BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001O19

Length=509
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009803416.1|  PREDICTED: cytochrome P450 77A3                    201   2e-58   Nicotiana sylvestris
ref|XP_009612631.1|  PREDICTED: cytochrome P450 77A1                    196   1e-56   Nicotiana tomentosiformis
ref|XP_006348097.1|  PREDICTED: cytochrome P450 77A3-like               194   9e-56   Solanum tuberosum [potatoes]
ref|XP_011086180.1|  PREDICTED: cytochrome P450 77A3-like               191   1e-54   Sesamum indicum [beniseed]
gb|KDP20776.1|  hypothetical protein JCGZ_21247                         189   7e-54   Jatropha curcas
ref|XP_002305592.1|  cytochrome P450 family protein                     187   2e-53   Populus trichocarpa [western balsam poplar]
ref|XP_010316601.1|  PREDICTED: cytochrome P450 77A1                    187   4e-53   Solanum lycopersicum
gb|EYU33905.1|  hypothetical protein MIMGU_mgv1a004759mg                187   4e-53   Erythranthe guttata [common monkey flower]
ref|XP_002518512.1|  cytochrome P450, putative                          184   5e-52   Ricinus communis
ref|XP_011037689.1|  PREDICTED: cytochrome P450 77A4-like               184   7e-52   Populus euphratica
ref|XP_007204450.1|  hypothetical protein PRUPE_ppa026370mg             182   2e-51   Prunus persica
ref|XP_009363721.1|  PREDICTED: cytochrome P450 77A1-like               182   6e-51   Pyrus x bretschneideri [bai li]
ref|XP_006468005.1|  PREDICTED: cytochrome P450 77A3-like               180   2e-50   Citrus sinensis [apfelsine]
ref|XP_006449061.1|  hypothetical protein CICLE_v10014970mg             180   2e-50   Citrus clementina [clementine]
ref|XP_008367238.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    180   3e-50   
gb|KDO75503.1|  hypothetical protein CISIN_1g036686mg                   179   4e-50   Citrus sinensis [apfelsine]
ref|XP_009370410.1|  PREDICTED: cytochrome P450 77A1-like               179   5e-50   Pyrus x bretschneideri [bai li]
ref|XP_008439972.1|  PREDICTED: cytochrome P450 77A1                    178   1e-49   Cucumis melo [Oriental melon]
gb|ABD97101.1|  cytochrome P450 monooxygenase CYP77B5                   175   1e-49   Medicago truncatula
ref|XP_004155597.1|  PREDICTED: cytochrome P450 77A1-like               177   3e-49   
ref|XP_004305483.2|  PREDICTED: cytochrome P450 77A4                    177   3e-49   Fragaria vesca subsp. vesca
ref|XP_004134754.1|  PREDICTED: cytochrome P450 77A1-like               176   4e-49   Cucumis sativus [cucumbers]
gb|KJB69319.1|  hypothetical protein B456_011G016000                    176   5e-49   Gossypium raimondii
ref|XP_003610402.1|  Cytochrome P450                                    175   1e-48   Medicago truncatula
ref|XP_004508228.1|  PREDICTED: uncharacterized protein LOC101501316    179   1e-48   
ref|XP_002265911.1|  PREDICTED: cytochrome P450 77A1                    175   1e-48   Vitis vinifera
ref|XP_010101456.1|  Cytochrome P450 77A3                               174   2e-48   
ref|XP_010276015.1|  PREDICTED: cytochrome P450 77A3                    173   6e-48   Nelumbo nucifera [Indian lotus]
ref|XP_010052825.1|  PREDICTED: cytochrome P450 77A2                    174   7e-48   Eucalyptus grandis [rose gum]
emb|CDP04373.1|  unnamed protein product                                172   1e-47   Coffea canephora [robusta coffee]
ref|XP_008242488.1|  PREDICTED: cytochrome P450 77A3                    172   2e-47   Prunus mume [ume]
ref|XP_007026022.1|  Cytochrome P450, family 77, subfamily B, pol...    171   4e-47   Theobroma cacao [chocolate]
gb|KDP20777.1|  hypothetical protein JCGZ_21248                         171   7e-47   Jatropha curcas
ref|XP_009362723.1|  PREDICTED: cytochrome P450 77A3-like               170   2e-46   
gb|KJB68589.1|  hypothetical protein B456_010G252700                    169   2e-46   Gossypium raimondii
ref|XP_002304925.2|  hypothetical protein POPTR_0004s01860g             169   3e-46   Populus trichocarpa [western balsam poplar]
ref|XP_008375760.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    169   4e-46   
gb|EMT07121.1|  hypothetical protein F775_44004                         159   5e-46   
ref|XP_002518513.1|  cytochrome P450, putative                          167   8e-46   Ricinus communis
ref|XP_011037690.1|  PREDICTED: cytochrome P450 77A1-like               166   2e-45   Populus euphratica
