubiquitin-like protein                                  416   1e-141   Phaseolus vulgaris [French bean]
gb|KIM67150.1|  hypothetical protein SCLCIDRAFT_1210637                 412   1e-141   Scleroderma citrinum Foug A
gb|KIJ45725.1|  hypothetical protein M422DRAFT_106821                   412   1e-141   Sphaerobolus stellatus SS14
ref|XP_003030030.1|  polyubiquitin                                      412   1e-141   Schizophyllum commune H4-8
gb|AIY27743.1|  polyubiquitin Ubi10                                     413   1e-141   Betula luminifera [liang ye hua]
gb|KJB62485.1|  hypothetical protein B456_009G418900                    412   1e-141   Gossypium raimondii
gb|KDB11907.1|  ubiquitin                                               412   1e-141   Ustilaginoidea virens
gb|KDQ20365.1|  hypothetical protein BOTBODRAFT_123907                  412   1e-141   Botryobasidium botryosum FD-172 SS1
ref|XP_008796945.1|  PREDICTED: LOW QUALITY PROTEIN: polyubiquiti...    412   1e-141   Phoenix dactylifera
emb|CEF99839.1|  Ubiquitin conserved site                               414   1e-141   Ostreococcus tauri
ref|XP_001555417.1|  polyubiquitin                                      412   1e-141   Botrytis cinerea B05.10
ref|XP_010492041.1|  PREDICTED: polyubiquitin-like                      412   1e-141   Camelina sativa [gold-of-pleasure]
ref|NP_001105376.1|  polyubiquitin                                      415   1e-141   
gb|AHC00631.1|  polyubiquitin                                           412   1e-141   Ganoderma lucidum
ref|XP_001598085.1|  polyubiquitin                                      412   1e-141   Sclerotinia sclerotiorum 1980 UF-70
ref|XP_001828882.1|  ubiquitin C                                        412   1e-141   Coprinopsis cinerea okayama7#130
gb|KIY53974.1|  polyubiquitin                                           412   1e-141   Fistulina hepatica ATCC 64428
ref|XP_002872109.1|  predicted protein                                  415   1e-141   
gb|ADO60140.1|  ubiquitin                                               409   1e-141   Beauveria bassiana
ref|XP_007763327.1|  polyubiquitin                                      412   1e-141   Coniophora puteana RWD-64-598 SS2
gb|KIY45417.1|  ubiquitin                                               412   1e-141   Fistulina hepatica ATCC 64428
gb|KIR63773.1|  polyubiquitin                                           412   1e-141   Cryptococcus gattii CA1873
gb|ABU40645.1|  polyubiquitin                                           415   2e-141   Triticum aestivum [Canadian hard winter wheat]
ref|NP_001174480.1|  Os05g0504766                                       415   2e-141   
gb|AAB68045.1|  polyubiquitin                                           415   2e-141   Fragaria x ananassa
gb|EYU33608.1|  hypothetical protein MIMGU_mgv1a004315mg                415   2e-141   Erythranthe guttata [common monkey flower]
gb|AGV54228.1|  polyubiquitin-like protein                              415   2e-141   Phaseolus vulgaris [French bean]
ref|XP_001420612.1|  predicted protein                                  415   2e-141   Ostreococcus lucimarinus CCE9901
ref|XP_002508175.1|  ubiquitin                                          415   2e-141   Micromonas commoda
ref|XP_010270791.1|  PREDICTED: polyubiquitin-like                      415   2e-141   Nelumbo nucifera [Indian lotus]
ref|XP_006396612.1|  hypothetical protein EUTSA_v10028730mg             415   2e-141   Eutrema salsugineum [saltwater cress]
gb|EMS60894.1|  Polyubiquitin                                           417   2e-141   Triticum urartu
ref|XP_010558157.1|  PREDICTED: polyubiquitin-like                      415   2e-141   Tarenaya hassleriana [spider flower]
gb|AAK68824.1|  Unknown protein                                         409   2e-141   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001148453.1|  LOC100282068                                       415   2e-141   Zea mays [maize]
gb|KIR29996.1|  polyubiquitin                                           412   2e-141   Cryptococcus gattii VGII LA55
ref|XP_006381473.1|  polyubiquitin family protein                       412   2e-141   
ref|XP_007339454.1|  ubiquitin                                          412   2e-141   
emb|CDP05795.1|  unnamed protein product                                414   2e-141   Coffea canephora [robusta coffee]
ref|XP_007924320.1|  hypothetical protein MYCFIDRAFT_60610              409   2e-141   Pseudocercospora fijiensis CIRAD86
ref|XP_010240921.1|  PREDICTED: polyubiquitin-like                      414   2e-141   Nelumbo nucifera [Indian lotus]
gb|KEH31155.1|  polyubiquitin 3                                         414   2e-141   Medicago truncatula
ref|XP_006593989.1|  PREDICTED: polyubiquitin 10-like isoform X1        414   2e-141   
ref|NP_849300.4|  polyubiquitin 10                                      414   2e-141   Arabidopsis thaliana [mouse-ear cress]
emb|CBY46746.1|  polyubiquitin 10 protein                               414   2e-141   Lepidium campestre [bastard cress]
gb|AAL09741.1|  AT4g05320/C17L7_240                                     414   2e-141   Arabidopsis thaliana [mouse-ear cress]
gb|AAQ07453.1|  ubiquitin                                               414   2e-141   Musa acuminata AAA Group [Cavendish banana]
emb|CCT70325.1|  UBI4-Ubiquitin                                         410   2e-141   Fusarium fujikuroi IMI 58289
gb|AAY86773.1|  polyubiquitin                                           414   2e-141   Noccaea caerulescens
gb|ACS68205.1|  ubiquitin 10.2                                          414   2e-141   Brassica napus [oilseed rape]
ref|XP_010454368.1|  PREDICTED: polyubiquitin 4-like                    414   2e-141   Camelina sativa [gold-of-pleasure]
ref|XP_002874006.1|  hypothetical protein ARALYDRAFT_488966             414   2e-141   
ref|XP_002992988.1|  hypothetical protein SELMODRAFT_187148             409   2e-141   Selaginella moellendorffii
ref|XP_009596689.1|  PREDICTED: polyubiquitin-like                      414   2e-141   Nicotiana tomentosiformis
ref|NP_568397.1|  ubiquitin 4                                           414   2e-141   Arabidopsis thaliana [mouse-ear cress]
emb|CCG34086.1|  Polyubiquitin                                          411   2e-141   uncultured eukaryote
gb|EYU18102.1|  hypothetical protein MIMGU_mgv1a008166mg                414   2e-141   Erythranthe guttata [common monkey flower]
gb|KJB81825.1|  hypothetical protein B456_013G163500                    414   2e-141   Gossypium raimondii
ref|XP_009763135.1|  PREDICTED: polyubiquitin-like                      414   2e-141   Nicotiana sylvestris
ref|XP_006428816.1|  hypothetical protein CICLE_v10011684mg             414   2e-141   
ref|XP_009591312.1|  PREDICTED: polyubiquitin 4                         414   2e-141   Nicotiana tomentosiformis
ref|XP_003670049.1|  hypothetical protein NDAI_0D04930                  409   2e-141   Naumovozyma dairenensis CBS 421
ref|XP_010062974.1|  PREDICTED: polyubiquitin                           416   2e-141   Eucalyptus grandis [rose gum]
ref|XP_007366816.1|  polyubiquitin                                      411   2e-141   Dichomitus squalens LYAD-421 SS1
gb|EPX74297.1|  ubiquitin                                               409   2e-141   Schizosaccharomyces octosporus yFS286
dbj|BAL61087.1|  polyubiquitin                                          409   2e-141   Dianthus caryophyllus [carnation]
sp|P0CG84.1|UBI4P_NICSY  RecName: Full=Polyubiquitin; Contains: R...    414   2e-141   Nicotiana sylvestris
sp|Q58G87.2|UBQ3_ORYSJ  RecName: Full=Polyubiquitin 3; Contains: ...    414   2e-141   Oryza sativa Japonica Group [Japonica rice]
ref|XP_001931824.1|  ubiquitin                                          408   2e-141   Pyrenophora tritici-repentis Pt-1C-BFP
gb|AAB95252.1|  ubiquitin                                               414   2e-141   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010696408.1|  PREDICTED: polyubiquitin 4                         414   2e-141   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002266370.1|  PREDICTED: polyubiquitin 4-like                    414   2e-141   Vitis vinifera
ref|XP_006302388.1|  hypothetical protein CARUB_v10020456mg             414   2e-141   Capsella rubella
ref|XP_010911599.1|  PREDICTED: polyubiquitin 4                         414   3e-141   Elaeis guineensis
gb|AAO43308.1|  putative polyubiquitin                                  409   3e-141   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003607669.1|  Multidrug resistance protein ABC transporter...    417   3e-141   
ref|XP_010452435.1|  PREDICTED: polyubiquitin-like                      411   3e-141   Camelina sativa [gold-of-pleasure]
ref|XP_009605659.1|  PREDICTED: polyubiquitin                           411   3e-141   Nicotiana tomentosiformis
ref|XP_010421267.1|  PREDICTED: polyubiquitin 4-like                    414   3e-141   Camelina sativa [gold-of-pleasure]
gb|KJB13592.1|  hypothetical protein B456_002G083000                    414   3e-141   Gossypium raimondii
ref|XP_719867.1|  hypothetical protein CaO19.6771                       408   3e-141   Candida albicans SC5314
gb|EMS65864.1|  Polyubiquitin                                           415   3e-141   Triticum urartu
emb|CAB81074.1|  polyubiquitin (ubq10)                                  417   3e-141   Arabidopsis thaliana [mouse-ear cress]
gb|KII93501.1|  hypothetical protein PLICRDRAFT_694663                  413   3e-141   Plicaturopsis crispa FD-325 SS-3
ref|XP_001783045.1|  predicted protein                                  408   3e-141   
ref|XP_010493589.1|  PREDICTED: polyubiquitin-like                      416   3e-141   Camelina sativa [gold-of-pleasure]
emb|CEP60563.1|  LALA0S01e13784g1_1                                     408   3e-141   Lachancea lanzarotensis
ref|XP_008020911.1|  hypothetical protein SETTUDRAFT_162442             411   3e-141   Exserohilum turcica Et28A
ref|XP_011048569.1|  PREDICTED: polyubiquitin 3-like                    411   3e-141   Populus euphratica
ref|XP_001755431.1|  predicted protein                                  408   3e-141   
ref|XP_009631616.1|  PREDICTED: polyubiquitin-like                      414   4e-141   Nicotiana tomentosiformis
gb|AAX40652.1|  polyubiquitin                                           414   4e-141   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009358096.1|  PREDICTED: polyubiquitin isoform X1                414   4e-141   Pyrus x bretschneideri [bai li]
dbj|GAK65396.1|  ubiquitin                                              412   5e-141   Moesziomyces antarcticus
ref|NP_001053957.1|  Os04g0628100                                       414   5e-141   
gb|KJB62483.1|  hypothetical protein B456_009G418900                    414   5e-141   Gossypium raimondii
ref|XP_001797032.1|  hypothetical protein SNOG_06667                    408   5e-141   Parastagonospora nodorum SN15
gb|AGZ15412.1|  fiber polyubiquitin                                     407   5e-141   Phaseolus vulgaris [French bean]
gb|AAN31845.1|  putative polyubiquitin (UBQ10)                          416   6e-141   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003607668.1|  Multidrug resistance protein ABC transporter...    417   7e-141   
ref|XP_001764949.1|  predicted protein                                  410   8e-141   
ref|XP_002953480.1|  polyubiquitin                                      410   9e-141   Volvox carteri f. nagariensis
ref|XP_001830230.1|  ubiquitin                                          410   9e-141   Coprinopsis cinerea okayama7#130
gb|EGO00841.1|  hypothetical protein SERLA73DRAFT_121253                412   1e-140   Serpula lacrymans var. lacrymans S7.3
ref|XP_004956019.1|  PREDICTED: polyubiquitin 4-like                    412   1e-140   Setaria italica
gb|ADD52202.1|  ubiquitin                                               412   1e-140   Catharanthus roseus [chatas]
gb|AIS40894.1|  polyubiquitin                                           416   1e-140   Kalanchoe fedtschenkoi [lavender-scallops]
ref|XP_003052575.1|  predicted protein                                  409   1e-140   [Nectria] haematococca mpVI 77-13-4
ref|XP_009108753.1|  PREDICTED: polyubiquitin 11-like                   406   1e-140   Brassica rapa
ref|XP_007154492.1|  hypothetical protein PHAVU_003G123400g             411   1e-140   Phaseolus vulgaris [French bean]
ref|XP_001880135.1|  ubiquitin                                          412   2e-140   Laccaria bicolor S238N-H82
dbj|GAA27344.2|  polyubiquitin-A                                        409   2e-140   Clonorchis sinensis [oriental liver fluke]
gb|KIJ68260.1|  hypothetical protein HYDPIDRAFT_173033                  412   2e-140   Hydnomerulius pinastri MD-312
gb|AFR98116.1|  polyubiquitin                                           412   2e-140   Cryptococcus neoformans var. grubii H99
ref|XP_010436682.1|  PREDICTED: polyubiquitin 4-like                    415   2e-140   
gb|EUC59758.1|  polyubiquitin                                           412   2e-140   Rhizoctonia solani AG-3 Rhs1AP
ref|XP_003010029.1|  polyubiquitin UbiD/Ubi4, putative                  406   2e-140   Trichophyton benhamiae CBS 112371
gb|KIM40192.1|  hypothetical protein M413DRAFT_73842                    412   2e-140   Hebeloma cylindrosporum h7
gb|KDR85168.1|  hypothetical protein GALMADRAFT_131895                  412   2e-140   Galerina marginata CBS 339.88
ref|XP_002551324.1|  ubiquitin                                          409   2e-140   Candida tropicalis MYA-3404
ref|XP_007864655.1|  ubiquitin                                          412   2e-140   Gloeophyllum trabeum ATCC 11539
ref|XP_010324326.1|  PREDICTED: polyubiquitin isoform X1                415   2e-140   
gb|AAB95251.1|  ubiquitin                                               415   2e-140   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008441422.1|  PREDICTED: LOW QUALITY PROTEIN: polyubiquiti...    415   2e-140   Cucumis melo [Oriental melon]
gb|KDP42860.1|  hypothetical protein JCGZ_23802                         415   2e-140   Jatropha curcas
gb|EJU00136.1|  ubiquitin                                               412   2e-140   Dacryopinax primogenitus
ref|XP_003196661.1|  ATP-dependent protein binding protein              412   2e-140   Cryptococcus gattii WM276
ref|XP_009784908.1|  PREDICTED: polyubiquitin-like isoform X2           414   2e-140   Nicotiana sylvestris
gb|EYU33607.1|  hypothetical protein MIMGU_mgv1a004315mg                415   2e-140   Erythranthe guttata [common monkey flower]
ref|NP_001045980.1|  Os02g0161900                                       415   2e-140   
dbj|BAK03691.1|  predicted protein                                      415   2e-140   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007211609.1|  hypothetical protein PRUPE_ppa005507mg             415   2e-140   Prunus persica
gb|KDQ30621.1|  hypothetical protein PLEOSDRAFT_1088454                 412   2e-140   Pleurotus ostreatus PC15
gb|KII92029.1|  hypothetical protein PLICRDRAFT_172184                  412   2e-140   Plicaturopsis crispa FD-325 SS-3
gb|KIM48035.1|  hypothetical protein M413DRAFT_16078                    412   2e-140   Hebeloma cylindrosporum h7
ref|XP_004953565.1|  PREDICTED: polyubiquitin-like                      415   2e-140   Setaria italica
emb|CAA40324.1|  hexaubiquitin protein                                  415   2e-140   Helianthus annuus
gb|AFD53810.1|  ubiquitin                                               407   2e-140   Trichoderma harzianum
ref|XP_007316637.1|  hypothetical protein SERLADRAFT_368035             412   2e-140   Serpula lacrymans var. lacrymans S7.9
ref|XP_002888365.1|  polyubiquitin                                      415   2e-140   Arabidopsis lyrata subsp. lyrata
ref|NP_849299.4|  polyubiquitin 10                                      415   2e-140   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003542730.1|  PREDICTED: polyubiquitin 10-like                   415   2e-140   
dbj|BAJ91912.1|  predicted protein                                      415   2e-140   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002452705.1|  hypothetical protein SORBIDRAFT_04g031060          415   2e-140   Sorghum bicolor [broomcorn]
gb|EGA57707.1|  Ubi4p                                                   407   2e-140   Saccharomyces cerevisiae FostersB
gb|KIK17147.1|  hypothetical protein PISMIDRAFT_685607                  412   2e-140   Pisolithus microcarpus 441
dbj|BAK02501.1|  predicted protein                                      414   2e-140   Hordeum vulgare subsp. vulgare [two-rowed barley]
sp|P0CG73.1|UBI1P_CANAX  RecName: Full=Polyubiquitin; Contains: R...    406   2e-140   Candida albicans
ref|XP_010431529.1|  PREDICTED: LOW QUALITY PROTEIN: polyubiquiti...    414   2e-140   Camelina sativa [gold-of-pleasure]
ref|XP_011094250.1|  PREDICTED: polyubiquitin-like                      414   2e-140   Sesamum indicum [beniseed]
gb|KIM22018.1|  hypothetical protein M408DRAFT_333137                   406   2e-140   Serendipita vermifera MAFF 305830
ref|XP_010423744.1|  PREDICTED: polyubiquitin                           414   2e-140   Camelina sativa [gold-of-pleasure]
gb|KJB81827.1|  hypothetical protein B456_013G163500                    414   2e-140   Gossypium raimondii
ref|XP_009784905.1|  PREDICTED: polyubiquitin-like isoform X1           414   2e-140   Nicotiana sylvestris
gb|AAD03343.1|  ubiquitin                                               414   2e-140   Pisum sativum [garden pea]
ref|XP_006428817.1|  hypothetical protein CICLE_v10011684mg             414   2e-140   
ref|XP_007049060.1|  Polyubiquitin 10                                   414   2e-140   
ref|XP_011094650.1|  PREDICTED: polyubiquitin                           414   3e-140   Sesamum indicum [beniseed]
ref|XP_002891806.1|  predicted protein                                  412   3e-140   
ref|XP_008350368.1|  PREDICTED: polyubiquitin                           414   3e-140   
ref|XP_002494205.1|  Ubiquitin                                          409   3e-140   Komagataella phaffii GS115
ref|XP_010275241.1|  PREDICTED: polyubiquitin-like                      412   3e-140   Nelumbo nucifera [Indian lotus]
gb|AAC16012.1|  polyubiquitin                                           414   3e-140   Elaeagnus umbellata [aki-gumi]
gb|ACX46987.1|  ubiquitin                                               414   3e-140   Guzmania wittmackii x Guzmania lingulata
gb|ACN40936.1|  unknown                                                 414   3e-140   
gb|KJB13590.1|  hypothetical protein B456_002G083000                    414   3e-140   
ref|XP_002980153.1|  hypothetical protein SELMODRAFT_271419             409   3e-140   
ref|XP_001227036.1|  polyubiquitin                                      409   3e-140   
ref|XP_001755307.1|  predicted protein                                  409   3e-140   
gb|KIW56414.1|  polyubiquitin                                           408   3e-140   
ref|XP_001266981.1|  polyubiquitin (UbiD), putative                     408   3e-140   
ref|XP_010324327.1|  PREDICTED: polyubiquitin isoform X2                411   3e-140   
ref|XP_001210780.1|  ubiquitin                                          408   3e-140   
dbj|BAP70433.1|  Ubiquitin                                              408   4e-140   
ref|XP_006372519.1|  polyubiquitin family protein                       408   4e-140   
gb|EKV13151.1|  hypothetical protein PDIG_39650                         409   4e-140   
ref|XP_008345409.1|  PREDICTED: polyubiquitin-like                      414   4e-140   
gb|EEQ88150.1|  ubiquitin                                               408   4e-140   
ref|XP_002839703.1|  hypothetical protein                               408   4e-140   
gb|KEZ40313.1|  Polyubiquitin                                           408   4e-140   
gb|AFW70219.1|  polyubiquitin-like protein                              416   4e-140   
ref|XP_010262389.1|  PREDICTED: polyubiquitin                           414   4e-140   
ref|XP_002419618.1|  ubiquitin, putative                                408   4e-140   
gb|EEH20847.2|  polyubiquitin                                           409   4e-140   
gb|AAV65292.1|  polyubiquitin                                           408   4e-140   
gb|EEH07231.1|  ubiquitin                                               408   4e-140   
gb|AAY33920.2|  polyubiquitin                                           411   4e-140   
ref|XP_010756991.1|  polyubiquitin                                      409   4e-140   
ref|XP_008244357.1|  PREDICTED: polyubiquitin isoform X1                414   5e-140   
emb|CCO30833.1|  Polyubiquitin                                          412   5e-140   
gb|AEH41483.1|  ubiquitin                                               408   5e-140   
gb|AGT38457.1|  polyubiquitin                                           414   5e-140   
ref|XP_002888394.1|  hexaubiquitin protein                              414   6e-140   
ref|XP_011037020.1|  PREDICTED: polyubiquitin-like                      411   6e-140   
gb|EZF98642.1|  polyubiquitin                                           405   6e-140   
gb|AAA82978.1|  polyubiquitin                                           410   6e-140   
gb|AAO43309.1|  putative polyubiquitin                                  405   6e-140   
dbj|BAH71115.1|  ACYPI006410                                            405   7e-140   
ref|XP_010046742.1|  PREDICTED: polyubiquitin-like                      413   7e-140   
gb|KIM30634.1|  hypothetical protein M408DRAFT_328170                   405   8e-140   
ref|XP_006694532.1|  hypothetical protein CTHT_0041260                  407   8e-140   
ref|XP_002791169.1|  ubiquitin                                          407   8e-140   
ref|XP_007808982.1|  ubiquitin                                          409   8e-140   
ref|XP_659604.1|  hypothetical protein AN2000.2                         408   8e-140   
gb|AFW66445.1|  ubiquitin2                                              416   8e-140   
gb|AGM32540.1|  polyubiquitin-B-like isoform                            405   9e-140   
gb|KHJ83418.1|  ubiquitin family protein                                404   9e-140   
gb|EMS24129.1|  ubiquitin C                                             405   9e-140   
emb|CDH08450.1|  ubiquitin and ubiquitin-like proteins                  407   9e-140   
ref|XP_003350608.1|  hypothetical protein SMAC_07925                    404   1e-139   
emb|CAA52290.1|  polyubiquitin                                          410   1e-139   
gb|KDR10312.1|  Ubiquitin                                               404   1e-139   
dbj|GAA55031.1|  ubiquitin C                                            404   1e-139   
gb|AFK47245.1|  unknown                                                 404   1e-139   
tpd|FAA00317.1|  TPA: polyubiquitin                                     407   1e-139   
ref|XP_001538486.1|  polyubiquitin                                      407   1e-139   
ref|XP_003402310.1|  PREDICTED: polyubiquitin-B-like isoform 1          404   1e-139   
ref|XP_010451655.1|  PREDICTED: polyubiquitin 4-like                    415   2e-139   
gb|AAC67552.1|  polyubiquitin                                           409   2e-139   
gb|ETN78467.1|  ubiquitin family protein                                404   2e-139   
gb|AGM32487.1|  polyubiquitin-B-like isoform 1                          404   2e-139   
ref|XP_011038259.1|  PREDICTED: polyubiquitin-like                      407   2e-139   
gb|EYC42800.1|  hypothetical protein Y032_0517g2809                     404   2e-139   
ref|XP_002842034.1|  hypothetical protein                               407   2e-139   
tpe|CBF85986.1|  TPA: Polyubiquitin Fragment [Source:UniProtKB/Tr...    407   2e-139   
ref|XP_008034069.1|  ubiquitin 10.1                                     412   2e-139   
ref|XP_003608276.1|  Ubiquitin                                          415   2e-139   
ref|XP_007307433.1|  polyubiquitin                                      412   2e-139   
ref|XP_003843815.1|  hypothetical protein LEMA_P014660.1                410   2e-139   
ref|XP_004505453.1|  PREDICTED: polyubiquitin-A-like                    415   2e-139   
gb|AAL91103.1|  ubiquitin                                               405   2e-139   
ref|XP_008645269.1|  PREDICTED: polyubiquitin                           415   2e-139   
gb|AAC49013.1|  polyubiquitin containing 7 ubiquitin monomers           415   2e-139   
gb|EYU33611.1|  hypothetical protein MIMGU_mgv1a004315mg                415   2e-139   
ref|XP_009618235.1|  PREDICTED: polyubiquitin-like isoform X1           416   2e-139   
emb|CAA51679.1|  ubiquitin                                              415   2e-139   
tpd|FAA00319.1|  TPA: polyubiquitin                                     412   2e-139   
ref|XP_006350990.1|  PREDICTED: polyubiquitin-A-like                    415   2e-139   
gb|AAO43306.1|  putative polyubiquitin                                  407   2e-139   
ref|XP_003627151.1|  Ubiquitin                                          415   2e-139   
emb|CAD27944.1|  polyubiquitin-like                                     403   2e-139   
ref|XP_003542728.1|  PREDICTED: polyubiquitin-A-like isoform 1          415   2e-139   
ref|XP_003607670.1|  Ubiquitin                                          415   2e-139   
dbj|BAK61744.1|  ubiquitin                                              403   2e-139   
ref|XP_567862.1|  ATP-dependent protein binding protein                 412   2e-139   
ref|XP_004249885.1|  PREDICTED: polyubiquitin-like                      415   2e-139   
ref|XP_011388891.1|  putative ubiquitin                                 412   2e-139   
gb|EYU38681.1|  hypothetical protein MIMGU_mgv1a004304mg                414   2e-139   
ref|XP_007861169.1|  polyubiquitin                                      412   2e-139   
ref|XP_010553005.1|  PREDICTED: polyubiquitin-like                      414   2e-139   
ref|XP_009150698.1|  PREDICTED: polyubiquitin                           414   3e-139   
ref|XP_006480550.1|  PREDICTED: polyubiquitin-A-like                    414   3e-139   
gb|EYU18101.1|  hypothetical protein MIMGU_mgv1a004289mg                414   3e-139   
gb|KDQ63803.1|  hypothetical protein JAAARDRAFT_29850                   412   3e-139   
ref|XP_007410937.1|  hypothetical protein MELLADRAFT_87680              414   3e-139   
ref|XP_005644220.1|  polyubiquitin                                      406   3e-139   
gb|ABD32351.2|  Ubiquitin                                               414   3e-139   
gb|AIS71924.1|  polyubiquitin                                           403   3e-139   
gb|KIY97628.1|  ubiquitin C                                             406   3e-139   
gb|KJB62486.1|  hypothetical protein B456_009G418900                    409   3e-139   
sp|P0CH27.1|RL402_TRYCR  RecName: Full=Ubiquitin-60S ribosomal pr...    408   3e-139   
emb|CCA16073.1|  polyubiquitin putative                                 414   3e-139   
emb|CCA40372.1|  Ubiquitin cross-reactive protein                       409   3e-139   
dbj|GAA87419.1|  polyubiquitin                                          406   3e-139   
gb|AAO43305.1|  putative polyubiquitin                                  407   3e-139   
ref|XP_003675939.1|  hypothetical protein NCAS_0C05850                  409   3e-139   
gb|AAO43310.1|  putative polyubiquitin                                  404   3e-139   
dbj|BAL61084.1|  polyubiqutin                                           409   4e-139   
gb|KFY10578.1|  hypothetical protein V492_04946                         410   4e-139   
ref|XP_002992907.1|  hypothetical protein SELMODRAFT_162680             409   4e-139   
ref|XP_001246797.1|  polyubiquitin                                      406   4e-139   
ref|NP_013061.1|  ubiquitin                                             409   4e-139   
ref|XP_001777816.1|  predicted protein                                  409   4e-139   
dbj|BAO38900.1|  ubiquitin                                              409   4e-139   
ref|XP_002976481.1|  hypothetical protein SELMODRAFT_271198             409   4e-139   
gb|ELR08709.1|  polyubiquitin                                           408   5e-139   
ref|NP_983342.1|  ACL062Cp                                              408   5e-139   
tpd|FAA00316.1|  TPA: polyubiquitin                                     408   5e-139   
emb|CAN71997.1|  hypothetical protein VITISV_004025                     414   5e-139   
ref|XP_002267017.1|  PREDICTED: polyubiquitin-like                      414   5e-139   
gb|ADD24466.1|  Ubiquitin                                               402   5e-139   
ref|XP_453980.1|  hypothetical protein                                  408   5e-139   
ref|NP_595409.1|  ubiquitin                                             408   5e-139   
ref|XP_011275993.1|  ubiquitin C                                        408   5e-139   
ref|XP_002627625.1|  ubiquitin                                          408   5e-139   
gb|KJB62482.1|  hypothetical protein B456_009G418900                    408   5e-139   
ref|XP_010537590.1|  PREDICTED: polyubiquitin 11                        402   6e-139   
ref|XP_004365491.1|  polyubiquitin 5                                    402   6e-139   
emb|CDI53149.1|  probable Polyubiquitin protein                         405   6e-139   
gb|AEZ66647.1|  putative beta-1,6-glucanase                             408   6e-139   
emb|CEL52635.1|  Polyubiquitin OS=Petroselinum crispum GN=PCUBI4-...    414   6e-139   
ref|XP_004341200.1|  polyubiquitin, putative                            402   7e-139   
ref|XP_002171731.1|  ubiquitin                                          408   7e-139   
emb|CAJ41447.1|  polyubiquitin                                          405   9e-139   
ref|XP_002553736.1|  KLTH0E05852p                                       409   9e-139   
dbj|BAK61751.1|  ubiquitin                                              402   1e-138   
gb|KFY77115.1|  hypothetical protein V499_03430                         407   1e-138   
ref|XP_001766873.1|  predicted protein                                  406   1e-138   
gb|ABV22331.1|  ubiquitin                                               404   1e-138   
ref|XP_958803.1|  ubiquitin                                             404   1e-138   
gb|AEP96154.1|  ubiquitin C-like protein                                401   1e-138   
gb|AAC13691.1|  poly-ubiquitin                                          407   1e-138   
gb|EFN76024.1|  Ubiquitin                                               401   2e-138   
ref|XP_007545871.1|  PREDICTED: polyubiquitin-B isoform X2              402   2e-138   
ref|XP_008426285.1|  PREDICTED: polyubiquitin-B isoform X1              402   2e-138   
ref|XP_008243902.1|  PREDICTED: polyubiquitin-like isoform X1           412   2e-138   
ref|XP_005831810.1|  ubiquitin                                          401   2e-138   
gb|AAL91109.1|  ubiquitin                                               404   2e-138   
ref|XP_003290908.1|  ubiquitin                                          401   2e-138   
tpg|DAA34473.1|  TPA: ubiquitin                                         401   2e-138   
ref|XP_011302492.1|  PREDICTED: polyubiquitin-B                         404   2e-138   
ref|XP_005525793.1|  PREDICTED: polyubiquitin-C-like isoform X2         401   2e-138   
gb|AAP80689.1|  polyubiquitin                                           401   2e-138   
ref|XP_003331105.1|  polyubiquitin-A                                    415   2e-138   
ref|XP_009620669.1|  PREDICTED: polyubiquitin-like                      414   2e-138   
ref|XP_010602597.1|  PREDICTED: polyubiquitin-C                         401   3e-138   
gb|KHN45015.1|  Polyubiquitin-A                                         414   3e-138   
ref|XP_011094688.1|  PREDICTED: polyubiquitin-like                      415   3e-138   
gb|AAO43303.1|  putative polyubiquitin                                  404   3e-138   
gb|KIZ01427.1|  ubiquitin C                                             406   3e-138   
ref|XP_006352490.1|  PREDICTED: polyubiquitin-A-like isoform X1         414   3e-138   
ref|XP_008816966.1|  polyubiquitin                                      404   3e-138   
gb|EJD76734.1|  polyubiquitin, variant 2                                404   3e-138   
ref|XP_010293819.1|  PREDICTED: polyubiquitin-B isoform X15             402   3e-138   
ref|XP_008161896.1|  PREDICTED: polyubiquitin-C                         400   3e-138   
gb|AAO43304.1|  putative polyubiquitin                                  404   4e-138   
ref|XP_001774326.1|  predicted protein                                  409   4e-138   
pir||T02358  ubiquitin homolog T8F5.13 - Arabidopsis thaliana           404   4e-138
gb|KIJ26545.1|  hypothetical protein M422DRAFT_216245                   412   4e-138   
gb|EDM13555.1|  rCG21222, isoform CRA_a                                 402   4e-138   
ref|XP_667472.1|  ubiquitin B                                           400   5e-138   
gb|AAX43350.1|  ubiquitin B                                             400   5e-138   
ref|NP_061828.1|  polyubiquitin-B precursor                             400   5e-138   
emb|CAA30815.1|  unnamed protein product                                400   5e-138   
emb|CAJ32646.1|  ubiquitin                                              400   5e-138   
ref|XP_002498336.1|  ZYRO0G07854p                                       409   5e-138   
ref|XP_002099886.1|  GE16472                                            400   5e-138   
ref|XP_007057723.1|  PREDICTED: polyubiquitin-C isoform X1              400   5e-138   
dbj|BAE40351.1|  unnamed protein product                                402   5e-138   
ref|XP_008003373.1|  PREDICTED: polyubiquitin-C                         400   5e-138   
gb|ELU06246.1|  hypothetical protein CAPTEDRAFT_186294                  400   5e-138   
emb|CAX72421.1|  ubiquitin C                                            400   6e-138   
gb|ELU42015.1|  polyubiquitin                                           416   6e-138   
gb|AAA28997.1|  ubiquitin                                               400   6e-138   
emb|CCF74470.1|  unnamed protein product                                402   6e-138   
ref|XP_005023176.1|  PREDICTED: polyubiquitin-C isoform X2              400   6e-138   
ref|XP_004395987.1|  PREDICTED: polyubiquitin-B-like isoform 1          400   6e-138   
gb|ABI53721.1|  polyubiquitin                                           408   6e-138   
ref|XP_008300055.1|  PREDICTED: polyubiquitin-B                         400   6e-138   
ref|XP_004946727.1|  PREDICTED: polyubiquitin-C-like isoform X9         400   6e-138   
ref|XP_002973843.1|  hypothetical protein SELMODRAFT_173723             408   6e-138   
ref|NP_001133175.1|  polyubiquitin                                      400   6e-138   
ref|XP_001486573.1|  ubiquitin                                          408   6e-138   
ref|XP_005056764.1|  PREDICTED: polyubiquitin-C-like isoform X2         400   6e-138   
ref|XP_002674746.1|  polyubiquitin                                      400   7e-138   
ref|XP_001610925.1|  polyubiquitin                                      400   7e-138   
gb|ABY55758.1|  ubiquitin                                               399   7e-138   
ref|XP_460488.1|  DEHA2F02816p                                          408   7e-138   
ref|XP_626192.1|  polyubiquitin with 3 Ub domains                       400   7e-138   
ref|XP_001897032.1|  polyubiquitin precursor                            405   7e-138   
ref|XP_009901570.1|  PREDICTED: polyubiquitin-B isoform X1              400   8e-138   
emb|CDP91931.1|  Protein Bm3564, isoform e                              405   8e-138   
emb|CAX72428.1|  ubiquitin C                                            399   8e-138   
gb|EMS54972.1|  Polyubiquitin-A                                         415   8e-138   
ref|XP_002723083.2|  PREDICTED: LOW QUALITY PROTEIN: polyubiquiti...    400   9e-138   
ref|NP_176714.4|  ubiquitin 13                                          403   9e-138   
ref|XP_010298600.1|  PREDICTED: polyubiquitin-B isoform X2              399   9e-138   
ref|XP_010177726.1|  PREDICTED: polyubiquitin-B isoform X5              400   1e-137   
gb|ACL98140.1|  ubiquitin C variant                                     400   1e-137   
ref|XP_010876509.1|  PREDICTED: polyubiquitin-B                         399   1e-137   
gb|ABH08755.1|  ubiquitin                                               399   1e-137   
emb|CDP08561.1|  unnamed protein product                                414   1e-137   
gb|ABF13286.1|  polyubiquitin                                           400   1e-137   
ref|XP_001018501.1|  Ubiquitin family protein                           399   1e-137   
gb|ABF66639.1|  ubiquitin                                               402   1e-137   
gb|AAA30719.1|  polyubiquitin                                           400   1e-137   
emb|CAB55973.1|  hypothetical protein                                   399   1e-137   
ref|XP_008047384.1|  PREDICTED: polyubiquitin-B                         399   1e-137   
gb|EWS74283.1|  polyubiquitin                                           399   1e-137   
ref|XP_003082269.1|  polyubiquitin (ISS)                                401   1e-137   
ref|XP_006306291.1|  hypothetical protein CARUB_v10012156mg             407   1e-137   
emb|CAX72419.1|  polyubiquitin                                          399   1e-137   
ref|NP_001232075.1|  putative ubiquitin C variant 2                     399   1e-137   
ref|XP_008330590.1|  PREDICTED: polyubiquitin-B isoform X2              399   2e-137   
ref|XP_002771956.1|  polyubiquitin, putative                            399   2e-137   



