BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001O20

Length=637
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004229466.1|  PREDICTED: BSD domain-containing protein 1         194   6e-56   Solanum lycopersicum
ref|XP_006339426.1|  PREDICTED: BSD domain-containing protein 1-like    192   4e-55   Solanum tuberosum [potatoes]
ref|XP_009769832.1|  PREDICTED: BSD domain-containing protein 1-like    187   6e-53   Nicotiana sylvestris
ref|XP_009609401.1|  PREDICTED: BSD domain-containing protein 1-like    184   6e-52   Nicotiana tomentosiformis
ref|XP_010105696.1|  hypothetical protein L484_011308                   168   4e-46   Morus notabilis
ref|XP_006594442.1|  PREDICTED: BSD domain-containing protein C22...    157   1e-41   Glycine max [soybeans]
ref|XP_009352143.1|  PREDICTED: protein DOS2-like isoform X2            156   2e-41   Pyrus x bretschneideri [bai li]
ref|XP_009352142.1|  PREDICTED: protein DOS2-like isoform X1            156   3e-41   Pyrus x bretschneideri [bai li]
ref|XP_003594077.1|  BSD domain-containing protein                      152   9e-40   Medicago truncatula
ref|XP_002279111.1|  PREDICTED: BSD domain-containing protein 1-like    150   5e-39   Vitis vinifera
gb|KDP40072.1|  hypothetical protein JCGZ_02070                         149   5e-39   Jatropha curcas
ref|XP_008390800.1|  PREDICTED: protein DOS2-like                       149   6e-39   
ref|XP_009339936.1|  PREDICTED: protein DOS2-like                       147   3e-38   Pyrus x bretschneideri [bai li]
ref|XP_007222224.1|  hypothetical protein PRUPE_ppa005863mg             147   5e-38   Prunus persica
ref|XP_010279061.1|  PREDICTED: BSD domain-containing protein 1-like    146   1e-37   Nelumbo nucifera [Indian lotus]
ref|XP_008223041.1|  PREDICTED: protein DOS2                            145   2e-37   Prunus mume [ume]
ref|XP_004486098.1|  PREDICTED: clumping factor A-like                  144   6e-37   
ref|XP_007147818.1|  hypothetical protein PHAVU_006G157500g             144   1e-36   Phaseolus vulgaris [French bean]
ref|XP_002516813.1|  synapse-associated protein, putative               143   2e-36   
ref|XP_006597563.1|  PREDICTED: BSD domain-containing protein 1-like    142   4e-36   Glycine max [soybeans]
ref|XP_008340893.1|  PREDICTED: uncharacterized protein LOC103403823    141   8e-36   
ref|XP_010255803.1|  PREDICTED: LOW QUALITY PROTEIN: BSD domain-c...    139   8e-35   Nelumbo nucifera [Indian lotus]
ref|XP_011091054.1|  PREDICTED: protein DOS2-like                       136   3e-34   Sesamum indicum [beniseed]
ref|XP_010024448.1|  PREDICTED: BSD domain-containing protein 1-like    136   4e-34   Eucalyptus grandis [rose gum]
ref|XP_006850837.1|  hypothetical protein AMTR_s00025p00132420          137   5e-34   Amborella trichopoda
ref|XP_004297011.1|  PREDICTED: BSD domain-containing protein 1         135   5e-34   Fragaria vesca subsp. vesca
ref|XP_010524783.1|  PREDICTED: BSD domain-containing protein 1         133   7e-33   Tarenaya hassleriana [spider flower]
ref|XP_009420984.1|  PREDICTED: BSD domain-containing protein 1-like    133   8e-33   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDO98964.1|  unnamed protein product                                132   9e-33   Coffea canephora [robusta coffee]
gb|EYU43852.1|  hypothetical protein MIMGU_mgv1a018969mg                132   1e-32   Erythranthe guttata [common monkey flower]
ref|XP_008775272.1|  PREDICTED: BSD domain-containing protein C22...    130   2e-32   
gb|KGN57039.1|  hypothetical protein Csa_3G150190                       129   1e-31   Cucumis sativus [cucumbers]
ref|XP_004167627.1|  PREDICTED: BSD domain-containing protein 1-like    129   1e-31   
ref|XP_004134462.1|  PREDICTED: BSD domain-containing protein 1-like    129   1e-31   
ref|XP_008438741.1|  PREDICTED: BSD domain-containing protein 1         129   2e-31   Cucumis melo [Oriental melon]
ref|XP_009393894.1|  PREDICTED: BSD domain-containing protein C22...    129   2e-31   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006414966.1|  hypothetical protein EUTSA_v10025468mg             127   6e-31   Eutrema salsugineum [saltwater cress]
ref|XP_009139648.1|  PREDICTED: BSD domain-containing protein 1         125   2e-30   Brassica rapa
emb|CDY47334.1|  BnaCnng14710D                                          123   1e-29   Brassica napus [oilseed rape]
gb|KJB38458.1|  hypothetical protein B456_006G255500                    122   3e-29   Gossypium raimondii
ref|XP_011006074.1|  PREDICTED: BSD domain-containing protein 1-like    122   4e-29   Populus euphratica
ref|XP_002312727.2|  hypothetical protein POPTR_0008s20350g             120   2e-28   Populus trichocarpa [western balsam poplar]
emb|CDP03589.1|  unnamed protein product                                120   3e-28   Coffea canephora [robusta coffee]
gb|KJB28560.1|  hypothetical protein B456_005G055700                    118   3e-28   Gossypium raimondii
gb|EPS60092.1|  hypothetical protein M569_14713                         119   3e-28   Genlisea aurea
ref|XP_006419764.1|  hypothetical protein CICLE_v10005126mg             119   4e-28   Citrus clementina [clementine]
ref|XP_006489227.1|  PREDICTED: BSD domain-containing protein 1-like    117   3e-27   Citrus sinensis [apfelsine]
gb|KDO74911.1|  hypothetical protein CISIN_1g016172mg                   116   3e-27   Citrus sinensis [apfelsine]
ref|XP_006378128.1|  hypothetical protein POPTR_0010s02980g             115   1e-26   
ref|XP_007035359.1|  BSD domain-containing protein, putative            114   2e-26   
ref|XP_011006601.1|  PREDICTED: protein DOS2-like isoform X5            112   1e-25   Populus euphratica
ref|XP_011006598.1|  PREDICTED: protein DOS2-like isoform X2            112   2e-25   Populus euphratica
ref|XP_011006597.1|  PREDICTED: protein DOS2-like isoform X1            112   2e-25   Populus euphratica
ref|XP_011006599.1|  PREDICTED: protein DOS2-like isoform X3            112   2e-25   Populus euphratica
ref|XP_010450297.1|  PREDICTED: BSD domain-containing protein 1-like    111   2e-25   Camelina sativa [gold-of-pleasure]
ref|XP_010905741.1|  PREDICTED: BSD domain-containing protein C22...    112   2e-25   
ref|XP_009412174.1|  PREDICTED: BSD domain-containing protein 1-like    112   2e-25   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006358434.1|  PREDICTED: BSD domain-containing protein 1-like    112   4e-25   Solanum tuberosum [potatoes]
ref|XP_004247485.1|  PREDICTED: BSD domain-containing protein 1 i...    111   6e-25   Solanum lycopersicum
ref|XP_011006071.1|  PREDICTED: BSD domain-containing protein 1-l...    110   7e-25   Populus euphratica
ref|XP_011006073.1|  PREDICTED: BSD domain-containing protein 1-l...    110   7e-25   Populus euphratica
ref|XP_011006070.1|  PREDICTED: BSD domain-containing protein 1-l...    110   9e-25   Populus euphratica
gb|EYU38131.1|  hypothetical protein MIMGU_mgv1a005992mg                108   3e-24   Erythranthe guttata [common monkey flower]
ref|XP_002273759.1|  PREDICTED: BSD domain-containing protein 1         108   3e-24   Vitis vinifera
ref|XP_002312728.2|  BSD domain-containing family protein               107   4e-24   
ref|XP_010675084.1|  PREDICTED: BSD domain-containing protein 1-like    107   5e-24   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002863270.1|  hypothetical protein ARALYDRAFT_497083             106   1e-23   
gb|EPS72559.1|  hypothetical protein M569_02195                         104   2e-23   Genlisea aurea
gb|EYU28548.1|  hypothetical protein MIMGU_mgv1a0257391mg               102   1e-22   Erythranthe guttata [common monkey flower]
gb|EYU46629.1|  hypothetical protein MIMGU_mgv1a005790mg                103   3e-22   Erythranthe guttata [common monkey flower]
ref|XP_010495981.1|  PREDICTED: BSD domain-containing protein 1-l...    102   4e-22   Camelina sativa [gold-of-pleasure]
ref|XP_010495980.1|  PREDICTED: BSD domain-containing protein 1-l...    102   4e-22   Camelina sativa [gold-of-pleasure]
gb|KFK23730.1|  hypothetical protein AALP_AAs39056U000200               101   9e-22   Arabis alpina [alpine rockcress]
dbj|BAD14380.1|  hypothetical protein                                 97.1    2e-21   Solanum melongena [aubergine]
ref|XP_010093391.1|  hypothetical protein L484_022954                 98.6    8e-21   
ref|XP_006282973.1|  hypothetical protein CARUB_v10007847mg           98.2    8e-21   
ref|XP_008812007.1|  PREDICTED: BSD domain-containing protein C22...  98.6    1e-20   Phoenix dactylifera
gb|AAM62871.1|  unknown                                               97.4    1e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011082538.1|  PREDICTED: glutamic acid-rich protein-like       98.6    2e-20   Sesamum indicum [beniseed]
dbj|BAE99413.1|  hypothetical protein                                 97.1    2e-20   Arabidopsis thaliana [mouse-ear cress]
ref|NP_567396.1|  BSD domain-containing protein                       96.7    2e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008234921.1|  PREDICTED: BSD domain-containing protein 1       98.6    3e-20   Prunus mume [ume]
emb|CAB45510.1|  putative protein                                     96.7    3e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002524803.1|  synapse-associated protein, putative             97.1    4e-20   Ricinus communis
ref|XP_009119551.1|  PREDICTED: BSD domain-containing protein 1       96.3    7e-20   Brassica rapa
emb|CBI26160.3|  unnamed protein product                              95.1    1e-19   Vitis vinifera
ref|XP_007199615.1|  hypothetical protein PRUPE_ppa004513mg           96.7    1e-19   Prunus persica
ref|XP_011079797.1|  PREDICTED: uncharacterized protein LOC105163226  95.9    1e-19   Sesamum indicum [beniseed]
ref|XP_001783300.1|  predicted protein                                95.9    1e-19   
ref|XP_009599212.1|  PREDICTED: BSD domain-containing protein 1-like  95.5    3e-19   Nicotiana tomentosiformis
ref|XP_010522686.1|  PREDICTED: BSD domain-containing protein 1       94.7    3e-19   Tarenaya hassleriana [spider flower]
ref|XP_006307489.1|  hypothetical protein CARUB_v10009113mg           94.7    4e-19   Capsella rubella
gb|KDP21511.1|  hypothetical protein JCGZ_21982                       94.0    4e-19   Jatropha curcas
ref|XP_009769239.1|  PREDICTED: BSD domain-containing protein 1-like  94.7    5e-19   Nicotiana sylvestris
ref|XP_010474958.1|  PREDICTED: BSD domain-containing protein 1-like  94.4    6e-19   Camelina sativa [gold-of-pleasure]
ref|XP_006418242.1|  hypothetical protein EUTSA_v10009692mg           94.0    6e-19   Eutrema salsugineum [saltwater cress]
ref|XP_008451401.1|  PREDICTED: BSD domain-containing protein 1-A     94.4    6e-19   Cucumis melo [Oriental melon]
ref|XP_010090347.1|  hypothetical protein L484_025012                 93.6    9e-19   Morus notabilis
ref|XP_010457343.1|  PREDICTED: BSD domain-containing protein 1-like  93.6    1e-18   Camelina sativa [gold-of-pleasure]
gb|KJB47008.1|  hypothetical protein B456_008G006000                  93.6    1e-18   Gossypium raimondii
ref|XP_002892158.1|  hypothetical protein ARALYDRAFT_470313           93.2    1e-18   
ref|XP_004148869.1|  PREDICTED: uncharacterized protein LOC101217772  92.0    4e-18   Cucumis sativus [cucumbers]
ref|XP_004158933.1|  PREDICTED: uncharacterized LOC101217772          91.7    5e-18   
gb|KJB23152.1|  hypothetical protein B456_004G083900                  90.1    1e-17   Gossypium raimondii
emb|CDY15460.1|  BnaA08g27440D                                        90.1    1e-17   Brassica napus [oilseed rape]
ref|XP_010481925.1|  PREDICTED: BSD domain-containing protein 1-like  90.1    2e-17   Camelina sativa [gold-of-pleasure]
ref|XP_009111155.1|  PREDICTED: BSD domain-containing protein 1-like  89.4    3e-17   Brassica rapa
emb|CDX86678.1|  BnaC08g00250D                                        89.0    3e-17   
ref|NP_563683.1|  BSD domain-containing protein                       88.2    7e-17   Arabidopsis thaliana [mouse-ear cress]
gb|KHG23728.1|  BSD domain-containing 1                               86.3    9e-17   Gossypium arboreum [tree cotton]
ref|XP_010921958.1|  PREDICTED: BSD domain-containing protein C22...  86.3    1e-16   
gb|KFK42693.1|  hypothetical protein AALP_AA1G027500                  87.0    2e-16   Arabis alpina [alpine rockcress]
ref|XP_007144594.1|  hypothetical protein PHAVU_007G168800g           86.7    2e-16   Phaseolus vulgaris [French bean]
ref|XP_008386574.1|  PREDICTED: BSD domain-containing protein 1       86.3    5e-16   Malus domestica [apple tree]
ref|XP_003536399.1|  PREDICTED: spore wall protein 2-like isoform 1   85.1    9e-16   Glycine max [soybeans]
ref|XP_010070258.1|  PREDICTED: BSD domain-containing protein 1-like  84.3    2e-15   Eucalyptus grandis [rose gum]
ref|XP_004493637.1|  PREDICTED: uncharacterized protein LOC101495422  83.2    3e-15   Cicer arietinum [garbanzo]
ref|XP_003565639.1|  PREDICTED: BSD domain-containing protein 1-like  82.0    1e-14   Brachypodium distachyon [annual false brome]
gb|EAY73476.1|  hypothetical protein OsI_01355                        82.0    2e-14   Oryza sativa Indica Group [Indian rice]
ref|NP_001042714.1|  Os01g0273300                                     81.6    2e-14   
ref|XP_002324988.1|  BSD domain-containing family protein             74.3    9e-14   
ref|XP_007050696.1|  Synapse-associated protein, putative             79.0    1e-13   
ref|XP_008673904.1|  PREDICTED: uncharacterized abhydrolase domai...  79.3    1e-13   Zea mays [maize]
ref|XP_010512929.1|  PREDICTED: uncharacterized protein LOC104788847  77.4    1e-13   
ref|XP_002987201.1|  hypothetical protein SELMODRAFT_425984           77.0    2e-13   
ref|XP_002976358.1|  hypothetical protein SELMODRAFT_416268           77.0    2e-13   
ref|XP_003591620.1|  BSD domain-containing protein                    77.4    4e-13   Medicago truncatula
ref|XP_002457630.1|  hypothetical protein SORBIDRAFT_03g010780        77.8    4e-13   Sorghum bicolor [broomcorn]
gb|KEH23702.1|  synapse-associated protein, putative                  76.6    5e-13   Medicago truncatula
gb|AFK39974.1|  unknown                                               77.0    5e-13   Medicago truncatula
emb|CDM82781.1|  unnamed protein product                              77.0    7e-13   Triticum aestivum [Canadian hard winter wheat]
emb|CBI32321.3|  unnamed protein product                              75.5    8e-13   Vitis vinifera
ref|XP_006378127.1|  hypothetical protein POPTR_0010s02970g           72.8    2e-12   
ref|XP_009393114.1|  PREDICTED: BSD domain-containing protein 1-like  73.2    4e-12   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003520218.1|  PREDICTED: protein starmaker-like                73.9    5e-12   Glycine max [soybeans]
ref|XP_007162386.1|  hypothetical protein PHAVU_001G147700g           73.2    8e-12   Phaseolus vulgaris [French bean]
ref|XP_001779382.1|  predicted protein                                71.6    2e-11   
ref|XP_006444149.1|  hypothetical protein CICLE_v10020022mg           72.0    3e-11   Citrus clementina [clementine]
ref|XP_009356725.1|  PREDICTED: glutamic acid-rich protein            71.2    6e-11   Pyrus x bretschneideri [bai li]
ref|XP_004967719.1|  PREDICTED: dentin sialophosphoprotein-like       70.5    1e-10   Setaria italica
ref|XP_004290686.1|  PREDICTED: BSD domain-containing protein 1       69.3    2e-10   Fragaria vesca subsp. vesca
gb|AFW70924.1|  hypothetical protein ZEAMMB73_576122                  68.2    5e-10   
ref|XP_004496069.1|  PREDICTED: BSD domain-containing protein 1-like  67.8    6e-10   
gb|EMS55437.1|  hypothetical protein TRIUR3_20550                     67.0    1e-09   Triticum urartu
ref|XP_006576882.1|  PREDICTED: high mobility group nucleosome-bi...  63.2    2e-08   Glycine max [soybeans]
ref|XP_010326623.1|  PREDICTED: BSD domain-containing protein 1 i...  62.8    3e-08   
ref|NP_001168539.1|  hypothetical protein                             58.5    7e-07   Zea mays [maize]
gb|AFW74907.1|  hypothetical protein ZEAMMB73_322148                  57.4    1e-06   
ref|XP_008680666.1|  PREDICTED: LOW QUALITY PROTEIN: BSD domain-c...  56.2    3e-06   
ref|XP_002461138.1|  hypothetical protein SORBIDRAFT_02g041350        56.2    4e-06   
ref|XP_004958525.1|  PREDICTED: BSD domain-containing protein 1-like  54.7    1e-05   Setaria italica
ref|XP_008671572.1|  PREDICTED: protein enabled homolog               52.0    6e-05   
ref|XP_003562559.1|  PREDICTED: BSD domain-containing protein 1       52.8    7e-05   Brachypodium distachyon [annual false brome]
ref|NP_001060469.1|  Os07g0647400                                     51.6    2e-04   
ref|XP_006605223.1|  PREDICTED: BSD domain-containing protein 1-like  50.1    4e-04   
gb|KHN45382.1|  BSD domain-containing protein 1                       50.1    5e-04   Glycine soja [wild soybean]



>ref|XP_004229466.1| PREDICTED: BSD domain-containing protein 1 [Solanum lycopersicum]
Length=424

 Score =   194 bits (494),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 104/156 (67%), Positives = 123/156 (79%), Gaps = 5/156 (3%)
 Frame = +3

Query  117  MDFFKSVFTEEQDYSDTEDTEISSSNLDVQAQPESPPGAPDGNPNIPAIVNAWGFGSGLL  296
            MDFFKSVF ++ ++SDTED   S SN   Q+QPESP   P+ N ++PAI NAW FGS L 
Sbjct  1    MDFFKSVFADDPEFSDTEDAPTSPSN--SQSQPESP--NPNPNHDVPAITNAWTFGSTLF  56

Query  297  KTLASKSESVIQNYRRDLEEFSSGLQKETAIIREAASRAVQDLPAHIESGATAAQESLET  476
            +T+ASKSESV+QNYRRD EEFSSGL+ ETA IRE ASRAV+DLPA  ESGA  AQESLE+
Sbjct  57   RTIASKSESVVQNYRRDFEEFSSGLKIETATIREVASRAVKDLPARFESGAAVAQESLES  116

Query  477  VGQAIDDIGSSVAEIIVQGKDSILAPEDSDNEFSEN  584
            VGQAID+IGS+V+EII  GK+SIL   DSD+E  EN
Sbjct  117  VGQAIDNIGSTVSEIIAHGKESIL-DNDSDSELFEN  151



>ref|XP_006339426.1| PREDICTED: BSD domain-containing protein 1-like [Solanum tuberosum]
Length=434

 Score =   192 bits (489),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 103/156 (66%), Positives = 123/156 (79%), Gaps = 5/156 (3%)
 Frame = +3

Query  117  MDFFKSVFTEEQDYSDTEDTEISSSNLDVQAQPESPPGAPDGNPNIPAIVNAWGFGSGLL  296
            MDFFKSVF ++ ++SDT+D   S S    Q+QPESP   P+ N ++PAI NAW FGS L 
Sbjct  1    MDFFKSVFADDPEFSDTDDAPTSPSY--SQSQPESP--NPNPNHDVPAITNAWTFGSTLF  56

Query  297  KTLASKSESVIQNYRRDLEEFSSGLQKETAIIREAASRAVQDLPAHIESGATAAQESLET  476
            +T+ASKSESV+QNYRRD EEFSSGL+ ETA IRE ASRAV+DLPA  ESGA  AQESLE+
Sbjct  57   RTIASKSESVVQNYRRDFEEFSSGLKIETATIREVASRAVKDLPARFESGAAVAQESLES  116

Query  477  VGQAIDDIGSSVAEIIVQGKDSILAPEDSDNEFSEN  584
            VGQAID+IGS+V+EII  GK+SIL   DSD+E SEN
Sbjct  117  VGQAIDNIGSTVSEIIAHGKESIL-DNDSDSELSEN  151



>ref|XP_009769832.1| PREDICTED: BSD domain-containing protein 1-like [Nicotiana sylvestris]
Length=438

 Score =   187 bits (474),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 104/158 (66%), Positives = 124/158 (78%), Gaps = 8/158 (5%)
 Frame = +3

Query  117  MDFFKSVFTEE-QDYSDTEDTEISSSNLDVQAQPESPPGAPDGNPNIPAIVNAWGFGSGL  293
            MDFFKSVF ++ ++ SD+E+   S SN   Q +      +P+ NPNIPAI +AW FGS L
Sbjct  1    MDFFKSVFADDPEELSDSENAPSSPSNSQSQPE------SPNPNPNIPAISDAWTFGSSL  54

Query  294  LKTLASKSESVIQNYRRDLEEFSSGLQKETAIIREAASRAVQDLPAHIESGATAAQESLE  473
             KT+ASKSESV+QNYRR+LEEFSSGL+KETA IRE ASRAV+DLPA +ESGA  AQESLE
Sbjct  55   FKTIASKSESVMQNYRRELEEFSSGLKKETATIREVASRAVKDLPARLESGAAVAQESLE  114

Query  474  TVGQAIDDIGSSVAEIIVQGKDSILAPEDSDNEFSENS  587
            +VGQAID+IGS+V EII  GKDSIL   DSD+E SENS
Sbjct  115  SVGQAIDNIGSTVTEIIAHGKDSILV-NDSDSELSENS  151



>ref|XP_009609401.1| PREDICTED: BSD domain-containing protein 1-like [Nicotiana tomentosiformis]
Length=440

 Score =   184 bits (467),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 110/158 (70%), Positives = 126/158 (80%), Gaps = 6/158 (4%)
 Frame = +3

Query  117  MDFFKSVFTEE-QDYSDTEDTEISSSNLDVQAQPESPPGAPDGNPNIPAIVNAWGFGSGL  293
            MDFFKSVF ++ ++ SD+E+   S SN   Q+QPESP   P  NPN PAI NAW FGS L
Sbjct  1    MDFFKSVFVDDPEELSDSENAPTSPSN--SQSQPESPNTNP--NPNTPAISNAWTFGSSL  56

Query  294  LKTLASKSESVIQNYRRDLEEFSSGLQKETAIIREAASRAVQDLPAHIESGATAAQESLE  473
             KT+ASKSESV+QNYRRDLEEFSSGL+KETA IRE ASRAV+DLPA +ESGA  AQESLE
Sbjct  57   FKTIASKSESVMQNYRRDLEEFSSGLKKETATIREVASRAVKDLPARLESGAAVAQESLE  116

Query  474  TVGQAIDDIGSSVAEIIVQGKDSILAPEDSDNEFSENS  587
            +VGQAID+IGS+V EII  GKDSIL   DSD+E SENS
Sbjct  117  SVGQAIDNIGSTVTEIIAHGKDSILV-NDSDSELSENS  153



>ref|XP_010105696.1| hypothetical protein L484_011308 [Morus notabilis]
 gb|EXC05727.1| hypothetical protein L484_011308 [Morus notabilis]
Length=401

 Score =   168 bits (425),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 100/164 (61%), Positives = 123/164 (75%), Gaps = 19/164 (12%)
 Frame = +3

Query  117  MDFFKSVFTEEQ-DYSDTEDTEISSSNLDVQAQPESPPGAPDGNPNIPAIVNAWGFGSGL  293
            MDFFKSVF +E  + SD+++ +    N DV A PESPP   D N + P     W FG GL
Sbjct  1    MDFFKSVFADEHLESSDSDEPQ----NDDVPA-PESPP---DSNSSTP-----WSFG-GL  46

Query  294  LKTLASKSESVIQNYRRDLEEFSSGLQKETAIIREAASRAVQDLPAHIESGATAAQESLE  473
            +KTLA+KSESVIQ YR+DLEEF SGL+ E+A+IR+AASRAV+DLPA +E GAT AQESLE
Sbjct  47   IKTLATKSESVIQTYRKDLEEFGSGLRMESAVIRDAASRAVKDLPASLEVGATVAQESLE  106

Query  474  TVGQAIDDIGSSV----AEIIVQGKDSILAPEDSDNEFSENSGR  593
            +VGQAIDDIGSSV    AEII QG+DS+LA  D D++ SE++ R
Sbjct  107  SVGQAIDDIGSSVWKSTAEIISQGRDSLLAAADEDSDASESNSR  150



>ref|XP_006594442.1| PREDICTED: BSD domain-containing protein C22A12.14c-like [Glycine 
max]
Length=469

 Score =   157 bits (398),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 89/151 (59%), Positives = 109/151 (72%), Gaps = 26/151 (17%)
 Frame = +3

Query  117  MDFFKSVFTEEQDYSDTEDTEISSSNLDVQAQPESPPGAPDGNPNIPAI--VNAWGFGSG  290
            M+FFKSVF +E D                  +P+SPP   D NP+ P     +AW FG G
Sbjct  1    MNFFKSVFADEPD------------------EPDSPPAESD-NPDPPQSHHDSAWSFG-G  40