ref|XP_003549954.2|  PREDICTED: cytochrome P450 77A2-like               166   3e-45   
gb|KHN03460.1|  Cytochrome P450 77A1                                    166   3e-45   Glycine soja [wild soybean]
ref|XP_002437457.1|  hypothetical protein SORBIDRAFT_10g027430          166   4e-45   Sorghum bicolor [broomcorn]
emb|CDY65267.1|  BnaCnng46320D                                          158   1e-44   Brassica napus [oilseed rape]
dbj|BAK06611.1|  predicted protein                                      164   1e-44   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003528678.1|  PREDICTED: cytochrome P450 77A1-like               164   2e-44   Glycine max [soybeans]
ref|NP_001141481.1|  uncharacterized protein LOC100273592 precursor     163   3e-44   Zea mays [maize]
gb|ACF86457.1|  unknown                                                 162   6e-44   Zea mays [maize]
ref|XP_004966222.1|  PREDICTED: cytochrome P450 77A3-like               162   7e-44   Setaria italica
ref|XP_006657255.1|  PREDICTED: cytochrome P450 77A3-like               162   1e-43   Oryza brachyantha
ref|XP_007153928.1|  hypothetical protein PHAVU_003G076900g             162   1e-43   Phaseolus vulgaris [French bean]
ref|XP_010227164.1|  PREDICTED: cytochrome P450 77A1                    161   2e-43   Brachypodium distachyon [annual false brome]
ref|XP_008784547.1|  PREDICTED: cytochrome P450 77A3-like               160   3e-43   Phoenix dactylifera
ref|XP_009412014.1|  PREDICTED: cytochrome P450 77A3-like               160   3e-43   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010931808.1|  PREDICTED: cytochrome P450 77A3                    159   9e-43   Elaeis guineensis
ref|XP_011086181.1|  PREDICTED: cytochrome P450 77A3-like               159   1e-42   Sesamum indicum [beniseed]
emb|CDY64815.1|  BnaA08g31590D                                          159   1e-42   Brassica napus [oilseed rape]
ref|XP_009110714.1|  PREDICTED: cytochrome P450 77A3-like               158   2e-42   Brassica rapa
gb|KJB67165.1|  hypothetical protein B456_010G178900                    158   2e-42   Gossypium raimondii
ref|XP_008812264.1|  PREDICTED: cytochrome P450 77A3-like               158   3e-42   Phoenix dactylifera
ref|XP_006858061.1|  hypothetical protein AMTR_s00062p00048540          157   4e-42   
ref|XP_010553430.1|  PREDICTED: cytochrome P450 77A3                    157   5e-42   Tarenaya hassleriana [spider flower]
ref|XP_010665549.1|  PREDICTED: cytochrome P450 77A4                    157   9e-42   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002889880.1|  CYP77B1                                            156   2e-41   Arabidopsis lyrata subsp. lyrata
ref|XP_010476093.1|  PREDICTED: cytochrome P450 77A3-like               155   2e-41   Camelina sativa [gold-of-pleasure]
ref|XP_010458565.1|  PREDICTED: cytochrome P450 77A3-like               155   2e-41   Camelina sativa [gold-of-pleasure]
ref|XP_010493054.1|  PREDICTED: cytochrome P450 77A3-like               155   2e-41   Camelina sativa [gold-of-pleasure]
ref|XP_006307273.1|  hypothetical protein CARUB_v10008888mg             155   2e-41   Capsella rubella
ref|NP_001058373.1|  Os06g0680700                                       155   3e-41   
gb|EEE66224.1|  hypothetical protein OsJ_22376                          155   3e-41   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010102452.1|  Cytochrome P450 77A3                               155   3e-41   Morus notabilis
ref|NP_172626.1|  cytochrome P450, family 77, subfamily B, polype...    155   4e-41   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011086179.1|  PREDICTED: cytochrome P450 77A3-like               154   1e-40   Sesamum indicum [beniseed]
ref|XP_009393330.1|  PREDICTED: cytochrome P450 77A3-like               153   1e-40   Musa acuminata subsp. malaccensis [pisang utan]
gb|KFK31941.1|  hypothetical protein AALP_AA6G179900                    153   2e-40   Arabis alpina [alpine rockcress]
ref|XP_006417335.1|  hypothetical protein EUTSA_v10007399mg             152   5e-40   Eutrema salsugineum [saltwater cress]
ref|XP_009118184.1|  PREDICTED: cytochrome P450 77A3                    150   2e-39   Brassica rapa
emb|CDY34640.1|  BnaC08g41990D                                          149   4e-39   Brassica napus [oilseed rape]
gb|EPS68900.1|  hypothetical protein M569_05868                         146   5e-38   Genlisea aurea
ref|XP_010278187.1|  PREDICTED: cytochrome P450 77A2-like               124   5e-30   Nelumbo nucifera [Indian lotus]