>ref|XP_007205619.1| hypothetical protein PRUPE_ppa009116mg [Prunus persica]
 gb|EMJ06818.1| hypothetical protein PRUPE_ppa009116mg [Prunus persica]
Length=232

 Score =   420 bits (1080),  Expect = 6e-146, Method: Compositional matrix adjust.
 Identities = 217/235 (92%), Positives = 219/235 (93%), Gaps = 6/235 (3%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQ+FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQVFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ---XIHPPLWFSV*GXACRSL  753
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ    +H  L F V   ACR L
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRFVV---ACRFL  232



>ref|XP_007211606.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 gb|EMJ12805.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
Length=309

 Score =   421 bits (1081),  Expect = 6e-145, Method: Compositional matrix adjust.
 Identities = 217/235 (92%), Positives = 219/235 (93%), Gaps = 5/235 (2%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ---XIHPPLWFSV*GXACRSL  753
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ    +H  L   + G  CRSL
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH--LVLRLRGVVCRSL  309


 Score =   415 bits (1067),  Expect = 9e-143, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214



>ref|XP_002872805.1| hypothetical protein ARALYDRAFT_490270 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49064.1| hypothetical protein ARALYDRAFT_490270 [Arabidopsis lyrata subsp. 
lyrata]
Length=309

 Score =   419 bits (1077),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   367 bits (943),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 185/186 (99%), Positives = 186/186 (100%), Gaps = 0/186 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  598  KIQDKE  615
            KIQDK+
Sbjct  257  KIQDKK  262



>gb|AEZ49160.1| polyubiquitin, partial [Wolffia australiana]
Length=281

 Score =   417 bits (1073),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 211/215 (98%), Positives = 211/215 (98%), Gaps = 0/215 (0%)
 Frame = +1

Query  55   KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  234
            KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  20   KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  79

Query  235  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  414
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  80   NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  139

Query  415  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  594
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  140  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  199

Query  595  AKIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            AKIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  200  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  234


 Score =   362 bits (930),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 184/185 (99%), Positives = 184/185 (99%), Gaps = 0/185 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  97   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  156

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  157  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  216

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEV SSDTIDNVKA
Sbjct  217  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVASSDTIDNVKA  276

Query  598  KIQDK  612
            KIQDK
Sbjct  277  KIQDK  281


 Score =   269 bits (688),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 136/143 (95%), Positives = 137/143 (96%), Gaps = 0/143 (0%)
 Frame = +1

Query  271  RLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRT  450
            RL+  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRT
Sbjct  16   RLQSKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRT  75

Query  451  LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPX  630
            LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP 
Sbjct  76   LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPD  135

Query  631  QQXLIFAGKQLEDGRTLPDYXIQ  699
            QQ LIFAGKQLEDGRTL DY IQ
Sbjct  136  QQRLIFAGKQLEDGRTLADYNIQ  158



>ref|XP_003626479.1| Ubiquitin-like protein [Medicago truncatula]
 gb|AES82697.1| polyubiquitin 3 [Medicago truncatula]
Length=277

 Score =   417 bits (1072),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 211/216 (98%), Positives = 212/216 (98%), Gaps = 0/216 (0%)
 Frame = +1

Query  52   LKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  231
            +KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  47   IKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  106

Query  232  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  411
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  107  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  166

Query  412  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV  591
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV
Sbjct  167  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV  226

Query  592  KAKIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KAKIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  227  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  262


 Score =   303 bits (777),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  125  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  185  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  244

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  516
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  245  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  277



>gb|AEW46688.1| polyubiquitin, partial [Ulva linza]
Length=226

 Score =   415 bits (1067),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   298 bits (764),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 150/150 (100%), Positives = 150/150 (100%), Gaps = 0/150 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLR  507
            FAGKQLEDGRTLADYNIQKESTLHLVLRLR
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLR  226



>ref|XP_010931017.1| PREDICTED: polyubiquitin 11 isoform X1 [Elaeis guineensis]
 ref|XP_010931026.1| PREDICTED: polyubiquitin 11 isoform X2 [Elaeis guineensis]
 ref|XP_010923942.1| PREDICTED: polyubiquitin 11 [Elaeis guineensis]
Length=229

 Score =   415 bits (1066),  Expect = 8e-144, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   305 bits (782),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 153/153 (100%), Positives = 153/153 (100%), Gaps = 0/153 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  516
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229



>gb|AFW66442.1| putative ubiquitin family protein, partial [Zea mays]
Length=216

 Score =   414 bits (1064),  Expect = 9e-144, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   278 bits (712),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 140/140 (100%), Positives = 140/140 (100%), Gaps = 0/140 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKE  477
            FAGKQLEDGRTLADYNIQKE
Sbjct  197  FAGKQLEDGRTLADYNIQKE  216



>ref|XP_008358804.1| PREDICTED: LOW QUALITY PROTEIN: polyubiquitin 11-like, partial 
[Malus domestica]
Length=260

 Score =   416 bits (1069),  Expect = 9e-144, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   353 bits (906),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 179/181 (99%), Positives = 179/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKT TGKTITLE ESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTXTGKTITLEXESSDTIDNVKA  256

Query  598  K  600
            K
Sbjct  257  K  257



>gb|AET06143.1| ubiquitin [Papaver somniferum]
Length=229

 Score =   414 bits (1065),  Expect = 9e-144, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   303 bits (776),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  513
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>gb|KJB36627.1| hypothetical protein B456_006G167800 [Gossypium raimondii]
Length=229

 Score =   414 bits (1065),  Expect = 9e-144, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   303 bits (776),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  513
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>ref|XP_002317213.1| polyubiquitin family protein [Populus trichocarpa]
 gb|ABK95814.1| unknown [Populus trichocarpa]
 gb|EEE97825.1| polyubiquitin family protein [Populus trichocarpa]
Length=229

 Score =   414 bits (1065),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   303 bits (777),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 153/153 (100%), Gaps = 0/153 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  516
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGI  229



>dbj|BAC57955.1| polyubiquitin [Aster tripolium]
Length=229

 Score =   414 bits (1065),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   304 bits (778),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 153/153 (100%), Gaps = 0/153 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  516
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGL  229



>ref|XP_004968120.1| PREDICTED: polyubiquitin-like [Setaria italica]
 ref|XP_009404996.1| PREDICTED: polyubiquitin 11 [Musa acuminata subsp. malaccensis]
 gb|ABS18744.1| ubiqutin ligase-like protein [Oryza sativa Japonica Group]
 dbj|BAJ88219.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=229

 Score =   414 bits (1065),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   303 bits (776),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  513
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>ref|XP_006370634.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 gb|ERP67203.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
Length=261

 Score =   416 bits (1068),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   350 bits (899),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 177/177 (100%), Positives = 177/177 (100%), Gaps = 0/177 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDN  588
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDN
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDN  253



>ref|XP_002438839.1| hypothetical protein SORBIDRAFT_10g027030 [Sorghum bicolor]
 gb|EER90206.1| hypothetical protein SORBIDRAFT_10g027030 [Sorghum bicolor]
Length=229

 Score =   414 bits (1065),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   301 bits (772),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 151/152 (99%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  513
            FAGKQLEDGRTLADYNIQK+STLHLVLRLRGG
Sbjct  197  FAGKQLEDGRTLADYNIQKDSTLHLVLRLRGG  228



>gb|EYU33610.1| hypothetical protein MIMGU_mgv1a004315mg [Erythranthe guttata]
Length=229

 Score =   414 bits (1065),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   303 bits (777),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 153/153 (100%), Gaps = 0/153 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  516
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGV  229



>ref|XP_003570150.1| PREDICTED: polyubiquitin 11 isoform X2 [Brachypodium distachyon]
Length=241

 Score =   415 bits (1066),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   303 bits (777),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  513
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>ref|XP_010490793.1| PREDICTED: polyubiquitin 11-like [Camelina sativa]
Length=230

 Score =   414 bits (1065),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   303 bits (776),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  513
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>gb|ACJ85618.1| unknown [Medicago truncatula]
Length=229

 Score =   414 bits (1065),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   303 bits (775),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  513
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>ref|NP_567286.1| ubiquitin 11 [Arabidopsis thaliana]
 ref|NP_849291.1| polyubiquitin 14 [Arabidopsis thaliana]
 ref|NP_001031585.1| ubiquitin 11 [Arabidopsis thaliana]
 ref|NP_567247.2| polyubiquitin 14 [Arabidopsis thaliana]
 ref|NP_001118936.1| ubiquitin 11 [Arabidopsis thaliana]
 ref|XP_002305607.1| hypothetical protein POPTR_0004s02080g [Populus trichocarpa]
 ref|XP_006370636.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 ref|XP_007157173.1| hypothetical protein PHAVU_002G048800g [Phaseolus vulgaris]
 ref|XP_007211604.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 ref|XP_007211605.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 ref|XP_007211608.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 ref|XP_008349294.1| PREDICTED: polyubiquitin 11 [Malus domestica]
 ref|XP_010437606.1| PREDICTED: polyubiquitin 11 isoform X1 [Camelina sativa]
 ref|XP_010437607.1| PREDICTED: polyubiquitin 11 isoform X2 [Camelina sativa]
 ref|XP_010491428.1| PREDICTED: polyubiquitin 11 [Camelina sativa]
 sp|P0CH33.1|UBQ11_ARATH RecName: Full=Polyubiquitin 11; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAD48980.1|AF162444_12 contains similarity to Pfam family PF00240 - Ubiquitin family; 
score=526.5, E=1.9e-154, N=3 [Arabidopsis thaliana]
 emb|CAA10056.1| polyubiquitin [Vicia faba]
 emb|CAB81047.1| AT4g05050 [Arabidopsis thaliana]
 emb|CAC27335.1| putative polyubiquitin [Picea abies]
 gb|AAK96565.1| AT4g05050/T32N4_13 [Arabidopsis thaliana]
 gb|AAL06940.1| AT4g05050/T32N4_13 [Arabidopsis thaliana]
 gb|AAL09770.1| AT4g05050/T32N4_13 [Arabidopsis thaliana]
 gb|AAM19968.1| AT4g05050/T32N4_13 [Arabidopsis thaliana]
 gb|AAN65052.1| Unknown protein [Arabidopsis thaliana]
 gb|AAV92464.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92465.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92466.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92467.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92468.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92469.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92470.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92471.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92472.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92473.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92474.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92475.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92476.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92477.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92478.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92479.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92480.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92481.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92482.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92483.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92484.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92485.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92486.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92487.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92488.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92489.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92490.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 dbj|BAE98552.1| hypothetical protein [Arabidopsis thaliana]
 gb|EEE86118.1| hypothetical protein POPTR_0004s02080g [Populus trichocarpa]
 gb|AEE82244.1| polyubiquitin 14 [Arabidopsis thaliana]
 gb|AEE82245.1| polyubiquitin 14 [Arabidopsis thaliana]
 gb|AEE82468.1| ubiquitin 11 [Arabidopsis thaliana]
 gb|AEE82469.1| ubiquitin 11 [Arabidopsis thaliana]
 gb|AEE82470.1| ubiquitin 11 [Arabidopsis thaliana]
 gb|AFP43343.1| polyubiquitin [Arabidopsis thaliana]
 gb|EMJ12803.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 gb|EMJ12804.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 gb|EMJ12807.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 gb|AGV54265.1| ubiquitin 11 [Phaseolus vulgaris]
 gb|ERP67205.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 gb|ESW29167.1| hypothetical protein PHAVU_002G048800g [Phaseolus vulgaris]
 gb|AES82698.2| polyubiquitin 3 [Medicago truncatula]
 gb|AJA29686.1| polyubiquitin Ubi4 [Betula luminifera]
 gb|KJB67136.1| hypothetical protein B456_010G177000 [Gossypium raimondii]
 gb|KJB69250.1| hypothetical protein B456_011G016600 [Gossypium raimondii]
 gb|KJB69251.1| hypothetical protein B456_011G016600 [Gossypium raimondii]
 gb|KJB69252.1| hypothetical protein B456_011G016600 [Gossypium raimondii]
Length=229

 Score =   414 bits (1065),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   303 bits (776),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  516
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  229



>ref|XP_010235843.1| PREDICTED: polyubiquitin 11 isoform X1 [Brachypodium distachyon]
Length=265

 Score =   416 bits (1068),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  25   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  84