Query  291  LLKTLASKSESVIQNYRRDLEEFSSGLQKETAIIREAASRAVQDLPAHIESGATAAQESL  470
            L++TLASKSESV++NYRRDLEEF SGL+KETA+IREAASRAVQDLPA ++ GA+ AQESL
Sbjct  41   LIQTLASKSESVLENYRRDLEEFGSGLRKETAVIREAASRAVQDLPASLDVGASVAQESL  100

Query  471  ETVGQAIDDIGSSV----AEIIVQGKDSILA  551
            E+VGQAIDDIGS+V    A+II  G+DS+LA
Sbjct  101  ESVGQAIDDIGSTVWNSTAQIISHGRDSLLA  131



>ref|XP_009352143.1| PREDICTED: protein DOS2-like isoform X2 [Pyrus x bretschneideri]
Length=434

 Score =   156 bits (394),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 90/170 (53%), Positives = 118/170 (69%), Gaps = 18/170 (11%)
 Frame = +3

Query  117  MDFFKSVFTEEQDYSDTEDTEISSSNLDVQAQPE----SPPGAPDGNPNIPAIVNAWGFG  284
            MDFFKSVF+         D  + S +L   AQ +    +P   PD +P +     AW FG
Sbjct  1    MDFFKSVFS---------DDPLPSDDLHPDAQNDGVDPNPDWEPDRSPRLNYGAGAWSFG  51

Query  285  SGLLKTLASKSESVIQNYRRDLEEFSSGLQKETAIIREAASRAVQDLPAHIESGATAAQE  464
             GL+ TLA+KS+SVIQNYRRDL+EF SGL+KETA+IRE ASRAV++LP  +E GA+ AQE
Sbjct  52   -GLITTLATKSDSVIQNYRRDLKEFGSGLKKETAVIREVASRAVKNLPGSLEVGASVAQE  110

Query  465  SLETVGQAIDDIGSSV----AEIIVQGKDSILAPEDSDNEFSENSGRNDR  602
            SLETVGQAIDDIGS+V    AEII  G+D+ILA +D +++  +++G  +R
Sbjct  111  SLETVGQAIDDIGSTVWKSTAEIISHGRDAILADDDVESDNLDDNGSGNR  160



>ref|XP_009352142.1| PREDICTED: protein DOS2-like isoform X1 [Pyrus x bretschneideri]
Length=447

 Score =   156 bits (394),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 90/170 (53%), Positives = 118/170 (69%), Gaps = 18/170 (11%)
 Frame = +3

Query  117  MDFFKSVFTEEQDYSDTEDTEISSSNLDVQAQPE----SPPGAPDGNPNIPAIVNAWGFG  284
            MDFFKSVF+         D  + S +L   AQ +    +P   PD +P +     AW FG
Sbjct  1    MDFFKSVFS---------DDPLPSDDLHPDAQNDGVDPNPDWEPDRSPRLNYGAGAWSFG  51

Query  285  SGLLKTLASKSESVIQNYRRDLEEFSSGLQKETAIIREAASRAVQDLPAHIESGATAAQE  464
             GL+ TLA+KS+SVIQNYRRDL+EF SGL+KETA+IRE ASRAV++LP  +E GA+ AQE
Sbjct  52   -GLITTLATKSDSVIQNYRRDLKEFGSGLKKETAVIREVASRAVKNLPGSLEVGASVAQE  110

Query  465  SLETVGQAIDDIGSSV----AEIIVQGKDSILAPEDSDNEFSENSGRNDR  602
            SLETVGQAIDDIGS+V    AEII  G+D+ILA +D +++  +++G  +R
Sbjct  111  SLETVGQAIDDIGSTVWKSTAEIISHGRDAILADDDVESDNLDDNGSGNR  160



>ref|XP_003594077.1| BSD domain-containing protein [Medicago truncatula]
 gb|AES64328.1| synapse-associated protein, putative [Medicago truncatula]
Length=457

 Score =   152 bits (384),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 86/157 (55%), Positives = 108/157 (69%), Gaps = 33/157 (21%)
 Frame = +3

Query  117  MDFFKSVFTEEQDYSDTEDTEISSSNLDVQAQPESPPG------APD-GNPNIPAIVNAW  275
            M+FFK+VF++E                     PESPP        PD  + + P    AW
Sbjct  1    MNFFKTVFSDE---------------------PESPPSHNSDSDQPDPDHHDTPTETTAW  39

Query  276  GFGSGLLKTLASKSESVIQNYRRDLEEFSSGLQKETAIIREAASRAVQDLPAHIESGATA  455
             FG GL++TLASKSESV++NYRRDLEEFSSGL+ ET++IREAASRAV+DLPA ++ GA+ 
Sbjct  40   SFG-GLIQTLASKSESVLENYRRDLEEFSSGLKIETSVIREAASRAVKDLPASLDVGASV  98

Query  456  AQESLETVGQAIDDIGSSV----AEIIVQGKDSILAP  554
            AQESLETVGQAIDDIGS+V    A+II  G++S+LAP
Sbjct  99   AQESLETVGQAIDDIGSTVWKSTAQIISHGRESLLAP  135



>ref|XP_002279111.1| PREDICTED: BSD domain-containing protein 1-like [Vitis vinifera]
Length=426

 Score =   150 bits (378),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 87/154 (56%), Positives = 109/154 (71%), Gaps = 15/154 (10%)
 Frame = +3

Query  117  MDFFKSVFTEEQDYSDTEDTEISSSNLDVQAQPESPPGAPDGNPNIPAIVNAWGFGSGLL  296
            M+FFKSVF +        D E +S      A P+  PG  + N   P    AW FG GL+
Sbjct  1    MNFFKSVFAD--------DPEPASDPPHSAAHPD--PGDDEPNHRNPNPNAAWSFG-GLI  49

Query  297  KTLASKSESVIQNYRRDLEEFSSGLQKETAIIREAASRAVQDLPAHIESGATAAQESLET  476
            KTLASKSESVI++YRRD+EEF +GL+KETA+IR+ ASRAV+DLPA +E GA+ AQ+SLE+
Sbjct  50   KTLASKSESVIESYRRDIEEFGTGLKKETAVIRDVASRAVKDLPASLEVGASVAQDSLES  109

Query  477  VGQAIDDIGSSV----AEIIVQGKDSILAPEDSD  566
            VGQAIDDIGSSV    AEII  G+D++LA E+ D
Sbjct  110  VGQAIDDIGSSVWRGTAEIITHGRDALLAAEEHD  143



>gb|KDP40072.1| hypothetical protein JCGZ_02070 [Jatropha curcas]
Length=410

 Score =   149 bits (376),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 81/149 (54%), Positives = 103/149 (69%), Gaps = 16/149 (11%)
 Frame = +3

Query  117  MDFFKSVFTEEQDYSDTEDTEISSSNLDVQAQPESPPGAPDGNPNIPAIVNAWGFGSGLL  296
            M+FFKSVF+EE    D+  +   +   D Q     P G P           AW FG GL+
Sbjct  1    MNFFKSVFSEETTPPDSPTSPTDTPTSDPQTLNTQPTGTP-----------AWSFG-GLI  48

Query  297  KTLASKSESVIQNYRRDLEEFSSGLQKETAIIREAASRAVQDLPAHIESGATAAQESLET  476
            KTLA+KSES+I+ YR+D EEF SGL+KETA+IRE ASRAV+DLPA ++ GA+ AQESLET
Sbjct  49   KTLATKSESMIETYRKDFEEFGSGLKKETAVIREVASRAVKDLPASLDVGASVAQESLET  108

Query  477  VGQAIDDIGSSV----AEIIVQGKDSILA  551
            VGQAIDDIG++V    ++II  G+DSI+A
Sbjct  109  VGQAIDDIGATVWKSTSQIITHGRDSIVA  137



>ref|XP_008390800.1| PREDICTED: protein DOS2-like [Malus domestica]
Length=443

 Score =   149 bits (377),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 90/161 (56%), Positives = 108/161 (67%), Gaps = 20/161 (12%)
 Frame = +3

Query  117  MDFFKSVFTEEQDYSDTEDTEISSSNLDVQAQPE----SPPGAPDGNPNIPAIVNAWGFG  284
            MDFFKSVF+         D  + S +L   AQ +    +P   PD +P       AW FG
Sbjct  1    MDFFKSVFS---------DDPLPSDDLHPDAQNDGGHPNPDWEPDRSPRPNYGAGAWSFG  51

Query  285  SGLLKTLASKSESVIQNYRRDLEEFSSGLQKETAIIREAASRAVQDLPAHIESGATAAQE  464
             GL+ TLA+KSESVIQNYRRDLEEF SGL+KETA+IR+ ASRAV+ LP  +E GA+ AQE
Sbjct  52   -GLITTLATKSESVIQNYRRDLEEFGSGLKKETAVIRQVASRAVKXLPGSLEVGASVAQE  110

Query  465  SLETVGQAIDDIGSSV----AEIIVQGKDSILAPED--SDN  569
            SLETVGQAIDDIGS+V    A II  G+D+IL  +D  SDN
Sbjct  111  SLETVGQAIDDIGSTVWKSTARIISHGRDAILXDDDVESDN  151



>ref|XP_009339936.1| PREDICTED: protein DOS2-like [Pyrus x bretschneideri]
Length=449

 Score =   147 bits (372),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 93/171 (54%), Positives = 114/171 (67%), Gaps = 10/171 (6%)
 Frame = +3

Query  117  MDFFKSVFTEEQDYSDTEDTEISSSNLDVQAQPESPPGAPDGNPNIPAIVNAWGFGSGLL  296
            M+FF SVF++E  +SD  D    + N  V   PES P  P+ +P   +   AW FG GL+
Sbjct  1    MNFFNSVFSDEPLHSD--DPHYDAPNDGVDRNPESDP-EPELSPRPNSGTGAWSFG-GLI  56

Query  297  KTLASKSESVIQNYRRDLEEFSSGLQKETAIIREAASRAVQDLPAHIESGATAAQESLET  476
             TLA+KS SV++NYRRDLEEF S L+KETA+IRE ASRAV+DLP  +E GA+ AQESLET
Sbjct  57   TTLATKSGSVMKNYRRDLEEFGSELKKETAVIREVASRAVKDLPGSLEVGASVAQESLET  116

Query  477  VGQAIDDIGSSV----AEIIVQGKDSILAPED--SDNEFSENSGRNDRSDD  611
            VGQAIDDIG +V    AEII  G+D+I A  D  SDN     SG  + S D
Sbjct  117  VGQAIDDIGGTVWKSTAEIISHGRDAISADGDVESDNLDDNVSGNRESSGD  167



>ref|XP_007222224.1| hypothetical protein PRUPE_ppa005863mg [Prunus persica]
 gb|EMJ23423.1| hypothetical protein PRUPE_ppa005863mg [Prunus persica]
Length=440

 Score =   147 bits (371),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 87/149 (58%), Positives = 107/149 (72%), Gaps = 11/149 (7%)
 Frame = +3

Query  117  MDFFKSVFTEEQDYSDTEDTEISSSNLDVQAQPESPPGAPDGNPNIPAIVNAWGFGSGLL  296
            MDFFKSVF+++   SD   T+  + + D    PES    P   PN  +   AW FG GL+
Sbjct  1    MDFFKSVFSDDPIPSDDSHTDTQNDD-DPNPVPESDHSPP---PN--SGTGAWSFG-GLI  53

Query  297  KTLASKSESVIQNYRRDLEEFSSGLQKETAIIREAASRAVQDLPAHIESGATAAQESLET  476
             TLA+KSESVIQNYRRD EEF SGL++ETA+IR+ ASRAV+DLPA +E GA+ AQESLE+
Sbjct  54   TTLAAKSESVIQNYRRDFEEFGSGLREETAVIRQVASRAVKDLPASLEVGASVAQESLES  113

Query  477  VGQAIDDIGSSV----AEIIVQGKDSILA  551
            VGQAIDDIGS+V    +EII  G+D ILA
Sbjct  114  VGQAIDDIGSTVWKSTSEIISHGRDVILA  142



>ref|XP_010279061.1| PREDICTED: BSD domain-containing protein 1-like [Nelumbo nucifera]
Length=470

 Score =   146 bits (369),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 86/169 (51%), Positives = 112/169 (66%), Gaps = 32/169 (19%)
 Frame = +3

Query  117  MDFFKSVFTEEQDYSDTEDTEISSSNLDVQAQPESPPGAPD----GNPNIPAIVN-----  269
            MDFFKSVF+++Q+  D +  + SS +       ESP G  +    G+P+  A+++     
Sbjct  1    MDFFKSVFSDDQEPLDVQRNQTSSVS-------ESPSGTSEVQEEGDPDREALLDEYESN  53

Query  270  -----------AWGFGSGLLKTLASKSESVIQNYRRDLEEFSSGLQKETAIIREAASRAV  416
                        W FG G +KT A+KSESV+Q YRRDLEEFSSGL+KET  +REAASRAV
Sbjct  54   PNPSPTSSAASGWSFG-GFIKTFATKSESVLQTYRRDLEEFSSGLKKETEALREAASRAV  112

Query  417  QDLPAHIESGATAAQESLETVGQAIDDIGSSV----AEIIVQGKDSILA  551
            +DLPA IE GA+ AQESLE+VGQAIDD+G++V    AEII  GKD +L+
Sbjct  113  KDLPASIEVGASVAQESLESVGQAIDDLGNTVWRGTAEIISHGKDVLLS  161



>ref|XP_008223041.1| PREDICTED: protein DOS2 [Prunus mume]
Length=440

 Score =   145 bits (367),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 86/149 (58%), Positives = 107/149 (72%), Gaps = 11/149 (7%)
 Frame = +3

Query  117  MDFFKSVFTEEQDYSDTEDTEISSSNLDVQAQPESPPGAPDGNPNIPAIVNAWGFGSGLL  296
            MDFFKSVF+++   SD   ++  + + D    PES    P   PN  +   AW FG GL+
Sbjct  1    MDFFKSVFSDDPLPSDDSHSDTQNDD-DPNPVPESDHSPP---PN--SGTGAWSFG-GLI  53

Query  297  KTLASKSESVIQNYRRDLEEFSSGLQKETAIIREAASRAVQDLPAHIESGATAAQESLET  476
             TLA+KSESVIQNYRRD EEF SGL++ETA+IR+ ASRAV+DLPA +E GA+ AQ+SLE+
Sbjct  54   TTLAAKSESVIQNYRRDFEEFGSGLKEETAVIRQVASRAVKDLPASLEVGASVAQDSLES  113

Query  477  VGQAIDDIGSSV----AEIIVQGKDSILA  551
            VGQAIDDIGS+V    AEII  G+D ILA
Sbjct  114  VGQAIDDIGSTVWKSTAEIISHGRDVILA  142



>ref|XP_004486098.1| PREDICTED: clumping factor A-like [Cicer arietinum]
Length=460

 Score =   144 bits (364),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 72/104 (69%), Positives = 90/104 (87%), Gaps = 5/104 (5%)
 Frame = +3

Query  255  PAIVNAWGFGSGLLKTLASKSESVIQNYRRDLEEFSSGLQKETAIIREAASRAVQDLPAH  434
            P   NAW FG GL++TLASKSESV++NYRRDLE+FSSGL+ ET++IREAASRAV+DLPA 
Sbjct  29   PTETNAWSFG-GLIQTLASKSESVLENYRRDLEDFSSGLRIETSVIREAASRAVKDLPAS  87

Query  435  IESGATAAQESLETVGQAIDDIGSSV----AEIIVQGKDSILAP  554
            +++GA+ AQESLETVGQAIDDIGS+V    A+II  G++S+LAP
Sbjct  88   LDAGASVAQESLETVGQAIDDIGSTVWKSTAQIISHGRESLLAP  131



>ref|XP_007147818.1| hypothetical protein PHAVU_006G157500g [Phaseolus vulgaris]
 gb|ESW19812.1| hypothetical protein PHAVU_006G157500g [Phaseolus vulgaris]
Length=487

 Score =   144 bits (362),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 82/149 (55%), Positives = 104/149 (70%), Gaps = 22/149 (15%)
 Frame = +3

Query  117  MDFFKSVFTEEQDYSDTEDTEISSSNLDVQAQPESPPGAPDGNPNIPAIVNAWGFGSGLL  296
            M+FFKSVF +E +    E T           QPES       +P+ P     W FG  L+
Sbjct  1    MNFFKSVFADEPESPPPEST-----------QPESE------SPDPPQTDAVWSFGD-LI  42

Query  297  KTLASKSESVIQNYRRDLEEFSSGLQKETAIIREAASRAVQDLPAHIESGATAAQESLET  476
            +T+ASKSESV++NYRRD+EEF SGL+KET +IREAASRAV+DLPA ++ GA+ AQESLE+
Sbjct  43   QTIASKSESVLENYRRDIEEFGSGLRKETEVIREAASRAVKDLPASLDVGASVAQESLES  102

Query  477  VGQAIDDIGSSV----AEIIVQGKDSILA  551
            VGQAIDDIGS+V    A+II  G+DS+LA
Sbjct  103  VGQAIDDIGSTVWNSTAQIISHGRDSLLA  131



>ref|XP_002516813.1| synapse-associated protein, putative [Ricinus communis]
 gb|EEF45427.1| synapse-associated protein, putative [Ricinus communis]
Length=454

 Score =   143 bits (360),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 86/168 (51%), Positives = 109/168 (65%), Gaps = 29/168 (17%)
 Frame = +3

Query  117  MDFFKSVFTEEQDYSDTEDTEISSSNLDVQAQPESPPGAPDG-NPNIPAIVNAWGFGSGL  293
            M+FFKSVF++E    D+               P+S P +P   +PN     +AW FG  L
Sbjct  1    MNFFKSVFSDEPTPPDS---------------PKSRPDSPTSQSPNTGPTTSAWSFGD-L  44

Query  294  LKTLASKSESVIQNYRRDLEEFSSGLQKETAIIREAASRAVQDLPAHIESGATAAQESLE  473
            +KTL++KSES+IQ YR+D EE  SGL+KETA+IR+ ASRAV+ LPA  E GA+ AQESLE
Sbjct  45   IKTLSTKSESMIQTYRQDFEELGSGLRKETAVIRDVASRAVKVLPASFEIGASVAQESLE  104

Query  474  TVGQAIDDIGSSV----AEIIVQGKDSILAPEDSDNEFSENSGRNDRS  605
            TVGQAIDDIG++V    A+II  GKDSILA        S+N   NDR+
Sbjct  105  TVGQAIDDIGATVWKSTAQIISHGKDSILA--------SDNYNSNDRN  144



>ref|XP_006597563.1| PREDICTED: BSD domain-containing protein 1-like [Glycine max]
Length=471

 Score =   142 bits (358),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 84/149 (56%), Positives = 103/149 (69%), Gaps = 27/149 (18%)
 Frame = +3

Query  117  MDFFKSVFTEEQDYSDTEDTEISSSNLDVQAQPESPPGAPDGNPNIPAIVNAWGFGSGLL  296
            M+F KSVF +E                     P SPP A   +P+ P    AW FG GL+
Sbjct  1    MNFLKSVFADE---------------------PNSPP-AVSDSPDPPPSDAAWSFG-GLI  37

Query  297  KTLASKSESVIQNYRRDLEEFSSGLQKETAIIREAASRAVQDLPAHIESGATAAQESLET  476
            +TLASKSESV++NYRRDLEEF SGL+KETA+IREAASRAVQ+LPA ++ GA+ AQESLE+
Sbjct  38   QTLASKSESVLENYRRDLEEFGSGLRKETAVIREAASRAVQELPASLDVGASVAQESLES  97

Query  477  VGQAIDDIG----SSVAEIIVQGKDSILA  551
            VGQAIDDIG    +S A+II  G+DS+LA
Sbjct  98   VGQAIDDIGITVWNSTAQIISHGRDSLLA  126



>ref|XP_008340893.1| PREDICTED: uncharacterized protein LOC103403823 [Malus domestica]
Length=450

 Score =   141 bits (355),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 87/157 (55%), Positives = 107/157 (68%), Gaps = 10/157 (6%)
 Frame = +3

Query  117  MDFFKSVFTEEQDYSDTEDTEISSSNLDVQAQPESPPGAPDGNPNIPAIVNAWGFGSGLL  296
            M+FF SVF++E   SD  D    + N  V   PES P  P+ +    +    W FG GL+
Sbjct  1    MNFFNSVFSDEPLPSD--DPHYDAPNDGVBPNPESDP-EPELSSRPNSGTGXWSFG-GLI  56

Query  297  KTLASKSESVIQNYRRDLEEFSSGLQKETAIIREAASRAVQDLPAHIESGATAAQESLET  476
             TLA+KS SV++NYRRDLEEF S L+KETA+IRE ASRAV+DLP  +E GA+ AQESLET
Sbjct  57   TTLATKSGSVMKNYRRDLEEFGSELKKETAVIREVASRAVKDLPGSLEVGASVAQESLET  116

Query  477  VGQAIDDIGSSV----AEIIVQGKDSILAPED--SDN  569
            VGQAIDDIGS+V     EII  G+D+I A +D  SDN
Sbjct  117  VGQAIDDIGSTVWKSTTEIISHGRDAISADDDVESDN  153



>ref|XP_010255803.1| PREDICTED: LOW QUALITY PROTEIN: BSD domain-containing protein 
1-like [Nelumbo nucifera]
Length=469

 Score =   139 bits (349),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 82/161 (51%), Positives = 108/161 (67%), Gaps = 18/161 (11%)
 Frame = +3

Query  117  MDFFKSVFTEEQDYSDTEDTEISSSNLDVQAQPESPPGAP----------DGNPNI---P  257
            MDFFK+VF+++ +   +++   SS +   + +PE+               D NPN     
Sbjct  1    MDFFKTVFSDDPEPEPSDNKNQSSVSGSPKREPEAEAEGDSDHEALLEEHDSNPNPNTDS  60

Query  258  AIVNAWGFGSGLLKTLASKSESVIQNYRRDLEEFSSGLQKETAIIREAASRAVQDLPAHI  437
            ++ + W FG G +KT A+KSESV+Q YRRDLEEFSSGL+KET  IREA SRAV++LPA I
Sbjct  61   SVGSGWSFG-GFIKTFATKSESVLQTYRRDLEEFSSGLKKETEAIREATSRAVKELPASI  119

Query  438  ESGATAAQESLETVGQAIDDIGSSV----AEIIVQGKDSIL  548
            E+GA+AAQES E+VGQAID  GS+V    AEII  GKDS+L
Sbjct  120  EAGASAAQESFESVGQAIDVFGSTVWRGTAEIISHGKDSLL  160



>ref|XP_011091054.1| PREDICTED: protein DOS2-like [Sesamum indicum]
Length=423

 Score =   136 bits (343),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 85/164 (52%), Positives = 108/164 (66%), Gaps = 17/164 (10%)
 Frame = +3

Query  117  MDFFKSVFTEEQDYSDTEDTEISSSNLDVQAQPESPPGAPDGNPNIPAIVNAWGFGSGLL  296
            MDFFKSVF+E    S     + S  +    A  E+ P         P   ++WGFGS L 
Sbjct  1    MDFFKSVFSE---LSPNPSPDPSPPSTPTPANHETNP---------PP-TSSWGFGSTLF  47

Query  297  KTLASKSESVIQNYRRDLEEFSSGLQKETAIIREAASRAVQDLPAHIESGATAAQESLET  476
            +T+ASKSES++ +Y +DL+EFSSGLQKET +IR+AA RAVQDLPA +ESGA  AQESLE 
Sbjct  48   RTIASKSESLLDSYYKDLQEFSSGLQKETLVIRQAAGRAVQDLPARLESGAAIAQESLEA  107

Query  477  VGQAIDDIGSSVAEIIVQGKDSILAPED--SDNEFSENSGRNDR  602
            VGQAID++GS+V+EII  GKD   A  D  S++    NSG  D+
Sbjct  108  VGQAIDNVGSTVSEII--GKDLNFAANDGFSNSHLDGNSGNRDK  149



>ref|XP_010024448.1| PREDICTED: BSD domain-containing protein 1-like [Eucalyptus grandis]
 gb|KCW60899.1| hypothetical protein EUGRSUZ_H03637 [Eucalyptus grandis]
Length=444

 Score =   136 bits (343),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 86/174 (49%), Positives = 111/174 (64%), Gaps = 30/174 (17%)
 Frame = +3

Query  117  MDFFKSVFTEEQDYSDTEDTEISSSNLDVQAQPESPPGAPDGNPNIPAIVNA--------  272
            MDFFKSVF+         D  I  +       P+SP   PD  P   +            
Sbjct  1    MDFFKSVFS---------DDPIPPA----PGSPQSPRLDPDPEPEPGSPPPPSPPPAAAA  47

Query  273  --WGFGSGLLKTLASKSESVIQNYRRDLEEFSSGLQKETAIIREAASRAVQDLPAHIESG  446
              W FG GL+KTLA++SESVI++YRRDLEEF SGL+KETA+IREAASRAV+DLP  +E+G
Sbjct  48   GAWSFG-GLIKTLATRSESVIESYRRDLEEFGSGLRKETAVIREAASRAVKDLPTSLEAG  106

Query  447  ATAAQESLETVGQAIDDIGSSV----AEIIVQGKDSILAPEDSDNEFSENSGRN  596
            A+ AQESLE+VGQAIDDIG++V    AEI+  GK+++L  E   +++   SGR 
Sbjct  107  ASVAQESLESVGQAIDDIGATVVKSTAEILSHGKEALLDLESDSSDY--GSGRR  158



>ref|XP_006850837.1| hypothetical protein AMTR_s00025p00132420 [Amborella trichopoda]
 gb|ERN12418.1| hypothetical protein AMTR_s00025p00132420 [Amborella trichopoda]
Length=498

 Score =   137 bits (344),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 81/156 (52%), Positives = 108/156 (69%), Gaps = 16/156 (10%)
 Frame = +3

Query  117  MDFFKSVFTEE-QDYSDTEDTEISSSNLDVQAQPE-SPPGAPDGNPNIPAIVNAWGFGSG  290
            M+FFKSVF E+  DYS  ED E   ++ D +  P+  PP  P   P      + W FG G
Sbjct  1    MNFFKSVFAEDPNDYS-AEDRE---THQDEELSPDPDPPQKP--RPTSNPKSSPWSFG-G  53

Query  291  LLKTLASKSESVIQNYRRDLEEFSSGLQKETAIIREAASRAVQDLPAHIESGATAAQESL  470
            L+KTL+ KSE V++ YRRDLEEFSSGL++ETA IREAA+RAV+DLP  +E+GA+ AQESL
Sbjct  54   LIKTLSEKSEGVLETYRRDLEEFSSGLKQETAAIREAATRAVKDLPGSLEAGASVAQESL  113

Query  471  ETVGQAIDDIGSSVAEIIVQGKDSILAPEDSDNEFS  578
            E+VGQA+DD       +I QGK+ +++ E S+ +FS
Sbjct  114  ESVGQALDD-------LIAQGKEVLISSESSNQDFS  142



>ref|XP_004297011.1| PREDICTED: BSD domain-containing protein 1 [Fragaria vesca subsp. 
vesca]
Length=414

 Score =   135 bits (341),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 83/147 (56%), Positives = 107/147 (73%), Gaps = 11/147 (7%)
 Frame = +3

Query  117  MDFFKSVFTEEQDYSDTEDTEISSSNLDVQAQPESPPGAPDGNPNIPAIVNAWGFGSGLL  296
            MDFFKSVF+++ D SD + T +S +  DV A P+ P   PD N +      AW FG GL+
Sbjct  1    MDFFKSVFSDDPDPSDDDSTSLSQTE-DV-ASPD-PEQTPDSNSHT---TGAWSFG-GLM  53

Query  297  KTLASKSESVIQNYRRDLEEFSSGLQKETAIIREAASRAVQDLPAHIESGATAAQESLET  476
             TLA+KSESV+Q YRRDL E  SGL+KETA+IR+ ASRAV++LPA ++ GA+ AQ SLE+
Sbjct  54   TTLATKSESVLQTYRRDLAELGSGLKKETAVIRDVASRAVKELPASLDVGASVAQVSLES  113

Query  477  VGQAIDDIGSSV----AEIIVQGKDSI  545
            VGQAIDDIGS+V    AEII  G+++I
Sbjct  114  VGQAIDDIGSTVWKSTAEIISHGREAI  140



>ref|XP_010524783.1| PREDICTED: BSD domain-containing protein 1 [Tarenaya hassleriana]
Length=443

 Score =   133 bits (334),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 79/149 (53%), Positives = 97/149 (65%), Gaps = 26/149 (17%)
 Frame = +3

Query  111  FSMDFFKSVFTEEQDYSDTEDTEISSSNLDVQAQPESPPGAPDGNPNIPAIVNAWGFGSG  290
            FSMD FKSVF+E                      P+  P  PD +   P    +W FG G
Sbjct  45   FSMDLFKSVFSEYD-------------------HPQ--PDPPDCDLADPDPSPSWSFG-G  82

Query  291  LLKTLASKSESVIQNYRRDLEEFSSGLQKETAIIREAASRAVQDLPAHIESGATAAQESL  470
            L+KTLA+KSESVI +YRRD EEF S L+KET+IIRE ASRAV+DLP  +E GA+ AQESL
Sbjct  83   LIKTLATKSESVIGSYRRDFEEFGSELKKETSIIREVASRAVKDLPQSLEIGASVAQESL  142

Query  471  ETVGQAIDDIGSSV----AEIIVQGKDSI  545
            E+VGQAIDDIG+SV    A+II  G++S+
Sbjct  143  ESVGQAIDDIGASVWKSTAQIISHGRESL  171



>ref|XP_009420984.1| PREDICTED: BSD domain-containing protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=471

 Score =   133 bits (334),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 83/162 (51%), Positives = 100/162 (62%), Gaps = 28/162 (17%)
 Frame = +3

Query  117  MDFFKSVFTEEQDYSDTEDTEISSSNLDVQAQPESPPGAPDGNPNIPAIVNA--------  272
            MDFFKSVF+           +  S     Q+QPESP  +P+ +        A        
Sbjct  1    MDFFKSVFS----------ADPVSPRDQHQSQPESPHRSPEADEQGDGAPGAGGDGDGGG  50

Query  273  ---WGFGSGLLKTLASKSESVIQNYRRDLEEFSSGLQKETAIIREAASRAVQDLPAHIES  443
               W    GL+KT A+KSESVIQ YRRDLEEF SGL+KETA IREAA+RAV DLP  +E+
Sbjct  51   GSGW---RGLMKTFATKSESVIQTYRRDLEEFGSGLKKETASIREAAARAVLDLPGSLEA  107

Query  444  GATAAQESLETVGQAIDDIGSSV----AEIIVQGKDSILAPE  557
            GA+AAQESLE+VG A DD G SV    AEI+ QGK++IL  E
Sbjct  108  GASAAQESLESVGHAFDDFGGSVWRGTAEILSQGKEAILLME  149



>emb|CDO98964.1| unnamed protein product [Coffea canephora]
Length=423

 Score =   132 bits (333),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 65/102 (64%), Positives = 80/102 (78%), Gaps = 1/102 (1%)
 Frame = +3

Query  264  VNAWG-FGSGLLKTLASKSESVIQNYRRDLEEFSSGLQKETAIIREAASRAVQDLPAHIE  440
             ++W  FGS   K++ASKSESVI+NYR DLEEFSSGL+KET +IREAA RAV++LP  +E
Sbjct  55   TSSWATFGSSFFKSVASKSESVIRNYRNDLEEFSSGLRKETTVIREAARRAVENLPGRLE  114

Query  441  SGATAAQESLETVGQAIDDIGSSVAEIIVQGKDSILAPEDSD  566
            SGA  AQ SLE+VGQ IDD+G +V+ II+ GKDSI  P D D
Sbjct  115  SGAAVAQTSLESVGQVIDDLGGAVSGIIIHGKDSIFHPNDGD  156



>gb|EYU43852.1| hypothetical protein MIMGU_mgv1a018969mg [Erythranthe guttata]
Length=409

 Score =   132 bits (331),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 78/158 (49%), Positives = 105/158 (66%), Gaps = 18/158 (11%)
 Frame = +3

Query  117  MDFFKSVFTEEQDYSDTEDTEISSSNLDVQAQPESPPGAPDGNPNIPAIVNAWGFGSGLL  296
            MDFFKSVF+E         T  + +N +                N P   ++W FGS L 
Sbjct  1    MDFFKSVFSEPTPDPSPPSTPSTPTNPE----------------NTPPAASSWEFGSTLF  44

Query  297  KTLASKSESVIQNYRRDLEEFSSGLQKETAIIREAASRAVQDLPAHIESGATAAQESLET  476
            +T+ASKSES+I NY +DL++FS+ L+KET++IR+AASRAVQDLPA +ESGA  AQESLE 
Sbjct  45   RTIASKSESLIDNYYKDLQDFSTELKKETSVIRQAASRAVQDLPARLESGAAIAQESLEA  104

Query  477  VGQAIDDIGSSVAEIIVQGKDSILAPEDSDNEFSENSG  590
            VGQAID++GS+V+EII  GKD   AP D  ++  +++G
Sbjct  105  VGQAIDNVGSTVSEII--GKDLNFAPNDGYSDSDDDAG  140



>ref|XP_008775272.1| PREDICTED: BSD domain-containing protein C22A12.14c [Phoenix 
dactylifera]
Length=356

 Score =   130 bits (328),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 87/177 (49%), Positives = 107/177 (60%), Gaps = 34/177 (19%)
 Frame = +3

Query  117  MDFFKSVFTEEQDYSDTEDTEISSSNLDVQAQPESPPGAPD--------------GNPNI  254
            MDFFKSVF  + D S ++     S        P+SP   PD               +PN 
Sbjct  1    MDFFKSVFAADPDPSPSDSPRQISP-------PDSPCRPPDEEEERGGEAPATCSPDPNS  53

Query  255  PAIV------NAWGFGSGLLKTLASKSE--SVIQNYRRDLEEFSSGLQKETAIIREAASR  410
            P          AW FG GL+KT+ASK E  S+I+ YRRDLEEF SGL+KETA IREAA+R
Sbjct  54   PTTGGGGGGSEAWSFG-GLIKTIASKKELRSLIETYRRDLEEFGSGLKKETAAIREAATR  112

Query  411  AVQDLPAHIESGATAAQESLETVGQAIDDIGSSV----AEIIVQGKDSILAPEDSDN  569
             V+DLP  +ESGA+ AQESLE+VGQA+DDIG SV    A+II Q K+++LA E   N
Sbjct  113  TVRDLPGSLESGASVAQESLESVGQAMDDIGGSVWRGTADIISQSKEALLAMESDAN  169



>gb|KGN57039.1| hypothetical protein Csa_3G150190 [Cucumis sativus]
Length=369

 Score =   129 bits (323),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 65/98 (66%), Positives = 81/98 (83%), Gaps = 5/98 (5%)
 Frame = +3

Query  270  AWGFGSGLLKTLASKSESVIQNYRRDLEEFSSGLQKETAIIREAASRAVQDLPAHIESGA  449
            +W FG GL+KTLA+KSESVI NYRRDLEE  SGL+KET++IRE ASRAV+DLP  ++ GA
Sbjct  40   SWSFG-GLIKTLATKSESVISNYRRDLEELGSGLRKETSVIREVASRAVKDLPTTLDVGA  98

Query  450  TAAQESLETVGQAIDDIGSSV----AEIIVQGKDSILA  551
            + AQESLE+VGQAIDDIGS+V    ++II  G+D+ LA
Sbjct  99   SVAQESLESVGQAIDDIGSAVWKSTSKIISHGRDTFLA  136



>ref|XP_004167627.1| PREDICTED: BSD domain-containing protein 1-like [Cucumis sativus]
Length=384

 Score =   129 bits (324),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 65/100 (65%), Positives = 82/100 (82%), Gaps = 5/100 (5%)
 Frame = +3

Query  270  AWGFGSGLLKTLASKSESVIQNYRRDLEEFSSGLQKETAIIREAASRAVQDLPAHIESGA  449
            +W FG GL+KTLA+KSESVI NYRRDLEE  SGL+KET++IRE ASRAV+DLP  ++ GA
Sbjct  40   SWSFG-GLIKTLATKSESVISNYRRDLEELGSGLRKETSVIREVASRAVKDLPTTLDVGA  98

Query  450  TAAQESLETVGQAIDDIGSSV----AEIIVQGKDSILAPE  557
            + AQESLE+VGQAIDDIGS+V    ++II  G+D+ LA +
Sbjct  99   SVAQESLESVGQAIDDIGSAVWKSTSKIISHGRDTFLASD  138



>ref|XP_004134462.1| PREDICTED: BSD domain-containing protein 1-like [Cucumis sativus]
Length=399

 Score =   129 bits (324),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 66/107 (62%), Positives = 84/107 (79%), Gaps = 5/107 (5%)
 Frame = +3

Query  249  NIPAIVNAWGFGSGLLKTLASKSESVIQNYRRDLEEFSSGLQKETAIIREAASRAVQDLP  428
            N+     +W FG GL+KTLA+KSESVI NYRRDLEE  SGL+KET++IRE ASRAV+DLP
Sbjct  33   NLSPPSTSWSFG-GLIKTLATKSESVISNYRRDLEELGSGLRKETSVIREVASRAVKDLP  91

Query  429  AHIESGATAAQESLETVGQAIDDIGSSV----AEIIVQGKDSILAPE  557
              ++ GA+ AQESLE+VGQAIDDIGS+V    ++II  G+D+ LA +
Sbjct  92   TTLDVGASVAQESLESVGQAIDDIGSAVWKSTSKIISHGRDTFLASD  138



>ref|XP_008438741.1| PREDICTED: BSD domain-containing protein 1 [Cucumis melo]
Length=403

 Score =   129 bits (323),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 65/107 (61%), Positives = 84/107 (79%), Gaps = 5/107 (5%)
 Frame = +3

Query  249  NIPAIVNAWGFGSGLLKTLASKSESVIQNYRRDLEEFSSGLQKETAIIREAASRAVQDLP  428
            N+     +W FG GL+KTLA+KSESVI NYRRDLEE  SGL+KET++IRE ASRAV+DLP
Sbjct  32   NLSTPSTSWSFG-GLIKTLATKSESVISNYRRDLEELGSGLRKETSVIREVASRAVKDLP  90

Query  429  AHIESGATAAQESLETVGQAIDDIGSSV----AEIIVQGKDSILAPE  557
              ++ GA+ AQESLE+VGQAIDDIG++V    ++II  G+D+ LA +
Sbjct  91   TTLDVGASVAQESLESVGQAIDDIGTAVWKSTSKIISHGRDTFLASD  137



>ref|XP_009393894.1| PREDICTED: BSD domain-containing protein C22A12.14c-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009393895.1| PREDICTED: BSD domain-containing protein C22A12.14c-like [Musa 
acuminata subsp. malaccensis]
Length=465

 Score =   129 bits (323),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 75/159 (47%), Positives = 102/159 (64%), Gaps = 20/159 (13%)
 Frame = +3

Query  117  MDFFKSVFTEEQDYSDTEDTEISSSNLDVQAQPESPPGAPDGNPNIP----AIVNAWGFG  284
            MDFFKSVF+ +            +S     + PESP  +PDG+             W FG
Sbjct  1    MDFFKSVFSAD-----------PTSPRQKNSPPESPHHSPDGDERGSFGGSGETGGWSFG  49

Query  285  SGLLKTLASKSESVIQNYRRDLEEFSSGLQKETAIIREAASRAVQDLPAHIESGATAAQE  464
             G +KT A+KSESVI+ YRRDLEEF SG++KETA + +A +RAV DLP  +++GA+ AQE
Sbjct  50   -GFVKTFATKSESVIRTYRRDLEEFGSGIKKETAFLGDATARAVLDLPGSLDAGASVAQE  108

Query  465  SLETVGQAIDDIGSSV----AEIIVQGKDSILAPEDSDN  569
            SLE+VG+ +DDIG SV    AEII +GK++I++ E  D+
Sbjct  109  SLESVGRIVDDIGGSVWRGTAEIISRGKEAIMSMEAEDS  147



>ref|XP_006414966.1| hypothetical protein EUTSA_v10025468mg [Eutrema salsugineum]
 gb|ESQ56419.1| hypothetical protein EUTSA_v10025468mg [Eutrema salsugineum]
Length=379

 Score =   127 bits (318),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 77/164 (47%), Positives = 102/164 (62%), Gaps = 24/164 (15%)
 Frame = +3

Query  117  MDFFKSVFTEEQDYSDTEDTEISSSNLDVQAQPESPPGAPDGNPNIPAIVNAWGFGSGLL  296
            MD FKSV +E                 D Q +P+SP   P  +P   +  +       L+
Sbjct  1    MDLFKSVLSE----------------YDHQQRPDSPDSTPLDDPTTSSSSSW--SFGSLI  42

Query  297  KTLASKSESVIQNYRRDLEEFSSGLQKETAIIREAASRAVQDLPAHIESGATAAQESLET  476
            KTL +KSESVI +YR D +EF S L+KET++IR  ASRAV+DLP  +E GA+ AQESLE+
Sbjct  43   KTLTTKSESVIGSYRHDFQEFGSELKKETSVIRRVASRAVKDLPDSLEIGASVAQESLES  102

Query  477  VGQAIDDIGSSV----AEIIVQGKDSIL--APEDSDNEFSENSG  590
            VGQAIDDIG++V    A+II  GK+S+L  +PEDSDN  + + G
Sbjct  103  VGQAIDDIGATVWKSTAKIISHGKESLLSSSPEDSDNRRNHHQG  146



>ref|XP_009139648.1| PREDICTED: BSD domain-containing protein 1 [Brassica rapa]
 emb|CDY01112.1| BnaA04g07070D [Brassica napus]
Length=343

 Score =   125 bits (313),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 72/149 (48%), Positives = 95/149 (64%), Gaps = 29/149 (19%)
 Frame = +3

Query  117  MDFFKSVFTEEQDYSDTEDTEISSSNLDVQAQPESPPGAPDGNPNIPAIVNAWGFGSGLL  296
            MD FKSV                         PE  P     +P   A  ++W FG+ L+
Sbjct  1    MDLFKSVL------------------------PEYDPSESTQSPVDDAASSSWSFGN-LI  35

Query  297  KTLASKSESVIQNYRRDLEEFSSGLQKETAIIREAASRAVQDLPAHIESGATAAQESLET  476
            KTLA+KSESVI +YRR+ EEF S L+KE+++IR+ ASRAV+DLPA ++ GA+ AQESLE+
Sbjct  36   KTLATKSESVIGSYRREFEEFGSELKKESSVIRQVASRAVKDLPASLDVGASVAQESLES  95

Query  477  VGQAIDDIGSSV----AEIIVQGKDSILA  551
            VGQAIDDIG +V    A+II +GKDS+L+
Sbjct  96   VGQAIDDIGGAVWKSTAKIISRGKDSLLS  124



>emb|CDY47334.1| BnaCnng14710D [Brassica napus]
Length=388

 Score =   123 bits (309),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 80/173 (46%), Positives = 103/173 (60%), Gaps = 22/173 (13%)
 Frame = +3

Query  33   FVAGHGGNCVIYFDSGEHQSHLYFYLFS-MDFFKSVFTEEQDYSDTEDTEISSSNLDVQA  209
            FVAGH  N           S      FS MD FKSV  E   +               Q 
Sbjct  10   FVAGHRSNIPRQIVQNSTSSIKPLASFSPMDLFKSVLPEYDHHH--------------QQ  55

Query  210  QPESPPGAPDGNPNIPAIVNAWGFGSGLLKTLASKSESVIQNYRRDLEEFSSGLQKETAI  389
            QP+SP      +P   A  ++W FG+ L+KTLA+KSESVI +YRR+ EEF S L+KE+++
Sbjct  56   QPDSPESTQ--SPLDDAASSSWSFGN-LIKTLATKSESVIGSYRREFEEFGSELKKESSV  112

Query  390  IREAASRAVQDLPAHIESGATAAQESLETVGQAIDDIGSSV----AEIIVQGK  536
            IR+ ASRAV+DLP  ++ GA+ AQESLE+VGQAIDDIG +V    A+II +GK
Sbjct  113  IRQVASRAVKDLPGSLDIGASVAQESLESVGQAIDDIGGAVWKSTAKIISRGK  165



>gb|KJB38458.1| hypothetical protein B456_006G255500 [Gossypium raimondii]
 gb|KJB38459.1| hypothetical protein B456_006G255500 [Gossypium raimondii]
 gb|KJB38460.1| hypothetical protein B456_006G255500 [Gossypium raimondii]
Length=372

 Score =   122 bits (306),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 75/148 (51%), Positives = 93/148 (63%), Gaps = 28/148 (19%)
 Frame = +3

Query  117  MDFFKSVFTEEQDYSDTEDTEISSSNLDVQAQPESPPGAPDGNPNIPAIVNAWGFGSGLL  296
            MDFFKSVF +                 D+Q+Q    P  P   P++ +    W FG GL+
Sbjct  1    MDFFKSVFAD-----------------DIQSQSSHLPTDP--TPDLGSSA-TWSFG-GLI  39

Query  297  KTLASKSESVIQNYRRDLEEFSSGLQKETAIIREAASRAVQDLPAHIESGATAAQESLET  476
            KTLA KSESV+++YR++ EEF SGL+KET IIR  ASRAV D    +E GA+ AQE LE+
Sbjct  40   KTLADKSESVMESYRKEFEEFGSGLKKETEIIRSVASRAVND---SLEIGASVAQEKLES  96

Query  477  VGQAIDDIGSSV----AEIIVQGKDSIL  548
            VGQAIDDIGSSV    A+II  GKD+ L
Sbjct  97   VGQAIDDIGSSVWKSTAQIISHGKDTFL  124



>ref|XP_011006074.1| PREDICTED: BSD domain-containing protein 1-like [Populus euphratica]
Length=403

 Score =   122 bits (306),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 79/175 (45%), Positives = 101/175 (58%), Gaps = 23/175 (13%)
 Frame = +3

Query  117  MDFFKSVFTEEQDYSDTEDTEISSSNLDVQAQPESPPGAPDGNPNIPAIVNAWGFGSGLL  296
            M+FFKSVF          D + +  N      P S    P   P    +  AW F S L+
Sbjct  1    MNFFKSVF----------DKDTTPPN-----NPSSENPEPAPEPEPSTLNLAWSFDS-LI  44

Query  297  KTLASKSESVIQNYRRDLEEFSSGLQKETAIIREAASRAVQDLPAHIESGATAAQESLET  476
            KT+++KSES+IQ Y++DL E  SG  KETA+IR  ASRAV DLPA  ESGA  AQ SLE+
Sbjct  45   KTISTKSESIIQTYKKDLHELRSGFNKETAVIRHVASRAVHDLPASFESGAAVAQHSLES  104

Query  477  VGQAIDDIGSSV----AEIIVQGKDSILAPEDSDNEFSENSGRNDRSDDVYKQHL  629
            VGQ IDDIGS+V    A+II  GKDS+ +  D   + +++S   D S    + HL
Sbjct  105  VGQVIDDIGSTVWNSTAQIISHGKDSVFSAVDHHRDLNDDS---DASSSTKRHHL  156



>ref|XP_002312727.2| hypothetical protein POPTR_0008s20350g [Populus trichocarpa]
 gb|EEE90094.2| hypothetical protein POPTR_0008s20350g [Populus trichocarpa]
Length=416

 Score =   120 bits (301),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 79/190 (42%), Positives = 104/190 (55%), Gaps = 45/190 (24%)
 Frame = +3

Query  117  MDFFKSVFTEEQDYSDTEDTEISSSNLDVQAQPESPPGAPDG-NPNIP------------  257
            M+FFKSVF E+                       +PP  P   NP+              
Sbjct  1    MNFFKSVFDEDT----------------------APPNNPSSDNPDPEPEPEQEPEPEPE  38

Query  258  -AIVN-AWGFGSGLLKTLASKSESVIQNYRRDLEEFSSGLQKETAIIREAASRAVQDLPA  431
             + +N AW F S L+KT+++KSES+IQ Y++DL+E  SG  KE A+IR  ASRAV DLPA
Sbjct  39   PSTLNLAWSFDS-LIKTISTKSESIIQTYKKDLQELRSGFNKENAVIRHVASRAVHDLPA  97

Query  432  HIESGATAAQESLETVGQAIDDIGSSV----AEIIVQGKDSILAPEDSDNEFSENSGRND  599
              ESGA  AQ SLE+VGQ IDDIGS+V    A+II  GKDS+ +  D   + +++S   D
Sbjct  98   SFESGAAVAQHSLESVGQVIDDIGSTVWNSTAQIISHGKDSVFSAVDHHRDLNDDS---D  154

Query  600  RSDDVYKQHL  629
             S    + HL
Sbjct  155  ASSSTKRHHL  164



>emb|CDP03589.1| unnamed protein product [Coffea canephora]
Length=519

 Score =   120 bits (302),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 73/183 (40%), Positives = 105/183 (57%), Gaps = 35/183 (19%)
 Frame = +3

Query  117  MDFFKSVFTEEQDYSDTEDTEISSSNLDVQAQPESPP---------------GAPDGNP-  248
            M+FFKS+ +++ D    + T+        + +P SPP                +P+ NP 
Sbjct  1    MNFFKSILSDDPDPPHPQKTQ--------EPEPNSPPPCSSQDSDEESGVVAKSPNANPT  52

Query  249  ----------NIPAIVNAWGFGSGLLKTLASKSESVIQNYRRDLEEFSSGLQKETAIIRE  398
                      +  + V  W FG GL+KTLAS+SESV++ YRRDL+EF SGL+KE+ + RE
Sbjct  53   PDSSPVAGTSSTTSGVGGWSFG-GLIKTLASQSESVLETYRRDLQEFGSGLRKESQLFRE  111

Query  399  AASRAVQDLPAHIESGATAAQESLETVGQAIDDIGSSVAEIIVQGKDSILAPEDSDNEFS  578
             A RAV+DLPA IE GA+ A  SLE+V  AID +  S A+II  GKD+++   D ++E  
Sbjct  112  VAGRAVRDLPASIEVGASVAHGSLESVTHAIDGVIKSTADIISHGKDTVILSSDVESETP  171

Query  579  ENS  587
            + S
Sbjct  172  DTS  174



>gb|KJB28560.1| hypothetical protein B456_005G055700, partial [Gossypium raimondii]
Length=286

 Score =   118 bits (296),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 76/145 (52%), Positives = 97/145 (67%), Gaps = 15/145 (10%)
 Frame = +3

Query  213  PESPPGAPDGNPNIPAIVNAWGFGSGLLKTLASKSESVIQNYRRDLEEFSSGLQKETAII  392
            PE PP  P  +PN+ +  + W F  GL+KTLASKSESVI++YR+D EE  SGL+KET II
Sbjct  1    PE-PPTEP--SPNLGS-SSTWSF-VGLVKTLASKSESVIESYRKDFEELGSGLKKETEII  55

Query  393  REAASRAVQDLPAHIESGATAAQESLETVGQAIDDIGSSV----AEIIVQGKDSILAPE-  557
            +   SRAV D    +++GA+ AQE LE+VGQAIDDIGSSV    A+II  GKD+ L+P  
Sbjct  56   KSVVSRAVTD---SLDTGASVAQEKLESVGQAIDDIGSSVWKSTAQIISHGKDTFLSPSD  112

Query  558  --DSDNEFSENSGRNDRSDDVYKQH  626
              DSD E S N   N  S+ V ++ 
Sbjct  113  DYDSDPENSRNRKLNINSNSVNEKR  137



>gb|EPS60092.1| hypothetical protein M569_14713 [Genlisea aurea]
Length=358

 Score =   119 bits (298),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 58/108 (54%), Positives = 79/108 (73%), Gaps = 4/108 (4%)
 Frame = +3

Query  201  VQAQPESPPGAPDGNPNIPAIVNAWGFGSGLLKTLASKSESVIQNYRRDLEEFSSGLQKE  380
            V ++P + P  P    N   + ++WGFGS +L ++A+KS S + NY++D+EEFSSG ++E
Sbjct  7    VSSEPTATPSPPSSPANRATVTSSWGFGSAVLDSIAAKSASFLDNYQKDIEEFSSGFRRE  66