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  85   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  144

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  145  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  204

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  205  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  238


 Score =   304 bits (778),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  101  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  160

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  161  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  220

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  513
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  221  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  252


 Score =   268 bits (684),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 136/144 (94%), Positives = 136/144 (94%), Gaps = 0/144 (0%)
 Frame = +1

Query  268  LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  447
            L  R  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  19   LECRKMMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  78

Query  448  TLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  627
            TLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP
Sbjct  79   TLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  138

Query  628  XQQXLIFAGKQLEDGRTLPDYXIQ  699
             QQ LIFAGKQLEDGRTL DY IQ
Sbjct  139  DQQRLIFAGKQLEDGRTLADYNIQ  162



>ref|XP_006288299.1| hypothetical protein CARUB_v10001544mg [Capsella rubella]
 gb|EOA21197.1| hypothetical protein CARUB_v10001544mg [Capsella rubella]
Length=230

 Score =   414 bits (1065),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   303 bits (775),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  513
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>gb|AAP31578.1| ubiquitin [Hevea brasiliensis]
Length=230

 Score =   414 bits (1065),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   303 bits (775),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  513
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>gb|ACD31680.1| ubiquitin [Gossypium hirsutum]
Length=305

 Score =   417 bits (1072),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 211/214 (99%), Positives = 211/214 (99%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTLPDY IQ
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLPDYNIQ  290


 Score =   412 bits (1059),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 209/214 (98%), Positives = 209/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   301 bits (770),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  516
            FAGKQLEDGRTL DYNIQKESTLHLVLRLRGG 
Sbjct  273  FAGKQLEDGRTLPDYNIQKESTLHLVLRLRGGF  305



>gb|KDO51109.1| hypothetical protein CISIN_1g026973mg [Citrus sinensis]
Length=230

 Score =   414 bits (1064),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   303 bits (775),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  513
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>emb|CBI22349.3| unnamed protein product [Vitis vinifera]
Length=298

 Score =   417 bits (1071),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 211/216 (98%), Positives = 211/216 (98%), Gaps = 0/216 (0%)
 Frame = +1

Query  52   LKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  231
             KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  26   FKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  85

Query  232  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  411
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  86   YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  145

Query  412  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV  591
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV
Sbjct  146  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV  205

Query  592  KAKIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KAKIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  206  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  241


 Score =   369 bits (946),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 187/188 (99%), Positives = 188/188 (100%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  104  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  163

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  164  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  223

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  224  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  283

Query  598  KIQDKEGI  621
            KIQDKEG+
Sbjct  284  KIQDKEGM  291



>ref|XP_006428779.1| hypothetical protein CICLE_v10012654mg [Citrus clementina]
 ref|XP_006594132.1| PREDICTED: polyubiquitin-like [Glycine max]
 gb|ESR42019.1| hypothetical protein CICLE_v10012654mg [Citrus clementina]
 gb|KDO45140.1| hypothetical protein CISIN_1g0269401mg [Citrus sinensis]
 gb|KDO45141.1| hypothetical protein CISIN_1g0269401mg [Citrus sinensis]
 gb|KHN48309.1| Polyubiquitin [Glycine soja]
Length=230

 Score =   414 bits (1064),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   303 bits (775),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  513
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>gb|AGV54749.1| ubiquitin 11 [Phaseolus vulgaris]
Length=269

 Score =   416 bits (1068),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 211/216 (98%), Positives = 211/216 (98%), Gaps = 0/216 (0%)
 Frame = +1

Query  52   LKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  231
             KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  39   FKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  98

Query  232  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  411
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  99   YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  158

Query  412  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV  591
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV
Sbjct  159  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV  218

Query  592  KAKIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KAKIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  219  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  254


 Score =   303 bits (775),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  117  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  176

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  177  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  236

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  516
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  237  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  269



>ref|XP_003590494.1| Ubiquitin [Medicago truncatula]
Length=312

 Score =   417 bits (1072),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   305 bits (780),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  513
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>gb|KDO51955.1| hypothetical protein CISIN_1g026932mg [Citrus sinensis]
 gb|KDO51956.1| hypothetical protein CISIN_1g026932mg [Citrus sinensis]
Length=230

 Score =   414 bits (1064),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   303 bits (775),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  513
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>gb|AAO43307.1| putative polyubiquitin [Arabidopsis thaliana]
Length=250

 Score =   415 bits (1066),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  21   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  80

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  81   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  140

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  141  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  200

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  201  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  234


 Score =   306 bits (784),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 154/158 (97%), Positives = 154/158 (97%), Gaps = 0/158 (0%)
 Frame = +1

Query  226  ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ  405
            ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ
Sbjct  1    ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ  60

Query  406  QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTID  585
            QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTID
Sbjct  61   QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTID  120

Query  586  NVKAKIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            NVKAKIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  121  NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  158


 Score =   303 bits (776),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  97   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  156

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  157  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  216

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  513
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  217  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  248



>emb|CAH59739.1| polyubiquitin [Plantago major]
Length=232

 Score =   414 bits (1063),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   304 bits (778),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 153/156 (98%), Positives = 154/156 (99%), Gaps = 0/156 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  525
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+  F
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGLTGF  232



>gb|AFK41706.1| unknown [Medicago truncatula]
 gb|AES60745.2| pentameric polyubiquitin [Medicago truncatula]
Length=233

 Score =   414 bits (1063),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   302 bits (774),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  513
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>gb|KJB62484.1| hypothetical protein B456_009G418900 [Gossypium raimondii]
Length=229

 Score =   413 bits (1062),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 209/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   303 bits (776),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  513
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>ref|XP_003627152.1| Ubiquitin [Medicago truncatula]
 gb|KEH18411.1| polyubiquitin 3 [Medicago truncatula]
Length=270

 Score =   414 bits (1065),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   333 bits (853),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 177/214 (83%), Positives = 177/214 (83%), Gaps = 35/214 (16%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTIT              
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTIT--------------  242

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
                                 LEDGRTL DY IQ
Sbjct  243  ---------------------LEDGRTLADYNIQ  255


 Score =   134 bits (337),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 76/118 (64%), Positives = 76/118 (64%), Gaps = 41/118 (35%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQK-----------------------------------------ESTLHLVLRLRGGM  288
            IQK                                         ESTLHLVLRLRGG 
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEDGRTLADYNIQKESTLHLVLRLRGGF  270



>gb|ACJ85643.1| unknown [Medicago truncatula]
Length=229

 Score =   413 bits (1061),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 209/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQ+KEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQNKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   303 bits (776),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  516
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  229



>ref|XP_006377830.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 gb|ERP55627.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
Length=297

 Score =   415 bits (1067),  Expect = 5e-143, Method: Compositional matrix adjust.
 Identities = 211/221 (95%), Positives = 212/221 (96%), Gaps = 0/221 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQXIHPPLW  720
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ  +  L 
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKENANLC  297


 Score =   415 bits (1066),  Expect = 7e-143, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214



>ref|XP_007512209.1| polyubiquitin [Bathycoccus prasinos]
 emb|CCO66297.1| polyubiquitin [Bathycoccus prasinos]
Length=359

 Score =   418 bits (1074),  Expect = 5e-143, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  128  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  187

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  188  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  247

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  248  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  307

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  308  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  341


 Score =   394 bits (1012),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 210/265 (79%), Positives = 210/265 (79%), Gaps = 51/265 (19%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEG-------------------------  162
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEG                         
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGTFRVKSRRLKFCLLALLDSATTIES  60

Query  163  --------------------------IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  264
                                      IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  61   SLALRSKKSSERREREKESALSRARGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  120

Query  265  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  444
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  121  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  180

Query  445  RTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  624
            RTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP
Sbjct  181  RTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  240

Query  625  PXQQXLIFAGKQLEDGRTLPDYXIQ  699
            P QQ LIFAGKQLEDGRTL DY IQ
Sbjct  241  PDQQRLIFAGKQLEDGRTLADYNIQ  265


 Score =   305 bits (781),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  204  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  263

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  264  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  323

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  513
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  324  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  355



>ref|NP_001147027.1| polyubiquitin containing 7 ubiquitin monomers [Zea mays]
 gb|ACG25128.1| polyubiquitin containing 7 ubiquitin monomers [Zea mays]
Length=311

 Score =   416 bits (1069),  Expect = 5e-143, Method: Compositional matrix adjust.
 Identities = 211/215 (98%), Positives = 211/215 (98%), Gaps = 0/215 (0%)
 Frame = +1

Query  55   KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  234
            KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  82   KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  141

Query  235  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  414
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  142  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  201

Query  415  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  594
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  202  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  261

Query  595  AKIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            AKIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  262  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  296


 Score =   360 bits (924),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 190/220 (86%), Positives = 193/220 (88%), Gaps = 6/220 (3%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL----  225
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR L    
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRNLIFSP  60

Query  226  --ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  399
               + +  +          R  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP
Sbjct  61   FARNAHTARSPISDPRSPRRSKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  120

Query  400  DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDT  579
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDT
Sbjct  121  DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDT  180

Query  580  IDNVKAKIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            IDNVKAKIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  IDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  220


 Score =   303 bits (776),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  159  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  218

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  219  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  278

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  513
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  279  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  310



>gb|AES89865.2| polyubiquitin 3 [Medicago truncatula]
Length=278

 Score =   414 bits (1065),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   332 bits (852),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 168/168 (100%), Positives = 168/168 (100%), Gaps = 0/168 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE  561
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE  244



>ref|XP_008784557.1| PREDICTED: LOW QUALITY PROTEIN: polyubiquitin 11-like [Phoenix 
dactylifera]
Length=229

 Score =   412 bits (1060),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 209/214 (98%), Positives = 209/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLV RLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVXRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   303 bits (776),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  513
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>gb|ABY60454.1| putative polyubiquitin [Adonis aestivalis var. palaestina]
Length=281

 Score =   414 bits (1065),  Expect = 7e-143, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  12   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  71

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  72   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  131

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  132  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  191

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  192  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  225


 Score =   379 bits (973),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 192/193 (99%), Positives = 192/193 (99%), Gaps = 0/193 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  88   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  147

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  148  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  207

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  208  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  267

Query  598  KIQDKEGIPPXQQ  636
            KIQDKEGIPP QQ
Sbjct  268  KIQDKEGIPPDQQ  280


 Score =   287 bits (735),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 145/149 (97%), Positives = 145/149 (97%), Gaps = 0/149 (0%)
 Frame = +1

Query  253  TLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQ  432
            TLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQ
Sbjct  1    TLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQ  60

Query  433  LEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  612
            LEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK
Sbjct  61   LEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  120

Query  613  EGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            EGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  121  EGIPPDQQRLIFAGKQLEDGRTLADYNIQ  149


 Score =   234 bits (598),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 118/118 (100%), Positives = 118/118 (100%), Gaps = 0/118 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  164  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  223

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  411
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  224  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  281



>ref|XP_006428822.1| hypothetical protein CICLE_v10012652mg [Citrus clementina]
 ref|XP_006480632.1| PREDICTED: polyubiquitin 4-like [Citrus sinensis]
 ref|XP_006480634.1| PREDICTED: polyubiquitin 4-like [Citrus sinensis]
 gb|ESR42062.1| hypothetical protein CICLE_v10012652mg [Citrus clementina]
Length=230

 Score =   412 bits (1060),  Expect = 7e-143, Method: Compositional matrix adjust.
 Identities = 209/214 (98%), Positives = 209/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGR L DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRNLADYNIQ  214


 Score =   301 bits (771),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 151/152 (99%), Positives = 151/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  513
            FAGKQLEDGR LADYNIQKESTLHLVLRLRGG
Sbjct  197  FAGKQLEDGRNLADYNIQKESTLHLVLRLRGG  228



>gb|EJU04700.1| polyubiquitin UbiD/Ubi4 [Dacryopinax sp. DJM-731 SS1]
Length=229

 Score =   412 bits (1060),  Expect = 7e-143, Method: Compositional matrix adjust.
 Identities = 208/214 (97%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ  214


 Score =   301 bits (770),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  513
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  228



>gb|KDP38838.1| hypothetical protein JCGZ_04995 [Jatropha curcas]
Length=308

 Score =   415 bits (1067),  Expect = 8e-143, Method: Compositional matrix adjust.
 Identities = 214/232 (92%), Positives = 215/232 (93%), Gaps = 3/232 (1%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ---XIHPPLWFSV*GXAC  744
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ    +H  L     G  C
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGGDYC  308


 Score =   414 bits (1064),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214



>gb|KIM78989.1| hypothetical protein PILCRDRAFT_573034 [Piloderma croceum F 1598]
Length=229

 Score =   412 bits (1059),  Expect = 8e-143, Method: Compositional matrix adjust.
 Identities = 208/214 (97%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ  214


 Score =   301 bits (770),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  513
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  228



>ref|XP_003574865.1| PREDICTED: polyubiquitin-like [Brachypodium distachyon]
Length=341

 Score =   416 bits (1070),  Expect = 8e-143, Method: Compositional matrix adjust.
 Identities = 211/215 (98%), Positives = 211/215 (98%), Gaps = 0/215 (0%)
 Frame = +1

Query  55   KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  234
            KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  36   KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  95

Query  235  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  414
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  96   NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  155

Query  415  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  594
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  156  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  215

Query  595  AKIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            AKIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  216  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  250


 Score =   415 bits (1066),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  113  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  172

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  173  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  232

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  233  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  292

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  293  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  326


 Score =   303 bits (777),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  189  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  248

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  249  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  308

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  513
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  309  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  340



>gb|KIM78981.1| hypothetical protein PILCRDRAFT_10644 [Piloderma croceum F 1598]
Length=229

 Score =   412 bits (1059),  Expect = 9e-143, Method: Compositional matrix adjust.
 Identities = 208/214 (97%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ  214


 Score =   301 bits (770),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 153/153 (100%), Gaps = 0/153 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  516
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG+
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGV  229



>gb|AAQ84316.1| fiber polyubiquitin [Gossypium barbadense]
Length=229

 Score =   412 bits (1059),  Expect = 9e-143, Method: Compositional matrix adjust.
 Identities = 209/214 (98%), Positives = 209/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   299 bits (765),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  516
            FAGKQLEDGRTLADYNIQKESTL LVLRLRGG 
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLPLVLRLRGGF  229



>gb|KJA26171.1| hypothetical protein HYPSUDRAFT_354705 [Hypholoma sublateritium 
FD-334 SS-4]
Length=229

 Score =   412 bits (1059),  Expect = 9e-143, Method: Compositional matrix adjust.
 Identities = 208/214 (97%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ  214


 Score =   300 bits (769),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  513
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  228



>ref|XP_011110054.1| hypothetical protein H072_4094 [Dactylellina haptotyla CBS 200.50]
 gb|EPS41950.1| hypothetical protein H072_4094 [Dactylellina haptotyla CBS 200.50]
Length=229

 Score =   412 bits (1059),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 208/214 (97%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ  214


 Score =   300 bits (769),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  513
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  228



>gb|AFK43392.1| unknown [Medicago truncatula]
Length=233

 Score =   412 bits (1059),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 209/214 (98%), Positives = 209/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDN KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNAKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   302 bits (774),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  513
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>ref|XP_009114489.1| PREDICTED: polyubiquitin-like [Brassica rapa]
Length=305

 Score =   415 bits (1066),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  290


 Score =   411 bits (1056),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 209/214 (98%), Positives = 209/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP DQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPQDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   303 bits (777),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  516
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  305



>gb|KJB81824.1| hypothetical protein B456_013G163500 [Gossypium raimondii]
Length=393

 Score =   418 bits (1075),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 212/223 (95%), Positives = 214/223 (96%), Gaps = 0/223 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQXIHPPLWFS  726
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ  +P   +S
Sbjct  333  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKENPLCTWS  375


 Score =   415 bits (1066),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  290


 Score =   413 bits (1061),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 209/214 (98%), Positives = 209/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214



>emb|CDP08567.1| unnamed protein product [Coffea canephora]
Length=364

 Score =   417 bits (1072),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 211/215 (98%), Positives = 211/215 (98%), Gaps = 0/215 (0%)
 Frame = +1

Query  55   KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  234
            KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  53   KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  112

Query  235  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  414
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  113  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  172

Query  415  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  594
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  173  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  232

Query  595  AKIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            AKIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  233  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  267


 Score =   414 bits (1063),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 209/213 (98%), Positives = 209/213 (98%), Gaps = 0/213 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  130  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  189

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  190  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  249

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  250  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  309

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXI  696
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY I
Sbjct  310  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNI  342



>dbj|BAJ85978.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ91581.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=305

 Score =   415 bits (1066),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  290


 Score =   414 bits (1063),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 209/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   303 bits (776),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  513
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>ref|XP_002456845.1| hypothetical protein SORBIDRAFT_03g043940 [Sorghum bicolor]
 ref|XP_002453347.1| hypothetical protein SORBIDRAFT_04g004280 [Sorghum bicolor]
 ref|XP_003574869.1| PREDICTED: polyubiquitin [Brachypodium distachyon]
 ref|XP_007695807.1| hypothetical protein COCSADRAFT_108224 [Bipolaris sorokiniana 
ND90Pr]
 ref|XP_009412665.1| PREDICTED: polyubiquitin isoform X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009412666.1| PREDICTED: polyubiquitin isoform X2 [Musa acuminata subsp. malaccensis]
 ref|XP_010227192.1| PREDICTED: polyubiquitin isoform X2 [Brachypodium distachyon]
 sp|P69309.2|UBIQP_AVEFA RecName: Full=Polyubiquitin; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor [Avena fatua]
 pir||S28426 polyubiquitin 4 - wild oat
 emb|CAA49200.1| tetraubiquitin [Avena fatua]
 gb|AAC37466.1| polyubiquitin [Saccharum hybrid cultivar H65-7052]
 gb|AAM28291.1| tetrameric ubiquitin [Ananas comosus]
 gb|EES01965.1| hypothetical protein SORBIDRAFT_03g043940 [Sorghum bicolor]
 gb|EES06323.1| hypothetical protein SORBIDRAFT_04g004280 [Sorghum bicolor]
 gb|AEE65379.1| ubiquitin 1 [Panicum virgatum]
 gb|EMD68114.1| hypothetical protein COCSADRAFT_108224 [Bipolaris sorokiniana 
ND90Pr]
 gb|EMD93446.1| hypothetical protein COCHEDRAFT_1202381 [Bipolaris maydis C5]
 gb|EMS58836.1| Polyubiquitin [Triticum urartu]
 gb|ENI07106.1| hypothetical protein COCC4DRAFT_70576 [Bipolaris maydis ATCC 
48331]
 gb|AGT16802.1| polyubiquitin-like protein [Saccharum hybrid cultivar R570]
 gb|EUN28034.1| hypothetical protein COCVIDRAFT_96666 [Bipolaris victoriae FI3]
Length=305

 Score =   415 bits (1066),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   415 bits (1066),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  290


 Score =   303 bits (776),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  513
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>ref|XP_006654612.1| PREDICTED: polyubiquitin-like [Oryza brachyantha]
Length=305

 Score =   415 bits (1066),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   413 bits (1062),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 209/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQL+DGRTL DY IQ
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLDDGRTLADYNIQ  290


 Score =   301 bits (772),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 151/152 (99%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  513
            FAGKQL+DGRTLADYNIQKESTLHLVLRLRGG
Sbjct  273  FAGKQLDDGRTLADYNIQKESTLHLVLRLRGG  304



>emb|CAA40323.1| polyubiquitin protein [Helianthus annuus]
Length=334

 Score =   416 bits (1069),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   416 bits (1069),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  290


 Score =   359 bits (921),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 182/182 (100%), Positives = 182/182 (100%), Gaps = 0/182 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  598  KI  603
            KI
Sbjct  333  KI  334



>ref|XP_007154495.1| hypothetical protein PHAVU_003G1236001g, partial [Phaseolus vulgaris]
 gb|ESW26489.1| hypothetical protein PHAVU_003G1236001g, partial [Phaseolus vulgaris]
Length=269

 Score =   413 bits (1062),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 209/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE+SDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVENSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   378 bits (970),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 191/193 (99%), Positives = 192/193 (99%), Gaps = 0/193 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE+SDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVENSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  598  KIQDKEGIPPXQQ  636
            KIQDKEGIPP QQ
Sbjct  257  KIQDKEGIPPDQQ  269



>ref|XP_011468094.1| PREDICTED: polyubiquitin [Fragaria vesca subsp. vesca]
Length=306

 Score =   415 bits (1066),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  290


 Score =   414 bits (1064),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 209/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDT+DNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTVDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   303 bits (776),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  513
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>emb|CAH59740.1| polyubiquitin [Plantago major]
Length=305

 Score =   414 bits (1065),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   414 bits (1065),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  290


 Score =   303 bits (776),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  516
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGC  305



>ref|XP_010258950.1| PREDICTED: polyubiquitin [Nelumbo nucifera]
Length=306

 Score =   415 bits (1066),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   415 bits (1066),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  290


 Score =   303 bits (777),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 153/153 (100%), Gaps = 0/153 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  516
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGI  305



>gb|AAM64530.1| ubiquitin homolog [Arabidopsis thaliana]
Length=229

 Score =   412 bits (1058),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 209/214 (98%), Positives = 209/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVL LRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLXLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   303 bits (776),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  516
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  229



>prf||1604470A poly-ubiquitin
Length=272

 Score =   413 bits (1062),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  44   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  103

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  104  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  163

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  164  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  223

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  224  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  257


 Score =   350 bits (899),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 176/180 (98%), Positives = 176/180 (98%), Gaps = 0/180 (0%)
 Frame = +1

Query  160  GIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE  339
            GIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE
Sbjct  2    GIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE  61

Query  340  SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQ  519
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQ
Sbjct  62   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQ  121

Query  520  IFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            IFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  122  IFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  181


 Score =   302 bits (773),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  120  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  179

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  180  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  239

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  513
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  240  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  271



>ref|XP_007014924.1| Polyubiquitin 3 [Theobroma cacao]
 gb|EOY32543.1| Polyubiquitin 3 [Theobroma cacao]
Length=305

 Score =   414 bits (1065),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   414 bits (1065),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  290


 Score =   303 bits (776),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  513
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>ref|XP_006428821.1| hypothetical protein CICLE_v10012292mg [Citrus clementina]
 ref|XP_006480633.1| PREDICTED: polyubiquitin-like [Citrus sinensis]
 gb|ESR42061.1| hypothetical protein CICLE_v10012292mg [Citrus clementina]
Length=306

 Score =   414 bits (1065),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   414 bits (1065),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  290


 Score =   303 bits (776),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  513
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>gb|AES89866.2| polyubiquitin 3 [Medicago truncatula]
Length=305

 Score =   414 bits (1065),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   414 bits (1065),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  290


 Score =   303 bits (776),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  513
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>gb|ABK94002.1| unknown [Populus trichocarpa]
Length=305

 Score =   414 bits (1065),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  290


 Score =   411 bits (1056),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 209/214 (98%), Positives = 209/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD N
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADNN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   303 bits (776),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  516
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  305



>gb|KDP39203.1| hypothetical protein JCGZ_00960 [Jatropha curcas]
Length=317

 Score =   415 bits (1066),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   415 bits (1066),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  290


 Score =   309 bits (792),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 155/156 (99%), Positives = 155/156 (99%), Gaps = 0/156 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  525
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI 
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIL  308



>emb|CDR41572.1| RHTO0S06e03070g1_1 [Rhodosporidium toruloides]
Length=230

 Score =   411 bits (1057),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 207/214 (97%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTL+DYN+QKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLSDYNVQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLQDYNIQ  214


 Score =   299 bits (766),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 149/152 (98%), Positives = 151/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            +QKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  VQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  513
            FAGKQLEDGRTL DYNIQKESTLHLVLRLRGG
Sbjct  197  FAGKQLEDGRTLQDYNIQKESTLHLVLRLRGG  228



>ref|NP_851029.1| polyubiquitin 3 [Arabidopsis thaliana]
 ref|NP_568112.2| polyubiquitin 3 [Arabidopsis thaliana]
 ref|NP_001031824.1| polyubiquitin 3 [Arabidopsis thaliana]
 ref|XP_006288303.1| hypothetical protein CARUB_v10001548mg [Capsella rubella]
 ref|XP_009122723.1| PREDICTED: polyubiquitin 3 [Brassica rapa]
 sp|Q1EC66.1|UBQ3_ARATH RecName: Full=Polyubiquitin 3; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor [Arabidopsis thaliana]
 emb|CAB86091.1| polyubiquitin (ubq3) [Arabidopsis thaliana]
 dbj|BAB08384.1| polyubiquitin [Arabidopsis thaliana]
 gb|AAO00780.1| polyubiquitin (UBQ3) [Arabidopsis thaliana]
 gb|ABF85770.1| At5g03240 [Arabidopsis thaliana]
 dbj|BAH19791.1| AT5G03240 [Arabidopsis thaliana]
 gb|AED90574.1| polyubiquitin 3 [Arabidopsis thaliana]
 gb|AED90575.1| polyubiquitin 3 [Arabidopsis thaliana]
 gb|AED90576.1| polyubiquitin 3 [Arabidopsis thaliana]
 gb|EOA21201.1| hypothetical protein CARUB_v10001548mg [Capsella rubella]
Length=306