Query  381  TAIIREAASRAVQDLPAHIESGATAAQESLETVGQAIDDIGSSVAEII  524
            T+IIREAA RAV +LP+ +ESGA  AQESLE VGQAIDD    VAE+I
Sbjct  67   TSIIREAARRAVSNLPSRLESGAAVAQESLEAVGQAIDD----VAELI  110



>ref|XP_006419764.1| hypothetical protein CICLE_v10005126mg [Citrus clementina]
 gb|ESR33004.1| hypothetical protein CICLE_v10005126mg [Citrus clementina]
Length=394

 Score =   119 bits (299),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 70/149 (47%), Positives = 95/149 (64%), Gaps = 41/149 (28%)
 Frame = +3

Query  117  MDFFKSVFTEEQDYSDTEDTEISSSNLDVQAQPESPPGAPDGNPNIPAIVNAWGFGSGLL  296
            M+FFKSVF+++ + S++E+                    PD NPN+ ++   WG      
Sbjct  1    MNFFKSVFSKDPEPSESEN--------------------PDPNPNLNSV---WG------  31

Query  297  KTLASKSESVIQNYRRDLEEFSSGLQKETAIIREAASRAVQDLPAHIESGATAAQESLET  476
                    SVI++Y++D E+F SGL+KETA+IREAASRAV+DLPA  E GA+ AQESLE+
Sbjct  32   --------SVIESYKKDFEDFRSGLKKETAVIREAASRAVKDLPASFEIGASVAQESLES  83

Query  477  VGQAIDDIGSSV----AEIIVQGKDSILA  551
            VGQAIDDIGS+V    A+II QGK ++L 
Sbjct  84   VGQAIDDIGSTVWKSTADIISQGKRNLLT  112



>ref|XP_006489227.1| PREDICTED: BSD domain-containing protein 1-like [Citrus sinensis]
Length=394

 Score =   117 bits (292),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 69/149 (46%), Positives = 94/149 (63%), Gaps = 41/149 (28%)
 Frame = +3

Query  117  MDFFKSVFTEEQDYSDTEDTEISSSNLDVQAQPESPPGAPDGNPNIPAIVNAWGFGSGLL  296
            M+FFKSVF+++ + S++E+                    PD NPN+ ++   WG      
Sbjct  1    MNFFKSVFSKDPEPSESEN--------------------PDPNPNLNSV---WG------  31

Query  297  KTLASKSESVIQNYRRDLEEFSSGLQKETAIIREAASRAVQDLPAHIESGATAAQESLET  476
                    SVI++Y++D E+F SGL+KETA+IREAASRAV+DLPA  E GA+ AQESLE+
Sbjct  32   --------SVIESYKKDFEDFRSGLKKETAVIREAASRAVKDLPASFEIGASVAQESLES  83

Query  477  VGQAIDDIGSSV----AEIIVQGKDSILA  551
            VGQAIDDI S+V    A+II QGK ++L 
Sbjct  84   VGQAIDDISSTVWKSTADIISQGKRNLLT  112



>gb|KDO74911.1| hypothetical protein CISIN_1g016172mg [Citrus sinensis]
Length=394

 Score =   116 bits (291),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 69/149 (46%), Positives = 94/149 (63%), Gaps = 41/149 (28%)
 Frame = +3

Query  117  MDFFKSVFTEEQDYSDTEDTEISSSNLDVQAQPESPPGAPDGNPNIPAIVNAWGFGSGLL  296
            M+FFKSVF+++ + S++E+                    PD NPN+ ++   WG      
Sbjct  1    MNFFKSVFSKDPEPSESEN--------------------PDPNPNLNSV---WG------  31

Query  297  KTLASKSESVIQNYRRDLEEFSSGLQKETAIIREAASRAVQDLPAHIESGATAAQESLET  476
                    SVI++Y++D E+F SGL+KETA+IREAASRAV+DLPA  E GA+ AQESLE+
Sbjct  32   --------SVIESYKKDFEDFRSGLKKETAVIREAASRAVKDLPASFEIGASVAQESLES  83

Query  477  VGQAIDDIGSSV----AEIIVQGKDSILA  551
            VGQAIDDI S+V    A+II QGK ++L 
Sbjct  84   VGQAIDDISSTVWKSTADIISQGKRNLLT  112



>ref|XP_006378128.1| hypothetical protein POPTR_0010s02980g [Populus trichocarpa]
 gb|ERP55925.1| hypothetical protein POPTR_0010s02980g [Populus trichocarpa]
Length=475

 Score =   115 bits (289),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 70/158 (44%), Positives = 96/158 (61%), Gaps = 18/158 (11%)
 Frame = +3

Query  117  MDFFKSVFTEEQDYSDTEDTEISSSNLDVQAQPESPPG-APDGNPNIPAIVNAWGFGSGL  293
            M+FFKSVF ++    D+              +  SPP  +   +PN       W  GS L
Sbjct  23   MNFFKSVFADDTTPPDS-------------PKSRSPPNNSTSEDPNPTTQNQVWSLGS-L  68

Query  294  LKTLASKSESVIQNYRRDLEEFSSGLQKETAIIREAASRAVQDLPAHIESGATAAQESLE  473
            ++TLA+KSESV++ Y++DLEEF SGL+KETAIIR+ ASRAV DLPA  E+ A  AQE+++
Sbjct  69   IQTLATKSESVMEIYKKDLEEFGSGLKKETAIIRDVASRAVHDLPASFEASAAVAQETID  128

Query  474  TVGQAIDDIGSSVAEIIVQGKDSILAPEDSDNEFSENS  587
             +G     +  S A+II QGKDSIL  +   + FS N+
Sbjct  129  GIGST---MWKSTAQIISQGKDSILDADHDHDLFSSNA  163



>ref|XP_007035359.1| BSD domain-containing protein, putative [Theobroma cacao]
 gb|EOY06285.1| BSD domain-containing protein, putative [Theobroma cacao]
Length=372

 Score =   114 bits (286),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 73/148 (49%), Positives = 92/148 (62%), Gaps = 28/148 (19%)
 Frame = +3

Query  117  MDFFKSVFTEEQDYSDTEDTEISSSNLDVQAQPESPPGAPDGNPNIPAIVNAWGFGSGLL  296
            MDFFKSVF++        D +   S+      P   PG+             W FG GL+
Sbjct  1    MDFFKSVFSD--------DAQCQFSDPPTDPNPNPNPGSR------------WSFG-GLM  39

Query  297  KTLASKSESVIQNYRRDLEEFSSGLQKETAIIREAASRAVQDLPAHIESGATAAQESLET  476
            +TLA KSESV+++YR+DLE+F SGL+KET IIR  AS+AV D    +E GA+ AQE LE+
Sbjct  40   RTLADKSESVMESYRKDLEDFGSGLKKETEIIRSVASQAVND---SLEIGASVAQEKLES  96

Query  477  VGQAIDDIGSSV----AEIIVQGKDSIL  548
            VGQAIDDIGSSV    A+II  GKD+ L
Sbjct  97   VGQAIDDIGSSVWKSTAQIIAHGKDTFL  124



>ref|XP_011006601.1| PREDICTED: protein DOS2-like isoform X5 [Populus euphratica]
Length=432

 Score =   112 bits (281),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 67/145 (46%), Positives = 89/145 (61%), Gaps = 18/145 (12%)
 Frame = +3

Query  117  MDFFKSVFTEEQDYSDTEDTEISSSNLDVQAQPESPPGAPDGNPNIPAIVN-AWGFGSGL  293
            M+FFKSVF ++    D+ ++              SPP         P   N  W  GS L
Sbjct  23   MNFFKSVFADDTTPPDSPNSH-------------SPPNKSTSEDPNPTTQNPTWSLGS-L  68

Query  294  LKTLASKSESVIQNYRRDLEEFSSGLQKETAIIREAASRAVQDLPAHIESGATAAQESLE  473
            ++TLA+KSESV++ Y++DLEEF SGL+KETAIIR+ ASRAV DLPA  E+ A  AQE+++
Sbjct  69   IQTLATKSESVMEIYKKDLEEFGSGLKKETAIIRDVASRAVHDLPASFEASAAVAQETID  128

Query  474  TVGQAIDDIGSSVAEIIVQGKDSIL  548
             +G     +  S A+II QGKDSIL
Sbjct  129  GIGST---MWKSTAQIISQGKDSIL  150



>ref|XP_011006598.1| PREDICTED: protein DOS2-like isoform X2 [Populus euphratica]
Length=499

 Score =   112 bits (281),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 67/145 (46%), Positives = 89/145 (61%), Gaps = 18/145 (12%)
 Frame = +3

Query  117  MDFFKSVFTEEQDYSDTEDTEISSSNLDVQAQPESPPGAPDGNPNIPAIVN-AWGFGSGL  293
            M+FFKSVF ++    D+ ++              SPP         P   N  W  GS L
Sbjct  23   MNFFKSVFADDTTPPDSPNSH-------------SPPNKSTSEDPNPTTQNPTWSLGS-L  68

Query  294  LKTLASKSESVIQNYRRDLEEFSSGLQKETAIIREAASRAVQDLPAHIESGATAAQESLE  473
            ++TLA+KSESV++ Y++DLEEF SGL+KETAIIR+ ASRAV DLPA  E+ A  AQE+++
Sbjct  69   IQTLATKSESVMEIYKKDLEEFGSGLKKETAIIRDVASRAVHDLPASFEASAAVAQETID  128

Query  474  TVGQAIDDIGSSVAEIIVQGKDSIL  548
             +G     +  S A+II QGKDSIL
Sbjct  129  GIGST---MWKSTAQIISQGKDSIL  150



>ref|XP_011006597.1| PREDICTED: protein DOS2-like isoform X1 [Populus euphratica]
Length=500

 Score =   112 bits (281),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 67/145 (46%), Positives = 89/145 (61%), Gaps = 18/145 (12%)
 Frame = +3

Query  117  MDFFKSVFTEEQDYSDTEDTEISSSNLDVQAQPESPPGAPDGNPNIPAIVN-AWGFGSGL  293
            M+FFKSVF ++    D+ ++              SPP         P   N  W  GS L
Sbjct  23   MNFFKSVFADDTTPPDSPNSH-------------SPPNKSTSEDPNPTTQNPTWSLGS-L  68

Query  294  LKTLASKSESVIQNYRRDLEEFSSGLQKETAIIREAASRAVQDLPAHIESGATAAQESLE  473
            ++TLA+KSESV++ Y++DLEEF SGL+KETAIIR+ ASRAV DLPA  E+ A  AQE+++
Sbjct  69   IQTLATKSESVMEIYKKDLEEFGSGLKKETAIIRDVASRAVHDLPASFEASAAVAQETID  128

Query  474  TVGQAIDDIGSSVAEIIVQGKDSIL  548
             +G     +  S A+II QGKDSIL
Sbjct  129  GIGST---MWKSTAQIISQGKDSIL  150



>ref|XP_011006599.1| PREDICTED: protein DOS2-like isoform X3 [Populus euphratica]
 ref|XP_011006600.1| PREDICTED: protein DOS2-like isoform X4 [Populus euphratica]
Length=498

 Score =   112 bits (281),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 67/145 (46%), Positives = 89/145 (61%), Gaps = 18/145 (12%)
 Frame = +3

Query  117  MDFFKSVFTEEQDYSDTEDTEISSSNLDVQAQPESPPGAPDGNPNIPAIVN-AWGFGSGL  293
            M+FFKSVF ++    D+ ++              SPP         P   N  W  GS L
Sbjct  23   MNFFKSVFADDTTPPDSPNSH-------------SPPNKSTSEDPNPTTQNPTWSLGS-L  68

Query  294  LKTLASKSESVIQNYRRDLEEFSSGLQKETAIIREAASRAVQDLPAHIESGATAAQESLE  473
            ++TLA+KSESV++ Y++DLEEF SGL+KETAIIR+ ASRAV DLPA  E+ A  AQE+++
Sbjct  69   IQTLATKSESVMEIYKKDLEEFGSGLKKETAIIRDVASRAVHDLPASFEASAAVAQETID  128

Query  474  TVGQAIDDIGSSVAEIIVQGKDSIL  548
             +G     +  S A+II QGKDSIL
Sbjct  129  GIGST---MWKSTAQIISQGKDSIL  150



>ref|XP_010450297.1| PREDICTED: BSD domain-containing protein 1-like [Camelina sativa]
Length=356

 Score =   111 bits (278),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 71/150 (47%), Positives = 91/150 (61%), Gaps = 33/150 (22%)
 Frame = +3

Query  117  MDFFKSVFTEEQDYSDTEDTEISSSNLDVQAQPESPPGAPDGNPNIPAIVNAWGFGSGLL  296
            MD FKSV +E               + + Q QP+ P  +           ++W FG+ L+
Sbjct  1    MDLFKSVLSE--------------YDHEQQQQPDEPTASS----------SSWSFGN-LI  35

Query  297  KTLASKSESVIQNYRRDLEEFSSGLQKETAIIREAASRAVQDLPAHIESGATAAQESLET  476
            KTLA+KSESVI +YRRD EEF S L+KET+IIR+ ASR    LP  +E GA+ A ESLE+
Sbjct  36   KTLATKSESVIGSYRRDFEEFGSELKKETSIIRQVASR----LPDSLEIGASVASESLES  91

Query  477  VGQAIDDIGSSV----AEIIVQGKDSILAP  554
            VGQAIDDIG+SV    A II  GK+S+  P
Sbjct  92   VGQAIDDIGASVWKSTARIISHGKESLKKP  121



>ref|XP_010905741.1| PREDICTED: BSD domain-containing protein C22A12.14c [Elaeis guineensis]
Length=479

 Score =   112 bits (280),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 61/99 (62%), Positives = 75/99 (76%), Gaps = 6/99 (6%)
 Frame = +3

Query  291  LLKTLASKSE--SVIQNYRRDLEEFSSGLQKETAIIREAASRAVQDLPAHIESGATAAQE  464
            L+KT+A+K E  S+I+ YRRDLEEF SGL+KETA IREAA+RAVQ+LP  +E+GA+ AQE
Sbjct  53   LIKTIATKKEFGSLIETYRRDLEEFGSGLKKETAAIREAATRAVQNLPGSLEAGASVAQE  112

Query  465  SLETVGQAIDDIGSSV----AEIIVQGKDSILAPEDSDN  569
            SLE+VGQ IDD G SV     EII Q K+ +LA E   N
Sbjct  113  SLESVGQVIDDFGGSVWQGTTEIISQSKEVLLAMESDAN  151



>ref|XP_009412174.1| PREDICTED: BSD domain-containing protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=471

 Score =   112 bits (279),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 79/154 (51%), Positives = 107/154 (69%), Gaps = 8/154 (5%)
 Frame = +3

Query  117  MDFFKSVFTEEQDYSDTEDTEISSS-NLDVQAQPESPPGAPDGNPNIPAIVNA--WGFGS  287
            MDFFKSVF+ + + + ++ + + S  + + +A+ +    +   +PN  A      W FG 
Sbjct  1    MDFFKSVFSADPEPAISQHSPVGSPHDEEDRAREDDRGSSGSPSPNSEASAGGVGWSFG-  59

Query  288  GLLKTLASKSESVIQNYRRDLEEFSSGLQKETAIIREAASRAVQDLPAHIESGATAAQES  467
            G +KT ASKSESVIQ YRRDL EF +GL+KET  IREAA+RAV DLP  +E+GA+ AQES
Sbjct  60   GFIKTFASKSESVIQTYRRDLAEFGTGLKKETEAIREAAARAVGDLPGSLEAGASVAQES  119

Query  468  LETVGQAIDDIGSSV----AEIIVQGKDSILAPE  557
            LE+VGQAIDD+G SV    AEI+ QGK++IL+ E
Sbjct  120  LESVGQAIDDLGGSVWRGTAEIVSQGKEAILSVE  153



>ref|XP_006358434.1| PREDICTED: BSD domain-containing protein 1-like [Solanum tuberosum]
Length=509

 Score =   112 bits (279),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 74/175 (42%), Positives = 97/175 (55%), Gaps = 22/175 (13%)
 Frame = +3

Query  117  MDFFKSVFTEEQDYSDTEDTEISSSNLDVQAQPESPPGAPDGNPNIPAIVNA--------  272
            MDFFKS+ +++ +       +   S+ +   + E  P      PN  +   A        
Sbjct  1    MDFFKSILSDDPEPDPPLPKKPQDSSPEQSPEKEVDPDQNLEKPNSRSDSTADDGGDGGV  60

Query  273  WGFGSGLLKTLASKSESVIQNYRRDLEEFSSGLQKETAIIREAASRAVQDLPAHIESGAT  452
            W FG GLLKTL+++SESV++ YRRDL+EF SGL+KET + RE ASRAV+DLP  IE G  
Sbjct  61   WSFG-GLLKTLSTRSESVLETYRRDLQEFGSGLKKETELFREVASRAVKDLPNSIEVGT-  118

Query  453  AAQESLETVGQAIDDIGSSVAEIIVQGKDSILA-----PEDSDNEFSENSGRNDR  602
                   TV  AID +  S  EII QGKD++LA     PE  D   + NSGR  R
Sbjct  119  -------TVSHAIDGVIKSTTEIISQGKDTLLASSDAEPETPDANRTLNSGRYSR  166



>ref|XP_004247485.1| PREDICTED: BSD domain-containing protein 1 isoform X1 [Solanum 
lycopersicum]
Length=512

 Score =   111 bits (277),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 74/174 (43%), Positives = 99/174 (57%), Gaps = 21/174 (12%)
 Frame = +3

Query  117  MDFFKSVFTEEQDYSDTEDTEISSSNLDVQAQP----ESPPGAPDGNPNIPAI---VNAW  275
            MDFFKS+ +++ +       +   S+ + +  P    E P    D N    A       W
Sbjct  1    MDFFKSILSDDPEPDPPLPKKPHDSSPEKEIVPDQNLEKPNSRSDSNAADGADGPDAGVW  60

Query  276  GFGSGLLKTLASKSESVIQNYRRDLEEFSSGLQKETAIIREAASRAVQDLPAHIESGATA  455
             FG GLLKTL+++SESV++ YRRDL+EF SGL+KET + RE ASRAV+DLP  IE G   
Sbjct  61   SFG-GLLKTLSTRSESVLETYRRDLQEFGSGLKKETELFREVASRAVKDLPNSIEVGT--  117

Query  456  AQESLETVGQAIDDIGSSVAEIIVQGKDSILAPEDSDNEFSE-----NSGRNDR  602
                  TV  AID +  S  EII QGKD++LA  D+++E  +     NSGR  R
Sbjct  118  ------TVSHAIDGVIKSTTEIISQGKDTLLASSDAESETPDANQTLNSGRYSR  165



>ref|XP_011006071.1| PREDICTED: BSD domain-containing protein 1-like isoform X2 [Populus 
euphratica]
Length=477

 Score =   110 bits (276),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 63/103 (61%), Positives = 77/103 (75%), Gaps = 8/103 (8%)
 Frame = +3

Query  255  PAIVNAWGFGSGLLKTLASKSESVIQNYRRDLEEFSSGLQKETAIIREAASRAVQDLPAH  434
            P   + W FGS L++TLA+KSESVI+ Y++DLEEF SGL+ E+AIIR+ ASRAV DLPA 
Sbjct  33   PTQNSTWSFGS-LIQTLATKSESVIEIYKKDLEEFGSGLKNESAIIRDVASRAVHDLPAS  91

Query  435  IESGATAAQESLETVGQAIDDIGSSV----AEIIVQGKDSILA  551
             E+ A  AQES   VGQAI  IGSS+    A+II QG+DSILA
Sbjct  92   FEASAAVAQES---VGQAIGGIGSSMWKSTAQIISQGRDSILA  131



>ref|XP_011006073.1| PREDICTED: BSD domain-containing protein 1-like isoform X3 [Populus 
euphratica]
Length=473

 Score =   110 bits (276),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 63/103 (61%), Positives = 77/103 (75%), Gaps = 8/103 (8%)
 Frame = +3

Query  255  PAIVNAWGFGSGLLKTLASKSESVIQNYRRDLEEFSSGLQKETAIIREAASRAVQDLPAH  434
            P   + W FGS L++TLA+KSESVI+ Y++DLEEF SGL+ E+AIIR+ ASRAV DLPA 
Sbjct  33   PTQNSTWSFGS-LIQTLATKSESVIEIYKKDLEEFGSGLKNESAIIRDVASRAVHDLPAS  91

Query  435  IESGATAAQESLETVGQAIDDIGSSV----AEIIVQGKDSILA  551
             E+ A  AQES   VGQAI  IGSS+    A+II QG+DSILA
Sbjct  92   FEASAAVAQES---VGQAIGGIGSSMWKSTAQIISQGRDSILA  131



>ref|XP_011006070.1| PREDICTED: BSD domain-containing protein 1-like isoform X1 [Populus 
euphratica]
Length=502

 Score =   110 bits (276),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 63/103 (61%), Positives = 77/103 (75%), Gaps = 8/103 (8%)
 Frame = +3

Query  255  PAIVNAWGFGSGLLKTLASKSESVIQNYRRDLEEFSSGLQKETAIIREAASRAVQDLPAH  434
            P   + W FGS L++TLA+KSESVI+ Y++DLEEF SGL+ E+AIIR+ ASRAV DLPA 
Sbjct  33   PTQNSTWSFGS-LIQTLATKSESVIEIYKKDLEEFGSGLKNESAIIRDVASRAVHDLPAS  91

Query  435  IESGATAAQESLETVGQAIDDIGSSV----AEIIVQGKDSILA  551
             E+ A  AQES   VGQAI  IGSS+    A+II QG+DSILA
Sbjct  92   FEASAAVAQES---VGQAIGGIGSSMWKSTAQIISQGRDSILA  131



>gb|EYU38131.1| hypothetical protein MIMGU_mgv1a005992mg [Erythranthe guttata]
Length=462

 Score =   108 bits (271),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 78/170 (46%), Positives = 97/170 (57%), Gaps = 29/170 (17%)
 Frame = +3

Query  117  MDFFKSVFTEEQDYSDTEDTEISSSNLDVQAQPESPPGAP--DGNPNIPA----IVNAWG  278
            M+FFKS+  ++ D          S N D Q  P SP   P  D NP   A      + W 
Sbjct  1    MNFFKSILLDDPDPP-------KSLNSD-QPGPNSPLKPPHQDANPGGAAQEGTAADGWS  52

Query  279  FGSGLLKTLASKSESVIQNYRRDLEEFSSGLQKETAIIREAASRAVQDLPAHIESGATAA  458
            FG GL+KTLA++SESVI+ YR+DLEEF SGL+KE+ IIREAASRAV+DLPA +E+G +AA
Sbjct  53   FG-GLIKTLATRSESVIETYRKDLEEFGSGLKKESEIIREAASRAVKDLPASLEAGTSAA  111

Query  459  QESLETVGQAIDDIGSSVAEII-----VQGKDSILAPEDSDNEFSENSGR  593
            Q         +D +  S AEII     V G D    PE  +     NSGR
Sbjct  112  Q-------GVLDGVLKSTAEIISKETQVFGSDG--EPETPETNRGLNSGR  152



>ref|XP_002273759.1| PREDICTED: BSD domain-containing protein 1 [Vitis vinifera]
Length=449

 Score =   108 bits (270),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 69/160 (43%), Positives = 95/160 (59%), Gaps = 20/160 (13%)
 Frame = +3

Query  117  MDFFKSVFTEEQDYSDTEDTEISSSNLDVQAQPESPPGAPDGNPNIPAIVNAWGFGSGLL  296
            MDFFKSVF+++ D    +    S        + ++P   PD NPN P+    W FG GL+
Sbjct  1    MDFFKSVFSDDPDPPRFDPDPESPKKPSQSEEDDAPDAKPDPNPN-PSAGGGWSFG-GLI  58

Query  297  KTLASKSESVIQNYRRDLEEFSSGLQKETAIIREAASRAVQDLPAHIESGATAAQESLET  476
            KTL +KSESVI+ YRRDL+EF +GL+ ETA  RE ASR V++LPA IE GA+        
Sbjct  59   KTLTTKSESVIEIYRRDLQEFGTGLKHETAAFREVASRVVKELPASIEVGAS--------  110

Query  477  VGQAIDDIGSSV----AEIIVQGKDSILAPEDSDNEFSEN  584
                  + GSS+    AEII  GK+++LA +   +E ++N
Sbjct  111  ------EFGSSMLKGTAEIISHGKEALLAVDTDTDENAQN  144



>ref|XP_002312728.2| BSD domain-containing family protein [Populus trichocarpa]
 gb|EEE90095.2| BSD domain-containing family protein [Populus trichocarpa]
Length=358

 Score =   107 bits (268),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 61/105 (58%), Positives = 76/105 (72%), Gaps = 8/105 (8%)
 Frame = +3

Query  255  PAIVNAWGFGSGLLKTLASKSESVIQNYRRDLEEFSSGLQKETAIIREAASRAVQDLPAH  434
            P   + W FGS L++TLA+KSESVI+ Y++DLEEF SGL+ E+ IIR+ ASRAV DLPA 
Sbjct  33   PTQNSTWSFGS-LIQTLATKSESVIEIYKKDLEEFGSGLKNESTIIRDVASRAVHDLPAS  91

Query  435  IESGATAAQESLETVGQAIDDIGSSV----AEIIVQGKDSILAPE  557
             E+ A  AQES    GQAI  IGSS+    A+II QG+DSILA +
Sbjct  92   FEASAAVAQESF---GQAIGGIGSSMWKSTAQIISQGRDSILASD  133



>ref|XP_010675084.1| PREDICTED: BSD domain-containing protein 1-like [Beta vulgaris 
subsp. vulgaris]
Length=418

 Score =   107 bits (268),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 67/148 (45%), Positives = 89/148 (60%), Gaps = 22/148 (15%)
 Frame = +3

Query  117  MDFFKSVFTEEQDYSDTEDTEISSSNLDVQAQPESPPGAPDGNPNIPAIVNAWGFGSGLL  296
            M+FFKSVF ++    D +    S ++ + + QPE  P      P        WGF  GL+
Sbjct  1    MNFFKSVFADD----DPQPNPSSPTSHEPETQPEIEPETHQNPP-------TWGFVGGLI  49

Query  297  KTLASKSESVIQNYRRDLEEFSSGLQKETAIIREAASRAVQDLPAHIESGATAAQESLET  476
            KT+ +KSESVI+ YRRDL+EF SGL+ ET + +E AS       + +E GA+ AQESLE+
Sbjct  50   KTITTKSESVIETYRRDLQEFGSGLKMETQVFKEVAS-------SSLEVGASKAQESLES  102

Query  477  VGQAIDDIGS----SVAEIIVQGKDSIL  548
            VGQA D IGS    S A+II QG +S L
Sbjct  103  VGQAFDSIGSVVWKSTAQIIAQGTESDL  130



>ref|XP_002863270.1| hypothetical protein ARALYDRAFT_497083 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39529.1| hypothetical protein ARALYDRAFT_497083 [Arabidopsis lyrata subsp. 
lyrata]
Length=338

 Score =   106 bits (264),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 65/127 (51%), Positives = 82/127 (65%), Gaps = 16/127 (13%)
 Frame = +3

Query  204  QAQPESPPGAPDGNPNIPAIVNAWGFGSGLLKTLASKSESVIQNYRRDLEEFSSGLQKET  383
            Q Q +SP   P  +       ++W FG+ L+KTLA+KSESVI +YRRD EEF S L+KET
Sbjct  5    QQQSDSPIDEPTNS-------SSWSFGN-LIKTLATKSESVIGSYRRDFEEFGSELKKET  56

Query  384  AIIREAASRAVQDLPAHIESGATAAQESLETVGQAIDDIGSSV----AEIIVQGKDSILA  551
            +IIR  ASR    LP  +E GA  A ESLE+VGQ IDDIG+SV    A+II  GK+S+  
Sbjct  57   SIIRRVASR----LPDSLEIGAAVASESLESVGQVIDDIGASVWKSTAKIISHGKESLKP  112

Query  552  PEDSDNE  572
              D  N+
Sbjct  113  DRDRTNQ  119



>gb|EPS72559.1| hypothetical protein M569_02195, partial [Genlisea aurea]
Length=265

 Score =   104 bits (260),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 65/152 (43%), Positives = 92/152 (61%), Gaps = 12/152 (8%)
 Frame = +3

Query  117  MDFFKSVFTEEQDYSDTEDTEISSSNLDVQAQPESPPGAPDGNPNIPAIVNAWGFGSGLL  296
            M+FF+S+  E+ D SD+ED   S+   D     ESP      + +     NAW  G GL+
Sbjct  1    MNFFRSILAEDSDTSDSEDVHRSAD--DSIPPVESPEDRGTRSDSQDGADNAWNIG-GLI  57

Query  297  KTLASKSESVIQNYRRDLEEFSSGLQKETAIIREAASRAVQDLPAHIESGATAAQESLET  476
            K  A++SESVI+ YR+DL+EF  GLQKET IIRE  SRAV+DLP  +E+GA+AA      
Sbjct  58   KNFAARSESVIETYRKDLQEFGLGLQKETQIIREVTSRAVKDLPVSLEAGASAAH-----  112

Query  477  VGQAIDDIGSSVAEIIVQGKDSILAPEDSDNE  572
                +D +  S AEII   ++S++  +D D++
Sbjct  113  --GVLDGVLKSTAEII--SRESLIFGDDGDSD  140



>gb|EYU28548.1| hypothetical protein MIMGU_mgv1a0257391mg, partial [Erythranthe 
guttata]
Length=263

 Score =   102 bits (255),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 71/171 (42%), Positives = 95/171 (56%), Gaps = 28/171 (16%)
 Frame = +3

Query  117  MDFFKSVFTEEQDYSDTEDTEISSSNLDVQAQPESPPGAPDGNPNIPAIV---------N  269
            M+FFKS+  ++ D   + +++        Q  P SP   P  + N              +
Sbjct  1    MNFFKSILLDDPDPPKSHNSD--------QPGPNSPLKPPHQDANPGGAAAAAQEGTAAD  52

Query  270  AWGFGSGLLKTLASKSESVIQNYRRDLEEFSSGLQKETAIIREAASRAVQDLPAHIESGA  449
             W FG GL+KTLA++SESVI+ YR+DLEEF SGL+KE+ IIREAASRAV+DLPA +E+G 
Sbjct  53   GWSFG-GLIKTLATRSESVIETYRKDLEEFGSGLKKESEIIREAASRAVKDLPASLEAGT  111

Query  450  TAAQESLETVGQAIDDIGSSVAEII---VQGKDSILAPEDSDNEFSENSGR  593
            +AAQ         +D +  S AEII    Q   S   PE  +     NSGR
Sbjct  112  SAAQ-------GVLDGVLKSTAEIISKETQAFGSDGEPETPETNRGLNSGR  155



>gb|EYU46629.1| hypothetical protein MIMGU_mgv1a005790mg [Erythranthe guttata]
Length=470

 Score =   103 bits (256),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 71/162 (44%), Positives = 92/162 (57%), Gaps = 11/162 (7%)
 Frame = +3

Query  117  MDFFKSVFTEEQDYSDTEDTEISSSNLDVQAQPESPPGAPDGNPNIPAIVNAWGFGSGLL  296
            M+FFKS+ +++ D     D   S  N  ++ QP     +   + +     N W FG GL+
Sbjct  1    MNFFKSILSDDPDPPKPGDLNESDPNSLLKQQPRDDDDSDSSDASDSDPANGWSFG-GLI  59

Query  297  KTLASKSESVIQNYRRDLEEFSSGLQKETAIIREAASRAVQDLPAHIESGATAAQESLET  476
            KT A +SES+I+ YRRDL EF SGL+KET I RE ASRAV+DLPA IE+GA+AA      
Sbjct  60   KTFAVRSESMIETYRRDLTEFGSGLKKETEIFRETASRAVKDLPASIEAGASAAH-----  114

Query  477  VGQAIDDIGSSVAEIIVQ---GKDSILAPEDSDNEFSENSGR  593
               A+D +  S A II +   G  S   PE  D   S NSGR
Sbjct  115  --GALDGVLKSTAHIISKESLGFASDGEPETPDTNRSMNSGR  154



>ref|XP_010495981.1| PREDICTED: BSD domain-containing protein 1-like isoform X2 [Camelina 
sativa]
Length=357

 Score =   102 bits (253),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 74/166 (45%), Positives = 94/166 (57%), Gaps = 40/166 (24%)
 Frame = +3

Query  117  MDFFKSVFTEEQDYSDTEDTEISSSNLDVQAQPESPPGAPDGNPNIPAIVNAWGFGSGLL  296
            MD FKSV +E                 D + QP+ P  +   +           FG+ L+
Sbjct  1    MDRFKSVLSE----------------YDHEQQPDEPIASSSSSSW--------SFGN-LI  35

Query  297  KTLASKSESVIQNYRRDLEEFSSGLQKETAIIREAASRAVQDLPAHIESGATAAQESLET  476
            KTLA+KSESVI +YRRD EEF S L+KET+IIR+ ASR    LP  +E GA+ A ESLE+
Sbjct  36   KTLATKSESVIGSYRRDFEEFGSELRKETSIIRQVASR----LPDSLEIGASVASESLES  91

Query  477  VGQAIDDIGSSV----AEIIVQGKDSILAPEDSDNEFSENSGRNDR  602
            VGQAIDDIG+SV    A II  GK+S+  P        + S R+DR
Sbjct  92   VGQAIDDIGASVWKSTARIISHGKESLKKP-------PQGSDRSDR  130



>ref|XP_010495980.1| PREDICTED: BSD domain-containing protein 1-like isoform X1 [Camelina 
sativa]
Length=354

 Score =   102 bits (253),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 70/150 (47%), Positives = 88/150 (59%), Gaps = 33/150 (22%)
 Frame = +3

Query  117  MDFFKSVFTEEQDYSDTEDTEISSSNLDVQAQPESPPGAPDGNPNIPAIVNAWGFGSGLL  296
            MD FKSV +E                 D + QP+ P  +   +           FG+ L+
Sbjct  1    MDRFKSVLSE----------------YDHEQQPDEPIASSSSSSW--------SFGN-LI  35

Query  297  KTLASKSESVIQNYRRDLEEFSSGLQKETAIIREAASRAVQDLPAHIESGATAAQESLET  476
            KTLA+KSESVI +YRRD EEF S L+KET+IIR+ ASR    LP  +E GA+ A ESLE+
Sbjct  36   KTLATKSESVIGSYRRDFEEFGSELRKETSIIRQVASR----LPDSLEIGASVASESLES  91

Query  477  VGQAIDDIGSSV----AEIIVQGKDSILAP  554
            VGQAIDDIG+SV    A II  GK+S+  P
Sbjct  92   VGQAIDDIGASVWKSTARIISHGKESLKKP  121



>gb|KFK23730.1| hypothetical protein AALP_AAs39056U000200 [Arabis alpina]
Length=376

 Score =   101 bits (251),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 59/114 (52%), Positives = 78/114 (68%), Gaps = 12/114 (11%)
 Frame = +3

Query  219  SPPGAP---DGNPNIPAIVNAWGFGSGLLKTLASKSESVIQNYRRDLEEFSSGLQKETAI  389
            SPP +P   D   +  +  + W F   L+KTL +KSES    YRRD+ EF S L+KET++
Sbjct  13   SPPDSPIINDPTTSSSSPPSPWSFNH-LIKTLTTKSES----YRRDIAEFGSELKKETSV  67

Query  390  IREAASRAVQDLPAHIESGATAAQESLETVGQAIDDIGSSV----AEIIVQGKD  539
            IR+ ASRAV+DLP  +E GA+ AQESLE+VGQAIDDIG++V    A+I   GK+
Sbjct  68   IRQVASRAVKDLPDSLELGASVAQESLESVGQAIDDIGATVWKSTAKIFSHGKE  121



>dbj|BAD14380.1| hypothetical protein [Solanum melongena]
Length=145

 Score = 97.1 bits (240),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 57/116 (49%), Positives = 69/116 (59%), Gaps = 21/116 (18%)
 Frame = +3

Query  270  AWGFGSGLLKTLASKSESVIQNYRRDLEEFSSGLQKETAIIREAASRAVQDLPAHIESGA  449
             W FG GLLKTL+++SESV+  YRRDL+EF SGL+KET + RE ASRAV+DLP  IE   
Sbjct  22   VWSFG-GLLKTLSTRSESVLDTYRRDLQEFGSGLKKETELFREVASRAVKDLPNSIE---  77

Query  450  TAAQESLETVGQAIDDIGSSVAEIIVQGKDSILA-----PEDSDNEFSENSGRNDR  602
                         ID +  S  EII QGKD++LA     PE  D   S + GR  R
Sbjct  78   ------------VIDGVIKSTTEIISQGKDTLLASSDAEPETPDANRSLDPGRYSR  121



>ref|XP_010093391.1| hypothetical protein L484_022954 [Morus notabilis]
 gb|EXB53985.1| hypothetical protein L484_022954 [Morus notabilis]
Length=363

 Score = 98.6 bits (244),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 67/153 (44%), Positives = 89/153 (58%), Gaps = 36/153 (24%)
 Frame = +3

Query  117  MDFFKSVFTEEQ-DYSDTEDTEISSSNLDVQAQPESPPGAPDGNPNIPAIVNAWGFGSGL  293
            MDFFK +F +E  + SD+++ +    N D  A PE PP   D N +      AW FG GL
Sbjct  1    MDFFKFIFADEPLEPSDSDEPQ----NDDTPA-PELPP---DSNSS-----TAWSFG-GL  46

Query  294  LKTLASKSESVIQNYRRDLEEFSSGLQKETAIIREAASRAVQDLPAHIESGATAAQESLE  473
            +KTLA+K E VIQ YR+DLEEF SGL+ ET +IR+AASRAV+DLPA +E  AT       
Sbjct  47   IKTLATKFEPVIQTYRKDLEEFGSGLRMETTVIRDAASRAVRDLPASLEVVATI------  100

Query  474  TVGQAIDDIGSSVAEIIVQGKDSILAPEDSDNE  572
                           + + G+DS+LA  D D++
Sbjct  101  ---------------VALIGRDSLLAAADEDSD  118



>ref|XP_006282973.1| hypothetical protein CARUB_v10007847mg [Capsella rubella]
 gb|EOA15871.1| hypothetical protein CARUB_v10007847mg [Capsella rubella]
Length=319

 Score = 98.2 bits (243),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 58/100 (58%), Positives = 71/100 (71%), Gaps = 10/100 (10%)
 Frame = +3

Query  273  WGFGSGLLKTLASKSESVIQNYRRDLEEFSSGLQKETAIIREAASRAVQDLPAHIESGAT  452
            W FG+ L+KTL ++SESVI +YRRD EEF S L+KET+IIR  AS+    LP  +E GA+
Sbjct  18   WSFGT-LIKTLTTRSESVIGSYRRDFEEFGSELKKETSIIRHVASK----LPDSLEIGAS  72

Query  453  AAQESLETVGQAIDDIGSSV----AEIIVQGKDSILAPED  560
             A ESLE+VGQ IDDIG+SV    A +I QGK S L P D
Sbjct  73   VASESLESVGQVIDDIGASVWKSTARMISQGKLS-LKPLD  111



>ref|XP_008812007.1| PREDICTED: BSD domain-containing protein C22A12.14c-like [Phoenix 
dactylifera]
Length=407

 Score = 98.6 bits (244),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 67/173 (39%), Positives = 96/173 (55%), Gaps = 31/173 (18%)
 Frame = +3

Query  117  MDFFKSVFTEEQDYSDTEDTEISSSNLDVQAQPESPPGAPDGNPNIPAIVN---AWGFGS  287
            MDFFKSV       S+  D +    +++ +        A + NPN  +       W  G 
Sbjct  1    MDFFKSVL------SNLHDDDDGGGDVEEEI-------AANSNPNAISSTGRGAMWNLG-  46

Query  288  GLLKTLASKSESVIQNYRRDLEEFSSGLQKETAIIREAASRAVQDLPAHIESGATAAQES  467
            GL+K LA KSE+V+Q YRRDLEEF SGL+KETA ++ A +  V+DLP  +E+GA +AQES
Sbjct  47   GLIKILAVKSETVMQTYRRDLEEFRSGLKKETAALQAAVACVVRDLPGSLEAGAASAQES  106

Query  468  LETVGQAIDDIGSSVAEIIVQGKDSILAPEDSDNEFSENSGRNDRSDDVYKQH  626
            +E+V       G SV  I+  G++++L P +S       SG    ++   KQH
Sbjct  107  IESV-------GCSVVGILAHGREALLRPRES-------SGPQKTTEISSKQH  145



>gb|AAM62871.1| unknown [Arabidopsis thaliana]
Length=315

 Score = 97.4 bits (241),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 57/102 (56%), Positives = 74/102 (73%), Gaps = 9/102 (9%)
 Frame = +3

Query  279  FGSGLLKTLASKSESVIQNYRRDLEEFSSGLQKETAIIREAASRAVQDLPAHIESGATAA  458
            FG+ L+KTL++KSESVI +YRRDL EF S L+KET+IIR  ASR    LP  +E GA+ A
Sbjct  24   FGN-LIKTLSTKSESVIGSYRRDLVEFGSELKKETSIIRRVASR----LPDSLEIGASVA  78

Query  459  QESLETVGQAIDDIGSSV----AEIIVQGKDSILAPEDSDNE  572
             ESLE+VGQ IDDIG++V    A+II +GK+S+    D  N+
Sbjct  79   SESLESVGQVIDDIGATVWKSTAKIISRGKESLKPDRDRTNQ  120



>ref|XP_011082538.1| PREDICTED: glutamic acid-rich protein-like [Sesamum indicum]
Length=475

 Score = 98.6 bits (244),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 68/168 (40%), Positives = 93/168 (55%), Gaps = 29/168 (17%)
 Frame = +3

Query  117  MDFFKSVFTEEQDYSDTEDTEISSSNLDVQAQPESPPGAP--DGNPNIPAI---VNAWGF  281
            M+FFKS+  ++ D    E+          +  P SP   P  D NP+  A     + W F
Sbjct  1    MNFFKSILLDDPDPPKPENPH--------EPGPSSPLKTPQEDRNPSDDAQDGDSDGWSF  52

Query  282  GSGLLKTLASKSESVIQNYRRDLEEFSSGLQKETAIIREAASRAVQDLPAHIESGATAAQ  461
            G GL+KT  ++SESVI+ YR+DL EF SGL+KET +IREAASRAV+DLPA +E+G +   
Sbjct  53   G-GLIKTFTTRSESVIETYRKDLLEFGSGLKKETEVIREAASRAVKDLPASLEAGTS---  108

Query  462  ESLETVGQAIDDIGSSVAEIIVQGKDSILA----PEDSDNEFSENSGR  593
                    A+D +  S AEII +    + A    P+  +   S NSGR
Sbjct  109  --------ALDGVLKSTAEIISKETRQVFASDGEPDTPETNRSLNSGR  148



>dbj|BAE99413.1| hypothetical protein [Arabidopsis thaliana]
Length=302

 Score = 97.1 bits (240),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 57/103 (55%), Positives = 74/103 (72%), Gaps = 9/103 (9%)
 Frame = +3

Query  279  FGSGLLKTLASKSESVIQNYRRDLEEFSSGLQKETAIIREAASRAVQDLPAHIESGATAA  458
            FG+ L+KTL++KSESVI +YRRDL EF S L+KET+IIR  ASR    LP  +E GA+ A
Sbjct  11   FGN-LIKTLSTKSESVIGSYRRDLVEFGSELKKETSIIRRVASR----LPDSLEIGASVA  65

Query  459  QESLETVGQAIDDIGSSV----AEIIVQGKDSILAPEDSDNEF  575
             ESLE+VGQ IDDIG++V    A+II +GK+S+    D  N+ 
Sbjct  66   SESLESVGQVIDDIGATVWKSTAKIISRGKESLEPNRDRTNQV  108



>ref|NP_567396.1| BSD domain-containing protein [Arabidopsis thaliana]
 gb|AEE83236.1| BSD domain-containing protein [Arabidopsis thaliana]
Length=316

 Score = 96.7 bits (239),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 57/103 (55%), Positives = 74/103 (72%), Gaps = 9/103 (9%)
 Frame = +3

Query  279  FGSGLLKTLASKSESVIQNYRRDLEEFSSGLQKETAIIREAASRAVQDLPAHIESGATAA  458
            FG+ L+KTL++KSESVI +YRRDL EF S L+KET+IIR  ASR    LP  +E GA+ A
Sbjct  25   FGN-LIKTLSTKSESVIGSYRRDLVEFGSELKKETSIIRRVASR----LPDSLEIGASVA  79

Query  459  QESLETVGQAIDDIGSSV----AEIIVQGKDSILAPEDSDNEF  575
             ESLE+VGQ IDDIG++V    A+II +GK+S+    D  N+ 
Sbjct  80   SESLESVGQVIDDIGATVWKSTAKIISRGKESLEPNRDRTNQV  122



>ref|XP_008234921.1| PREDICTED: BSD domain-containing protein 1 [Prunus mume]
Length=505

 Score = 98.6 bits (244),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 69/156 (44%), Positives = 89/156 (57%), Gaps = 34/156 (22%)
 Frame = +3

Query  117  MDFFKSVFTEEQDY----SDTEDTEISSSNLDVQ-AQPESPPGAPDGNPNIPAIVNAWGF  281
            M+FFKSVF++E D     S+ E    S  N + + A  +SPP  PD NP+       W F
Sbjct  1    MNFFKSVFSDEPDPPNPDSEFESEPGSRKNPEQEDADSKSPPSQPDPNPS--GNSGGWMF  58

Query  282  GSGLLKTLASKSESVIQNYRRDLEEFSSGLQKETAIIREAASRAVQDLPAHIESGATAAQ  461
            G  L+KTLA+KSESVI+ YRRDL+EF SGL+KE  +                      AQ
Sbjct  59   GD-LIKTLATKSESVIETYRRDLQEFGSGLKKEIEV----------------------AQ  95

Query  462  ESLETVGQAIDDIGSSV----AEIIVQGKDSILAPE  557
             SLETVG  ID+ G++V    A+II QG D+ILAP+
Sbjct  96   GSLETVGSVIDEFGNTVLKGTAQIISQGTDAILAPD  131



>emb|CAB45510.1| putative protein [Arabidopsis thaliana]
 emb|CAB78353.1| putative protein [Arabidopsis thaliana]
Length=365

 Score = 96.7 bits (239),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 57/102 (56%), Positives = 74/102 (73%), Gaps = 9/102 (9%)
 Frame = +3

Query  279  FGSGLLKTLASKSESVIQNYRRDLEEFSSGLQKETAIIREAASRAVQDLPAHIESGATAA  458
            FG+ L+KTL++KSESVI +YRRDL EF S L+KET+IIR  ASR    LP  +E GA+ A
Sbjct  74   FGN-LIKTLSTKSESVIGSYRRDLVEFGSELKKETSIIRRVASR----LPDSLEIGASVA  128

Query  459  QESLETVGQAIDDIGSSV----AEIIVQGKDSILAPEDSDNE  572
             ESLE+VGQ IDDIG++V    A+II +GK+S+    D  N+
Sbjct  129  SESLESVGQVIDDIGATVWKSTAKIISRGKESLEPNRDRTNQ  170



>ref|XP_002524803.1| synapse-associated protein, putative [Ricinus communis]
 gb|EEF37646.1| synapse-associated protein, putative [Ricinus communis]
Length=433

 Score = 97.1 bits (240),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 77/179 (43%), Positives = 98/179 (55%), Gaps = 37/179 (21%)
 Frame = +3

Query  117  MDFFKSVFTEEQDYSDTEDTEISSSNLDVQAQ--PESPPGAPDGNPNIPAIVNAWGFGSG  290
            M+FFKSVF++E   SD+  +   S+N    A   P SPP  P  NP+       W FG G
Sbjct  1    MNFFKSVFSDE---SDSPKSGFESNNNQSHADSDPTSPP-TPQPNPS-DHDSTGWSFG-G  54

Query  291  LLKTLASKSESVIQNYRRDLEEFSSGLQKETAIIREAASRAVQDLPAHIESGATAAQESL  470
            L+KTL +KSESVI  YRRDL+EF SGL+KE  +                      A  SL
Sbjct  55   LIKTLTTKSESVIDIYRRDLKEFGSGLKKEIEV----------------------AHGSL  92

Query  471  ETVGQAIDDIGSSV----AEIIVQGKDSILAPEDSDNEFSENSGRNDRSDDVYKQHLNS  635
            ETVG AID+IG+SV    A+II QGKD+ILA    D+E   +   N+      +Q+LNS
Sbjct  93   ETVGHAIDEIGTSVLKGTAQIISQGKDAILA---VDHESDSSDNNNNERSISSQQNLNS  148



>ref|XP_009119551.1| PREDICTED: BSD domain-containing protein 1 [Brassica rapa]
 emb|CDX89898.1| BnaA10g01840D [Brassica napus]
Length=432

 Score = 96.3 bits (238),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 70/168 (42%), Positives = 92/168 (55%), Gaps = 48/168 (29%)
 Frame = +3

Query  117  MDFFKSVFTEEQDYSDTEDTEISSSNLDVQAQPESPPGAPDGNPNIPAIVNAWGFGSGLL  296
            M+FF SVF+++ D  +TE      S  D Q+ P    G              W FG GL+
Sbjct  1    MNFFTSVFSDDPDPPETE------SESDEQSNPNDDDGG-------------WSFG-GLM  40

Query  297  KTLASKSESVIQNYRRDLEEFSSGLQKETAIIREAASRAVQDLPAHIESGATAAQESLET  476
            KT+A +SESVI+ YRRDLEEF +GL+KE  +                      AQ SL T
Sbjct  41   KTIADRSESVIETYRRDLEEFGTGLKKEIEV----------------------AQGSLGT  78

Query  477  VGQAIDDIGSSV----AEIIVQGKDSILAPEDSDNEFSEN--SGRNDR  602
            VG AID++GSSV    AEII QGK++ILA  D++++ S+N  SG N R
Sbjct  79   VGHAIDELGSSVIKGTAEIIAQGKEAILAAGDNESDSSDNNTSGSNRR  126



>emb|CBI26160.3| unnamed protein product [Vitis vinifera]
Length=353

 Score = 95.1 bits (235),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 67/154 (44%), Positives = 84/154 (55%), Gaps = 44/154 (29%)
 Frame = +3

Query  117  MDFFKSVFTEEQDYSDTEDTEISSSNLDVQAQPESPPGAPDGNPNIPAIVNAWGFGSGLL  296
            M+FFKSVF +        D E +S      A P+  PG  + N   P    AW FG GL+
Sbjct  1    MNFFKSVFAD--------DPEPASDPPHSAAHPD--PGDDEPNHRNPNPNAAWSFG-GLI  49

Query  297  KTLASKSESVIQNYRRDLEEFSSGLQKETAIIREAASRAVQDLPAHIESGATAAQESLET  476
            KTLASKSESVI++YRRD+EEF +GL+KETA+IR+                          
Sbjct  50   KTLASKSESVIESYRRDIEEFGTGLKKETAVIRD--------------------------  83

Query  477  VGQAIDDIGSSV----AEIIVQGKDSILAPEDSD  566
               AIDDIGSSV    AEII  G+D++LA E+ D
Sbjct  84   ---AIDDIGSSVWRGTAEIITHGRDALLAAEEHD  114



>ref|XP_007199615.1| hypothetical protein PRUPE_ppa004513mg [Prunus persica]
 gb|EMJ00814.1| hypothetical protein PRUPE_ppa004513mg [Prunus persica]
Length=505

 Score = 96.7 bits (239),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 66/156 (42%), Positives = 86/156 (55%), Gaps = 34/156 (22%)
 Frame = +3

Query  117  MDFFKSVFTEEQDYSDTEDTEISSSNLDVQAQPE-----SPPGAPDGNPNIPAIVNAWGF  281
            M+FFKSVF++E D  + +    S        + E     SPP  PD NP+  +    W F
Sbjct  1    MNFFKSVFSDEPDPPNPDSESESEPESRKNPEQEDADSKSPPSQPDPNPSSNS--GGWMF  58