 Score =   414 bits (1065),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   414 bits (1065),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  290


 Score =   303 bits (776),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  513
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>ref|XP_009112898.1| PREDICTED: polyubiquitin [Brassica rapa]
Length=305

 Score =   414 bits (1065),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   414 bits (1065),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  290


 Score =   303 bits (777),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 153/153 (100%), Gaps = 0/153 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  516
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGI  305



>ref|NP_849292.1| polyubiquitin 14 [Arabidopsis thaliana]
 ref|NP_001118922.1| polyubiquitin 14 [Arabidopsis thaliana]
 ref|NP_974516.4| polyubiquitin 10 [Arabidopsis thaliana]
 ref|XP_002316978.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 ref|XP_002874829.1| hypothetical protein ARALYDRAFT_490155 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_004146845.1| PREDICTED: polyubiquitin-like [Cucumis sativus]
 ref|XP_004165599.1| PREDICTED: polyubiquitin-like [Cucumis sativus]
 ref|XP_004293260.1| PREDICTED: polyubiquitin [Fragaria vesca subsp. vesca]
 ref|XP_006383941.1| hypothetical protein POPTR_0004s02080g [Populus trichocarpa]
 ref|XP_006377831.1| polyubiquitin family protein [Populus trichocarpa]
 ref|XP_006377832.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 ref|XP_006377833.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 ref|XP_006372945.1| hypothetical protein POPTR_0017s06450g [Populus trichocarpa]
 ref|XP_006396614.1| hypothetical protein EUTSA_v10028728mg [Eutrema salsugineum]
 ref|XP_006396615.1| hypothetical protein EUTSA_v10028728mg [Eutrema salsugineum]
 ref|XP_006589609.1| PREDICTED: polyubiquitin [Glycine max]
 ref|XP_006593990.1| PREDICTED: polyubiquitin 10-like isoform X2 [Glycine max]
 ref|XP_006606032.1| PREDICTED: polyubiquitin [Glycine max]
 ref|XP_007211603.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 ref|XP_008454542.1| PREDICTED: polyubiquitin [Cucumis melo]
 ref|XP_009134330.1| PREDICTED: polyubiquitin [Brassica rapa]
 ref|XP_010422419.1| PREDICTED: polyubiquitin [Camelina sativa]
 ref|XP_011007895.1| PREDICTED: polyubiquitin [Populus euphratica]
 ref|XP_011010177.1| PREDICTED: polyubiquitin [Populus euphratica]
 sp|P69325.2|UBIQP_SOYBN RecName: Full=Polyubiquitin; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor [Glycine max]
 sp|Q3E7T8.2|UBQ14_ARATH RecName: Full=Polyubiquitin 14; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor [Arabidopsis thaliana]
 pir||S49332 polyubiquitin 4 - common sunflower
 pir||G85036 polyubiquitin [imported] - Arabidopsis thaliana
 dbj|BAA03764.1| ubiquitin [Glycine max]
 dbj|BAA05670.1| ubiquitin [Glycine max]
 emb|CAA84440.1| seed tetraubiquitin [Helianthus annuus]
 dbj|BAA05085.1| Ubiquitin [Glycine max]
 gb|AAD15340.1| putative polyubiquitin [Arabidopsis thaliana]
 emb|CAB77774.1| polyubiquitin [Arabidopsis thaliana]
 gb|AAM65295.1| polyubiquitin (UBQ14) [Arabidopsis thaliana]
 emb|CAH59738.1| polyubiquitin [Plantago major]
 dbj|BAH19554.1| AT4G02890 [Arabidopsis thaliana]
 gb|EEE97590.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 gb|EFH51088.1| hypothetical protein ARALYDRAFT_490155 [Arabidopsis lyrata subsp. 
lyrata]
 gb|AEE82246.1| polyubiquitin 14 [Arabidopsis thaliana]
 gb|AEE82247.1| polyubiquitin 14 [Arabidopsis thaliana]
 gb|AEE82503.1| polyubiquitin 10 [Arabidopsis thaliana]
 gb|AFP43341.1| polyubiquitin [Arabidopsis thaliana]
 gb|EMJ12802.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 gb|ERP50742.1| hypothetical protein POPTR_0017s06450g [Populus trichocarpa]
 gb|ERP55628.1| polyubiquitin family protein [Populus trichocarpa]
 gb|ERP55629.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 gb|ERP55630.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 gb|ERP61738.1| hypothetical protein POPTR_0004s02080g [Populus trichocarpa]
 gb|ESQ38067.1| hypothetical protein EUTSA_v10028728mg [Eutrema salsugineum]
 gb|ESQ38068.1| hypothetical protein EUTSA_v10028728mg [Eutrema salsugineum]
 dbj|BAO57270.1| ubiquitin 10 [Ipomoea nil]
 gb|KHN02680.1| Polyubiquitin [Glycine soja]
 gb|KHN15806.1| Polyubiquitin [Glycine soja]
 gb|KJB13594.1| hypothetical protein B456_002G083100 [Gossypium raimondii]
 gb|KJB69249.1| hypothetical protein B456_011G016600 [Gossypium raimondii]
 prf||2111434A tetraubiquitin
Length=305

 Score =   414 bits (1065),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   414 bits (1065),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  290


 Score =   303 bits (776),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  516
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  305



>ref|XP_006396611.1| hypothetical protein EUTSA_v10028730mg [Eutrema salsugineum]
 gb|AAL27563.1|AF429429_1 polyubiquitin OUB1 [Olea europaea]
 gb|ESQ38064.1| hypothetical protein EUTSA_v10028730mg [Eutrema salsugineum]
Length=305

 Score =   414 bits (1065),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   414 bits (1065),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  290


 Score =   304 bits (778),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 153/153 (100%), Gaps = 0/153 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  516
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGL  305



>ref|XP_006480631.1| PREDICTED: polyubiquitin-like [Citrus sinensis]
Length=306

 Score =   414 bits (1065),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   414 bits (1065),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  290


 Score =   303 bits (776),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  513
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>ref|XP_007205620.1| hypothetical protein PRUPE_ppa009116mg [Prunus persica]
 ref|XP_007205621.1| hypothetical protein PRUPE_ppa009116mg [Prunus persica]
 gb|EMJ06819.1| hypothetical protein PRUPE_ppa009116mg [Prunus persica]
 gb|EMJ06820.1| hypothetical protein PRUPE_ppa009116mg [Prunus persica]
Length=306

 Score =   414 bits (1065),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  290


 Score =   414 bits (1064),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 209/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQ+FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQVFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   303 bits (775),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  513
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>ref|XP_006428820.1| hypothetical protein CICLE_v10012290mg [Citrus clementina]
 gb|ESR42060.1| hypothetical protein CICLE_v10012290mg [Citrus clementina]
Length=306

 Score =   414 bits (1065),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  290


 Score =   412 bits (1058),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 209/214 (98%), Positives = 209/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQ KEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQHKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   303 bits (775),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  513
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>gb|EYU33609.1| hypothetical protein MIMGU_mgv1a004315mg [Erythranthe guttata]
 gb|EYU33612.1| hypothetical protein MIMGU_mgv1a004315mg [Erythranthe guttata]
Length=305

 Score =   414 bits (1065),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   414 bits (1065),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  290


 Score =   303 bits (776),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 153/153 (100%), Gaps = 0/153 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  516
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGV  305



>ref|XP_002873083.1| hypothetical protein ARALYDRAFT_487095 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49342.1| hypothetical protein ARALYDRAFT_487095 [Arabidopsis lyrata subsp. 
lyrata]
Length=306

 Score =   414 bits (1065),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  290


 Score =   412 bits (1060),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 209/214 (98%), Positives = 209/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLTDYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   303 bits (775),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  513
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>gb|KJB81823.1| hypothetical protein B456_013G163500 [Gossypium raimondii]
Length=305

 Score =   414 bits (1065),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  290


 Score =   412 bits (1060),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 209/214 (98%), Positives = 209/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   303 bits (776),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  516
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  305



>ref|XP_006302387.1| hypothetical protein CARUB_v10020456mg [Capsella rubella]
 gb|EOA35285.1| hypothetical protein CARUB_v10020456mg [Capsella rubella]
Length=307

 Score =   414 bits (1065),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   414 bits (1065),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  290


 Score =   303 bits (775),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  513
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>gb|KIK28767.1| hypothetical protein PISMIDRAFT_672939, partial [Pisolithus microcarpus 
441]
Length=247

 Score =   412 bits (1059),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 208/214 (97%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  19   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  78

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  79   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  138

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  139  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  198

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  199  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ  232


 Score =   301 bits (771),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 153/153 (100%), Gaps = 0/153 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  95   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  154

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  155  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  516
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG+
Sbjct  215  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGL  247


 Score =   300 bits (769),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 151/156 (97%), Positives = 152/156 (97%), Gaps = 0/156 (0%)
 Frame = +1

Query  232  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  411
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  1    YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  60

Query  412  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV  591
            LIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV
Sbjct  61   LIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV  120

Query  592  KAKIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KAKIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  121  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ  156



>ref|XP_003537278.1| PREDICTED: polyubiquitin-like [Glycine max]
 ref|XP_010454744.1| PREDICTED: polyubiquitin 3 [Camelina sativa]
 gb|KHN39094.1| Polyubiquitin [Glycine soja]
Length=306

 Score =   414 bits (1064),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   414 bits (1064),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  290


 Score =   303 bits (775),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  513
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>emb|CDP08569.1| unnamed protein product [Coffea canephora]
Length=306

 Score =   414 bits (1064),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  290


 Score =   413 bits (1061),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 209/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   303 bits (776),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 153/153 (100%), Gaps = 0/153 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  516
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGI  305



>emb|CAA48140.1| ubiquitin [Antirrhinum majus]
Length=296

 Score =   414 bits (1063),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  68   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  127

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  128  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  187

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  188  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  247

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  248  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  281


 Score =   397 bits (1019),  Expect = 9e-136, Method: Compositional matrix adjust.
 Identities = 201/205 (98%), Positives = 201/205 (98%), Gaps = 0/205 (0%)
 Frame = +1

Query  85   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  264
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  1    GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  60

Query  265  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  444
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  61   VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  120

Query  445  RTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  624
            RTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP
Sbjct  121  RTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  180

Query  625  PXQQXLIFAGKQLEDGRTLPDYXIQ  699
            P QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  PDQQRLIFAGKQLEDGRTLADYNIQ  205


 Score =   303 bits (775),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  144  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  203

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  204  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  263

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  516
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  264  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  296



>gb|AFY06654.1| polyubiquitin, partial [Carica papaya]
Length=264

 Score =   412 bits (1060),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 209/214 (98%), Positives = 209/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  36   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  95

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  96   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  155

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  156  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  215

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  216  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  249


 Score =   304 bits (778),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 155/162 (96%), Positives = 155/162 (96%), Gaps = 0/162 (0%)
 Frame = +1

Query  214  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  393
            G TLADYNIQKESTL LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  12   GGTLADYNIQKESTLLLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  71

Query  394  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESS  573
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESS
Sbjct  72   PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESS  131

Query  574  DTIDNVKAKIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            DTIDNVK KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  132  DTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  173


 Score =   301 bits (771),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  112  MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  171

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  172  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  231

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  516
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  232  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  264



>gb|EPS72031.1| polyubiquitin, partial [Genlisea aurea]
Length=274

 Score =   413 bits (1061),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  46   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  105

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  106  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  165

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  166  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  225

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  226  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  259


 Score =   356 bits (913),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 179/183 (98%), Positives = 179/183 (98%), Gaps = 0/183 (0%)
 Frame = +1

Query  151  DKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITL  330
            DKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITL
Sbjct  1    DKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITL  60

Query  331  EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  510
            EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG
Sbjct  61   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  120

Query  511  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPXQQXLIFAGKQLEDGRTLPDY  690
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP QQ LIFAGKQLEDGRTL DY
Sbjct  121  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  180

Query  691  XIQ  699
             IQ
Sbjct  181  NIQ  183


 Score =   302 bits (773),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  122  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  181

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  182  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  241

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  516
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  242  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  274



>ref|XP_006685644.1| ubiquitin [Candida tenuis ATCC 10573]
 gb|EGV64838.1| ubiquitin [Candida tenuis ATCC 10573]
Length=229

 Score =   411 bits (1056),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 207/214 (97%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   301 bits (770),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  513
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>gb|ABD96088.1| polyubiquitin [Malus domestica]
Length=270

 Score =   412 bits (1060),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  42   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  101

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  102  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  161

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  162  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  221

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  222  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  255


 Score =   348 bits (892),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 175/179 (98%), Positives = 175/179 (98%), Gaps = 0/179 (0%)
 Frame = +1

Query  163  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  342
            IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES
Sbjct  1    IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  60

Query  343  SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  522
            SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI
Sbjct  61   SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  120

Query  523  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  121  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  179


 Score =   302 bits (773),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  118  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  177

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  178  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  237

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  516
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  238  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  270



>ref|XP_006428925.1| hypothetical protein CICLE_v10012291mg [Citrus clementina]
 gb|ESR42165.1| hypothetical protein CICLE_v10012291mg [Citrus clementina]
Length=306

 Score =   414 bits (1064),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   414 bits (1064),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  290


 Score =   303 bits (775),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  513
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>ref|XP_011077812.1| PREDICTED: polyubiquitin 3 [Sesamum indicum]
 ref|XP_011077813.1| PREDICTED: polyubiquitin 3 [Sesamum indicum]
Length=334

 Score =   415 bits (1066),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  29   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  88

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  89   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  148

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  149  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  208

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  209  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  242


 Score =   415 bits (1066),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  105  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  164

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  165  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  224

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  225  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  284

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  285  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  318


 Score =   303 bits (776),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  181  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  240

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  241  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  300

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  513
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  301  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  332


 Score =   295 bits (755),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 149/153 (97%), Positives = 149/153 (97%), Gaps = 0/153 (0%)
 Frame = +1

Query  241  QKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF  420
            QKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF
Sbjct  14   QKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF  73

Query  421  AGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAK  600
            AGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAK
Sbjct  74   AGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAK  133

Query  601  IQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            IQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  134  IQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  166



>gb|AFW66439.1| putative ubiquitin family protein [Zea mays]
Length=297

 Score =   414 bits (1063),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   391 bits (1005),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 202/214 (94%), Positives = 202/214 (94%), Gaps = 8/214 (4%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD       
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD-------  249

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
             IQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  250  -IQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  282


 Score =   280 bits (716),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 144/152 (95%), Positives = 144/152 (95%), Gaps = 8/152 (5%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD        IQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD--------IQDKEGIPPDQQRLI  264

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  513
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  265  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  296



>gb|KIK92093.1| hypothetical protein PAXRUDRAFT_830299, partial [Paxillus rubicundulus 
Ve08.2h10]
Length=229

 Score =   410 bits (1055),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 208/214 (97%), Positives = 209/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLLDYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ  214


 Score =   301 bits (770),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  516
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGC  229



>ref|XP_010227188.1| PREDICTED: polyubiquitin isoform X1 [Brachypodium distachyon]
Length=339

 Score =   415 bits (1066),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  35   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  94

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  95   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  154

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  155  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  214

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  215  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  248


 Score =   415 bits (1066),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  111  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  170

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  171  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  230

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  231  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  290

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  291  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  324


 Score =   303 bits (776),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  187  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  246

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  247  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  306

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  513
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  307  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  338


 Score =   272 bits (696),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 137/141 (97%), Positives = 137/141 (97%), Gaps = 0/141 (0%)
 Frame = +1

Query  277  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  456
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  32   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  91

Query  457  DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPXQQ  636
            DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP QQ
Sbjct  92   DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ  151

Query  637  XLIFAGKQLEDGRTLPDYXIQ  699
             LIFAGKQLEDGRTL DY IQ
Sbjct  152  RLIFAGKQLEDGRTLADYNIQ  172



>emb|CBY46745.1| polyubiquitin 10 protein, partial [Lepidium appelianum]
Length=308

 Score =   414 bits (1063),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  4    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  63

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  64   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  123

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  124  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  183

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  184  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  217


 Score =   414 bits (1063),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  80   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  139

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  140  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  200  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  259

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  260  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  293


 Score =   303 bits (775),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  156  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  215

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  216  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  275

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  516
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  276  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  308


 Score =   271 bits (694),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 137/141 (97%), Positives = 137/141 (97%), Gaps = 0/141 (0%)
 Frame = +1

Query  277  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  456
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  1    RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  60

Query  457  DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPXQQ  636
            DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP QQ
Sbjct  61   DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ  120

Query  637  XLIFAGKQLEDGRTLPDYXIQ  699
             LIFAGKQLEDGRTL DY IQ
Sbjct  121  RLIFAGKQLEDGRTLADYNIQ  141



>gb|AAB95250.1| ubiquitin [Arabidopsis thaliana]
Length=304

 Score =   414 bits (1063),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 209/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQ+ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQRESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   414 bits (1063),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 209/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQ+ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQRESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  290


 Score =   303 bits (776),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  513
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>gb|AAC35858.1| polyubiquitin [Capsicum chinense]
Length=265

 Score =   412 bits (1059),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 209/214 (98%), Positives = 209/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  37   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  96

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  97   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  156

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  157  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKT  216

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  217  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  250


 Score =   337 bits (863),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 170/174 (98%), Positives = 170/174 (98%), Gaps = 0/174 (0%)
 Frame = +1

Query  178  QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTID  357
            QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTID
Sbjct  1    QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTID  60

Query  358  NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTL  537
            NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTL
Sbjct  61   NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTL  120

Query  538  TGKTITLEVESSDTIDNVKAKIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            TGKTITLEVESSDTIDNVKAKIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  121  TGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  174


 Score =   301 bits (770),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  113  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  172

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  173  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  232

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  516
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  233  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  265



>gb|KJB14874.1| hypothetical protein B456_002G147600, partial [Gossypium raimondii]
Length=344

 Score =   415 bits (1066),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  42   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  101

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  102  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  161

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  162  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  221

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  222  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  255


 Score =   415 bits (1066),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  118  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  177

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  178  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  237

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  238  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  297

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  298  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  331


 Score =   328 bits (841),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 175/214 (82%), Positives = 175/214 (82%), Gaps = 35/214 (16%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLE                                   DGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLE-----------------------------------DGRTLADYN  25

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  26   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  85

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  86   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  145

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  146  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  179


 Score =   301 bits (770),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 151/151 (100%), Positives = 151/151 (100%), Gaps = 0/151 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  194  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  253

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  254  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  313

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRG  510
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRG
Sbjct  314  FAGKQLEDGRTLADYNIQKESTLHLVLRLRG  344



>gb|KIL68862.1| hypothetical protein M378DRAFT_157997 [Amanita muscaria Koide 
BX008]
Length=305

 Score =   413 bits (1062),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 209/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ  214


 Score =   413 bits (1062),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 209/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ  290


 Score =   301 bits (772),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 153/153 (100%), Gaps = 0/153 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  516
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG+
Sbjct  273  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGL  305



>gb|EGO00904.1| hypothetical protein SERLA73DRAFT_178893 [Serpula lacrymans var. 
lacrymans S7.3]
Length=312

 Score =   414 bits (1063),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 208/214 (97%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ  214


 Score =   414 bits (1063),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 208/214 (97%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ  290


 Score =   290 bits (741),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 144/147 (98%), Positives = 146/147 (99%), Gaps = 0/147 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVL  498
            FAGKQLEDGRTL+DYNIQKESTLHLV 
Sbjct  273  FAGKQLEDGRTLSDYNIQKESTLHLVF  299



>emb|CAA54603.1| pentameric polyubiquitin [Nicotiana tabacum]
Length=346

 Score =   415 bits (1066),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   415 bits (1066),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  290


 Score =   373 bits (958),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 189/189 (100%), Positives = 189/189 (100%), Gaps = 0/189 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  598  KIQDKEGIP  624
            KIQDKEGIP
Sbjct  333  KIQDKEGIP  341



>ref|XP_010938693.1| PREDICTED: polyubiquitin [Elaeis guineensis]
Length=307

 Score =   413 bits (1062),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 209/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIF+KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFIKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   411 bits (1057),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 208/214 (97%), Positives = 209/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIF+KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFIKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKT  256

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  290


 Score =   301 bits (770),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 151/152 (99%), Positives = 151/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  272

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  513
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>ref|XP_002872746.1| hypothetical protein ARALYDRAFT_911794 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_002872769.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49005.1| hypothetical protein ARALYDRAFT_911794 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49028.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=229

 Score =   410 bits (1054),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 209/214 (98%), Positives = 209/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIP  QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPLDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   299 bits (765),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP DQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPLDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  516
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  229



>gb|KJB62487.1| hypothetical protein B456_009G418900 [Gossypium raimondii]
Length=305

 Score =   413 bits (1062),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 209/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  290


 Score =   412 bits (1059),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 208/214 (97%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   303 bits (776),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  513
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>ref|XP_007154496.1| hypothetical protein PHAVU_003G1236001g [Phaseolus vulgaris]
 gb|ESW26490.1| hypothetical protein PHAVU_003G1236001g [Phaseolus vulgaris]
Length=305

 Score =   413 bits (1061),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 209/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE+SDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVENSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   413 bits (1061),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 209/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE+SDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVENSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  290


 Score =   302 bits (774),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 153/153 (100%), Gaps = 0/153 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVE+SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVENSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  516
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGL  305



>ref|XP_010453358.1| PREDICTED: polyubiquitin-like [Camelina sativa]
Length=305

 Score =   413 bits (1061),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 209/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES+DTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESTDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   413 bits (1061),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 209/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVES+DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESTDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  290


 Score =   303 bits (776),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  516
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  305



>emb|CCL99875.1| predicted protein [Fibroporia radiculosa]
Length=312

 Score =   413 bits (1062),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 208/214 (97%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  8    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  67

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  68   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  127

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  128  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  187

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  188  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ  221


 Score =   413 bits (1062),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 208/214 (97%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  84   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  143

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  144  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  203

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  204  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  263

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  264  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ  297


 Score =   302 bits (774),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 153/153 (100%), Gaps = 0/153 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  160  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  219

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  220  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  279

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  516
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG+
Sbjct  280  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGL  312



>sp|P69315.2|UBIQP_LINUS RecName: Full=Polyubiquitin; Contains: RecName: Full=Ubiquitin; 
Contains: RecName: Full=Ubiquitin-related; Flags: Precursor, 
partial [Linum usitatissimum]
 gb|AAA33401.1| ubiquitin, partial [Linum usitatissimum]
Length=305

 Score =   413 bits (1061),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 209/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIF+KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  42   MQIFLKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  101

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  102  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  161

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  162  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  221

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  222  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  255


 Score =   369 bits (947),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 188/188 (100%), Positives = 188/188 (100%), Gaps = 0/188 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  118  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  177

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  178  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  237

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  238  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  297

Query  598  KIQDKEGI  621
            KIQDKEGI
Sbjct  298  KIQDKEGI  305


 Score =   348 bits (892),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 174/179 (97%), Positives = 175/179 (98%), Gaps = 0/179 (0%)
 Frame = +1

Query  163  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  342
            IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF+KTLTGKTITLEVES
Sbjct  1    IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFLKTLTGKTITLEVES  60

Query  343  SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  522
            SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI
Sbjct  61   SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  120

Query  523  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  121  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  179



>ref|XP_007154493.1| hypothetical protein PHAVU_003G123500g [Phaseolus vulgaris]
 gb|ESW26487.1| hypothetical protein PHAVU_003G123500g [Phaseolus vulgaris]
Length=429

 Score =   417 bits (1073),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 212/216 (98%), Positives = 212/216 (98%), Gaps = 0/216 (0%)
 Frame = +1

Query  52   LKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  231
            LKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  47   LKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  106

Query  232  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  411
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  107  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  166

Query  412  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV  591
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV
Sbjct  167  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV  226

Query  592  KAKIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KAKIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  227  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  262


 Score =   414 bits (1064),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  125  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  185  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  244

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  245  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  304

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  305  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  338


 Score =   414 bits (1064),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  201  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  260

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  261  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  320

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  321  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  380

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  381  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  414


 Score =   303 bits (776),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  277  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  336

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  337  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  396

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  516
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  397  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  429



>ref|XP_006288300.1| hypothetical protein CARUB_v10001544mg [Capsella rubella]
 gb|EOA21198.1| hypothetical protein CARUB_v10001544mg [Capsella rubella]
Length=306