Query  282  GSGLLKTLASKSESVIQNYRRDLEEFSSGLQKETAIIREAASRAVQDLPAHIESGATAAQ  461
            G  L+KTLA+KSESVI+ YRRDL+EF SGL+KE  +                      AQ
Sbjct  59   GD-LIKTLATKSESVIETYRRDLQEFGSGLKKEIEV----------------------AQ  95

Query  462  ESLETVGQAIDDIGSSV----AEIIVQGKDSILAPE  557
             SLETVG  ID+ G++V    A+II QG D+ILAP+
Sbjct  96   GSLETVGSVIDEFGNTVLKGTAQIISQGTDAILAPD  131



>ref|XP_011079797.1| PREDICTED: uncharacterized protein LOC105163226 [Sesamum indicum]
Length=460

 Score = 95.9 bits (237),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 69/170 (41%), Positives = 98/170 (58%), Gaps = 31/170 (18%)
 Frame = +3

Query  117  MDFFKSVFTEEQDYSDTEDTEISSSNLDVQAQPESPP-------GAPDGNPNIPAIVNAW  275
            M+FFKS+ +++ D  D +    S +N  ++     PP          DG P+     + W
Sbjct  1    MNFFKSLLSDDPDPPDPQIVRESDANSALK-----PPRDGGNSIDVADGGPD-----DGW  50

Query  276  GFGSGLLKTLASKSESVIQNYRRDLEEFSSGLQKETAIIREAASRAVQDLPAHIESGATA  455
             FG GL++T A +SES+I+ YR+DLEEF SGL+KET I+RE ASRAV+DLPA +E+ ATA
Sbjct  51   SFG-GLIRTFAVQSESLIETYRKDLEEFGSGLKKETEILRETASRAVKDLPASLEASATA  109

Query  456  AQESLETVGQAIDDIGSSVAEIIVQGKDSILA----PEDSDNEFSENSGR  593
            A         A+D +  S AEII   K+++      PE  +   S+NS R
Sbjct  110  AH-------GALDGVLKSTAEII--SKEALFGSDGEPETPETNRSKNSSR  150



>ref|XP_001783300.1| predicted protein [Physcomitrella patens]
 gb|EDQ51910.1| predicted protein [Physcomitrella patens]
Length=455

 Score = 95.9 bits (237),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 50/104 (48%), Positives = 70/104 (67%), Gaps = 5/104 (5%)
 Frame = +3

Query  267  NAWGFGSGLLKTLASKSESVIQNYRRDLEEFSSGLQKETAIIREAASRAVQDLPAHIESG  446
            + W FG G +KT+A KS  V+Q Y+ DL+EF  GL+KET +I  A +  V+DLP+ +E+G
Sbjct  67   SGWNFG-GFMKTIAEKSGGVLQTYQHDLKEFGIGLKKETEVITGATAHVVKDLPSTLETG  125

Query  447  ATAAQESLETVGQAIDDIGSSV----AEIIVQGKDSILAPEDSD  566
            AT AQESLETVGQ ++  GS+V     EI  Q K+ +   ED++
Sbjct  126  ATVAQESLETVGQTLEVFGSTVWKGTTEIFAQVKEVLTVDEDAE  169



>ref|XP_009599212.1| PREDICTED: BSD domain-containing protein 1-like [Nicotiana tomentosiformis]
Length=525

 Score = 95.5 bits (236),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 63/96 (66%), Gaps = 16/96 (17%)
 Frame = +3

Query  273  WGFGSGLLKTLASKSESVIQNYRRDLEEFSSGLQKETAIIREAASRAVQDLPAHIESGAT  452
            W FG GL KTL+++SESV++ YR+DL+EF SGL+KET + RE ASRAV+DLP  IE    
Sbjct  62   WSFG-GLFKTLSTRSESVLETYRKDLQEFGSGLKKETELFREVASRAVKDLPNSIE----  116

Query  453  AAQESLETVGQAIDDIGSSVAEIIVQGKDSILAPED  560
                        ID +  S AEII QGKDS+LA  D
Sbjct  117  -----------VIDGVIKSTAEIISQGKDSLLASSD  141



>ref|XP_010522686.1| PREDICTED: BSD domain-containing protein 1 [Tarenaya hassleriana]
Length=434

 Score = 94.7 bits (234),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 65/151 (43%), Positives = 85/151 (56%), Gaps = 32/151 (21%)
 Frame = +3

Query  117  MDFFKSVFTEEQDY--SDTEDTEISSSNLDVQAQPESPPGAPDGNPNIPAIVNAWGFGSG  290
            M+FFKSVF+++ D   S  E    S    + Q  P++ P     NP+   +   W FG G
Sbjct  1    MNFFKSVFSDDPDPDPSTAESGSESPRTSEEQQNPDTIPSPEKSNPSDGGL---WSFG-G  56

Query  291  LLKTLASKSESVIQNYRRDLEEFSSGLQKETAIIREAASRAVQDLPAHIESGATAAQESL  470
            L+KTLA++SESV++ YRRDL+EF SGL+KE  +                      AQ SL
Sbjct  57   LMKTLATRSESVLETYRRDLQEFGSGLKKEIEV----------------------AQGSL  94

Query  471  ETVGQAIDDIGSSV----AEIIVQGKDSILA  551
             TVG AID+IGSSV    AEII  GK++ILA
Sbjct  95   GTVGHAIDEIGSSVIKGTAEIIAHGKEAILA  125



>ref|XP_006307489.1| hypothetical protein CARUB_v10009113mg [Capsella rubella]
 gb|EOA40387.1| hypothetical protein CARUB_v10009113mg [Capsella rubella]
Length=451

 Score = 94.7 bits (234),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 64/149 (43%), Positives = 83/149 (56%), Gaps = 36/149 (24%)
 Frame = +3

Query  117  MDFFKSVFTEEQDYSDTEDTEISSSNLDVQAQPESPPGAPDGNPNIPAIVNAWGFGSGLL  296
            M+FFKSVF ++ D  +TE    S  + +    PE        NPN       W FG GL+
Sbjct  1    MNFFKSVFEDDPDPPETESESDSPKHSEEHEHPEQ------SNPNDDG---GWSFG-GLM  50

Query  297  KTLASKSESVIQNYRRDLEEFSSGLQKETAIIREAASRAVQDLPAHIESGATAAQESLET  476
            KTLAS+SESVI+ YRRDLEEF +GL+KE  +                      AQ SL T
Sbjct  51   KTLASRSESVIETYRRDLEEFGTGLKKEIEV----------------------AQGSLGT  88

Query  477  VGQAIDDIGSSV----AEIIVQGKDSILA  551
            VG AID++G++V    A+II QGK++ILA
Sbjct  89   VGHAIDELGNTVLKGTADIIAQGKEAILA  117



>gb|KDP21511.1| hypothetical protein JCGZ_21982 [Jatropha curcas]
Length=420

 Score = 94.0 bits (232),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 76/178 (43%), Positives = 97/178 (54%), Gaps = 39/178 (22%)
 Frame = +3

Query  117  MDFFKSVFTEEQDYSDTEDTEISSSNLDVQAQPESPPGAPDGNPNIPAIVN-AWGFGSGL  293
            MDFF+SVF+EE D   +E    S +N     QP+S           P   + AW FG GL
Sbjct  1    MDFFRSVFSEEHDSPKSEHESKSFNN-----QPQSDSDPNSPPNPNPNTTDGAWSFG-GL  54

Query  294  LKTLASKSESVIQNYRRDLEEFSSGLQKETAIIREAASRAVQDLPAHIESGATAAQESLE  473
            ++TL +KSESVI+ YRRDL+EF SGL+KE  +                      A  SLE
Sbjct  55   MRTLTTKSESVIEIYRRDLKEFGSGLKKEIEV----------------------AHGSLE  92

Query  474  TVGQAIDDIGSSV----AEIIVQGKDSILAPEDSDNEFSENSGRNDRSDDVYKQHLNS  635
            TVG  ID+IGSSV    A+II QGK++ILA  +SD     +S  N+RS    +Q LNS
Sbjct  93   TVGHTIDEIGSSVLKSTAQIISQGKEAILADHESD-----SSDNNERS-IASQQSLNS  144



>ref|XP_009769239.1| PREDICTED: BSD domain-containing protein 1-like [Nicotiana sylvestris]
Length=505

 Score = 94.7 bits (234),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 62/159 (39%), Positives = 88/159 (55%), Gaps = 29/159 (18%)
 Frame = +3

Query  117  MDFFKSVFTEE-----------QDYSDTEDTEISSSNLDVQAQPESPPGAPDGNPNIPAI  263
            M+FFKS+ +++           Q+ +  +  E   +++DV   PE  P +   +    + 
Sbjct  1    MNFFKSILSDDPDPDPPIPKKLQESTPEQSHETPDNDVDVD--PEHTPDSGSDSAADGSD  58

Query  264  VNAWGFGSGLLKTLASKSESVIQNYRRDLEEFSSGLQKETAIIREAASRAVQDLPAHIES  443
               W FG GL KTL+++SE V++ YR+DL+EF SGL+KET + RE ASRAV+DLP  IE 
Sbjct  59   GGVWSFG-GLFKTLSTRSELVLETYRKDLQEFGSGLKKETELFREVASRAVKDLPNSIE-  116

Query  444  GATAAQESLETVGQAIDDIGSSVAEIIVQGKDSILAPED  560
                           ID +  S AEII QGKDS+LA  D
Sbjct  117  --------------VIDGVIKSTAEIISQGKDSLLASSD  141



>ref|XP_010474958.1| PREDICTED: BSD domain-containing protein 1-like [Camelina sativa]
Length=452

 Score = 94.4 bits (233),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 63/149 (42%), Positives = 82/149 (55%), Gaps = 36/149 (24%)
 Frame = +3

Query  117  MDFFKSVFTEEQDYSDTEDTEISSSNLDVQAQPESPPGAPDGNPNIPAIVNAWGFGSGLL  296
            M+FFKSVF ++ D   TE    S  + +   QPE      DG          W FG GL+
Sbjct  1    MNFFKSVFQDDPDPPGTESESDSPKHSEEHEQPEQSNPEDDG---------GWSFG-GLM  50

Query  297  KTLASKSESVIQNYRRDLEEFSSGLQKETAIIREAASRAVQDLPAHIESGATAAQESLET  476
            KTLA++SESVI+ YRRDLEEF +GL+KE  +                      AQ SL T
Sbjct  51   KTLATRSESVIETYRRDLEEFGTGLKKEIEV----------------------AQGSLGT  88

Query  477  VGQAIDDIGSSV----AEIIVQGKDSILA  551
            VG AID++G++V    A+II QGK++ILA
Sbjct  89   VGHAIDELGNTVLKGTADIIAQGKEAILA  117



>ref|XP_006418242.1| hypothetical protein EUTSA_v10009692mg [Eutrema salsugineum]
 gb|ESQ36595.1| hypothetical protein EUTSA_v10009692mg [Eutrema salsugineum]
Length=450

 Score = 94.0 bits (232),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 64/150 (43%), Positives = 84/150 (56%), Gaps = 37/150 (25%)
 Frame = +3

Query  117  MDFFKSVFTEEQDYSDTEDTEISSSNLDVQAQPE-SPPGAPDGNPNIPAIVNAWGFGSGL  293
            M+FFKSVF+++ D   TE    S  + +    PE S P   DG          W FG GL
Sbjct  1    MNFFKSVFSDDPDPPGTESESDSPKHSEQHENPEQSNPNDEDG---------GWSFG-GL  50

Query  294  LKTLASKSESVIQNYRRDLEEFSSGLQKETAIIREAASRAVQDLPAHIESGATAAQESLE  473
            +KT+A++SESVI+ YRRDLEEF +GL+KE  +                      AQ SL 
Sbjct  51   MKTIATRSESVIETYRRDLEEFGTGLKKEIEV----------------------AQGSLG  88

Query  474  TVGQAIDDIGSSV----AEIIVQGKDSILA  551
            TVG AID++G++V    AEII QGK++ILA
Sbjct  89   TVGHAIDELGNTVLKGTAEIIAQGKEAILA  118



>ref|XP_008451401.1| PREDICTED: BSD domain-containing protein 1-A [Cucumis melo]
Length=466

 Score = 94.4 bits (233),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 65/152 (43%), Positives = 84/152 (55%), Gaps = 32/152 (21%)
 Frame = +3

Query  117  MDFFKSVFTEEQDYSDTEDTEISS---SNLDVQAQPESPPGAPDGNPNIPAIVNAWGFGS  287
            M+FF+SVF+++ D S    TE  S   S+ D   +   P  +P  NP       AW FG 
Sbjct  1    MNFFRSVFSDDPDPSTASKTEPQSPKKSSFDEGEESSDP--SPRSNPTPVEDAGAWSFG-  57

Query  288  GLLKTLASKSESVIQNYRRDLEEFSSGLQKETAIIREAASRAVQDLPAHIESGATAAQES  467
            GL+KTL++KSESVI+ YRRDL+EF SGL+KE  +                      A  S
Sbjct  58   GLIKTLSAKSESVIETYRRDLQEFGSGLKKEIEV----------------------AHGS  95

Query  468  LETVGQAIDDIGSSV----AEIIVQGKDSILA  551
            LETVG A D+ GSSV    A+II QGK++I A
Sbjct  96   LETVGHAFDEFGSSVLKGTAQIIAQGKNAIQA  127



>ref|XP_010090347.1| hypothetical protein L484_025012 [Morus notabilis]
 gb|EXB39317.1| hypothetical protein L484_025012 [Morus notabilis]
Length=445

 Score = 93.6 bits (231),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 64/151 (42%), Positives = 83/151 (55%), Gaps = 42/151 (28%)
 Frame = +3

Query  117  MDFFKSVFTEEQDYSDTEDTEISSSNLDVQAQPESPPGAPDGNPNIP--AIVNAWGFGSG  290
            M+FFKSVF+E+ D  ++E              P+ PP   +     P      AW FG G
Sbjct  1    MNFFKSVFSEDPDPPNSE-------------SPDYPPNKDEREALDPDSGAGGAWSFG-G  46

Query  291  LLKTLASKSESVIQNYRRDLEEFSSGLQKETAIIREAASRAVQDLPAHIESGATAAQESL  470
            L+KTLA+KSESVI+ YRRDL+EFSSGL+KE  ++                      Q SL
Sbjct  47   LVKTLATKSESVIETYRRDLQEFSSGLKKEIEVV----------------------QGSL  84

Query  471  ETVGQAIDDIGSSV----AEIIVQGKDSILA  551
             TVG AID+ G++V    A+II QGKD+ILA
Sbjct  85   GTVGHAIDEFGNTVVKGTAQIISQGKDAILA  115



>ref|XP_010457343.1| PREDICTED: BSD domain-containing protein 1-like [Camelina sativa]
Length=462

 Score = 93.6 bits (231),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 63/149 (42%), Positives = 82/149 (55%), Gaps = 36/149 (24%)
 Frame = +3

Query  117  MDFFKSVFTEEQDYSDTEDTEISSSNLDVQAQPESPPGAPDGNPNIPAIVNAWGFGSGLL  296
            M+FFKSVF ++ D   TE    S  + +   QPE      DG          W FG GL+
Sbjct  1    MNFFKSVFQDDPDPPGTESESDSPKHSEEHEQPEQSNPEDDG---------VWSFG-GLM  50

Query  297  KTLASKSESVIQNYRRDLEEFSSGLQKETAIIREAASRAVQDLPAHIESGATAAQESLET  476
            KTLA++SESVI+ YRRDLEEF +GL+KE  +                      AQ SL T
Sbjct  51   KTLATRSESVIETYRRDLEEFGTGLKKEIEV----------------------AQGSLGT  88

Query  477  VGQAIDDIGSSV----AEIIVQGKDSILA  551
            VG AID++G++V    A+II QGK++ILA
Sbjct  89   VGHAIDELGNTVLKGTADIIAQGKEAILA  117



>gb|KJB47008.1| hypothetical protein B456_008G006000 [Gossypium raimondii]
Length=461

 Score = 93.6 bits (231),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 64/149 (43%), Positives = 85/149 (57%), Gaps = 33/149 (22%)
 Frame = +3

Query  117  MDFFKSVFTEEQDYSDTEDTEISSSNLDVQAQPESPPGAPDGNPNIPAIVNAWGFGSGLL  296
            M+FFKSVF ++ D    +  E  S   D  + P+S P  PD NPN P+    W FG GL+
Sbjct  1    MNFFKSVFADDPDPPKPQ-LESDSPKADY-STPDSSPRVPDPNPN-PS---GWSFG-GLI  53

Query  297  KTLASKSESVIQNYRRDLEEFSSGLQKETAIIREAASRAVQDLPAHIESGATAAQESLET  476
            +T+A++SESVI+ YRRDLEEF  GL+KE  +                      AQ+SL  
Sbjct  54   QTIATRSESVIETYRRDLEEFGLGLKKEIEV----------------------AQDSLGN  91

Query  477  VGQAIDDIGSSV----AEIIVQGKDSILA  551
            VGQ ID+ G++V     +II QGKD+ILA
Sbjct  92   VGQVIDEFGNTVIKGTTQIINQGKDAILA  120



>ref|XP_002892158.1| hypothetical protein ARALYDRAFT_470313 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68417.1| hypothetical protein ARALYDRAFT_470313 [Arabidopsis lyrata subsp. 
lyrata]
Length=452

 Score = 93.2 bits (230),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 62/149 (42%), Positives = 83/149 (56%), Gaps = 36/149 (24%)
 Frame = +3

Query  117  MDFFKSVFTEEQDYSDTEDTEISSSNLDVQAQPESPPGAPDGNPNIPAIVNAWGFGSGLL  296
            M+FFKSVF+++ D   TE    S  + + +  PE      DG          W FG GL+
Sbjct  1    MNFFKSVFSDDLDPPGTESESDSPKHSEEKEHPEQSDPNDDG---------GWSFG-GLM  50

Query  297  KTLASKSESVIQNYRRDLEEFSSGLQKETAIIREAASRAVQDLPAHIESGATAAQESLET  476
            KT+A++SESVI+ YRRDLEEF +GL+KE  +                      AQ SL T
Sbjct  51   KTIATRSESVIETYRRDLEEFGTGLKKEIEV----------------------AQGSLGT  88

Query  477  VGQAIDDIGSSV----AEIIVQGKDSILA  551
            VG AID++G++V    AEII QGK++ILA
Sbjct  89   VGHAIDELGNTVLKGTAEIIAQGKEAILA  117



>ref|XP_004148869.1| PREDICTED: uncharacterized protein LOC101217772 [Cucumis sativus]
 gb|KGN44859.1| hypothetical protein Csa_7G392320 [Cucumis sativus]
Length=464

 Score = 92.0 bits (227),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 66/162 (41%), Positives = 91/162 (56%), Gaps = 29/162 (18%)
 Frame = +3

Query  117  MDFFKSVFTEEQDYSDTEDTEISSSNLD-VQAQPESPPGAPDGNPNIPAIVNAWGFGSGL  293
            M+FF+SVF+++ D S    TE  S +    +   +S   +P  NP       AW FG GL
Sbjct  1    MNFFRSVFSDDPDPSTASKTEPQSPHKSSFEEGEQSSDSSPLSNPTPVDDAGAWSFG-GL  59

Query  294  LKTLASKSESVIQNYRRDLEEFSSGLQKETAIIREAASRAVQDLPAHIESGATAAQESLE  473
            +KTL+++SESVI+ YRRDL+EF SGL+KE  +                      A  SLE
Sbjct  60   IKTLSARSESVIETYRRDLQEFGSGLKKEIEV----------------------AHGSLE  97

Query  474  TVGQAIDDIGSSV----AEIIVQGKDSILA-PEDSDNEFSEN  584
            TVG A D+ GSSV    A+II QGK++I A  ++SD++ S N
Sbjct  98   TVGHAFDEFGSSVLKGTAQIIAQGKNAIQAIDQESDSDSSTN  139



>ref|XP_004158933.1| PREDICTED: uncharacterized LOC101217772 [Cucumis sativus]
Length=464

 Score = 91.7 bits (226),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 66/162 (41%), Positives = 91/162 (56%), Gaps = 29/162 (18%)
 Frame = +3

Query  117  MDFFKSVFTEEQDYSDTEDTEISSSNLD-VQAQPESPPGAPDGNPNIPAIVNAWGFGSGL  293
            M+FF+SVF+++ D S    TE  S +    +   +S   +P  NP       AW FG GL
Sbjct  1    MNFFRSVFSDDPDPSTASKTEPQSPHKSSFEEGEQSSDSSPLSNPTPVDDAGAWSFG-GL  59

Query  294  LKTLASKSESVIQNYRRDLEEFSSGLQKETAIIREAASRAVQDLPAHIESGATAAQESLE  473
            +KTL+++SESVI+ YRRDL+EF SGL+KE  +                      A  SLE
Sbjct  60   IKTLSARSESVIETYRRDLQEFGSGLKKEIEV----------------------AHGSLE  97

Query  474  TVGQAIDDIGSSV----AEIIVQGKDSILA-PEDSDNEFSEN  584
            TVG A D+ GSSV    A+II QGK++I A  ++SD++ S N
Sbjct  98   TVGHAFDEFGSSVLKGTAQIIAQGKNAIQAIDQESDSDSSTN  139



>gb|KJB23152.1| hypothetical protein B456_004G083900 [Gossypium raimondii]
Length=443

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 62/149 (42%), Positives = 81/149 (54%), Gaps = 35/149 (23%)
 Frame = +3

Query  117  MDFFKSVFTEEQDYSDTEDTEISSSNLDVQAQPESPPGAPDGNPNIPAIVNAWGFGSGLL  296
            MDFFKS+F ++    D E    S+S  D  + P+SPP   D NP        W FG  L+
Sbjct  1    MDFFKSIFADDPYPPDPESE--SNSLKDQDSAPDSPPKQSDSNPT------GWSFGD-LV  51

Query  297  KTLASKSESVIQNYRRDLEEFSSGLQKETAIIREAASRAVQDLPAHIESGATAAQESLET  476
            KT+AS+SESVI+ YRRDL+EF +GL+ E  +                      AQ SL  
Sbjct  52   KTIASRSESVIEVYRRDLQEFGTGLKNEIEV----------------------AQGSLGN  89

Query  477  VGQAIDDIGSSV----AEIIVQGKDSILA  551
            VG AID++GS+V     +II QG+D ILA
Sbjct  90   VGHAIDELGSTVLKGTVQIINQGRDVILA  118



>emb|CDY15460.1| BnaA08g27440D [Brassica napus]
Length=449

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 69/172 (40%), Positives = 94/172 (55%), Gaps = 41/172 (24%)
 Frame = +3

Query  117  MDFFKSVFTEEQDYSDTEDTEISSSNLDVQAQPE--SPPGAPDGNPNIPAIVNAWGFGSG  290
            M+FFKSVF+++ D  +TE    S  + +    P+  +P    D N       + W FG G
Sbjct  1    MNFFKSVFSDDPDPPETESESDSPKHSEEHEDPDQSNPEHEDDDN-------SGWSFG-G  52

Query  291  LLKTLASKSESVIQNYRRDLEEFSSGLQKETAIIREAASRAVQDLPAHIESGATAAQESL  470
            L+KT+A +SESVI+ YRRDL+EF +GL+KE  +                      AQ SL
Sbjct  53   LMKTIADRSESVIETYRRDLQEFGTGLKKEIEV----------------------AQGSL  90

Query  471  ETVGQAIDDIGSSV----AEIIVQGKDSILAP----EDSDNEFSENS-GRND  599
             TVG AID++G++V    AEII QGK++ILA     + SDN  S  S GR D
Sbjct  91   GTVGHAIDELGNTVIKGTAEIIAQGKEAILAAGNESDSSDNTSSGTSLGRRD  142



>ref|XP_010481925.1| PREDICTED: BSD domain-containing protein 1-like [Camelina sativa]
Length=458

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 62/149 (42%), Positives = 81/149 (54%), Gaps = 36/149 (24%)
 Frame = +3

Query  117  MDFFKSVFTEEQDYSDTEDTEISSSNLDVQAQPESPPGAPDGNPNIPAIVNAWGFGSGLL  296
            M+FFKSVF ++ D   TE    S  + +   Q E      DG          W FG GL+
Sbjct  1    MNFFKSVFQDDPDPPGTESESDSPKHSEEHEQTEQSNPEDDG---------GWSFG-GLM  50

Query  297  KTLASKSESVIQNYRRDLEEFSSGLQKETAIIREAASRAVQDLPAHIESGATAAQESLET  476
            KTLA++SESVI+ YRRDLEEF +GL+KE  +                      AQ SL T
Sbjct  51   KTLATRSESVIETYRRDLEEFGTGLKKEIEV----------------------AQGSLGT  88

Query  477  VGQAIDDIGSSV----AEIIVQGKDSILA  551
            VG AID++G++V    A+II QGK++ILA
Sbjct  89   VGHAIDELGNTVLKGTADIIAQGKEAILA  117



>ref|XP_009111155.1| PREDICTED: BSD domain-containing protein 1-like [Brassica rapa]
Length=451

 Score = 89.4 bits (220),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 72/172 (42%), Positives = 93/172 (54%), Gaps = 40/172 (23%)
 Frame = +3

Query  117  MDFFKSVFTEEQDYSDTEDTEISSSNLDVQAQPESPPGAPD-GNPNIPAIVNA-WGFGSG  290
            M+FFKSVF+++ D  +TE      S  D     E     PD  NP      N+ W FG G
Sbjct  1    MNFFKSVFSDDPDPPETE------SESDSPKHSEEEHEDPDQSNPEHEDDDNSGWSFG-G  53

Query  291  LLKTLASKSESVIQNYRRDLEEFSSGLQKETAIIREAASRAVQDLPAHIESGATAAQESL  470
            L+KT+A +SESVI+ YRRDL+EF +GL+KE  +                      AQ SL
Sbjct  54   LMKTIADRSESVIETYRRDLQEFGTGLKKEIEV----------------------AQGSL  91

Query  471  ETVGQAIDDIGSSV----AEIIVQGKDSILAP----EDSDNEFSENS-GRND  599
             TVG AID++G++V    AEII QGK++ILA     + SDN  S  S GR D
Sbjct  92   GTVGHAIDELGNTVIKGTAEIIAQGKEAILAAGNESDSSDNTSSGTSLGRRD  143



>emb|CDX86678.1| BnaC08g00250D [Brassica napus]
Length=440

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 66/170 (39%), Positives = 94/170 (55%), Gaps = 44/170 (26%)
 Frame = +3

Query  117  MDFFKSVFTEEQDYSDTEDTEISSSNLDVQAQPESPPGAPDGNPNIPAIVN----AWGFG  284
            M+FFKSVF+++ D   TE            ++ +SP  + D + + P   +     W FG
Sbjct  1    MNFFKSVFSDDPDPPGTE------------SESDSPKHSEDPDQSNPEHEDDDNGGWSFG  48

Query  285  SGLLKTLASKSESVIQNYRRDLEEFSSGLQKETAIIREAASRAVQDLPAHIESGATAAQE  464
             GL+KT+A +SESVI+ YRRDLEEF +GL+KE  +                      AQ 
Sbjct  49   -GLMKTIADRSESVIETYRRDLEEFGTGLKKEIEV----------------------AQG  85

Query  465  SLETVGQAIDDIGSSV----AEIIVQGKDSILAP-EDSDNEFSENSGRND  599
            SL TVG AID++G++V    AEII QGK++ILA   +SD+  + + GR D
Sbjct  86   SLGTVGHAIDELGNTVIKGTAEIIAQGKEAILAAGNESDSSDNTSLGRRD  135



>ref|NP_563683.1| BSD domain-containing protein [Arabidopsis thaliana]
 gb|AAK25838.1|AF360128_1 unknown protein [Arabidopsis thaliana]
 gb|AAC72109.1| ESTs gb|T21276, gb|T45403, and gb|AA586113 come from this gene 
[Arabidopsis thaliana]
 gb|AAK93706.1| unknown protein [Arabidopsis thaliana]
 gb|AEE27562.1| BSD domain-containing protein [Arabidopsis thaliana]
Length=470

 Score = 88.2 bits (217),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 63/149 (42%), Positives = 82/149 (55%), Gaps = 31/149 (21%)
 Frame = +3

Query  117  MDFFKSVFTEEQDYSDTEDTEISSSNLDVQAQPESPPGAPDGNPNIPAIVNAWGFGSGLL  296
            M+FFKSVFTE+ D  +TE +E  S     + +            N       W FG GL+
Sbjct  1    MNFFKSVFTEDLDPPETE-SESDSPKHSEEHEHPEQEHPEQSESNDDG---GWSFG-GLM  55

Query  297  KTLASKSESVIQNYRRDLEEFSSGLQKETAIIREAASRAVQDLPAHIESGATAAQESLET  476
            KTLA++SESVI+ YRRDLEEF +GL+KE  +                      AQ SL T
Sbjct  56   KTLATRSESVIETYRRDLEEFGTGLKKEIEV----------------------AQGSLGT  93

Query  477  VGQAIDDIGSSV----AEIIVQGKDSILA  551
            VG AID++G++V    AEII QGK++ILA
Sbjct  94   VGHAIDELGNTVLKGTAEIIAQGKEAILA  122



>gb|KHG23728.1| BSD domain-containing 1 [Gossypium arboreum]
Length=303

 Score = 86.3 bits (212),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 47/78 (60%), Positives = 58/78 (74%), Gaps = 7/78 (9%)
 Frame = +3

Query  327  IQNYRRDLEEFSSGLQKETAIIREAASRAVQDLPAHIESGATAAQESLETVGQAIDDIGS  506
            +++YR++ EEF SGL+KET IIR  ASRAV D    +E GA+ AQE LE+VGQAIDDIGS
Sbjct  1    MESYRKEFEEFGSGLKKETEIIRSVASRAVND---SLEIGASVAQEKLESVGQAIDDIGS  57

Query  507  SV----AEIIVQGKDSIL  548
            SV    A+II  GKD+ L
Sbjct  58   SVWESTAQIISHGKDTFL  75



>ref|XP_010921958.1| PREDICTED: BSD domain-containing protein C22A12.14c-like [Elaeis 
guineensis]
Length=370

 Score = 86.3 bits (212),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 53/92 (58%), Positives = 68/92 (74%), Gaps = 3/92 (3%)
 Frame = +3

Query  288  GLLKTLASKSESVIQNYRRDLEEFSSGLQKETAIIREAASRAVQDLPAHIESGATAAQES  467
            GL+K LA KSE+V Q YRRDLEEF SGL+KETA +R AA+R V++ P  +E  A AAQES
Sbjct  6    GLVKILAVKSETVFQTYRRDLEEFRSGLRKETAALRAAAARVVREFPCSLEGRAAAAQES  65

Query  468  LETVGQAIDDIGSSVAEIIVQGKDSILAPEDS  563
            LE+VGQA   +G SVA I+   ++S+L P +S
Sbjct  66   LESVGQA---VGGSVAGILAHDRESLLHPRES  94



>gb|KFK42693.1| hypothetical protein AALP_AA1G027500 [Arabis alpina]
Length=444

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 62/154 (40%), Positives = 81/154 (53%), Gaps = 44/154 (29%)
 Frame = +3

Query  117  MDFFKSVFTEEQDYSDTEDTEISSSNLDVQAQPESPPGAPDGNPNIPAIVN-----AWGF  281
            M+FFKSVF++        DTE  S +      P SP    + + N            W F
Sbjct  1    MNFFKSVFSD--------DTETESES----DSPNSPKNTEEHHENPSQSTTEEDDGGWSF  48

Query  282  GSGLLKTLASKSESVIQNYRRDLEEFSSGLQKETAIIREAASRAVQDLPAHIESGATAAQ  461
            G GL+KT+A++SESVI+ YRRDLEEF +GL+KE  +                      AQ
Sbjct  49   G-GLMKTIATRSESVIETYRRDLEEFGTGLKKEIEV----------------------AQ  85

Query  462  ESLETVGQAIDDIGSSV----AEIIVQGKDSILA  551
             SL TVG AID++G++V    AEII QGK+ ILA
Sbjct  86   GSLGTVGHAIDELGNTVLKGTAEIIAQGKEVILA  119



>ref|XP_007144594.1| hypothetical protein PHAVU_007G168800g [Phaseolus vulgaris]
 gb|ESW16588.1| hypothetical protein PHAVU_007G168800g [Phaseolus vulgaris]
Length=447

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 68/174 (39%), Positives = 92/174 (53%), Gaps = 34/174 (20%)
 Frame = +3

Query  117  MDFFKSVFTEEQDYSDTEDTEISSSNLDVQAQPESPPGAPDGNPNIPA-IVNAWGFGSGL  293
            M+FFKSVF E+QD    +     SSN      P+          N    + + W F  G 
Sbjct  1    MNFFKSVFLEDQDPPRPQS---GSSNEPPDQDPDPDSPPRSTTANSGGGVSDGWNFVGGF  57

Query  294  LKTLASKSESVIQNYRRDLEEFSSGLQKETAIIREAASRAVQDLPAHIESGATAAQESLE  473
            +KTL SKSES+I+ YRRDL+EFS+GL+KE  +                      AQ SL 
Sbjct  58   MKTLTSKSESIIETYRRDLQEFSTGLKKEIEV----------------------AQGSLG  95

Query  474  TVGQAIDDIGSSV----AEIIVQGKDSILAPE-DSDNEFSENSGRNDRSDDVYK  620
            TVG  ID+ G++V    A+II QGKD+ILA + DSD   S+N+  N +S D+ +
Sbjct  96   TVGHVIDEFGNTVVKGTAQIISQGKDAILAVDLDSD---SDNNSANRKSLDLMR  146



>ref|XP_008386574.1| PREDICTED: BSD domain-containing protein 1 [Malus domestica]
Length=578

 Score = 86.3 bits (212),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 63/161 (39%), Positives = 90/161 (56%), Gaps = 32/161 (20%)
 Frame = +3

Query  117  MDFFKSVFTEEQDYSDTE-DTEISSSNLDVQ--AQPESPPGAPDGNPNIPAIVNAWGFGS  287
            M+FFKSVF+++ D  + E ++E  S N   Q  A P+SP   P  +PN       W FG 
Sbjct  1    MNFFKSVFSDDPDPPNPESESETGSHNNPEQEHADPKSPRTQP--SPNPTGNTGGWMFGD  58

Query  288  GLLKTLASKSESVIQNYRRDLEEFSSGLQKETAIIREAASRAVQDLPAHIESGATAAQES  467
             L+KTL+++SESVI+ YRRDL+EF  GL+KE  +                      AQ S
Sbjct  59   -LIKTLSTRSESVIETYRRDLQEFGLGLKKEIEV----------------------AQGS  95

Query  468  LETVGQAIDDIGSSVAEIIVQGKDSILAPEDSDNEFSENSG  590
            LETVG  ID+ G++V    +QG   ILA ++SD+  +++ G
Sbjct  96   LETVGHVIDEFGNTV----LQGTAQILAGDESDSSDAKDQG  132



>ref|XP_003536399.1| PREDICTED: spore wall protein 2-like isoform 1 [Glycine max]
Length=464

 Score = 85.1 bits (209),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 61/153 (40%), Positives = 83/153 (54%), Gaps = 35/153 (23%)
 Frame = +3

Query  117  MDFFKSVFTEEQDYSDTEDTEISSSN---LDVQAQPESPPGAPDGNPNIPAIV-NAWGFG  284
            M+ FKSVF+++ D    E    S SN    D    P+SPP +   +     +  + W FG
Sbjct  1    MNLFKSVFSDDPDPPRPE----SGSNNAPRDKSRDPDSPPRSSAIDSAAAGVGGDGWNFG  56

Query  285  SGLLKTLASKSESVIQNYRRDLEEFSSGLQKETAIIREAASRAVQDLPAHIESGATAAQE  464
             GL+KTL +KSES+I+ YRRDL+EF +GL+KE  +                      AQ 
Sbjct  57   -GLIKTLTTKSESIIETYRRDLQEFGTGLKKEIEV----------------------AQG  93

Query  465  SLETVGQAIDDIGSSV----AEIIVQGKDSILA  551
            SL TVG  ID+ G++V    A+II QGKD+ILA
Sbjct  94   SLGTVGHVIDEFGNTVVKGTAQIISQGKDAILA  126



>ref|XP_010070258.1| PREDICTED: BSD domain-containing protein 1-like [Eucalyptus grandis]
 gb|KCW58912.1| hypothetical protein EUGRSUZ_H01532 [Eucalyptus grandis]
Length=518

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 63/163 (39%), Positives = 85/163 (52%), Gaps = 58/163 (36%)
 Frame = +3

Query  117  MDFFKSVFTEEQDYSDTEDTEISSSNLDVQAQPESPPGAPDGN---------------PN  251
            M+FF SVF+++ D                 A+PESPPG  D +               P+
Sbjct  1    MNFFNSVFSDDPD----------------PARPESPPGDDDPSRGRGGGEATAAAAPEPD  44

Query  252  IPAIVNAWGFGSGLLKTLASKSESVIQNYRRDLEEFSSGLQKETAIIREAASRAVQDLPA  431
             P+  + WG   GL+KTL +KSE+V++ YRRDL+EF  GL+KE   I+EA          
Sbjct  45   RPSY-SRWGGLGGLVKTLTTKSETVLETYRRDLQEFGLGLRKE---IQEAHG--------  92

Query  432  HIESGATAAQESLETVGQAIDDIGSSV----AEIIVQGKDSIL  548
                       SLE VGQAID++GSSV    A+II QGK++IL
Sbjct  93   -----------SLENVGQAIDELGSSVIKGTAQIISQGKEAIL  124



>ref|XP_004493637.1| PREDICTED: uncharacterized protein LOC101495422 [Cicer arietinum]
Length=401

 Score = 83.2 bits (204),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 64/155 (41%), Positives = 81/155 (52%), Gaps = 42/155 (27%)
 Frame = +3

Query  117  MDFFKSVFTEEQDYSDTEDTEISSSNLDVQAQPESPPGAPDGNPNIPAIVNAWGFGSGLL  296
            M+FFKSVF      SD  D + S SN    A     P AP+ NP+      AW FG  L+
Sbjct  1    MNFFKSVF------SDDPDPQQSQSN---DAHHTDSPHAPE-NPS-----GAWNFGK-LI  44

Query  297  KTLASKSESVIQNYRRDLEEFSSGLQKETAIIREAASRAVQDLPAHIESGATAAQESLET  476
            KTL+ KSESVI+ YRRDL EF +GL+KE  I                      A +SLET
Sbjct  45   KTLSQKSESVIEIYRRDLNEFGTGLKKEIEI----------------------AHDSLET  82

Query  477  VGQAIDDIGSSV----AEIIVQGKDSILAPEDSDN  569
            VG  ID  G++V    A+II QG+ +I+  +  DN
Sbjct  83   VGHVIDQFGNTVIKGTAQIISQGRHAIIESDSHDN  117



>ref|XP_003565639.1| PREDICTED: BSD domain-containing protein 1-like [Brachypodium 
distachyon]
Length=534

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 64/85 (75%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  LLKTLASKSESVIQNYRRDLEEFSSGLQKETAIIREAASRAVQDLPAHIESGATAAQESL  470
            L+KT AS+SESV++ YRRDL++  +GL+ ET ++R+AA RA   LP  +E+GA+ A + L
Sbjct  148  LMKTFASRSESVLEGYRRDLQDLGTGLRLETTVLRQAAVRAAAALPGALEAGASVASDRL  207

Query  471  ETVGQAIDDIGSSVAEIIVQGKDSI  545
            E+VGQA+DD+G++ A ++    +++
Sbjct  208  ESVGQAVDDLGAAAAGLLSHANEAL  232



>gb|EAY73476.1| hypothetical protein OsI_01355 [Oryza sativa Indica Group]
Length=537

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 46/100 (46%), Positives = 71/100 (71%), Gaps = 2/100 (2%)
 Frame = +3

Query  273  WGFGSGLLKTLASKSESVIQNYRRDLEEFSSGLQKETAIIREAASRAVQDLPAHIESGAT  452
            W FG GL++T A++SESV++ YRRD+++  SGL+ ETA +R AA+RA    P  +E+GA+
Sbjct  148  WSFG-GLIQTFATRSESVLEGYRRDIQDLGSGLRLETATLRAAAARAAAAFPGALEAGAS  206

Query  453  AAQESLETVGQAIDDIGSSVAEIIVQGKDSILAPEDSDNE  572
            AA   LE+VGQA+DD+G++ A +++   +  L   D+D E
Sbjct  207  AASNRLESVGQAVDDLGAAAA-VLLSHANEALRSVDADGE  245



>ref|NP_001042714.1| Os01g0273300 [Oryza sativa Japonica Group]
 dbj|BAD81206.1| hypothetical protein [Oryza sativa Japonica Group]
 dbj|BAF04628.1| Os01g0273300 [Oryza sativa Japonica Group]
Length=537

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 46/100 (46%), Positives = 71/100 (71%), Gaps = 2/100 (2%)
 Frame = +3

Query  273  WGFGSGLLKTLASKSESVIQNYRRDLEEFSSGLQKETAIIREAASRAVQDLPAHIESGAT  452
            W FG GL++T A++SESV++ YRRD+++  SGL+ ETA +R AA+RA    P  +E+GA+
Sbjct  148  WSFG-GLIQTFATRSESVLEGYRRDIQDLGSGLRLETATLRAAAARAAAAFPGALEAGAS  206

Query  453  AAQESLETVGQAIDDIGSSVAEIIVQGKDSILAPEDSDNE  572
            AA   LE+VGQA+DD+G++ A +++   +  L   D+D E
Sbjct  207  AASNRLESVGQAVDDLGAAAA-VLLSHANEALRSVDADGE  245



>ref|XP_002324988.1| BSD domain-containing family protein [Populus trichocarpa]
 gb|EEF03553.1| BSD domain-containing family protein [Populus trichocarpa]
Length=81

 Score = 74.3 bits (181),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 51/69 (74%), Gaps = 1/69 (1%)
 Frame = +3

Query  243  NPNIPAIVNAWGFGSGLLKTLASKSESVIQNYRRDLEEFSSGLQKETAIIREAASRAVQD  422
            NP+ P   +   FGS L++TLA+KSESVI+ Y++DLEEF SGL+ E+AIIR+ AS AV D
Sbjct  11   NPDPPTQNSTRSFGS-LIQTLATKSESVIEIYKKDLEEFRSGLKNESAIIRDVASHAVHD  69

Query  423  LPAHIESGA  449
            LP+  E+  
Sbjct  70   LPSFFEASV  78



>ref|XP_007050696.1| Synapse-associated protein, putative [Theobroma cacao]
 gb|EOX94853.1| Synapse-associated protein, putative [Theobroma cacao]
Length=438

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 63/165 (38%), Positives = 79/165 (48%), Gaps = 52/165 (32%)
 Frame = +3

Query  117  MDFFKSVFTEEQD---------YSDTEDTEISSSNLDVQAQPESPPGAPDGNPNIPAIVN  269
            MDFFKSVF ++ D         +   ED  + S        P   P              
Sbjct  1    MDFFKSVFADDPDPPKRQSESGFPKAEDCVVDSPPKQPDPNPNPNP-------------T  47

Query  270  AWGFGSGLLKTLASKSESVIQNYRRDLEEFSSGLQKETAIIREAASRAVQDLPAHIESGA  449
             W FG GL+KT+ ++SESVI+ YRRDL+EF SGL+KE  +                    
Sbjct  48   GWSFG-GLIKTITTRSESVIETYRRDLKEFGSGLKKEIEV--------------------  86

Query  450  TAAQESLETVGQAIDDIGSSV----AEIIVQGKDSILAPEDSDNE  572
              AQ SLE VG  ID+ G+SV    A+II QGKD ILA   +DNE
Sbjct  87   --AQGSLENVGHVIDEFGNSVLKGTAQIINQGKDVILA---ADNE  126



>ref|XP_008673904.1| PREDICTED: uncharacterized abhydrolase domain-containing protein 
DDB_G0269086-like [Zea mays]
 tpg|DAA54129.1| TPA: hypothetical protein ZEAMMB73_796632 [Zea mays]
 gb|AIB05761.1| BSD transcription factor, partial [Zea mays]
Length=595

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 51/112 (46%), Positives = 75/112 (67%), Gaps = 4/112 (4%)
 Frame = +3

Query  231  APDGNPNIPAIVNA---WGFGSGLLKTLASKSESVIQNYRRDLEEFSSGLQKETAIIREA  401
            A DG    PA  ++   W FG GL+ T AS+SESV+  YRRDLE+  SGL+ ETA +R A
Sbjct  185  AVDGEEGAPAGESSDGGWSFG-GLVSTFASRSESVLGGYRRDLEDLGSGLRLETAALRAA  243

Query  402  ASRAVQDLPAHIESGATAAQESLETVGQAIDDIGSSVAEIIVQGKDSILAPE  557
            A+RA   LP  +E+GA+ A + LE+VGQA+DD+G++ A ++    +++ + E
Sbjct  244  AARAASALPGALEAGASVASDRLESVGQAVDDLGAAAAGLLSHANEALRSAE  295



>ref|XP_010512929.1| PREDICTED: uncharacterized protein LOC104788847 [Camelina sativa]
Length=327

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 45/98 (46%), Positives = 60/98 (61%), Gaps = 27/98 (28%)
 Frame = +3

Query  270  AWGFGSGLLKTLASKSESVIQNYRRDLEEFSSGLQKETAIIREAASRAVQDLPAHIESGA  449
             W FG GL+KTLA++S+SVI+ YRRDLEEF +GL+KE  +                    
Sbjct  60   GWSFG-GLMKTLATRSKSVIETYRRDLEEFGTGLKKEIEV--------------------  98

Query  450  TAAQESLETVGQAIDDIGSSV----AEIIVQGKDSILA  551
              AQ SL TVG  ID++G++V    A+II QGK++ILA
Sbjct  99   --AQGSLGTVGHTIDELGNTVLKGTADIIAQGKEAILA  134



>ref|XP_002987201.1| hypothetical protein SELMODRAFT_425984 [Selaginella moellendorffii]
 gb|EFJ11777.1| hypothetical protein SELMODRAFT_425984 [Selaginella moellendorffii]
Length=305

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/90 (43%), Positives = 60/90 (67%), Gaps = 1/90 (1%)
 Frame = +3

Query  267  NAWGFGSGLLKTLASKSESVIQNYRRDLEEFSSGLQKETAIIREAASRAVQDLPAHIESG  446
            +AW FGS L+K+L SKSE V+Q Y+RDL+EF  GL++ET +  E  + AV+DLP  +ES 
Sbjct  14   SAWSFGS-LVKSLTSKSEEVLQAYQRDLQEFGIGLKRETTVAAEVTAHAVKDLPISLEST  72

Query  447  ATAAQESLETVGQAIDDIGSSVAEIIVQGK  536
            A  AQE+++ V + + +   + +  +  GK
Sbjct  73   AAVAQEAVKKVDEDVTENSEASSTPLSSGK  102



>ref|XP_002976358.1| hypothetical protein SELMODRAFT_416268 [Selaginella moellendorffii]
 gb|EFJ22618.1| hypothetical protein SELMODRAFT_416268 [Selaginella moellendorffii]
Length=307

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/90 (43%), Positives = 60/90 (67%), Gaps = 1/90 (1%)
 Frame = +3

Query  267  NAWGFGSGLLKTLASKSESVIQNYRRDLEEFSSGLQKETAIIREAASRAVQDLPAHIESG  446
            +AW FGS L+K+L SKSE V+Q Y+RDL+EF  GL++ET +  E  + AV+DLP  +ES 
Sbjct  14   SAWSFGS-LVKSLTSKSEEVLQAYQRDLQEFGIGLKRETTVAAEVTAHAVKDLPISLEST  72

Query  447  ATAAQESLETVGQAIDDIGSSVAEIIVQGK  536
            A  AQE+++ V + + +   + +  +  GK
Sbjct  73   AAVAQEAVKKVDEDVTENSEASSTPLSSGK  102



>ref|XP_003591620.1| BSD domain-containing protein [Medicago truncatula]
 gb|AES61871.1| synapse-associated protein, putative [Medicago truncatula]
Length=459

 Score = 77.4 bits (189),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 60/157 (38%), Positives = 80/157 (51%), Gaps = 48/157 (31%)
 Frame = +3

Query  117  MDFFKSVFTEEQDYSDTEDTEISSSNLDVQAQPES--PPGAPDGNPNIPA-IVNAWGFGS  287
            M+FFKSVF+++ D                  QPES   P   D +PN  A   + W FG 
Sbjct  1    MNFFKSVFSDDPD----------------PPQPESEPKPNNVDQDPNSGAGDGDTWNFG-  43

Query  288  GLLKTLASKSESVIQNYRRDLEEFSSGLQKETAIIREAASRAVQDLPAHIESGATAAQES  467
            GL+KTLASKSES+I+ YRRDL+EFS+GL+ E  +                      AQ+S
Sbjct  44   GLMKTLASKSESIIETYRRDLQEFSTGLKNEIEV----------------------AQDS  81

Query  468  LETVGQAIDDIGSSVAEIIVQGKDSILA---PEDSDN  569
            +  +G     +    A+II QGK++ILA     DSDN
Sbjct  82   VGEIGTT---VIKGTAQIISQGKEAILAVNLDSDSDN  115



>ref|XP_002457630.1| hypothetical protein SORBIDRAFT_03g010780 [Sorghum bicolor]
 gb|EES02750.1| hypothetical protein SORBIDRAFT_03g010780 [Sorghum bicolor]
Length=602

 Score = 77.8 bits (190),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 46/95 (48%), Positives = 69/95 (73%), Gaps = 1/95 (1%)
 Frame = +3

Query  273  WGFGSGLLKTLASKSESVIQNYRRDLEEFSSGLQKETAIIREAASRAVQDLPAHIESGAT  452
            W  G GL+KT AS+SESV+  YRRDLE+  SGL+ ETA +R AA+RA   LP  +E+GA+
Sbjct  208  WSLG-GLVKTFASRSESVLGGYRRDLEDLGSGLRLETAALRAAAARAASALPGALEAGAS  266

Query  453  AAQESLETVGQAIDDIGSSVAEIIVQGKDSILAPE  557
            AA + LE+VGQA+D++G++ A ++    +++ + E
Sbjct  267  AASDRLESVGQAVDELGAAAAGLLSHANEALRSAE  301



>gb|KEH23702.1| synapse-associated protein, putative [Medicago truncatula]
Length=401

 Score = 76.6 bits (187),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 57/149 (38%), Positives = 77/149 (52%), Gaps = 43/149 (29%)
 Frame = +3

Query  117  MDFFKSVFTEEQDYSDTE-DTEISSSNLDVQAQPESPPGAPDGNPNIPAIVNAWGFGSGL  293
            M+FFK+VF+++ D S +E +T  SS +L+V   P +                AW     L
Sbjct  1    MNFFKTVFSDDPDPSGSETNTASSSDSLNVPFNPTA----------------AWKNIGNL  44

Query  294  LKTLASKSESVIQNYRRDLEEFSSGLQKETAIIREAASRAVQDLPAHIESGATAAQESLE  473
            +KT+  KSESVI+ YRRDL EF +GLQKE  +                      A +SLE
Sbjct  45   IKTVGEKSESVIEIYRRDLHEFGTGLQKEIEV----------------------AHDSLE  82

Query  474  TVGQAIDDIGSSV----AEIIVQGKDSIL  548
            TVG  ID  G++V    A+II Q KD+IL
Sbjct  83   TVGHVIDQFGNTVIKGTAQIISQSKDAIL  111



>gb|AFK39974.1| unknown [Medicago truncatula]
Length=459

 Score = 77.0 bits (188),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 60/157 (38%), Positives = 80/157 (51%), Gaps = 48/157 (31%)
 Frame = +3

Query  117  MDFFKSVFTEEQDYSDTEDTEISSSNLDVQAQPES--PPGAPDGNPNIPA-IVNAWGFGS  287
            M+FFKSVF+++ D                  QPES   P   D +PN  A   + W FG 
Sbjct  1    MNFFKSVFSDDPD----------------PPQPESEPKPNNVDQDPNSGAGDGDTWNFG-  43

Query  288  GLLKTLASKSESVIQNYRRDLEEFSSGLQKETAIIREAASRAVQDLPAHIESGATAAQES  467
            GL+KTLASKSES+I+ YRRDL+EFS+GL+ E  +                      AQ+S
Sbjct  44   GLMKTLASKSESIIETYRRDLQEFSTGLKNEIDV----------------------AQDS  81