 Score =   413 bits (1061),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 209/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQ+KEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQEKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   413 bits (1061),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 209/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQ+KEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQEKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  290


 Score =   301 bits (771),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 151/152 (99%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQ+KEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQEKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  513
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>ref|XP_010240636.1| PREDICTED: polyubiquitin isoform X1 [Brachypodium distachyon]
 ref|XP_010240784.1| PREDICTED: polyubiquitin isoform X1 [Brachypodium distachyon]
Length=383

 Score =   416 bits (1068),  Expect = 8e-142, Method: Compositional matrix adjust.
 Identities = 210/216 (97%), Positives = 212/216 (98%), Gaps = 0/216 (0%)
 Frame = +1

Query  52   LKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  231
            ++MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  1    MQMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  60

Query  232  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  411
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  61   YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  120

Query  412  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV  591
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV
Sbjct  121  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV  180

Query  592  KAKIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KAKIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  216


 Score =   414 bits (1065),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  79   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  138

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  139  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  198

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  199  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  258

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  259  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  292


 Score =   414 bits (1065),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  155  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  214

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  215  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  274

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  275  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  334

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  335  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  368


 Score =   303 bits (776),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  231  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  290

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  291  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  350

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  513
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  351  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  382



>ref|XP_006287868.1| hypothetical protein CARUB_v10001095mg, partial [Capsella rubella]
 gb|EOA20766.1| hypothetical protein CARUB_v10001095mg, partial [Capsella rubella]
Length=407

 Score =   416 bits (1070),  Expect = 9e-142, Method: Compositional matrix adjust.
 Identities = 211/216 (98%), Positives = 211/216 (98%), Gaps = 0/216 (0%)
 Frame = +1

Query  52   LKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  231
             KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  24   FKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  83

Query  232  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  411
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  84   YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  143

Query  412  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV  591
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV
Sbjct  144  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV  203

Query  592  KAKIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KAKIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  204  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  239


 Score =   414 bits (1065),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  102  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  161

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  162  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  221

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  222  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  281

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  282  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  315


 Score =   414 bits (1065),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  178  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  297

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  298  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  357

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  358  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  391


 Score =   303 bits (776),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  254  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  313

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  314  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  373

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  513
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  374  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  405



>gb|EWZ40370.1| ubiquitin C [Fusarium oxysporum Fo47]
Length=229

 Score =   409 bits (1052),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 206/214 (96%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ  214


 Score =   299 bits (766),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 149/152 (98%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  513
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  228



>gb|AAB36545.1| ubiquitin-like protein [Phaseolus vulgaris]
Length=407

 Score =   416 bits (1069),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  103  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  162

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  163  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  222

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  223  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  282

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  283  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  316


 Score =   416 bits (1069),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  179  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  238

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  239  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  298

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  299  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  358

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  359  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  392


 Score =   325 bits (833),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 171/199 (86%), Positives = 177/199 (89%), Gaps = 3/199 (2%)
 Frame = +1

Query  103  EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  282
            +V  S  ++ V A++ D +      Q   FA KQLEDGRTLADYNIQKESTLHLVLRLRG
Sbjct  45   QVFVSHMVEGVDARLLDVQKGHKGAQ--CFA-KQLEDGRTLADYNIQKESTLHLVLRLRG  101

Query  283  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  462
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  102  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  161

Query  463  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPXQQXL  642
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP QQ L
Sbjct  162  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  221

Query  643  IFAGKQLEDGRTLPDYXIQ  699
            IFAGKQLEDGRTL DY IQ
Sbjct  222  IFAGKQLEDGRTLADYNIQ  240


 Score =   304 bits (779),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  255  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  314

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  315  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  374

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  516
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  375  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  407



>gb|KIM67150.1| hypothetical protein SCLCIDRAFT_1210637 [Scleroderma citrinum 
Foug A]
Length=305

 Score =   412 bits (1060),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 208/214 (97%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ  290


 Score =   409 bits (1050),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 207/214 (97%), Positives = 209/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQ KEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQVKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ  214


 Score =   301 bits (770),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  513
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  273  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  304



>gb|KIJ45725.1| hypothetical protein M422DRAFT_106821, partial [Sphaerobolus 
stellatus SS14]
Length=305

 Score =   412 bits (1060),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 208/214 (97%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ  214


 Score =   412 bits (1060),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 208/214 (97%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ  290


 Score =   303 bits (776),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 153/153 (100%), Gaps = 0/153 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  516
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGM
Sbjct  273  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  305



>ref|XP_003030030.1| polyubiquitin [Schizophyllum commune H4-8]
 ref|XP_006678580.1| polyubiquitin [Batrachochytrium dendrobatidis JAM81]
 ref|XP_007396817.1| hypothetical protein PHACADRAFT_257732 [Phanerochaete carnosa 
HHB-10118-sp]
 gb|AAB94630.1| polyubiquitin [Schizophyllum commune]
 gb|EFI95127.1| polyubiquitin [Schizophyllum commune H4-8]
 gb|EGF80702.1| polyubiquitin [Batrachochytrium dendrobatidis JAM81]
 gb|EKM54116.1| hypothetical protein PHACADRAFT_257732 [Phanerochaete carnosa 
HHB-10118-sp]
 gb|EPT04446.1| hypothetical protein FOMPIDRAFT_1021745 [Fomitopsis pinicola 
FP-58527 SS1]
 gb|KDQ24213.1| hypothetical protein PLEOSDRAFT_1058300 [Pleurotus ostreatus 
PC15]
 gb|KDQ28506.1| hypothetical protein PLEOSDRAFT_1089714 [Pleurotus ostreatus 
PC15]
 gb|KDQ53556.1| hypothetical protein JAAARDRAFT_72512 [Jaapia argillacea MUCL 
33604]
 gb|KIK09182.1| hypothetical protein K443DRAFT_671672 [Laccaria amethystina LaAM-08-1]
 gb|KIK44225.1| hypothetical protein CY34DRAFT_648259 [Suillus luteus UH-Slu-Lm8-n1]
 gb|KIM51102.1| hypothetical protein SCLCIDRAFT_144015 [Scleroderma citrinum 
Foug A]
 gb|KIN98337.1| hypothetical protein M404DRAFT_856969 [Pisolithus tinctorius 
Marx 270]
 gb|KIN98894.1| hypothetical protein M404DRAFT_966612 [Pisolithus tinctorius 
Marx 270]
Length=305

 Score =   412 bits (1059),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 208/214 (97%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ  214


 Score =   412 bits (1059),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 208/214 (97%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ  290


 Score =   301 bits (772),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 153/153 (100%), Gaps = 0/153 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  516
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG+
Sbjct  273  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGL  305



>gb|AIY27743.1| polyubiquitin Ubi10, partial [Betula luminifera]
Length=330

 Score =   413 bits (1062),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 208/214 (97%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  75   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  134

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFV+TLTGKTITLEVESSDT+DNVKAKIQDKEGIPPDQQRLI
Sbjct  135  IQKESTLHLVLRLRGGMQIFVRTLTGKTITLEVESSDTVDNVKAKIQDKEGIPPDQQRLI  194

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  195  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  254

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  255  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  288


 Score =   385 bits (990),  Expect = 9e-131, Method: Compositional matrix adjust.
 Identities = 199/214 (93%), Positives = 202/214 (94%), Gaps = 2/214 (1%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVK L  KTITLEV+    IDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVK-LYSKTITLEVKLRH-IDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  58

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLV RLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  59   IQKESTLHLVFRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  118

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFV+TLTGKTITLEVESSDT+DNVKA
Sbjct  119  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVRTLTGKTITLEVESSDTVDNVKA  178

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  179  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  212


 Score =   353 bits (906),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 178/180 (99%), Positives = 180/180 (100%), Gaps = 0/180 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFV+TLTGKTITLEVESSDT+DNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  151  MQIFVRTLTGKTITLEVESSDTVDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  210

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  211  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  270

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  271  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  330



>gb|KJB62485.1| hypothetical protein B456_009G418900 [Gossypium raimondii]
Length=305

 Score =   412 bits (1059),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 208/214 (97%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  290


 Score =   411 bits (1056),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 207/214 (97%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   302 bits (773),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 151/152 (99%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  513
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>gb|KDB11907.1| ubiquitin [Ustilaginoidea virens]
Length=305

 Score =   412 bits (1059),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 208/214 (97%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   412 bits (1059),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 208/214 (97%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS  256

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  290


 Score =   301 bits (770),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  272

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  513
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>gb|KDQ20365.1| hypothetical protein BOTBODRAFT_123907 [Botryobasidium botryosum 
FD-172 SS1]
Length=305

 Score =   412 bits (1059),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 208/214 (97%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ  214


 Score =   412 bits (1059),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 208/214 (97%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ  290


 Score =   301 bits (770),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  513
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  273  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  304



>ref|XP_008796945.1| PREDICTED: LOW QUALITY PROTEIN: polyubiquitin-like [Phoenix dactylifera]
Length=309

 Score =   412 bits (1060),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 209/214 (98%), Positives = 209/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES DTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESXDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   412 bits (1060),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 209/214 (98%), Positives = 209/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVES DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESXDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  290


 Score =   303 bits (775),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  513
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>emb|CEF99839.1| Ubiquitin conserved site [Ostreococcus tauri]
Length=339

 Score =   414 bits (1063),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  35   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  94

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  95   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  154

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  155  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  214

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  215  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  248


 Score =   414 bits (1063),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  111  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  170

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  171  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  230

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  231  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  290

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  291  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  324


 Score =   302 bits (774),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  187  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  246

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  247  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  306

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  513
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  307  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  338



>ref|XP_001555417.1| polyubiquitin [Botrytis cinerea B05.10]
 ref|XP_001906054.1| hypothetical protein [Podospora anserina S mat+]
 ref|XP_007336907.1| ubiquitin [Auricularia delicata TFB-10046 SS5]
 ref|XP_007390409.1| hypothetical protein PHACADRAFT_247222 [Phanerochaete carnosa 
HHB-10118-sp]
 ref|XP_011121602.1| hypothetical protein AOL_s00078g37 [Arthrobotrys oligospora ATCC 
24927]
 gb|AAC15225.1| polyubiquitin [Botrytis cinerea]
 emb|CAP66720.1| unnamed protein product [Podospora anserina S mat+]
 gb|EGX49548.1| hypothetical protein AOL_s00078g37 [Arthrobotrys oligospora ATCC 
24927]
 emb|CCD51422.1| similar to polyubiquitin protein [Botrytis cinerea T4]
 gb|EJD55630.1| ubiquitin [Auricularia delicata TFB-10046 SS5]
 gb|EKM60970.1| hypothetical protein PHACADRAFT_247222 [Phanerochaete carnosa 
HHB-10118-sp]
 gb|EMR84820.1| putative polyubiquitin protein [Botrytis cinerea BcDW1]
 emb|CDP28455.1| Putative Ubiquitin [Podospora anserina S mat+]
 gb|KIP12035.1| hypothetical protein PHLGIDRAFT_17814 [Phlebiopsis gigantea 11061_1 
CR5-6]
Length=305

 Score =   412 bits (1059),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 208/214 (97%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ  214


 Score =   412 bits (1059),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 208/214 (97%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ  290


 Score =   301 bits (770),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  513
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  273  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  304



>ref|XP_010492041.1| PREDICTED: polyubiquitin-like [Camelina sativa]
Length=305

 Score =   412 bits (1059),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 209/214 (98%), Positives = 209/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAG QLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGTQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   412 bits (1059),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 209/214 (98%), Positives = 209/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG QLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGTQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  290


 Score =   303 bits (776),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  516
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  305



>ref|NP_001105376.1| polyubiquitin [Zea mays]
 gb|AAC49025.1| polyubiquitin [Zea mays]
Length=381

 Score =   415 bits (1067),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   415 bits (1067),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  290


 Score =   414 bits (1063),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 209/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLV+RLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVVRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  333  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  366


 Score =   302 bits (773),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 151/152 (99%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLV+RLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVVRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  513
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>gb|AHC00631.1| polyubiquitin [Ganoderma lucidum]
Length=319

 Score =   412 bits (1060),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 208/214 (97%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  15   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  74

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  75   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  134

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  135  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  194

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  195  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ  228


 Score =   412 bits (1060),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 208/214 (97%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  91   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  150

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  151  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  210

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  211  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  270

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  271  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ  304


 Score =   302 bits (773),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 153/153 (100%), Gaps = 0/153 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  167  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  226

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  227  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  286

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  516
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG+
Sbjct  287  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGL  319



>ref|XP_001598085.1| polyubiquitin [Sclerotinia sclerotiorum 1980]
 gb|EDN90771.1| polyubiquitin [Sclerotinia sclerotiorum 1980 UF-70]
Length=305

 Score =   412 bits (1059),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 208/214 (97%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ  214


 Score =   411 bits (1056),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 208/214 (97%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLLDYNIQ  290


 Score =   299 bits (766),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 151/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  513
            FAGKQLEDGRTL DYNIQKESTLHLVLRLRGG
Sbjct  273  FAGKQLEDGRTLLDYNIQKESTLHLVLRLRGG  304



>ref|XP_001828882.1| ubiquitin C [Coprinopsis cinerea okayama7#130]
 ref|XP_001873268.1| ubiquitin [Laccaria bicolor S238N-H82]
 ref|XP_003037536.1| hypothetical protein SCHCODRAFT_64979 [Schizophyllum commune 
H4-8]
 ref|XP_006454479.1| ubiquitin [Agaricus bisporus var. bisporus H97]
 ref|XP_007316692.1| hypothetical protein SERLADRAFT_385284 [Serpula lacrymans var. 
lacrymans S7.9]
 ref|XP_007325267.1| hypothetical protein AGABI1DRAFT_81473 [Agaricus bisporus var. 
burnettii JB137-S8]
 ref|XP_007378433.1| ubiquitin [Punctularia strigosozonata HHB-11173 SS5]
 ref|XP_007842308.1| polyubiquitin [Moniliophthora roreri MCA 2997]
 ref|XP_007879465.1| hypothetical protein PFL1_06871 [Pseudozyma flocculosa PF-1]
 gb|EAU92889.1| ubiquitin C [Coprinopsis cinerea okayama7#130]
 gb|EDR15060.1| ubiquitin [Laccaria bicolor S238N-H82]
 gb|EFJ02634.1| hypothetical protein SCHCODRAFT_64979 [Schizophyllum commune 
H4-8]
 gb|EGO26519.1| hypothetical protein SERLADRAFT_385284 [Serpula lacrymans var. 
lacrymans S7.9]
 gb|EIN13516.1| ubiquitin [Punctularia strigosozonata HHB-11173 SS5]
 gb|EKM83733.1| hypothetical protein AGABI1DRAFT_81473 [Agaricus bisporus var. 
burnettii JB137-S8]
 gb|EKV51498.1| ubiquitin [Agaricus bisporus var. bisporus H97]
 dbj|GAC72194.1| ubiquitin and ubiquitin-like proteins [Pseudozyma antarctica 
T-34]
 dbj|GAC93128.1| ubiquitin [Pseudozyma hubeiensis SY62]
 gb|EPQ28867.1| hypothetical protein PFL1_06871 [Pseudozyma flocculosa PF-1]
 gb|ESK98373.1| polyubiquitin [Moniliophthora roreri MCA 2997]
 gb|AHA61591.1| ubiquitin [Volvariella volvacea]
 gb|KIK04252.1| hypothetical protein K443DRAFT_4723 [Laccaria amethystina LaAM-08-1]
 gb|KIO31281.1| hypothetical protein M407DRAFT_241831 [Tulasnella calospora MUT 
4182]
Length=305

 Score =   412 bits (1059),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 208/214 (97%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ  214


 Score =   412 bits (1059),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 208/214 (97%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ  290


 Score =   300 bits (769),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  513
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  273  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  304



>gb|KIY53974.1| polyubiquitin [Fistulina hepatica ATCC 64428]
Length=305

 Score =   412 bits (1059),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 208/214 (97%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYSIQ  290


 Score =   412 bits (1058),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 208/214 (97%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ  214


 Score =   299 bits (766),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 149/153 (97%), Positives = 153/153 (100%), Gaps = 0/153 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  516
            FAGKQLEDGRTL+DY+IQKESTLHLVLRLRGG+
Sbjct  273  FAGKQLEDGRTLSDYSIQKESTLHLVLRLRGGL  305



>ref|XP_002872109.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48368.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=383

 Score =   415 bits (1066),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  78   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  137

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  138  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  197

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  257

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  258  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  291


 Score =   414 bits (1065),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 209/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  154  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  213

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  214  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  273

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  274  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  333

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEG+PP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  334  KIQDKEGVPPDQQRLIFAGKQLEDGRTLADYNIQ  367


 Score =   410 bits (1055),  Expect = 7e-140, Method: Compositional matrix adjust.
 Identities = 209/214 (98%), Positives = 209/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP DQQRLIFAGKQLEDGRTLADYN
Sbjct  2    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPLDQQRLIFAGKQLEDGRTLADYN  61

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  62   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  121

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  122  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  181

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  182  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  215


 Score =   303 bits (775),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 151/152 (99%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  230  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  289

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEG+PPDQQRLI
Sbjct  290  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGVPPDQQRLI  349

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  513
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  350  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  381



>gb|ADO60140.1| ubiquitin [Beauveria bassiana]
Length=215

 Score =   409 bits (1050),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 205/214 (96%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ  214


 Score =   272 bits (696),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 135/139 (97%), Positives = 139/139 (100%), Gaps = 0/139 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQK  474
            FAGKQLEDGRTL+DYNIQK
Sbjct  197  FAGKQLEDGRTLSDYNIQK  215



>ref|XP_007763327.1| polyubiquitin [Coniophora puteana RWD-64-598 SS2]
 gb|EIW86558.1| polyubiquitin [Coniophora puteana RWD-64-598 SS2]
 gb|EUC62408.1| polyubiquitin [Rhizoctonia solani AG-3 Rhs1AP]
 gb|KDQ12738.1| hypothetical protein BOTBODRAFT_34195 [Botryobasidium botryosum 
FD-172 SS1]
 gb|KEP53373.1| polyubiquitin [Rhizoctonia solani 123E]
 gb|KIJ12827.1| hypothetical protein PAXINDRAFT_82237 [Paxillus involutus ATCC 
200175]
 gb|KIK47355.1| hypothetical protein CY34DRAFT_799527 [Suillus luteus UH-Slu-Lm8-n1]
Length=305

 Score =   412 bits (1059),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 208/214 (97%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ  214


 Score =   412 bits (1059),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 208/214 (97%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ  290


 Score =   301 bits (770),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  516
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  273  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGC  305



>gb|KIY45417.1| ubiquitin [Fistulina hepatica ATCC 64428]
Length=305

 Score =   412 bits (1058),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 208/214 (97%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ  214


 Score =   412 bits (1058),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 208/214 (97%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ  290


 Score =   300 bits (769),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  513
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  273  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  304



>gb|KIR63773.1| polyubiquitin [Cryptococcus gattii CA1873]
 gb|KIR98208.1| polyubiquitin [Cryptococcus gattii 2001/935-1]
Length=305

 Score =   412 bits (1058),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 208/214 (97%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ  290


 Score =   410 bits (1055),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 207/214 (97%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ  214


 Score =   300 bits (769),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  513
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  273  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  304



>gb|ABU40645.1| polyubiquitin [Triticum aestivum]
Length=380

 Score =   415 bits (1066),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   415 bits (1066),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  290


 Score =   415 bits (1066),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  333  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  366


 Score =   303 bits (776),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  513
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>ref|NP_001174480.1| Os05g0504766 [Oryza sativa Japonica Group]
 ref|XP_002438904.1| hypothetical protein SORBIDRAFT_10g028020 [Sorghum bicolor]
 ref|XP_006656385.1| PREDICTED: polyubiquitin-like [Oryza brachyantha]
 ref|XP_007027294.1| Ubiquitin 4 [Theobroma cacao]
 ref|XP_010240640.1| PREDICTED: polyubiquitin isoform X2 [Brachypodium distachyon]
 ref|XP_010240789.1| PREDICTED: polyubiquitin isoform X2 [Brachypodium distachyon]
 gb|AAD30173.1|AF148448_1 polyubiquitin [Sporobolus stapfianus]
 gb|AAW56906.1| polyubiquitin [Oryza sativa Japonica Group]
 gb|EAY98614.1| hypothetical protein OsI_20535 [Oryza sativa Indica Group]
 gb|EEE64284.1| hypothetical protein OsJ_19121 [Oryza sativa Japonica Group]
 gb|EER90271.1| hypothetical protein SORBIDRAFT_10g028020 [Sorghum bicolor]
 dbj|BAH93208.1| Os05g0504766 [Oryza sativa Japonica Group]
 dbj|BAJ91806.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK04112.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gb|AFH53939.1| polyubiquitin 4 [Brachypodium distachyon]
 gb|AFH53940.1| polyubiquitin 10 [Brachypodium distachyon]
 gb|EOY07796.1| Ubiquitin 4 [Theobroma cacao]
 gb|AGT16803.1| polyubiquitin [Saccharum hybrid cultivar R570]
Length=381

 Score =   415 bits (1066),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   415 bits (1066),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  290


 Score =   415 bits (1066),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  333  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  366


 Score =   303 bits (776),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  513
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>gb|AAB68045.1| polyubiquitin [Fragaria x ananassa]
Length=381

 Score =   415 bits (1066),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  333  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  366


 Score =   412 bits (1060),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 209/214 (98%), Positives = 209/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   412 bits (1060),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 209/214 (98%), Positives = 209/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  290


 Score =   303 bits (777),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  516
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  381



>gb|EYU33608.1| hypothetical protein MIMGU_mgv1a004315mg [Erythranthe guttata]
Length=381

 Score =   415 bits (1066),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   415 bits (1066),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  290


 Score =   415 bits (1066),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  333  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  366


 Score =   303 bits (777),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 153/153 (100%), Gaps = 0/153 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  516
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGV  381



>gb|AGV54228.1| polyubiquitin-like protein [Phaseolus vulgaris]
Length=381

 Score =   415 bits (1066),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  333  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  366


 Score =   409 bits (1052),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 208/214 (97%), Positives = 208/214 (97%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLV  LRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVSWLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   409 bits (1052),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 208/214 (97%), Positives = 208/214 (97%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLV  LRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVSWLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  290


 Score =   304 bits (778),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 153/153 (100%), Gaps = 0/153 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  516
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGL  381



>ref|XP_001420612.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO98905.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|KHN17791.1| Polyubiquitin 4 [Glycine soja]
Length=381

 Score =   415 bits (1066),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   415 bits (1066),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  290


 Score =   415 bits (1066),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  333  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  366


 Score =   303 bits (776),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  516
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGC  381



>ref|XP_002508175.1| ubiquitin [Micromonas sp. RCC299]
 ref|XP_003061956.1| ubiquitin [Micromonas pusilla CCMP1545]
 gb|EEH53668.1| ubiquitin [Micromonas pusilla CCMP1545]
 gb|ACO69433.1| ubiquitin [Micromonas sp. RCC299]
 gb|KEH20642.1| polyubiquitin 3 [Medicago truncatula]
Length=381

 Score =   415 bits (1066),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   415 bits (1066),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  290


 Score =   415 bits (1066),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  333  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  366


 Score =   303 bits (776),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  513
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>ref|XP_010270791.1| PREDICTED: polyubiquitin-like [Nelumbo nucifera]
Length=382

 Score =   415 bits (1066),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   414 bits (1064),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 209/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT+TLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTVTLEVESSDTIDNVKA  256

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  290


 Score =   414 bits (1064),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 209/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKT+TLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTVTLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  333  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  366


 Score =   303 bits (776),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 153/153 (100%), Gaps = 0/153 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKT+TLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTVTLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  516
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGI  381



>ref|XP_006396612.1| hypothetical protein EUTSA_v10028730mg [Eutrema salsugineum]
 ref|XP_010537979.1| PREDICTED: polyubiquitin [Tarenaya hassleriana]
 emb|CAJ86369.1| OSIGBa0117N13.13 [Oryza sativa Indica Group]
 emb|CAJ86419.1| H0303G06.8 [Oryza sativa Indica Group]
 gb|EAY95663.1| hypothetical protein OsI_17529 [Oryza sativa Indica Group]
 gb|ESQ38065.1| hypothetical protein EUTSA_v10028730mg [Eutrema salsugineum]
Length=381

 Score =   415 bits (1066),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   415 bits (1066),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  290


 Score =   415 bits (1066),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  333  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  366


 Score =   304 bits (778),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 153/153 (100%), Gaps = 0/153 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  516
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGL  381



>gb|EMS60894.1| Polyubiquitin [Triticum urartu]
Length=458

 Score =   417 bits (1073),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  230  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  289

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  290  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  349

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  350  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  409

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  410  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  443


 Score =   305 bits (780),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  306  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  365

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  366  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  425

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  513
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  426  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  457


 Score =   268 bits (685),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 136/143 (95%), Positives = 136/143 (95%), Gaps = 0/143 (0%)
 Frame = +1

Query  271  RLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRT  450
            RL   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRT
Sbjct  225  RLEKTMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRT  284

Query  451  LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPX  630
            LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP 
Sbjct  285  LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPD  344

Query  631  QQXLIFAGKQLEDGRTLPDYXIQ  699
            QQ LIFAGKQLEDGRTL DY IQ
Sbjct  345  QQRLIFAGKQLEDGRTLADYNIQ  367



>ref|XP_010558157.1| PREDICTED: polyubiquitin-like [Tarenaya hassleriana]
Length=382

 Score =   415 bits (1066),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   415 bits (1066),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  290


 Score =   415 bits (1066),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  333  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  366


 Score =   303 bits (776),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  513
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>gb|AAK68824.1| Unknown protein [Arabidopsis thaliana]
Length=229

 Score =   409 bits (1050),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 208/214 (97%), Positives = 208/214 (97%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK L GKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKPLPGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   298 bits (763),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 150/153 (98%), Gaps = 0/153 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVK L GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKPLPGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  516
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  229



>ref|NP_001148453.1| LOC100282068 [Zea mays]
 ref|XP_002299930.1| UBIQUITIN 11 family protein [Populus trichocarpa]
 ref|XP_003607671.1| Ubiquitin [Medicago truncatula]
 gb|AAC49014.1| ubiquitin [Zea mays]
 gb|ACG31521.1| polyubiquitin containing 7 ubiquitin monomers [Zea mays]
 gb|EEE84735.1| UBIQUITIN 11 family protein [Populus trichocarpa]
 gb|ACR37911.1| unknown [Zea mays]
 gb|AES89868.1| polyubiquitin 3 [Medicago truncatula]
 gb|AFW66440.1| putative ubiquitin family protein isoform 1 [Zea mays]
 gb|AFW66441.1| putative ubiquitin family protein isoform 2 [Zea mays]
Length=381

 Score =   415 bits (1066),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   415 bits (1066),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  290


 Score =   415 bits (1066),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  333  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  366


 Score =   303 bits (776),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  513
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>gb|KIR29996.1| polyubiquitin [Cryptococcus gattii LA55]
 gb|KIR37417.1| polyubiquitin [Cryptococcus gattii MMRL2647]
 gb|KIR43885.1| polyubiquitin [Cryptococcus gattii Ram5]
 gb|KIR92886.1| polyubiquitin [Cryptococcus gattii CBS 10090]
 gb|KIY60273.1| polyubiquitin [Cryptococcus gattii 99/473]
Length=315

 Score =   412 bits (1059),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 208/214 (97%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ  290


 Score =   411 bits (1056),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 207/214 (97%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ  214


 Score =   314 bits (805),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 157/159 (99%), Positives = 159/159 (100%), Gaps = 0/159 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKT  534
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKT
Sbjct  273  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKT  311



>ref|XP_006381473.1| polyubiquitin family protein [Populus trichocarpa]
 gb|ERP59270.1| polyubiquitin family protein [Populus trichocarpa]
Length=306

 Score =   412 bits (1058),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 209/214 (98%), Positives = 209/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGNTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  290


 Score =   409 bits (1050),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 207/214 (97%), Positives = 208/214 (97%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVE+SDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVENSDTIDNVKVKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGNTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   300 bits (769),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 151/152 (99%), Positives = 151/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTG TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGNTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  513
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>ref|XP_007339454.1| ubiquitin [Auricularia delicata TFB-10046 SS5]
 gb|EJD52725.1| ubiquitin [Auricularia delicata TFB-10046 SS5]
 gb|KIM81538.1| hypothetical protein PILCRDRAFT_821319 [Piloderma croceum F 1598]
Length=305

 Score =   412 bits (1058),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 208/214 (97%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ  214


 Score =   412 bits (1058),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 208/214 (97%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ  290


 Score =   300 bits (769),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  516
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  273  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGF  305



>emb|CDP05795.1| unnamed protein product [Coffea canephora]
Length=381

 Score =   414 bits (1065),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  333  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  366


 Score =   413 bits (1061),  Expect = 9e-141, Method: Compositional matrix adjust.
 Identities = 209/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQ+KEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQEKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   413 bits (1061),  Expect = 9e-141, Method: Compositional matrix adjust.
 Identities = 209/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQ+KEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQEKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  290


 Score =   303 bits (776),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  516
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  381



>ref|XP_007924320.1| hypothetical protein MYCFIDRAFT_60610 [Pseudocercospora fijiensis 
CIRAD86]
 gb|EHN05782.1| Ubi4p [Saccharomyces cerevisiae x Saccharomyces kudriavzevii 
VIN7]
 gb|EME83800.1| hypothetical protein MYCFIDRAFT_60610 [Pseudocercospora fijiensis 
CIRAD86]
 gb|EWH17145.1| Ubi4p [Saccharomyces cerevisiae P283]
Length=229

 Score =   409 bits (1050),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 205/214 (96%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ  214


 Score =   298 bits (764),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 148/152 (97%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  513
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  228



>ref|XP_010240921.1| PREDICTED: polyubiquitin-like [Nelumbo nucifera]
Length=381

 Score =   414 bits (1065),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  290


 Score =   414 bits (1065),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  333  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  366


 Score =   414 bits (1064),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 209/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            +QKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   VQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   303 bits (776),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  516
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  381



>gb|KEH31155.1| polyubiquitin 3 [Medicago truncatula]
Length=381

 Score =   414 bits (1065),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   414 bits (1065),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ  290


 Score =   413 bits (1062),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 209/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  333  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  366


 Score =   302 bits (773),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  288

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  516
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  381



>ref|XP_006593989.1| PREDICTED: polyubiquitin 10-like isoform X1 [Glycine max]
Length=381

 Score =   414 bits (1065),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   414 bits (1065),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  290


 Score =   414 bits (1064),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 209/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT+TLEVESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTVTLEVESSDTIDNVKA  332

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  333  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  366


 Score =   303 bits (775),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKT+TLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTVTLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  516
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  381



>ref|NP_849300.4| polyubiquitin 10 [Arabidopsis thaliana]
 ref|NP_567291.4| polyubiquitin 10 [Arabidopsis thaliana]
 ref|NP_001078353.4| polyubiquitin 10 [Arabidopsis thaliana]
 ref|XP_004134747.1| PREDICTED: polyubiquitin-like isoform 1 [Cucumis sativus]
 ref|XP_004134748.1| PREDICTED: polyubiquitin-like isoform 2 [Cucumis sativus]
 ref|XP_004496773.1| PREDICTED: polyubiquitin-like [Cicer arietinum]
 ref|XP_006360087.1| PREDICTED: polyubiquitin-like isoform X2 [Solanum tuberosum]
 ref|XP_006287939.1| hypothetical protein CARUB_v10001174mg [Capsella rubella]
 ref|XP_006370633.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 ref|XP_006370635.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 ref|XP_006370637.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 ref|XP_006380307.1| hypothetical protein POPTR_0007s02460g [Populus trichocarpa]
 ref|XP_006377834.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 ref|XP_006377835.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 ref|XP_006372946.1| UBIQUITIN 11 family protein [Populus trichocarpa]
 ref|XP_006396616.1| hypothetical protein EUTSA_v10028728mg [Eutrema salsugineum]
 ref|XP_006396617.1| hypothetical protein EUTSA_v10028728mg [Eutrema salsugineum]
 ref|XP_006452184.1| hypothetical protein CICLE_v10008642mg [Citrus clementina]
 ref|XP_007021032.1| Polyubiquitin 10 isoform 1 [Theobroma cacao]
 ref|XP_007021033.1| Polyubiquitin 10 isoform 1 [Theobroma cacao]
 ref|XP_007021035.1| Polyubiquitin 10 [Theobroma cacao]
 ref|XP_007025987.1| Polyubiquitin 10 [Theobroma cacao]
 ref|XP_007143204.1| hypothetical protein PHAVU_007G052600g [Phaseolus vulgaris]
 ref|XP_007211430.1| hypothetical protein PRUPE_ppa007117mg [Prunus persica]
 ref|XP_007211607.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 ref|XP_008244360.1| PREDICTED: polyubiquitin isoform X2 [Prunus mume]
 ref|XP_009365167.1| PREDICTED: polyubiquitin [Pyrus x bretschneideri]
 ref|XP_009358097.1| PREDICTED: polyubiquitin isoform X2 [Pyrus x bretschneideri]
 ref|XP_009358098.1| PREDICTED: polyubiquitin isoform X2 [Pyrus x bretschneideri]
 ref|XP_009343085.1| PREDICTED: polyubiquitin isoform X2 [Pyrus x bretschneideri]
 ref|XP_009343086.1| PREDICTED: polyubiquitin isoform X2 [Pyrus x bretschneideri]
 ref|XP_009611794.1| PREDICTED: polyubiquitin [Nicotiana tomentosiformis]
 ref|XP_009792849.1| PREDICTED: polyubiquitin [Nicotiana sylvestris]
 ref|XP_009793738.1| PREDICTED: polyubiquitin [Nicotiana sylvestris]
 ref|XP_010267760.1| PREDICTED: polyubiquitin [Nelumbo nucifera]
 ref|XP_010423137.1| PREDICTED: polyubiquitin [Camelina sativa]
 ref|XP_010447068.1| PREDICTED: polyubiquitin [Camelina sativa]
 ref|XP_010455857.1| PREDICTED: polyubiquitin [Camelina sativa]
 ref|XP_010644407.1| PREDICTED: polyubiquitin [Vitis vinifera]
 ref|XP_011026350.1| PREDICTED: polyubiquitin [Populus euphratica]
 ref|XP_011030849.1| PREDICTED: polyubiquitin [Populus euphratica]
 ref|XP_011048300.1| PREDICTED: polyubiquitin [Populus euphratica]
 ref|XP_011460984.1| PREDICTED: polyubiquitin [Fragaria vesca subsp. vesca]
 ref|XP_011460993.1| PREDICTED: polyubiquitin [Fragaria vesca subsp. vesca]
 sp|P69322.2|UBIQP_PEA RecName: Full=Polyubiquitin; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor [Pisum sativum]
 emb|CAA34886.1| unnamed protein product [Pisum sativum]
 gb|AAD03344.1| ubiquitin [Pisum sativum]
 gb|AAK96602.1| AT4g05320/C17L7_240 [Arabidopsis thaliana]
 dbj|BAD26592.1| polyubiquitin [Populus nigra]
 gb|ABB73307.1| ubiquitin [Lotus japonicus]
 gb|ABK92512.1| unknown [Populus trichocarpa]
 gb|ABK93264.1| unknown [Populus trichocarpa]
 gb|ABK95903.1| unknown [Populus trichocarpa]
 gb|ABK96012.1| unknown [Populus trichocarpa]
 gb|ABK96127.1| unknown [Populus trichocarpa]
 gb|ACK56276.1| ubiquitin [Populus trichocarpa]
 gb|AEE82501.1| polyubiquitin 10 [Arabidopsis thaliana]
 gb|AEE82504.1| polyubiquitin 10 [Arabidopsis thaliana]
 gb|AEE82505.1| polyubiquitin 10 [Arabidopsis thaliana]
 gb|EMJ12629.1| hypothetical protein PRUPE_ppa007117mg [Prunus persica]
 gb|EMJ12806.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 gb|EOA20837.1| hypothetical protein CARUB_v10001174mg [Capsella rubella]
 gb|EOY12557.1| Polyubiquitin 10 isoform 1 [Theobroma cacao]
 gb|EOY12558.1| Polyubiquitin 10 isoform 1 [Theobroma cacao]
 gb|EOY12560.1| Polyubiquitin 10 [Theobroma cacao]
 gb|EOY28609.1| Polyubiquitin 10 [Theobroma cacao]
 gb|ERP50743.1| UBIQUITIN 11 family protein [Populus trichocarpa]
 gb|ERP55631.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 gb|ERP55632.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 gb|ERP58104.1| hypothetical protein POPTR_0007s02460g [Populus trichocarpa]
 gb|ERP67202.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 gb|ERP67204.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 gb|ERP67206.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 gb|ESQ38069.1| hypothetical protein EUTSA_v10028728mg [Eutrema salsugineum]
 gb|ESQ38070.1| hypothetical protein EUTSA_v10028728mg [Eutrema salsugineum]
 gb|ESR65424.1| hypothetical protein CICLE_v10008642mg [Citrus clementina]
 gb|ESW15198.1| hypothetical protein PHAVU_007G052600g [Phaseolus vulgaris]
 gb|KDO52961.1| hypothetical protein CISIN_1g009518mg [Citrus sinensis]
 gb|KDP20793.1| hypothetical protein JCGZ_21264 [Jatropha curcas]
 gb|AET01628.2| polyubiquitin 3 [Medicago truncatula]
 gb|KEH30745.1| polyubiquitin 3 [Medicago truncatula]
 gb|KJB13593.1| hypothetical protein B456_002G083100 [Gossypium raimondii]
 gb|KJB62633.1| hypothetical protein B456_009G427000 [Gossypium raimondii]
 prf||1603402A poly-ubiquitin
Length=381

 Score =   414 bits (1065),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   414 bits (1065),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  290


 Score =   414 bits (1065),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  333  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  366


 Score =   303 bits (776),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  516
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  381



>emb|CBY46746.1| polyubiquitin 10 protein, partial [Lepidium campestre]
Length=381

 Score =   414 bits (1065),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  290


 Score =   414 bits (1065),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  333  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  366


 Score =   414 bits (1064),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 209/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDT+DNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTVDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   303 bits (776),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  516
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  381



>gb|AAL09741.1| AT4g05320/C17L7_240 [Arabidopsis thaliana]
Length=381

 Score =   414 bits (1065),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  333  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  366


 Score =   412 bits (1059),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 209/214 (98%), Positives = 209/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVL LRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLSLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   412 bits (1059),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 209/214 (98%), Positives = 209/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVL LRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLSLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  290


 Score =   303 bits (776),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  516
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  381



>gb|AAQ07453.1| ubiquitin [Musa acuminata AAA Group]
Length=381

 Score =   414 bits (1065),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   413 bits (1061),  Expect = 9e-141, Method: Compositional matrix adjust.
 Identities = 209/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITL+VESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLKVESSDTIDNVKA  256

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  290


 Score =   413 bits (1061),  Expect = 9e-141, Method: Compositional matrix adjust.
 Identities = 209/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITL+VESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLKVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  333  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  366


 Score =   301 bits (771),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 151/152 (99%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITL+VESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLKVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  513
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>emb|CCT70325.1| UBI4-Ubiquitin [Fusarium fujikuroi IMI 58289]
Length=281

 Score =   410 bits (1055),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 206/214 (96%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  53   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  112

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  113  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  172

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+
Sbjct  173  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS  232

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  233  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ  266


 Score =   350 bits (897),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 183/214 (86%), Positives = 186/214 (87%), Gaps = 24/214 (11%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDN                        LEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDN------------------------LEDGRTLSDYN  36

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  37   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  96

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+
Sbjct  97   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS  156

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  157  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ  190


 Score =   299 bits (765),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 148/152 (97%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  129  MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  188

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  189  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  248

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  513
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  249  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  280



>gb|AAY86773.1| polyubiquitin [Noccaea caerulescens]
Length=382

 Score =   414 bits (1065),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   414 bits (1065),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  290


 Score =   414 bits (1065),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  333  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  366


 Score =   303 bits (776),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  513
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>gb|ACS68205.1| ubiquitin 10.2 [Brassica napus]
Length=381

 Score =   414 bits (1065),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   414 bits (1065),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  290


 Score =   414 bits (1065),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  333  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  366


 Score =   303 bits (777),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 153/153 (100%), Gaps = 0/153 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  516
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGI  381



>ref|XP_010454368.1| PREDICTED: polyubiquitin 4-like [Camelina sativa]
Length=382

 Score =   414 bits (1065),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  333  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  366


 Score =   414 bits (1064),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 209/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDT+DNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTVDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   414 bits (1064),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 209/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDT+DNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTVDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  290


 Score =   303 bits (776),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  513
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>ref|XP_002874006.1| hypothetical protein ARALYDRAFT_488966 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50265.1| hypothetical protein ARALYDRAFT_488966 [Arabidopsis lyrata subsp. 
lyrata]
Length=382

 Score =   414 bits (1065),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  290


 Score =   414 bits (1065),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  333  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  366


 Score =   414 bits (1064),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 209/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQ+FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQVFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   303 bits (776),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  513
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>ref|XP_002992988.1| hypothetical protein SELMODRAFT_187148 [Selaginella moellendorffii]
 ref|XP_002994514.1| hypothetical protein SELMODRAFT_138728 [Selaginella moellendorffii]
 gb|EFJ04422.1| hypothetical protein SELMODRAFT_138728 [Selaginella moellendorffii]
 gb|EFJ05934.1| hypothetical protein SELMODRAFT_187148 [Selaginella moellendorffii]
Length=229

 Score =   409 bits (1050),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 207/214 (97%), Positives = 207/214 (97%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKT  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   301 bits (772),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  516
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229



>ref|XP_009596689.1| PREDICTED: polyubiquitin-like [Nicotiana tomentosiformis]
Length=382

 Score =   414 bits (1065),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   414 bits (1065),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  290


 Score =   414 bits (1065),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  333  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  366


 Score =   303 bits (776),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  513
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>ref|NP_568397.1| ubiquitin 4 [Arabidopsis thaliana]
 ref|XP_002881273.1| hypothetical protein ARALYDRAFT_482268 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_010420904.1| PREDICTED: polyubiquitin 4 [Camelina sativa]
 ref|XP_010493166.1| PREDICTED: polyubiquitin 4 [Camelina sativa]
 sp|P0CH32.1|UBQ4_ARATH RecName: Full=Polyubiquitin 4; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor [Arabidopsis thaliana]
 emb|CAA31331.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAB53929.1| polyubiquitin [Arabidopsis thaliana]
 gb|EFH57532.1| hypothetical protein ARALYDRAFT_482268 [Arabidopsis lyrata subsp. 
lyrata]
 gb|AED92867.1| ubiquitin 4 [Arabidopsis thaliana]
 prf||1515347A poly-ubiquitin
Length=382

 Score =   414 bits (1065),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   414 bits (1065),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  290


 Score =   414 bits (1065),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  333  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  366


 Score =   303 bits (776),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  513
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>emb|CCG34086.1| Polyubiquitin [uncultured eukaryote]
Length=304

 Score =   411 bits (1057),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 206/224 (92%), Positives = 212/224 (95%), Gaps = 0/224 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGM+IFVKTLTGKTITLEVESSDTIDNVK+
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMRIFVKTLTGKTITLEVESSDTIDNVKS  256

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQXIHPPLWFSV  729
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ      W  V
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKRALCTWCCV  300


 Score =   409 bits (1052),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 205/214 (96%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ  214



>gb|EYU18102.1| hypothetical protein MIMGU_mgv1a008166mg [Erythranthe guttata]
Length=383

 Score =   414 bits (1065),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  290


 Score =   414 bits (1065),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  333  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  366


 Score =   413 bits (1061),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 208/214 (97%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDT+DNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTVDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   303 bits (776),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  513
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>gb|KJB81825.1| hypothetical protein B456_013G163500 [Gossypium raimondii]
 gb|KJB81826.1| hypothetical protein B456_013G163500 [Gossypium raimondii]
Length=381

 Score =   414 bits (1065),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  290


 Score =   414 bits (1065),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  333  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  366


 Score =   412 bits (1060),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 209/214 (98%), Positives = 209/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   303 bits (776),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  516
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  381



>ref|XP_009763135.1| PREDICTED: polyubiquitin-like [Nicotiana sylvestris]
Length=381

 Score =   414 bits (1065),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  333  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  366


 Score =   413 bits (1062),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 209/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVES+DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESTDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  290


 Score =   412 bits (1058),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 208/214 (97%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES+DTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESTDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   303 bits (776),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  516
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  381



>ref|XP_006428816.1| hypothetical protein CICLE_v10011684mg [Citrus clementina]
 gb|ESR42056.1| hypothetical protein CICLE_v10011684mg [Citrus clementina]
Length=382

 Score =   414 bits (1065),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   414 bits (1065),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  290


 Score =   414 bits (1065),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  333  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  366


 Score =   303 bits (776),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  513
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>ref|XP_009591312.1| PREDICTED: polyubiquitin 4 [Nicotiana tomentosiformis]
 ref|XP_011468093.1| PREDICTED: LOW QUALITY PROTEIN: polyubiquitin 4-like [Fragaria 
vesca subsp. vesca]
Length=382

 Score =   414 bits (1065),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   414 bits (1065),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  290


 Score =   414 bits (1065),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  333  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  366


 Score =   303 bits (775),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  513
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>ref|XP_003670049.1| hypothetical protein NDAI_0D04930 [Naumovozyma dairenensis CBS 
421]
 ref|XP_003959063.1| hypothetical protein KAFR_0I01470 [Kazachstania africana CBS 
2517]
 ref|XP_004181533.1| hypothetical protein TBLA_0G00670 [Tetrapisispora blattae CBS 
6284]
 emb|CCD24806.1| hypothetical protein NDAI_0D04930 [Naumovozyma dairenensis CBS 
421]
 emb|CCF59928.1| hypothetical protein KAFR_0I01470 [Kazachstania africana CBS 
2517]
 emb|CCH62014.1| hypothetical protein TBLA_0G00670 [Tetrapisispora blattae CBS 
6284]
Length=229

 Score =   409 bits (1050),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 205/214 (96%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ  214


 Score =   300 bits (769),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 149/153 (97%), Positives = 153/153 (100%), Gaps = 0/153 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  516
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGM
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  229



>ref|XP_010062974.1| PREDICTED: polyubiquitin [Eucalyptus grandis]
Length=425

 Score =   416 bits (1069),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 210/216 (97%), Positives = 212/216 (98%), Gaps = 0/216 (0%)
 Frame = +1

Query  52   LKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  231
            +KMQIFVKTLTGKTITLEVESSDT+DNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  43   VKMQIFVKTLTGKTITLEVESSDTVDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  102

Query  232  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  411
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  103  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  162

Query  412  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV  591
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV
Sbjct  163  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV  222

Query  592  KAKIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KAKIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  223  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  258


 Score =   414 bits (1064),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 209/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  121  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  180

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  181  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  240

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDT+DNVKA
Sbjct  241  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTVDNVKA  300

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  301  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  334


 Score =   414 bits (1064),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 209/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  197  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  256

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDT+DNVKAKIQDKEGIPPDQQRLI
Sbjct  257  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTVDNVKAKIQDKEGIPPDQQRLI  316

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  317  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  376

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  377  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  410


 Score =   303 bits (775),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDT+DNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  273  MQIFVKTLTGKTITLEVESSDTVDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  332

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  333  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  392

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  516
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  393  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  425


 Score =   266 bits (681),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 138/160 (86%), Positives = 144/160 (90%), Gaps = 6/160 (4%)
 Frame = +1

Query  220  TLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  399
             L+ +++ K S+L      R  MQIFVKTLTGKTITLEVESSDT+DNVKAKIQDKEGIPP
Sbjct  29   ALSPFDLSKFSSL------RVKMQIFVKTLTGKTITLEVESSDTVDNVKAKIQDKEGIPP  82

Query  400  DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDT  579
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDT
Sbjct  83   DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDT  142

Query  580  IDNVKAKIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            IDNVKAKIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  143  IDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  182



>ref|XP_007366816.1| polyubiquitin [Dichomitus squalens LYAD-421 SS1]
 gb|EJF60398.1| polyubiquitin [Dichomitus squalens LYAD-421 SS1]
Length=305

 Score =   411 bits (1057),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 208/214 (97%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ  290


 Score =   409 bits (1051),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 207/214 (97%), Positives = 209/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR L+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRPLSDYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ  214


 Score =   301 bits (771),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 153/153 (100%), Gaps = 0/153 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  516
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG+
Sbjct  273  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGL  305



>gb|EPX74297.1| ubiquitin [Schizosaccharomyces octosporus yFS286]
Length=230

 Score =   409 bits (1050),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 205/214 (96%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ  214


 Score =   298 bits (764),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 148/153 (97%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  516
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGC  229



>dbj|BAL61087.1| polyubiquitin [Dianthus caryophyllus]
Length=229

 Score =   409 bits (1050),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 207/214 (97%), Positives = 207/214 (97%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKT  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   299 bits (766),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 150/153 (98%), Gaps = 0/153 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  516
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGC  229



>sp|P0CG84.1|UBI4P_NICSY RecName: Full=Polyubiquitin; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor, partial [Nicotiana sylvestris]
 gb|AAA34124.1| pentameric polyubiquitin, partial [Nicotiana sylvestris]
Length=377