Query  468  LETVGQAIDDIGSSVAEIIVQGKDSILA---PEDSDN  569
            +  +G     +    A+II QGK++ILA     DSDN
Sbjct  82   VGEIGTT---VIKGTAQIISQGKEAILAVNLDSDSDN  115



>emb|CDM82781.1| unnamed protein product [Triticum aestivum]
Length=532

 Score = 77.0 bits (188),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 46/100 (46%), Positives = 71/100 (71%), Gaps = 2/100 (2%)
 Frame = +3

Query  273  WGFGSGLLKTLASKSESVIQNYRRDLEEFSSGLQKETAIIREAASRAVQDLPAHIESGAT  452
            W FG GL+KT +S+SESV++ YRRDL++  SGL+ ET  +R AA+RA   LP  +E+GA+
Sbjct  140  WSFG-GLMKTFSSRSESVLEGYRRDLQDLGSGLRVETTALRAAAARAAAALPGALEAGAS  198

Query  453  AAQESLETVGQAIDDIGSSVAEIIVQGKDSILAPEDSDNE  572
             A + LE+VGQA+DD G++ A ++    +++ +  D+D E
Sbjct  199  VASDRLESVGQAVDDHGAAAAGLLSHANEALRSV-DADGE  237



>emb|CBI32321.3| unnamed protein product [Vitis vinifera]
Length=350

 Score = 75.5 bits (184),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 43/90 (48%), Positives = 57/90 (63%), Gaps = 2/90 (2%)
 Frame = +3

Query  117  MDFFKSVFTEEQDYSDTEDTEISSSNLDVQAQPESPPGAPDGNPNIPAIVNAWGFGSGLL  296
            MDFFKSVF+++ D    +    S        + ++P   PD NPN P+    W FG GL+
Sbjct  1    MDFFKSVFSDDPDPPRFDPDPESPKKPSQSEEDDAPDAKPDPNPN-PSAGGGWSFG-GLI  58

Query  297  KTLASKSESVIQNYRRDLEEFSSGLQKETA  386
            KTL +KSESVI+ YRRDL+EF +GL+ ETA
Sbjct  59   KTLTTKSESVIEIYRRDLQEFGTGLKHETA  88



>ref|XP_006378127.1| hypothetical protein POPTR_0010s02970g, partial [Populus trichocarpa]
 gb|ERP55924.1| hypothetical protein POPTR_0010s02970g, partial [Populus trichocarpa]
Length=194

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 40/72 (56%), Positives = 48/72 (67%), Gaps = 4/72 (6%)
 Frame = +3

Query  369  LQKETAIIREAASRAVQDLPAHIESGATAAQESLETVGQAIDDIGS----SVAEIIVQGK  536
            L+KETA+IR+ AS AV DLPA  E+    AQESLE+VGQAIDDI S    S A II  G 
Sbjct  3    LKKETAVIRDVASPAVHDLPASFETSTAVAQESLESVGQAIDDIRSTFWKSTARIISHGS  62

Query  537  DSILAPEDSDNE  572
            DS+ +  D D +
Sbjct  63   DSVFSAVDHDRD  74



>ref|XP_009393114.1| PREDICTED: BSD domain-containing protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=306

 Score = 73.2 bits (178),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 49/121 (40%), Positives = 63/121 (52%), Gaps = 25/121 (21%)
 Frame = +3

Query  117  MDFFKSVFTEEQDYSDTEDTEISSSNLDVQAQPE-SPPGAPDGNPNIPAIVNAWGFGSGL  293
            MDF K+VF+                     A PE S P   D         + W FG G 
Sbjct  1    MDFLKTVFS---------------------ADPEPSQPHDDDYRRGEGGGASEWSFG-GF  38

Query  294  LKTLASKSESVIQNYRRDLEEFSSGLQKETAIIREAASRAVQDLPAHIESGATAAQESLE  473
            +KTLAS SESVIQ YRRDL EF +GL+KET  + +AA+RA +DL   +  G    +E++E
Sbjct  39   IKTLASMSESVIQTYRRDLAEFGTGLKKETEAVGKAAARAFRDLDGSVWRG--TGKEAVE  96

Query  474  T  476
            T
Sbjct  97   T  97



>ref|XP_003520218.1| PREDICTED: protein starmaker-like [Glycine max]
 gb|KHN18903.1| BSD domain-containing protein 1 [Glycine soja]
Length=458

 Score = 73.9 bits (180),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 57/149 (38%), Positives = 73/149 (49%), Gaps = 29/149 (19%)
 Frame = +3

Query  117  MDFFKSVFTEEQDYSDTEDTEISSSNLDVQAQPESPPGAPDGNPNIPAIVNAWGFGSGLL  296
            M+ FKSVF+E+ D         S    D    P SPP +                  GL+
Sbjct  1    MNIFKSVFSEDPDPPRPGSNHASP---DKAPDPHSPPRSNATESAAGGGGGDGWNFGGLI  57

Query  297  KTLASKSESVIQNYRRDLEEFSSGLQKETAIIREAASRAVQDLPAHIESGATAAQESLET  476
            KTL SKSES+I+ YRRDL+EF +GL+KE  +                      AQ SL T
Sbjct  58   KTLTSKSESIIETYRRDLQEFGTGLKKEIEV----------------------AQGSLGT  95

Query  477  VGQAIDDIGSSV----AEIIVQGKDSILA  551
            VG  ID+ G++V    A+II QGKD+ILA
Sbjct  96   VGHVIDEFGNTVVKGTAQIISQGKDAILA  124



>ref|XP_007162386.1| hypothetical protein PHAVU_001G147700g [Phaseolus vulgaris]
 gb|ESW34380.1| hypothetical protein PHAVU_001G147700g [Phaseolus vulgaris]
Length=437

 Score = 73.2 bits (178),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 58/163 (36%), Positives = 80/163 (49%), Gaps = 38/163 (23%)
 Frame = +3

Query  117  MDFFKSVFTEEQDYSDTEDTEISSSNLDVQAQPESPPGAPDGNPNIPAIVNAWGFGSGLL  296
            M+FF SVF++  +    E        L  QA  +S P  P+   +      AW  G  L 
Sbjct  1    MNFFASVFSDSNNEHQNE--------LQEQANHDSSP--PEHQSDSSGD-GAWEIGD-LW  48

Query  297  KTLASKSESVIQNYRRDLEEFSSGLQKETAIIREAASRAVQDLPAHIESGATAAQESLET  476
            K L++KSE +I+ YRRDL+EF +GL+KE  +                      A  SLET
Sbjct  49   KRLSAKSELIIETYRRDLQEFGTGLKKEIEV----------------------AHGSLET  86

Query  477  VGQAIDDIGSSVAE----IIVQGKDSILAPEDSDNEFSENSGR  593
            VG  ID  G++VA+    II  GKD+IL   +SDN+ +  S R
Sbjct  87   VGHVIDQFGNTVAKGTANIISHGKDAILLDSESDNDVNTKSKR  129



>ref|XP_001779382.1| predicted protein [Physcomitrella patens]
 gb|EDQ55772.1| predicted protein [Physcomitrella patens]
Length=357

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 47/63 (75%), Gaps = 0/63 (0%)
 Frame = +3

Query  324  VIQNYRRDLEEFSSGLQKETAIIREAASRAVQDLPAHIESGATAAQESLETVGQAIDDIG  503
            V+Q Y++DL+EF  GL+KET +I    +  V+DLP  +E+GA+ AQESLETVGQ ++  G
Sbjct  34   VLQTYQQDLKEFGIGLKKETEVISGVTAHVVKDLPLSLETGASVAQESLETVGQTLEVFG  93

Query  504  SSV  512
            S+V
Sbjct  94   STV  96



>ref|XP_006444149.1| hypothetical protein CICLE_v10020022mg [Citrus clementina]
 ref|XP_006479781.1| PREDICTED: uncharacterized protein LOC102630764 [Citrus sinensis]
 gb|ESR57389.1| hypothetical protein CICLE_v10020022mg [Citrus clementina]
 gb|KDO68841.1| hypothetical protein CISIN_1g012195mg [Citrus sinensis]
Length=468

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 45/102 (44%), Positives = 59/102 (58%), Gaps = 26/102 (25%)
 Frame = +3

Query  270  AWGFGSGLLKTLASKSESVIQNYRRDLEEFSSGLQKETAIIREAASRAVQDLPAHIESGA  449
            AW FG GL+KTL +KSESV++ YRRDL+EF SGL+KE  +                    
Sbjct  55   AWSFG-GLIKTLTTKSESVLETYRRDLKEFGSGLKKELEV--------------------  93

Query  450  TAAQESLETVGQAIDDIGSSVAEIIVQGKDSILAPEDSDNEF  575
              AQ SL TV   ID+ G++V +   Q KD+ILA   +D+EF
Sbjct  94   --AQGSLGTVSTVIDEFGNTVLKSTAQIKDAILA---ADHEF  130



>ref|XP_009356725.1| PREDICTED: glutamic acid-rich protein [Pyrus x bretschneideri]
Length=580

 Score = 71.2 bits (173),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 58/154 (38%), Positives = 80/154 (52%), Gaps = 30/154 (19%)
 Frame = +3

Query  117  MDFFKSVFTEEQDYSDTEDTEISSS---NLDVQAQPESPPGAPDGNPNIPAIVNAWGFGS  287
            M+FFKSVF+++ D  + E    S +   N   Q  P+        NPN       W FG 
Sbjct  1    MNFFKSVFSDDPDPPNPESESESETGSPNNPEQEHPDPKSPPTQPNPNPTGNTGGWMFGD  60

Query  288  GLLKTLASKSESVIQNYRRDLEEFSSGLQKETAIIREAASRAVQDLPAHIESGATAAQES  467
             L+KTL+++SESVI+ YRRDL+EF  GL+KE  +                      AQ S
Sbjct  61   -LIKTLSTRSESVIETYRRDLQEFGLGLKKEIEV----------------------AQGS  97

Query  468  LETVGQAIDDIGSSVAEIIVQGKDSILAPEDSDN  569
            LETVG  ID+ G++V    +QG   ILA ++SD+
Sbjct  98   LETVGHVIDEFGNTV----LQGTAQILAGDESDS  127



>ref|XP_004967719.1| PREDICTED: dentin sialophosphoprotein-like [Setaria italica]
Length=593

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 45/95 (47%), Positives = 69/95 (73%), Gaps = 1/95 (1%)
 Frame = +3

Query  273  WGFGSGLLKTLASKSESVIQNYRRDLEEFSSGLQKETAIIREAASRAVQDLPAHIESGAT  452
            W FG GL+KT AS+SE+V+  YRRDL++  SGL+ ETA +R AA+RA   LP  +E+ A+
Sbjct  202  WSFG-GLVKTFASRSETVLGGYRRDLQDLGSGLRLETAALRAAAARAASALPGALEASAS  260

Query  453  AAQESLETVGQAIDDIGSSVAEIIVQGKDSILAPE  557
            AA + LE+VGQA+DD+G++ A ++    +++ + E
Sbjct  261  AASDRLESVGQAVDDLGAAAAGLLSHANEALRSAE  295



>ref|XP_004290686.1| PREDICTED: BSD domain-containing protein 1 [Fragaria vesca subsp. 
vesca]
Length=488

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 43/102 (42%), Positives = 60/102 (59%), Gaps = 30/102 (29%)
 Frame = +3

Query  264  VNAWGFGSGLLKTLASKSESVIQNYRRDLEEFSSGLQKETAIIREAASRAVQDLPAHIES  443
            +  W FG  L+KT+A+KSE+VI+ YRRDL+EF SGL+KE  +                  
Sbjct  46   IGGWNFGD-LIKTIATKSETVIETYRRDLQEFGSGLKKEIEV------------------  86

Query  444  GATAAQESLETVGQAIDDIGSSV----AEIIVQGKDSILAPE  557
                AQ SLETVG  ID++G++V    A+II Q   +IL+P+
Sbjct  87   ----AQGSLETVGTKIDELGNTVLQGTAQIISQ---NILSPD  121



>gb|AFW70924.1| hypothetical protein ZEAMMB73_576122 [Zea mays]
Length=531

 Score = 68.2 bits (165),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 40/95 (42%), Positives = 58/95 (61%), Gaps = 1/95 (1%)
 Frame = +3

Query  273  WGFGSGLLKTLASKSESVIQNYRRDLEEFSSGLQKETAIIREAASRAVQDLPAHIESGAT  452
            W FG GL+ T AS+SESV+  YRRDLE+  SGL  ET  +  AA+RA   L   +E GA+
Sbjct  52   WSFG-GLMSTFASRSESVLGGYRRDLEDLGSGLCLETVALWAAAARAASALHDTLEVGAS  110

Query  453  AAQESLETVGQAIDDIGSSVAEIIVQGKDSILAPE  557
                 LE+VGQ +DD+ ++ A ++     ++ + E
Sbjct  111  VVSNRLESVGQVVDDLRATTAGLLSHANKALRSAE  145



>ref|XP_004496069.1| PREDICTED: BSD domain-containing protein 1-like [Cicer arietinum]
Length=453

 Score = 67.8 bits (164),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 57/175 (33%), Positives = 80/175 (46%), Gaps = 62/175 (35%)
 Frame = +3

Query  117  MDFFKSVFTEEQDYSDTEDTEISSSNLDVQAQPESPPGAPDGNPNIPAIVNAWGFGSGLL  296
            M+FFKSVF+++ D                      PP   + +PN  +    W FG GL+
Sbjct  1    MNFFKSVFSDDPD----------------------PPQPNNADPNPDS---DWNFG-GLI  34

Query  297  KTLASKSESVIQNYRRDLEEFSSGLQKETAIIREAASRAVQDLPAHIESGATAAQESLET  476
            KTL +KSES+I+ YRRDL EFS+GL+ E  +                      AQ+S+  
Sbjct  35   KTLTAKSESIIETYRRDLHEFSTGLKNEIEV----------------------AQDSVGE  72

Query  477  VGQAIDDIGSSVAEIIVQGKDSILA---PEDSDN--------EFSENSGRNDRSD  608
            +G     +     +II +GK++ILA     DSDN         FS +S R  R D
Sbjct  73   IGTT---VIKGTTQIISKGKEAILAVNLDSDSDNSTTTTNRDSFSSDSKRYSRFD  124



>gb|EMS55437.1| hypothetical protein TRIUR3_20550 [Triticum urartu]
Length=456

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 42/100 (42%), Positives = 68/100 (68%), Gaps = 1/100 (1%)
 Frame = +3

Query  291  LLKTLASKSESVIQNYRRDLEEFSSGLQKETAIIREAASRAVQDLPAHIESGATAAQESL  470
            L+KT +S+SESV+   RRDL++  SGL+ ET  +R AA+RA   LP  +E+GA+ A + L
Sbjct  144  LMKTFSSRSESVLGGSRRDLQDLGSGLRVETTALRAAAARAAAALPGALEAGASVASDRL  203

Query  471  ETVGQAIDDIGSSVAEIIVQGKDSILAPEDSDNEFSENSG  590
            E+VGQA+DD+G++ A ++    +++ +  D+D E +   G
Sbjct  204  ESVGQAVDDLGAAAAGLLSHANEALRSV-DADGEDATGDG  242



>ref|XP_006576882.1| PREDICTED: high mobility group nucleosome-binding domain-containing 
protein 5-like [Glycine max]
 gb|KHN19858.1| BSD domain-containing protein 1 [Glycine soja]
Length=430

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 54/154 (35%), Positives = 75/154 (49%), Gaps = 41/154 (27%)
 Frame = +3

Query  117  MDFFKSVFTEEQ----DYSDTEDTEISSSNLDVQAQPESPPGAPDGNPNIPAIVNAWGFG  284
            M+FF S F+++     +   TE  +   ++ D +   +SP    DG         AW F 
Sbjct  1    MNFFTSFFSDDDDDDDNARQTESQDEEEASRDSEHLSDSP--TSDGG--------AWEF-  49

Query  285  SGLLKTLASKSESVIQNYRRDLEEFSSGLQKETAIIREAASRAVQDLPAHIESGATAAQE  464
            SGL KTL++KSES+I  YRRDL+EF +GL+KE  +                      A  
Sbjct  50   SGLWKTLSAKSESIIDTYRRDLQEFGTGLKKEIEV----------------------AHG  87

Query  465  SLETVGQAIDDIGSSVAEIIVQGKDSILAPEDSD  566
            SLETVG  ID  G++V    V+G   I +  DSD
Sbjct  88   SLETVGHVIDQFGNTV----VKGTSHIKSYLDSD  117



>ref|XP_010326623.1| PREDICTED: BSD domain-containing protein 1 isoform X2 [Solanum 
lycopersicum]
Length=487

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 40/87 (46%), Positives = 50/87 (57%), Gaps = 13/87 (15%)
 Frame = +3

Query  357  FSSGLQKETAIIREAASRAVQDLPAHIESGATAAQESLETVGQAIDDIGSSVAEIIVQGK  536
            F   L+KET + RE ASRAV+DLP  IE G         TV  AID +  S  EII QGK
Sbjct  62   FGGLLKKETELFREVASRAVKDLPNSIEVGT--------TVSHAIDGVIKSTTEIISQGK  113

Query  537  DSILAPEDSDNEFSE-----NSGRNDR  602
            D++LA  D+++E  +     NSGR  R
Sbjct  114  DTLLASSDAESETPDANQTLNSGRYSR  140



>ref|NP_001168539.1| hypothetical protein [Zea mays]
 gb|ACN28587.1| unknown [Zea mays]
 tpg|DAA63919.1| TPA: hypothetical protein ZEAMMB73_339106 [Zea mays]
Length=452

 Score = 58.5 bits (140),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 55/85 (65%), Gaps = 19/85 (22%)
 Frame = +3

Query  291  LLKTLASKSESVIQNYRRDLEEFSSGLQKETAIIREAASRAVQDLPAHIESGATAAQESL  470
            LLKTL S+SE+V++ YRRDL EF +GL++ET ++REAA+RA +DLP+             
Sbjct  47   LLKTLTSQSETVLEAYRRDLAEFGTGLRRETEVLREAAARAARDLPSS------------  94

Query  471  ETVGQAIDDIGSSVAEIIVQGKDSI  545
                 A+D     +A+I+ QGK+++
Sbjct  95   ---AHALD----GLADIVAQGKEAL  112



>gb|AFW74907.1| hypothetical protein ZEAMMB73_322148 [Zea mays]
Length=275

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/79 (38%), Positives = 48/79 (61%), Gaps = 19/79 (24%)
 Frame = +3

Query  309  SKSESVIQNYRRDLEEFSSGLQKETAIIREAASRAVQDLPAHIESGATAAQESLETVGQA  488
            S+SE+V++ YRRDL EF +GL +ET ++REA + AV+DLP+                  A
Sbjct  26   SQSETVLEAYRRDLAEFGTGLCRETEVLREAVAWAVRDLPSS---------------AHA  70

Query  489  IDDIGSSVAEIIVQGKDSI  545
            +D +    A+I+ QGK+++
Sbjct  71   LDGL----ADIVAQGKEAL  85



>ref|XP_008680666.1| PREDICTED: LOW QUALITY PROTEIN: BSD domain-containing protein 
1-like [Zea mays]
Length=297

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 37/121 (31%), Positives = 61/121 (50%), Gaps = 21/121 (17%)
 Frame = +3

Query  183  SSSNLDVQAQPESPPGAPDGNPNIPAIVNAWGFGSGLLKTLASKSESVIQNYRRDLEEFS  362
             ++ L     P  P   P   P+I  + +      GL KTL S+ E+V++  RRDL EF 
Sbjct  56   CTTVLPAPVIPSRPCSCPKSAPDI--LAHGVPSIGGLPKTLTSQFETVLEANRRDLTEFG  113

Query  363  SGLQKETAIIREAASRAVQDLPAHIESGATAAQESLETVGQAIDDIGSSVAEIIVQGKDS  542
            + L++ET ++REAA+R  +D               L +   A+D     +A+I+ QGK++
Sbjct  114  TDLRRETEVLREAAARVARD---------------LSSSAHALD----GLADIVAQGKEA  154

Query  543  I  545
            +
Sbjct  155  L  155



>ref|XP_002461138.1| hypothetical protein SORBIDRAFT_02g041350 [Sorghum bicolor]
 gb|EER97659.1| hypothetical protein SORBIDRAFT_02g041350 [Sorghum bicolor]
Length=458

 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 35/83 (42%), Positives = 53/83 (64%), Gaps = 19/83 (23%)
 Frame = +3

Query  291  LLKTLASKSESVIQNYRRDLEEFSSGLQKETAIIREAASRAVQDLPAHIESGATAAQESL  470
            L+KTL S+SE+V++ YRRDL EF +GL++ET ++REAA+RA +DLP              
Sbjct  48   LIKTLTSQSETVLEAYRRDLAEFGTGLRRETEVLREAAARAARDLP--------------  93

Query  471  ETVGQAIDDIGSSVAEIIVQGKD  539
             +   A+D     +A+I+ QGK+
Sbjct  94   -SSAHALD----GLADIVAQGKE  111



>ref|XP_004958525.1| PREDICTED: BSD domain-containing protein 1-like [Setaria italica]
Length=450

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 59/97 (61%), Gaps = 19/97 (20%)
 Frame = +3

Query  255  PAIVNAWGFGSGLLKTLASKSESVIQNYRRDLEEFSSGLQKETAIIREAASRAVQDLPAH  434
            PA         GLLKTL S+SE+V++ YRRDL EFS+GL++ET ++R+AA+RA +DLP  
Sbjct  31   PAGGGGGWGFGGLLKTLTSQSETVLEAYRRDLAEFSTGLRRETEVLRDAAARAARDLP--  88

Query  435  IESGATAAQESLETVGQAIDDIGSSVAEIIVQGKDSI  545
                         +   A+D     +A+I+ QGKD++
Sbjct  89   -------------SSAHALD----GLADIVAQGKDAL  108



>ref|XP_008671572.1| PREDICTED: protein enabled homolog [Zea mays]
Length=202

 Score = 52.0 bits (123),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 39/61 (64%), Gaps = 4/61 (7%)
 Frame = +3

Query  231  APDGNPNIPAIVNAWGFGSGLLKTLASKSESVIQNYRRDLEEFSSGLQKETAIIREAASR  410
            AP  NP +P + +      GLLKT  S+SE+V++ Y RDL EF +GL+ E  ++ +A +R
Sbjct  30   APFSNPALPPVPSI----GGLLKTPTSQSETVLEAYPRDLAEFGTGLRHEIEVLSKAVAR  85

Query  411  A  413
            A
Sbjct  86   A  86



>ref|XP_003562559.1| PREDICTED: BSD domain-containing protein 1 [Brachypodium distachyon]
Length=457

 Score = 52.8 bits (125),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 38/83 (46%), Positives = 53/83 (64%), Gaps = 19/83 (23%)
 Frame = +3

Query  291  LLKTLASKSESVIQNYRRDLEEFSSGLQKETAIIREAASRAVQDLPAHIESGATAAQESL  470
            LLKTL S+SE+V++ YRRDL EFS+GL++ET  +REAA+RA +DLP              
Sbjct  53   LLKTLTSQSETVLEAYRRDLAEFSTGLRRETDALREAAARAARDLP--------------  98

Query  471  ETVGQAIDDIGSSVAEIIVQGKD  539
             +   A+D     +A+I+ QGKD
Sbjct  99   -SSAHALD----GLADIVAQGKD  116



>ref|NP_001060469.1| Os07g0647400 [Oryza sativa Japonica Group]
 dbj|BAC06995.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAD31458.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF22383.1| Os07g0647400 [Oryza sativa Japonica Group]
 gb|EAZ40886.1| hypothetical protein OsJ_25364 [Oryza sativa Japonica Group]
Length=460

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 51/142 (36%), Positives = 70/142 (49%), Gaps = 20/142 (14%)
 Frame = +3

Query  117  MDFFKSVFTEEQDYSDTEDTEISSSNLDVQAQPES-PPGAPDGNPNIPAIVNAWGFGSGL  293
            MDFFKS+  E +    +      +      A   S PP   D                GL
Sbjct  1    MDFFKSILAEPEPGPSSPPPPPETETEQEHAGSTSTPPTDDDVGGGGGGGGGGGWGFGGL  60

Query  294  LKTLASKSESVIQNYRRDLEEFSSGLQKETAIIREAASRAVQDLPAHIESGATAAQESLE  473
            LKTL S+SE+V++ YRRDL EF +GL++ET  +R+AA+RA +DLPAH             
Sbjct  61   LKTLTSQSETVLEAYRRDLAEFGTGLRRETEALRDAAARAARDLPAH-------------  107

Query  474  TVGQAIDDIGSSVAEIIVQGKD  539
                A+D     +A+I+ QGKD
Sbjct  108  --AHALD----GLADIVAQGKD  123



>ref|XP_006605223.1| PREDICTED: BSD domain-containing protein 1-like, partial [Glycine 
max]
Length=314

 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 38/70 (54%), Gaps = 22/70 (31%)
 Frame = +3

Query  309  SKSESVIQNYRRDLEEFSSGLQKETAIIREAASRAVQDLPAHIESGATAAQESLETVGQA  488
            +KSES+I+ YRRDL+EF +GL+KE  +                      A  SLETVG  
Sbjct  35   AKSESIIETYRRDLQEFGTGLKKEIEV----------------------AHRSLETVGHV  72

Query  489  IDDIGSSVAE  518
            ID  G++VA+
Sbjct  73   IDQFGNTVAK  82



>gb|KHN45382.1| BSD domain-containing protein 1 [Glycine soja]
Length=356

 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 38/70 (54%), Gaps = 22/70 (31%)
 Frame = +3

Query  309  SKSESVIQNYRRDLEEFSSGLQKETAIIREAASRAVQDLPAHIESGATAAQESLETVGQA  488
            +KSES+I+ YRRDL+EF +GL+KE  +                      A  SLETVG  
Sbjct  19   AKSESIIETYRRDLQEFGTGLKKEIEV----------------------AHRSLETVGHV  56

Query  489  IDDIGSSVAE  518
            ID  G++VA+
Sbjct  57   IDQFGNTVAK  66



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 933768211125