 Score =   414 bits (1064),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  132

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  133  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  192

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  193  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  252

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  253  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  286


 Score =   414 bits (1064),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  149  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  208

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  209  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  268

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  269  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  328

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  329  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  362


 Score =   405 bits (1042),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 206/210 (98%), Positives = 206/210 (98%), Gaps = 0/210 (0%)
 Frame = +1

Query  70   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  249
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  1    VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  60

Query  250  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  429
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  61   STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  120

Query  430  QLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQD  609
            QLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQD
Sbjct  121  QLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQD  180

Query  610  KEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  210


 Score =   303 bits (775),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  225  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  284

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  285  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  344

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  516
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  345  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  377



>sp|Q58G87.2|UBQ3_ORYSJ RecName: Full=Polyubiquitin 3; Contains: RecName: Full=Ubiquitin-related; 
Contains: RecName: Full=Ubiquitin; Flags: Precursor 
[Oryza sativa Japonica Group]
 emb|CAE04243.3| OSJNBa0089N06.4 [Oryza sativa Japonica Group]
 gb|EAZ32071.1| hypothetical protein OsJ_16259 [Oryza sativa Japonica Group]
Length=381

 Score =   414 bits (1065),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  290


 Score =   414 bits (1065),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  333  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  366


 Score =   412 bits (1058),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 209/214 (98%), Positives = 209/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVE SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVEFSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   303 bits (777),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 153/153 (100%), Gaps = 0/153 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  516
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGL  381



>ref|XP_001931824.1| ubiquitin [Pyrenophora tritici-repentis Pt-1C-BFP]
 ref|XP_003305664.1| hypothetical protein PTT_18575 [Pyrenophora teres f. teres 0-1]
 ref|XP_003854274.1| hypothetical protein MYCGRDRAFT_57170 [Zymoseptoria tritici IPO323]
 ref|XP_007275950.1| ubiquitin [Colletotrichum gloeosporioides Nara gc5]
 ref|XP_007376605.1| polyubiquitin [Spathaspora passalidarum NRRL Y-27907]
 ref|XP_007674454.1| hypothetical protein BAUCODRAFT_32336 [Baudoinia compniacensis 
UAMH 10762]
 ref|XP_007741026.1| ubiquitin C [Cladophialophora psammophila CBS 110553]
 ref|XP_009261437.1| hypothetical protein FPSE_10045 [Fusarium pseudograminearum CS3096]
 ref|XP_009650785.1| ubiquitin [Verticillium dahliae VdLs.17]
 ref|XP_011319955.1| ubiquitin [Fusarium graminearum PH-1]
 gb|EDU40929.1| ubiquitin [Pyrenophora tritici-repentis Pt-1C-BFP]
 gb|EFQ86204.1| hypothetical protein PTT_18575 [Pyrenophora teres f. teres 0-1]
 gb|EGP89250.1| hypothetical protein MYCGRDRAFT_57170 [Zymoseptoria tritici IPO323]
 gb|EGW31827.1| polyubiquitin [Spathaspora passalidarum NRRL Y-27907]
 gb|EGY14431.1| ubiquitin [Verticillium dahliae VdLs.17]
 gb|EHK44351.1| hypothetical protein TRIATDRAFT_300588 [Trichoderma atroviride 
IMI 206040]
 gb|EJT46666.1| hypothetical protein A1Q1_04737 [Trichosporon asahii var. asahii 
CBS 2479]
 gb|EKJ69797.1| hypothetical protein FPSE_10045 [Fusarium pseudograminearum CS3096]
 gb|ELA35078.1| ubiquitin [Colletotrichum gloeosporioides Nara gc5]
 gb|EMC98317.1| hypothetical protein BAUCODRAFT_32336 [Baudoinia compniacensis 
UAMH 10762]
 gb|EME45125.1| hypothetical protein DOTSEDRAFT_70987 [Dothistroma septosporum 
NZE10]
 gb|ENH81500.1| ubiquitin [Colletotrichum orbiculare MAFF 240422]
 gb|ESU14530.1| ubiquitin [Fusarium graminearum PH-1]
 emb|CDK27817.1| unnamed protein product [Kuraishia capsulata CBS 1993]
 gb|EXJ73926.1| ubiquitin C [Cladophialophora psammophila CBS 110553]
 gb|EYB28525.1| hypothetical protein FG05_08768 [Fusarium graminearum]
 gb|KEQ58801.1| ubiquitin [Aureobasidium melanogenum CBS 110374]
 gb|KEQ70291.1| ubiquitin [Aureobasidium pullulans var. namibiae CBS 147.97]
 gb|KEQ87814.1| ubiquitin [Aureobasidium pullulans EXF-150]
 gb|KER00813.1| hypothetical protein AUEXF2481DRAFT_25097 [Aureobasidium subglaciale 
EXF-2481]
 emb|CEF77191.1| unnamed protein product [Fusarium graminearum]
 gb|KIV95571.1| polyubiquitin [Exophiala mesophila]
 gb|KIW22916.1| polyubiquitin [Cladophialophora immunda]
 gb|KIW83318.1| polyubiquitin [Fonsecaea pedrosoi CBS 271.37]
 gb|KIW87781.1| polyubiquitin [Cladophialophora bantiana CBS 173.52]
 gb|KIX98997.1| polyubiquitin [Fonsecaea multimorphosa CBS 102226]
Length=229

 Score =   408 bits (1049),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 205/214 (96%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ  214


 Score =   298 bits (763),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 148/152 (97%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  513
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  228



>gb|AAB95252.1| ubiquitin [Arabidopsis thaliana]
Length=380

 Score =   414 bits (1064),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  333  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYDIQ  366


 Score =   412 bits (1058),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 209/214 (98%), Positives = 209/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ LI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQWLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   412 bits (1058),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 209/214 (98%), Positives = 209/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQWLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  290


 Score =   301 bits (770),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 151/152 (99%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  513
            FAGKQLEDGRTLADY+IQKESTLHLVLRLRGG
Sbjct  349  FAGKQLEDGRTLADYDIQKESTLHLVLRLRGG  380



>ref|XP_010696408.1| PREDICTED: polyubiquitin 4 [Beta vulgaris subsp. vulgaris]
Length=382

 Score =   414 bits (1065),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   414 bits (1065),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  290


 Score =   412 bits (1060),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 209/214 (98%), Positives = 209/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKT  332

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  333  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  366


 Score =   301 bits (770),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 151/152 (99%), Positives = 151/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  348

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  513
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>ref|XP_002266370.1| PREDICTED: polyubiquitin 4-like [Vitis vinifera]
Length=383

 Score =   414 bits (1065),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   414 bits (1065),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  290


 Score =   414 bits (1065),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  333  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  366


 Score =   303 bits (775),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  513
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>ref|XP_006302388.1| hypothetical protein CARUB_v10020456mg [Capsella rubella]
 gb|EOA35286.1| hypothetical protein CARUB_v10020456mg [Capsella rubella]
Length=383

 Score =   414 bits (1065),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   414 bits (1065),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  290


 Score =   414 bits (1065),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  333  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  366


 Score =   303 bits (775),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  513
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>ref|XP_010911599.1| PREDICTED: polyubiquitin 4 [Elaeis guineensis]
Length=384

 Score =   414 bits (1065),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   414 bits (1065),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  290


 Score =   414 bits (1065),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  333  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  366


 Score =   303 bits (775),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  513
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>gb|AAO43308.1| putative polyubiquitin [Arabidopsis thaliana]
Length=250

 Score =   409 bits (1051),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 208/214 (97%), Positives = 208/214 (97%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  21   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  80

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLI
Sbjct  81   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEWIPPDQQRLI  140

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  141  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  200

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL  Y IQ
Sbjct  201  KIQDKEGIPPDQQRLIFAGKQLEDGRTLAVYNIQ  234


 Score =   304 bits (778),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 153/158 (97%), Positives = 153/158 (97%), Gaps = 0/158 (0%)
 Frame = +1

Query  226  ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ  405
            ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ
Sbjct  1    ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ  60

Query  406  QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTID  585
            QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTID
Sbjct  61   QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTID  120

Query  586  NVKAKIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            NVKAKIQDKE IPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  121  NVKAKIQDKEWIPPDQQRLIFAGKQLEDGRTLADYNIQ  158


 Score =   297 bits (761),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  97   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEWIPPDQQRLIFAGKQLEDGRTLADYN  156

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  157  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  216

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  513
            FAGKQLEDGRTLA YNIQKESTLHLVLRLRGG
Sbjct  217  FAGKQLEDGRTLAVYNIQKESTLHLVLRLRGG  248



>ref|XP_003607669.1| Multidrug resistance protein ABC transporter family [Medicago 
truncatula]
Length=448

 Score =   417 bits (1071),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 211/216 (98%), Positives = 211/216 (98%), Gaps = 0/216 (0%)
 Frame = +1

Query  52   LKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  231
             KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  218  FKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  277

Query  232  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  411
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  278  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  337

Query  412  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV  591
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV
Sbjct  338  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV  397

Query  592  KAKIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KAKIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  398  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  433


 Score =   303 bits (776),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  296  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  355

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  356  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  415

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  513
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  416  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  447



>ref|XP_010452435.1| PREDICTED: polyubiquitin-like [Camelina sativa]
Length=305

 Score =   411 bits (1057),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 208/214 (97%), Positives = 209/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQD+EGIPPDQQR I
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDQEGIPPDQQRFI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   411 bits (1057),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 208/214 (97%), Positives = 209/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQD+EGIPPDQQR IFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDQEGIPPDQQRFIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  290


 Score =   303 bits (775),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  516
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  305



>ref|XP_009605659.1| PREDICTED: polyubiquitin [Nicotiana tomentosiformis]
Length=305

 Score =   411 bits (1057),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 209/214 (98%), Positives = 209/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLED RTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDERTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   411 bits (1057),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 209/214 (98%), Positives = 209/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED RTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDERTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  290


 Score =   303 bits (776),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  516
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  305



>ref|XP_010421267.1| PREDICTED: polyubiquitin 4-like [Camelina sativa]
Length=382

 Score =   414 bits (1064),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   414 bits (1064),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  290


 Score =   413 bits (1061),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 209/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKE+TLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKETTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  333  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  366


 Score =   301 bits (772),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 151/152 (99%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKE+TLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKETTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  513
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>gb|KJB13592.1| hypothetical protein B456_002G083000 [Gossypium raimondii]
Length=385

 Score =   414 bits (1065),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   414 bits (1065),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  290


 Score =   414 bits (1065),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  333  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  366


 Score =   303 bits (777),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 152/155 (98%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  522
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG ++
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGFRM  383



>ref|XP_719867.1| hypothetical protein CaO19.6771 [Candida albicans SC5314]
 ref|XP_719750.1| hypothetical protein CaO19.14063 [Candida albicans SC5314]
 emb|CAA76783.1| polyubiquitin [Candida albicans]
 gb|EAL00878.1| hypothetical protein CaO19.14063 [Candida albicans SC5314]
 gb|EAL01003.1| hypothetical protein CaO19.6771 [Candida albicans SC5314]
 gb|EEQ44747.1| hypothetical protein CAWG_03035 [Candida albicans WO-1]
 emb|CCE42351.1| hypothetical protein CPAR2_809000 [Candida parapsilosis]
 gb|EMG49099.1| hypothetical protein G210_0209 [Candida maltosa Xu316]
 gb|KHC79264.1| polyubiquitin [Candida albicans SC5314]
Length=229

 Score =   408 bits (1049),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 205/214 (96%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ  214


 Score =   298 bits (763),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 148/153 (97%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  516
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGF  229



>gb|EMS65864.1| Polyubiquitin [Triticum urartu]
Length=405

 Score =   415 bits (1066),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   415 bits (1066),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  290


 Score =   415 bits (1066),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  333  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  366


 Score =   304 bits (778),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 154/163 (94%), Positives = 157/163 (96%), Gaps = 2/163 (1%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG--MQIFVKTLT  540
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  M  +V+  +
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGHVMHRYVRLFS  391



>emb|CAB81074.1| polyubiquitin (ubq10) [Arabidopsis thaliana]
Length=464

 Score =   417 bits (1072),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   417 bits (1072),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  290


 Score =   417 bits (1072),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  333  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  366


 Score =   367 bits (943),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 186/186 (100%), Positives = 186/186 (100%), Gaps = 0/186 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  408

Query  598  KIQDKE  615
            KIQDKE
Sbjct  409  KIQDKE  414



>gb|KII93501.1| hypothetical protein PLICRDRAFT_694663 [Plicaturopsis crispa 
FD-325 SS-3]
Length=348

 Score =   413 bits (1061),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 208/214 (97%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  44   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  103

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  104  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  163

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  164  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  223

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  224  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ  257


 Score =   413 bits (1061),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 208/214 (97%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  120  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  179

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  180  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  239

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  240  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  299

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  300  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ  333


 Score =   301 bits (771),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  196  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  255

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  315

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  513
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  316  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  347



>ref|XP_001783045.1| predicted protein [Physcomitrella patens]
 gb|EDQ52114.1| predicted protein [Physcomitrella patens]
Length=229

 Score =   408 bits (1049),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 207/214 (97%), Positives = 207/214 (97%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKT  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   299 bits (765),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  513
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>ref|XP_010493589.1| PREDICTED: polyubiquitin-like [Camelina sativa]
Length=430

 Score =   416 bits (1068),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  200  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  259

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  260  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  319

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  320  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  379

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  380  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  413


 Score =   416 bits (1068),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 210/216 (97%), Positives = 210/216 (97%), Gaps = 0/216 (0%)
 Frame = +1

Query  52   LKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  231
             KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  46   FKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  105

Query  232  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  411
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  106  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  165

Query  412  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV  591
            LIFAGKQLEDG TLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV
Sbjct  166  LIFAGKQLEDGHTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV  225

Query  592  KAKIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KAKIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  226  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  261


 Score =   414 bits (1063),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 209/214 (98%), Positives = 209/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG TLADYN
Sbjct  124  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGHTLADYN  183

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  184  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  243

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  244  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  303

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  304  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  337


 Score =   304 bits (778),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  276  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  335

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  336  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  395

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  513
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  396  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  427



>emb|CEP60563.1| LALA0S01e13784g1_1 [Lachancea lanzarotensis]
Length=229

 Score =   408 bits (1049),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 205/214 (96%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ  214


 Score =   298 bits (764),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 148/153 (97%), Positives = 153/153 (100%), Gaps = 0/153 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  516
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG+
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGI  229



>ref|XP_008020911.1| hypothetical protein SETTUDRAFT_162442 [Setosphaeria turcica 
Et28A]
 gb|EOA91885.1| hypothetical protein SETTUDRAFT_162442 [Setosphaeria turcica 
Et28A]
Length=305

 Score =   411 bits (1056),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 207/214 (97%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   411 bits (1056),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 207/214 (97%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS  256

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  290


 Score =   301 bits (770),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  272

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  513
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>ref|XP_011048569.1| PREDICTED: polyubiquitin 3-like [Populus euphratica]
Length=306

 Score =   411 bits (1056),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 208/214 (97%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQK+STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKDSTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLE+GRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEEGRTLADYNIQ  214


 Score =   411 bits (1056),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 208/214 (97%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQK+STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKDSTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLE+GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEEGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  290


 Score =   301 bits (771),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 151/152 (99%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLE+GRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEEGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  513
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>ref|XP_001755431.1| predicted protein [Physcomitrella patens]
 gb|EDQ79911.1| predicted protein [Physcomitrella patens]
Length=231

 Score =   408 bits (1049),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 207/214 (97%), Positives = 207/214 (97%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKT  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   296 bits (758),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 149/151 (99%), Positives = 149/151 (99%), Gaps = 0/151 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRG  510
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRG
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRG  227



>ref|XP_009631616.1| PREDICTED: polyubiquitin-like [Nicotiana tomentosiformis]
Length=381

 Score =   414 bits (1063),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 209/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDN+KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNIKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  333  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  366


 Score =   409 bits (1052),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 207/214 (97%), Positives = 209/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE+SDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVENSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDG TLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDN+KA
Sbjct  121  FAGKQLEDGCTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNIKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   409 bits (1052),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 207/214 (97%), Positives = 209/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVE+SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG TLADYN
Sbjct  77   MQIFVKTLTGKTITLEVENSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGCTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDN+KAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNIKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  290


 Score =   303 bits (776),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  516
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  381



>gb|AAX40652.1| polyubiquitin [Oryza sativa Japonica Group]
Length=381

 Score =   414 bits (1063),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 209/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ L+FAGKQLEDGRTL DY IQ
Sbjct  257  KIQDKEGIPPDQQRLVFAGKQLEDGRTLADYNIQ  290


 Score =   414 bits (1063),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 209/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL+
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLV  272

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  333  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  366


 Score =   412 bits (1058),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 209/214 (98%), Positives = 209/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVE SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVEFSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   303 bits (776),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 153/153 (100%), Gaps = 0/153 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL+FAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLVFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  516
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGL  381



>ref|XP_009358096.1| PREDICTED: polyubiquitin isoform X1 [Pyrus x bretschneideri]
 ref|XP_009343084.1| PREDICTED: polyubiquitin isoform X1 [Pyrus x bretschneideri]
Length=401

 Score =   414 bits (1065),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  21   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  80

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  81   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  140

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  141  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  200

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  201  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  234


 Score =   414 bits (1065),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  97   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  156

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  157  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  216

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  217  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  276

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  277  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  310


 Score =   414 bits (1065),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  173  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  232

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  233  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  292

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  293  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  352

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  353  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  386


 Score =   303 bits (776),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  249  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  308

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  309  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  368

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  516
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  369  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  401



>dbj|GAK65396.1| ubiquitin [Pseudozyma antarctica]
Length=334

 Score =   412 bits (1058),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 208/214 (97%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  30   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  89

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  90   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  149

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  150  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  209

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  210  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ  243


 Score =   412 bits (1058),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 208/214 (97%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  106  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  165

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  166  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  225

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  226  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  285

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  286  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ  319


 Score =   300 bits (769),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  182  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  241

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  242  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  301

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  513
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  302  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  333



>ref|NP_001053957.1| Os04g0628100 [Oryza sativa Japonica Group]
 dbj|BAF15871.1| Os04g0628100 [Oryza sativa Japonica Group]
Length=392

 Score =   414 bits (1064),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  88   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  147

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  148  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  207

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  208  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  267

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  268  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  301


 Score =   414 bits (1064),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  164  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  223

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  224  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  283

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  284  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  343

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  344  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  377


 Score =   412 bits (1058),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 209/216 (97%), Positives = 210/216 (97%), Gaps = 0/216 (0%)
 Frame = +1

Query  52   LKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  231
             +MQIFVKTLTGKTITLEVE SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  10   FQMQIFVKTLTGKTITLEVEFSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  69

Query  232  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  411
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  70   YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  129

Query  412  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV  591
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV
Sbjct  130  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV  189

Query  592  KAKIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KAKIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  190  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  225


 Score =   303 bits (777),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 153/153 (100%), Gaps = 0/153 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  240  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  299

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  300  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  359

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  516
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  360  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGL  392



>gb|KJB62483.1| hypothetical protein B456_009G418900 [Gossypium raimondii]
Length=381

 Score =   414 bits (1063),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 209/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  333  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  366


 Score =   412 bits (1059),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 208/214 (97%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  290


 Score =   411 bits (1056),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 207/214 (97%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   303 bits (776),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  513
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>ref|XP_001797032.1| hypothetical protein SNOG_06667 [Phaeosphaeria nodorum SN15]
 gb|EAT86498.1| hypothetical protein SNOG_06667 [Phaeosphaeria nodorum SN15]
Length=234

 Score =   408 bits (1048),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 205/214 (96%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ  214


 Score =   298 bits (762),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 148/152 (97%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  513
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  228



>gb|AGZ15412.1| fiber polyubiquitin [Phaseolus vulgaris]
Length=229

 Score =   407 bits (1047),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 208/214 (97%), Positives = 208/214 (97%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES DTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESFDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDG TL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGCTLADYNIQ  214


 Score =   286 bits (732),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 146/153 (95%), Positives = 146/153 (95%), Gaps = 0/153 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES DTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESFDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  516
            FAGKQLEDG TLADYNIQKE TL LVL  RGG 
Sbjct  197  FAGKQLEDGCTLADYNIQKEFTLPLVLCFRGGF  229



>gb|AAN31845.1| putative polyubiquitin (UBQ10) [Arabidopsis thaliana]
Length=464

 Score =   416 bits (1070),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   416 bits (1070),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  290


 Score =   416 bits (1070),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  333  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  366


 Score =   379 bits (973),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 191/192 (99%), Positives = 191/192 (99%), Gaps = 0/192 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  408

Query  598  KIQDKEGIPPXQ  633
            KIQDKEGIPP Q
Sbjct  409  KIQDKEGIPPDQ  420



>ref|XP_003607668.1| Multidrug resistance protein ABC transporter family [Medicago 
truncatula]
Length=497

 Score =   417 bits (1072),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 211/216 (98%), Positives = 211/216 (98%), Gaps = 0/216 (0%)
 Frame = +1

Query  52   LKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  231
             KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  218  FKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  277

Query  232  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  411
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  278  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  337

Query  412  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV  591
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV
Sbjct  338  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV  397

Query  592  KAKIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KAKIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  398  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  433


 Score =   333 bits (854),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 168/168 (100%), Positives = 168/168 (100%), Gaps = 0/168 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  296  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  355

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  356  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  415

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE  561
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE
Sbjct  416  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE  463



>ref|XP_001764949.1| predicted protein [Physcomitrella patens]
 gb|EDQ70165.1| predicted protein [Physcomitrella patens]
Length=318

 Score =   410 bits (1055),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 208/214 (97%), Positives = 208/214 (97%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKT  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   409 bits (1050),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 207/214 (97%), Positives = 207/214 (97%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKT  256

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  290


 Score =   310 bits (793),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 157/166 (95%), Positives = 158/166 (95%), Gaps = 0/166 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  272

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTIT  555
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM+I   TL  K IT
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMEIIEDTLASKIIT  318



>ref|XP_002953480.1| polyubiquitin [Volvox carteri f. nagariensis]
 gb|EFJ45453.1| polyubiquitin [Volvox carteri f. nagariensis]
Length=305

 Score =   410 bits (1053),  Expect = 9e-141, Method: Compositional matrix adjust.
 Identities = 207/214 (97%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTI+NVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIENVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTI+NVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIENVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   410 bits (1053),  Expect = 9e-141, Method: Compositional matrix adjust.
 Identities = 207/214 (97%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTI+NVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIENVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTI+NVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIENVKA  256

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  290


 Score =   301 bits (770),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 153/153 (100%), Gaps = 0/153 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTI+NVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIENVKAKIQDKEGIPPDQQRLI  272

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  516
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGL  305



>ref|XP_001830230.1| ubiquitin [Coprinopsis cinerea okayama7#130]
 gb|EAU91601.1| ubiquitin [Coprinopsis cinerea okayama7#130]
Length=305

 Score =   410 bits (1053),  Expect = 9e-141, Method: Compositional matrix adjust.
 Identities = 207/214 (97%), Positives = 209/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ  214


 Score =   410 bits (1053),  Expect = 9e-141, Method: Compositional matrix adjust.
 Identities = 207/214 (97%), Positives = 209/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ  290


 Score =   300 bits (769),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  516
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  273  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGF  305



>gb|EGO00841.1| hypothetical protein SERLA73DRAFT_121253 [Serpula lacrymans var. 
lacrymans S7.3]
Length=371

 Score =   412 bits (1059),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 208/214 (97%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  143  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  202

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  203  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  262

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  263  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  322

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  323  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ  356


 Score =   382 bits (982),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 197/214 (92%), Positives = 199/214 (93%), Gaps = 10/214 (5%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ   
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQH--  118

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
                    GRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  119  --------GRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  170

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  171  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ  204


 Score =   382 bits (982),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 197/214 (92%), Positives = 199/214 (93%), Gaps = 10/214 (5%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ           GRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQH----------GRTLSDYN  126

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  127  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  186

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  187  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  246

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  247  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ  280


 Score =   301 bits (770),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  219  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  278

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  279  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  338

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  513
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  339  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  370



>ref|XP_004956019.1| PREDICTED: polyubiquitin 4-like [Setaria italica]
Length=381

 Score =   412 bits (1060),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 209/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTID+VKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDHVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   412 bits (1060),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 209/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTID+VKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDHVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  290


 Score =   412 bits (1060),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 209/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTID+VKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDHVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  333  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  366


 Score =   303 bits (776),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  513
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>gb|ADD52202.1| ubiquitin [Catharanthus roseus]
 gb|AEK98798.1| ubiquitin [Carthamus tinctorius]
Length=381

 Score =   412 bits (1060),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 209/214 (98%), Positives = 209/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LI AGKQLEDGRTL DY IQ
Sbjct  333  KIQDKEGIPPDQQRLILAGKQLEDGRTLADYNIQ  366


 Score =   410 bits (1053),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 208/214 (97%), Positives = 208/214 (97%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDT DNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD N
Sbjct  77   MQIFVKTLTGKTITLEVESSDTTDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADCN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  290


 Score =   408 bits (1048),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 207/214 (97%), Positives = 207/214 (97%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAK QDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKTQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDT DNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTTDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLAD NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADCNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   301 bits (770),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  516
             AGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  349  LAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  381



>gb|AIS40894.1| polyubiquitin [Kalanchoe fedtschenkoi]
Length=470

 Score =   416 bits (1068),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 211/215 (98%), Positives = 211/215 (98%), Gaps = 0/215 (0%)
 Frame = +1

Query  55   KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  234
            KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  13   KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  72

Query  235  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  414
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  73   NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  132

Query  415  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  594
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  133  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  192

Query  595  AKIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            AKIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  193  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  227


 Score =   414 bits (1064),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  90   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  149

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  150  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  209

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  210  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  269

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  270  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  303


 Score =   414 bits (1064),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  166  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  225

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  226  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  285

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  286  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  345

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  346  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  379


 Score =   414 bits (1064),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  242  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  301

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  302  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  361

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  362  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  421

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  422  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  455


 Score =   303 bits (775),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  318  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  377

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  437

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  513
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  438  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  469



>ref|XP_003052575.1| predicted protein [Nectria haematococca mpVI 77-13-4]
 gb|EEU46862.1| predicted protein [Nectria haematococca mpVI 77-13-4]
 gb|ENH62031.1| Polyubiquitin [Fusarium oxysporum f. sp. cubense race 1]
 gb|EWG38736.1| polyubiquitin [Fusarium verticillioides 7600]
 gb|EWY88137.1| ubiquitin C [Fusarium oxysporum FOSC 3-a]
 gb|EWZ87537.1| ubiquitin C [Fusarium oxysporum f. sp. lycopersici MN25]
 gb|EXA41161.1| ubiquitin C [Fusarium oxysporum f. sp. pisi HDV247]
 gb|EXK33938.1| ubiquitin C [Fusarium oxysporum f. sp. melonis 26406]
 gb|EXK99281.1| ubiquitin C [Fusarium oxysporum f. sp. raphani 54005]
 gb|EXL44710.1| ubiquitin C [Fusarium oxysporum f. sp. radicis-lycopersici 26381]
 gb|EXL88175.1| ubiquitin C [Fusarium oxysporum f. sp. conglutinans race 2 54008]
 gb|EXM08998.1| ubiquitin C [Fusarium oxysporum f. sp. cubense tropical race 
4 54006]
 gb|EXM34538.1| ubiquitin C [Fusarium oxysporum f. sp. vasinfectum 25433]
 gb|KIL89583.1| polyubiquitin [Fusarium avenaceum]
Length=305

 Score =   409 bits (1052),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 206/214 (96%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ  214


 Score =   409 bits (1052),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 206/214 (96%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS  256

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ  290


 Score =   298 bits (763),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 148/152 (97%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  272

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  513
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  273  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  304



>ref|XP_009108753.1| PREDICTED: polyubiquitin 11-like [Brassica rapa]
Length=229

 Score =   406 bits (1044),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 206/214 (96%), Positives = 207/214 (97%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKE+ LHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKETNLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK LTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKNLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKE IPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEDIPPDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   298 bits (763),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 150/153 (98%), Gaps = 0/153 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVK LTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKNLTGKTITLEVESSDTIDNVKAKIQDKEDIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  516
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  229



>ref|XP_007154492.1| hypothetical protein PHAVU_003G123400g [Phaseolus vulgaris]
 gb|ESW26486.1| hypothetical protein PHAVU_003G123400g [Phaseolus vulgaris]
Length=358

 Score =   411 bits (1057),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 209/214 (98%), Positives = 209/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQ ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQMESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   387 bits (993),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 209/267 (78%), Positives = 209/267 (78%), Gaps = 53/267 (20%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEG---------  390
            IQ ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEG         
Sbjct  137  IQMESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  391  --------------------------------------------IPPDQQRLIFAGKQLE  438
                                                        IPPDQQRLIFAGKQLE
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFAKIQDKEGIPPDQQRLIFAGKQLE  256

Query  439  DGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEG  618
            DGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEG
Sbjct  257  DGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEG  316

Query  619  IPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            IPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  317  IPPDQQRLIFAGKQLEDGRTLADYNIQ  343


 Score =   278 bits (712),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 152/206 (74%), Positives = 153/206 (74%), Gaps = 53/206 (26%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEG-------------------------  162
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEG                         
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  163  ----------------------------IPPDQQRLIFAGKQLEDGRTLADYNIQKESTL  258
                                        IPPDQQRLIFAGKQLEDGRTLADYNIQKESTL
Sbjct  213  IQKESTLHLVLRLRGGMQIFAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTL  272

Query  259  HLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLE  438
            HLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLE
Sbjct  273  HLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLE  332

Query  439  DGRTLADYNIQKESTLHLVLRLRGGM  516
            DGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  333  DGRTLADYNIQKESTLHLVLRLRGGL  358



>ref|XP_001880135.1| ubiquitin [Laccaria bicolor S238N-H82]
 ref|XP_007307861.1| ubiquitin [Stereum hirsutum FP-91666 SS1]
 ref|XP_007843605.1| ubiquitin [Moniliophthora roreri MCA 2997]
 ref|XP_009541704.1| hypothetical protein HETIRDRAFT_469462 [Heterobasidion irregulare 
TC 32-1]
 ref|XP_009547126.1| hypothetical protein HETIRDRAFT_409860 [Heterobasidion irregulare 
TC 32-1]
 emb|CAA80851.1| ubiquitin [Phanerochaete chrysosporium]
 gb|EDR08822.1| ubiquitin [Laccaria bicolor S238N-H82]
 gb|EIM82624.1| ubiquitin [Stereum hirsutum FP-91666 SS1]
 gb|ESK97130.1| ubiquitin [Moniliophthora roreri MCA 2997]
 gb|ETW80366.1| hypothetical protein HETIRDRAFT_409860 [Heterobasidion irregulare 
TC 32-1]
 gb|ETW87847.1| hypothetical protein HETIRDRAFT_469462 [Heterobasidion irregulare 
TC 32-1]
 gb|KDR75791.1| hypothetical protein GALMADRAFT_248496 [Galerina marginata CBS 
339.88]
 gb|KIK67299.1| hypothetical protein GYMLUDRAFT_37383 [Gymnopus luxurians FD-317 
M1]
 gb|KIY66896.1| ubiquitin, partial [Cylindrobasidium torrendii FP15055 ss-10]
Length=381

 Score =   412 bits (1059),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 208/214 (97%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ  214


 Score =   412 bits (1059),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 208/214 (97%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ  290


 Score =   412 bits (1059),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 208/214 (97%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  333  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ  366


 Score =   301 bits (772),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 153/153 (100%), Gaps = 0/153 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  288

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  516
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG+
Sbjct  349  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGL  381



>dbj|GAA27344.2| polyubiquitin-A [Clonorchis sinensis]
Length=288

 Score =   409 bits (1050),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 203/214 (95%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVE+SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  61   MQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  120

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTI+NVKAKIQDKEGIPPDQQRLI
Sbjct  121  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIENVKAKIQDKEGIPPDQQRLI  180

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE+SDTI+NVKA
Sbjct  181  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKA  240

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  241  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ  274


 Score =   298 bits (764),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 147/152 (97%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  137  MQIFVKTLTGKTITLEVESSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  196

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE+SDTI+NVKAKIQDKEGIPPDQQRLI
Sbjct  197  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLI  256

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  513
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  257  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  288


 Score =   263 bits (673),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 131/141 (93%), Positives = 135/141 (96%), Gaps = 0/141 (0%)
 Frame = +1

Query  277  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  456
            R  MQIFVKTLTGKTITLEVE+SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+
Sbjct  58   RTAMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLS  117

Query  457  DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPXQQ  636
            DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTI+NVKAKIQDKEGIPP QQ
Sbjct  118  DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIENVKAKIQDKEGIPPDQQ  177

Query  637  XLIFAGKQLEDGRTLPDYXIQ  699
             LIFAGKQLEDGRTL DY IQ
Sbjct  178  RLIFAGKQLEDGRTLSDYNIQ  198



>gb|KIJ68260.1| hypothetical protein HYDPIDRAFT_173033 [Hydnomerulius pinastri 
MD-312]
Length=381

 Score =   412 bits (1059),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 208/214 (97%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ  214


 Score =   412 bits (1059),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 208/214 (97%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ  290


 Score =   412 bits (1059),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 208/214 (97%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  333  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ  366


 Score =   301 bits (770),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  288

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  516
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  349  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGC  381



>gb|AFR98116.1| polyubiquitin [Cryptococcus neoformans var. grubii H99]
Length=381

 Score =   412 bits (1059),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 208/214 (97%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ  214


 Score =   412 bits (1059),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 208/214 (97%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ  290


 Score =   412 bits (1059),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 208/214 (97%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  333  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ  366


 Score =   303 bits (776),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 153/153 (100%), Gaps = 0/153 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  288

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  516
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGM
Sbjct  349  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  381



>ref|XP_010436682.1| PREDICTED: polyubiquitin 4-like [Camelina sativa]
Length=462

 Score =   415 bits (1067),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  157  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  216

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  217  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  276

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  277  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  336

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  337  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  370


 Score =   415 bits (1067),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  233  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  292

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  293  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  352

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  353  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  412

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  413  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  446


 Score =   413 bits (1062),  Expect = 9e-140, Method: Compositional matrix adjust.
 Identities = 209/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            +QIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  81   IQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  140

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  141  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  200

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  201  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  260

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  261  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  294


 Score =   381 bits (979),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 194/214 (91%), Positives = 202/214 (94%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQI  KTLT KTITL+V+SSDTI+NVKA+IQD+EGIP DQQRLIF+GK L+DG TLADYN
Sbjct  5    MQIHAKTLTEKTITLDVKSSDTINNVKAQIQDREGIPLDQQRLIFSGKLLDDGLTLADYN  64

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKES LHL LRLRGG+QIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  65   IQKESILHLALRLRGGIQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  124

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  125  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  184

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  185  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  218


 Score =   303 bits (777),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  309  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  368

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  369  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  428

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  513
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  429  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  460



>gb|EUC59758.1| polyubiquitin [Rhizoctonia solani AG-3 Rhs1AP]
 gb|KEP54806.1| polyubiquitin [Rhizoctonia solani 123E]
Length=381

 Score =   412 bits (1059),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 208/214 (97%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ  214


 Score =   412 bits (1059),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 208/214 (97%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ  290


 Score =   412 bits (1059),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 208/214 (97%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  333  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ  366


 Score =   301 bits (770),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  288

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  513
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  349  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  380



>ref|XP_003010029.1| polyubiquitin UbiD/Ubi4, putative [Arthroderma benhamiae CBS 
112371]
 ref|XP_003170928.1| ubiquitin [Microsporum gypseum CBS 118893]
 ref|XP_003232289.1| polyubiquitin [Trichophyton rubrum CBS 118892]
 gb|EFE29389.1| polyubiquitin UbiD/Ubi4, putative [Arthroderma benhamiae CBS 
112371]
 gb|EFR03920.1| ubiquitin [Microsporum gypseum CBS 118893]
 gb|EGD90914.1| polyubiquitin [Trichophyton rubrum CBS 118892]
 gb|EGD97992.1| polyubiquitin [Trichophyton tonsurans CBS 112818]
 gb|EGE04992.1| ubiquitin [Trichophyton equinum CBS 127.97]
 gb|EZF26278.1| polyubiquitin [Trichophyton rubrum MR850]
 gb|EZF31874.1| polyubiquitin [Trichophyton interdigitale H6]
 gb|EZF45312.1| polyubiquitin [Trichophyton rubrum CBS 100081]
 gb|EZF56062.1| polyubiquitin [Trichophyton rubrum CBS 288.86]
 gb|EZF66560.1| polyubiquitin [Trichophyton rubrum CBS 289.86]
 gb|EZF77169.1| polyubiquitin [Trichophyton soudanense CBS 452.61]
 gb|EZF87859.1| polyubiquitin [Trichophyton rubrum MR1448]
 gb|EZG09817.1| polyubiquitin [Trichophyton rubrum CBS 735.88]
 gb|EZG20358.1| polyubiquitin [Trichophyton rubrum CBS 202.88]
 gb|KDB20983.1| polyubiquitin [Trichophyton interdigitale MR816]
 gb|KDB37038.1| polyubiquitin [Trichophyton rubrum D6]
Length=229

 Score =   406 bits (1044),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 205/214 (96%), Positives = 207/214 (97%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKT  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ  214


 Score =   296 bits (759),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 148/152 (97%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  513
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  228



>gb|KIM40192.1| hypothetical protein M413DRAFT_73842 [Hebeloma cylindrosporum 
h7]
Length=381

 Score =   412 bits (1059),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 208/214 (97%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ  214


 Score =   412 bits (1059),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 208/214 (97%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ  290


 Score =   409 bits (1052),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 207/214 (97%), Positives = 209/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES DTIDNVKA
Sbjct  273  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESLDTIDNVKA  332

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  333  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ  366


 Score =   298 bits (764),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 149/153 (97%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  288

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES DTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESLDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  516
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG+
Sbjct  349  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGL  381



>gb|KDR85168.1| hypothetical protein GALMADRAFT_131895 [Galerina marginata CBS 
339.88]
Length=381

 Score =   412 bits (1059),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 208/214 (97%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ  214


 Score =   412 bits (1059),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 208/214 (97%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ  290


 Score =   412 bits (1059),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 208/214 (97%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  333  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ  366


 Score =   300 bits (769),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  288

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  513
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  349  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  380



>ref|XP_002551324.1| ubiquitin [Candida tropicalis MYA-3404]
 gb|EER30626.1| ubiquitin [Candida tropicalis MYA-3404]
Length=299

 Score =   409 bits (1051),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 205/214 (96%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ  214


 Score =   407 bits (1046),  Expect = 9e-140, Method: Compositional matrix adjust.
 Identities = 204/213 (96%), Positives = 209/213 (98%), Gaps = 0/213 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS  256

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXI  696
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY I
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI  289


 Score =   272 bits (695),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 135/143 (94%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  272

Query  418  FAGKQLEDGRTLADYNIQKESTL  486
            FAGKQLEDGRTL+DYNI K++ L
Sbjct  273  FAGKQLEDGRTLSDYNISKKNLL  295



>ref|XP_007864655.1| ubiquitin [Gloeophyllum trabeum ATCC 11539]
 gb|EPQ57585.1| ubiquitin [Gloeophyllum trabeum ATCC 11539]
 gb|KIP08465.1| hypothetical protein PHLGIDRAFT_18910 [Phlebiopsis gigantea 11061_1 
CR5-6]
Length=381

 Score =   412 bits (1059),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 208/214 (97%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ  214


 Score =   412 bits (1059),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 208/214 (97%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ  290


 Score =   412 bits (1059),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 208/214 (97%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  333  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ  366


 Score =   301 bits (770),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  288

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  516
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  349  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGF  381



>ref|XP_010324326.1| PREDICTED: polyubiquitin isoform X1 [Solanum lycopersicum]
Length=457

 Score =   415 bits (1066),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   411 bits (1057),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 209/214 (98%), Positives = 209/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIP  QQ LIFAGKQLEDGRTL DY IQ
Sbjct  257  KIQDKEGIPSDQQRLIFAGKQLEDGRTLADYNIQ  290


 Score =   411 bits (1057),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 209/214 (98%), Positives = 209/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP DQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPSDQQRLI  272

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  333  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  366


 Score =   411 bits (1057),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 209/214 (98%), Positives = 209/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP DQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPSDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  408

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  409  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  442


 Score =   303 bits (777),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  305  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  364

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  365  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  424

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  516
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  425  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  457



>gb|AAB95251.1| ubiquitin [Arabidopsis thaliana]
Length=456

 Score =   415 bits (1066),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   415 bits (1066),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  290


 Score =   415 bits (1066),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  333  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  366


 Score =   415 bits (1066),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  408

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  409  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  442


 Score =   303 bits (776),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  305  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  364

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  365  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  424

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  513
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  425  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  456



>ref|XP_008441422.1| PREDICTED: LOW QUALITY PROTEIN: polyubiquitin-like [Cucumis melo]
Length=457

 Score =   415 bits (1066),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   414 bits (1063),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 209/214 (98%), Positives = 209/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF KTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFCKTLTGKTITLEVESSDTIDNVKA  256

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  290


 Score =   414 bits (1063),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 209/214 (98%), Positives = 209/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIF KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFCKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  333  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  366


 Score =   414 bits (1063),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 209/214 (98%), Positives = 209/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIF KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFCKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  408

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  409  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  442


 Score =   303 bits (777),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  305  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  364

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  365  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  424

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  516
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  425  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  457



>gb|KDP42860.1| hypothetical protein JCGZ_23802 [Jatropha curcas]
Length=457

 Score =   415 bits (1066),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  408

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  409  KIQDKEGIPPVQQRLIFAGKQLEDGRTLADYNIQ  442


 Score =   414 bits (1065),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   414 bits (1065),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  290


 Score =   414 bits (1065),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  333  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  366


 Score =   300 bits (767),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  305  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  364

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP QQRLI
Sbjct  365  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPVQQRLI  424

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  516
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  425  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  457



>gb|EJU00136.1| ubiquitin [Dacryopinax sp. DJM-731 SS1]
Length=381

 Score =   412 bits (1059),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 208/214 (97%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ  214


 Score =   412 bits (1059),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 208/214 (97%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ  290


 Score =   412 bits (1059),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 208/214 (97%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  333  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ  366


 Score =   300 bits (769),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  288

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  513
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  349  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  380



>ref|XP_003196661.1| ATP-dependent protein binding protein [Cryptococcus gattii WM276]
 gb|ADV24874.1| ATP-dependent protein binding protein, putative [Cryptococcus 
gattii WM276]
 gb|KGB77185.1| ubiquitin protein 1 [Cryptococcus gattii R265]
 gb|KIR55164.1| polyubiquitin [Cryptococcus gattii Ru294]
 gb|KIR75217.1| polyubiquitin [Cryptococcus gattii CA1014]
 gb|KIR79292.1| polyubiquitin [Cryptococcus gattii EJB2]
 gb|KIY35225.1| polyubiquitin [Cryptococcus gattii E566]
 gb|KJE05689.1| polyubiquitin [Cryptococcus gattii NT-10]
Length=381

 Score =   412 bits (1059),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 208/214 (97%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ  290


 Score =   412 bits (1059),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 208/214 (97%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  333  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ  366


 Score =   410 bits (1055),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 207/214 (97%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ  214


 Score =   300 bits (769),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  288

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  513
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  349  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  380



>ref|XP_009784908.1| PREDICTED: polyubiquitin-like isoform X2 [Nicotiana sylvestris]
Length=449

 Score =   414 bits (1065),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  408

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  409  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  442


 Score =   412 bits (1060),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 209/214 (98%), Positives = 209/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKT  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   412 bits (1060),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 209/214 (98%), Positives = 209/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  290


 Score =   412 bits (1060),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 209/214 (98%), Positives = 209/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  333  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  366


 Score =   289 bits (739),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 145/145 (100%), Positives = 145/145 (100%), Gaps = 0/145 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  305  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  364

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  365  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  424

Query  418  FAGKQLEDGRTLADYNIQKESTLHL  492
            FAGKQLEDGRTLADYNIQKESTLHL
Sbjct  425  FAGKQLEDGRTLADYNIQKESTLHL  449



>gb|EYU33607.1| hypothetical protein MIMGU_mgv1a004315mg [Erythranthe guttata]
Length=457

 Score =   415 bits (1066),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   415 bits (1066),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  290


 Score =   415 bits (1066),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  333  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  366


 Score =   415 bits (1066),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  408

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  409  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  442


 Score =   303 bits (777),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 153/153 (100%), Gaps = 0/153 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  305  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  364

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  365  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  424

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  516
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  425  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGV  457



>ref|NP_001045980.1| Os02g0161900 [Oryza sativa Japonica Group]
 ref|NP_001058378.1| Os06g0681400 [Oryza sativa Japonica Group]
 ref|XP_006646911.1| PREDICTED: polyubiquitin-like [Oryza brachyantha]
 gb|AAF01315.1|AF184279_1 polyubiquitin [Oryza sativa Indica Group]
 gb|AAF01316.1|AF184280_1 polyubiquitin [Oryza sativa Indica Group]
 emb|CAA53665.1| polyubiquitin [Oryza sativa Indica Group]
 gb|AAC49806.1| polyubiquitin [Oryza sativa Indica Group]
 dbj|BAD25213.1| polyubiquitin 6 [Oryza sativa Japonica Group]
 dbj|BAF07894.1| Os02g0161900 [Oryza sativa Japonica Group]
 dbj|BAF20292.1| Os06g0681400 [Oryza sativa Japonica Group]
 dbj|BAG95117.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC72542.1| hypothetical protein OsI_05955 [Oryza sativa Indica Group]
 gb|EEE56356.1| hypothetical protein OsJ_05481 [Oryza sativa Japonica Group]
 gb|ADB84621.1| polyubiquitin [Oryza sativa Japonica Group]
 gb|ADM86852.1| polyubiquitin [Oryza sativa Japonica Group]
 dbj|BAK06683.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gb|AEE65380.1| ubiquitin 2 [Panicum virgatum]
 gb|AFW66449.1| ubiquitin2 [Zea mays]
Length=457

 Score =   415 bits (1066),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   415 bits (1066),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  290


 Score =   415 bits (1066),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  333  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  366


 Score =   415 bits (1066),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  408

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  409  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  442


 Score =   303 bits (776),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  305  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  364

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  365  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  424

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  513
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  425  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  456



>dbj|BAK03691.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=457

 Score =   415 bits (1066),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  408

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  409  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  442


 Score =   414 bits (1065),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 209/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            K+QDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KVQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   414 bits (1065),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 209/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAK+QDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKVQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  290


 Score =   414 bits (1065),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 209/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAK+QDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKVQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  333  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  366


 Score =   303 bits (776),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  305  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  364

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  365  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  424

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  513
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  425  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  456



>ref|XP_007211609.1| hypothetical protein PRUPE_ppa005507mg [Prunus persica]
 gb|AAL27564.1|AF429430_1 polyubiquitin OUB2 [Olea europaea]
 gb|EMJ12808.1| hypothetical protein PRUPE_ppa005507mg [Prunus persica]
Length=457

 Score =   415 bits (1066),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  214


 Score =   415 bits (1066),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  290


 Score =   415 bits (1066),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  333  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  366


 Score =   415 bits (1066),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  408

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  409  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQ  442


 Score =   304 bits (778),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 153/153 (100%), Gaps = 0/153 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  305  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  364

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  365  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  424

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  516
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  425  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGL  457



>gb|KDQ30621.1| hypothetical protein PLEOSDRAFT_1088454 [Pleurotus ostreatus 
PC15]
Length=381

 Score =   412 bits (1059),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 208/214 (97%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ  214


 Score =   412 bits (1059),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 208/214 (97%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ  290


 Score =   412 bits (1059),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 208/214 (97%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  333  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ  366


 Score =   300 bits (769),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  288

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  513
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  349  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  380



>gb|KII92029.1| hypothetical protein PLICRDRAFT_172184 [Plicaturopsis crispa 
FD-325 SS-3]
Length=389

 Score =   412 bits (1059),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 208/214 (97%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  9    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  68

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  69   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  128

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  129  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  188

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  189  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ  222


 Score =   412 bits (1059),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 208/214 (97%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  85   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  144

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  145  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  204

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  205  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  264

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  265  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ  298


 Score =   412 bits (1059),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 208/214 (97%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  161  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  220

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  221  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  280

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  281  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  340

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  341  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ  374


 Score =   301 bits (772),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 153/153 (100%), Gaps = 0/153 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  237  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  296

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  297  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  356

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  516
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG+
Sbjct  357  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGL  389



>gb|KIM48035.1| hypothetical protein M413DRAFT_16078 [Hebeloma cylindrosporum 
h7]
Length=381

 Score =   412 bits (1059),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 208/214 (97%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ  290


 Score =   412 bits (1059),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 208/214 (97%), Positives = 210/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  212

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  333  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ  366


 Score =   410 bits (1055),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 207/214 (97%), Positives = 209/214 (98%), Gaps = 0/214 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLV RLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVFRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  597
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  598  KIQDKEGIPPXQQXLIFAGKQLEDGRTLPDYXIQ  699
            KIQDKEGIPP QQ LIFAGKQLEDGRTL DY IQ
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ  214


 Score =   300 bits (769),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  58   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  288

Query  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  417
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  418  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  513
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  349  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  380



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1521097577940