ref|XP_006851629.1|  hypothetical protein AMTR_s00040p00200250          121   3e-29   Amborella trichopoda
gb|EAZ30650.1|  hypothetical protein OsJ_14702                          120   1e-28   Oryza sativa Japonica Group [Japonica rice]
emb|CAE04891.3|  OSJNBa0042I15.13                                       120   1e-28   Oryza sativa Japonica Group [Japonica rice]
emb|CAH66495.1|  H0321H01.4                                             120   1e-28   Oryza sativa [red rice]
gb|EEC77233.1|  hypothetical protein OsI_15783                          117   2e-28   Oryza sativa Indica Group [Indian rice]
ref|XP_009760347.1|  PREDICTED: cytochrome P450 77A2                    119   2e-28   Nicotiana sylvestris
ref|XP_009392677.1|  PREDICTED: cytochrome P450 77A2-like               117   8e-28   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001052719.1|  Os04g0407900                                       116   1e-27   
ref|XP_010110167.1|  Cytochrome P450 77A3                               115   6e-27   Morus notabilis
ref|XP_004239717.1|  PREDICTED: cytochrome P450 77A2                    114   1e-26   
ref|XP_009603326.1|  PREDICTED: cytochrome P450 77A2                    114   2e-26   Nicotiana tomentosiformis
ref|XP_006345856.1|  PREDICTED: cytochrome P450 77A2-like               114   2e-26   
ref|XP_009414952.1|  PREDICTED: cytochrome P450 77A2-like               114   2e-26   Musa acuminata subsp. malaccensis [pisang utan]
gb|AGZ83069.1|  CYP77A19                                                114   2e-26   Solanum tuberosum [potatoes]
gb|AJD25188.1|  cytochrome P450 CYP77A28                                112   6e-26   Salvia miltiorrhiza [Chinese salvia]
ref|XP_008775191.1|  PREDICTED: cytochrome P450 77A2                    112   1e-25   Phoenix dactylifera
ref|XP_010940445.1|  PREDICTED: cytochrome P450 77A2                    112   1e-25   Elaeis guineensis
ref|XP_011101640.1|  PREDICTED: cytochrome P450 77A2-like               111   2e-25   Sesamum indicum [beniseed]
gb|ADJ57933.1|  cytochrome P450                                         111   2e-25   Solanum torvum [berenjena cimarrona]
dbj|BAJ85537.1|  predicted protein                                      109   2e-25   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDO99869.1|  unnamed protein product                                110   3e-25   Coffea canephora [robusta coffee]
ref|XP_010694692.1|  PREDICTED: cytochrome P450 77A2-like               111   3e-25   Beta vulgaris subsp. vulgaris [field beet]
sp|P37123.1|C77A1_SOLME  RecName: Full=Cytochrome P450 77A1; AltN...    110   4e-25   Solanum melongena [aubergine]
ref|XP_002530881.1|  cytochrome P450, putative                          109   5e-25   
ref|XP_009778853.1|  PREDICTED: cytochrome P450 77A1-like               107   5e-25   Nicotiana sylvestris
gb|AFO67234.1|  putative cytochrome P450                                105   7e-25   Aralia elata
gb|KDP45018.1|  hypothetical protein JCGZ_01518                         109   8e-25   Jatropha curcas
gb|AAM66094.1|  cytochrom P450-like protein                             109   8e-25   Arabidopsis thaliana [mouse-ear cress]
ref|NP_196086.1|  cytochrome P450, family 77, subfamily A, polype...    109   8e-25   Arabidopsis thaliana [mouse-ear cress]
gb|EPS63295.1|  hypothetical protein M569_11489                         109   8e-25   Genlisea aurea
sp|P37124.1|C77A2_SOLME  RecName: Full=Cytochrome P450 77A2; AltN...    109   1e-24   Solanum melongena [aubergine]
ref|XP_008345522.1|  PREDICTED: cytochrome P450 77A3-like               109   1e-24   
ref|XP_008446777.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    108   1e-24   
ref|XP_004496181.1|  PREDICTED: cytochrome P450 77A3-like               109   1e-24   Cicer arietinum [garbanzo]
ref|XP_002270736.1|  PREDICTED: cytochrome P450 77A2                    108   1e-24   Vitis vinifera
emb|CAN65790.1|  hypothetical protein VITISV_042049                     108   1e-24   Vitis vinifera
ref|XP_003536307.2|  PREDICTED: cytochrome P450 77A3-like               109   1e-24   Glycine max [soybeans]
ref|XP_009778849.1|  PREDICTED: cytochrome P450 77A1-like isoform X2    108   2e-24   Nicotiana sylvestris
ref|XP_009778848.1|  PREDICTED: cytochrome P450 77A1-like isoform X1    108   2e-24   Nicotiana sylvestris
ref|XP_002871108.1|  CYP77A4                                            108   3e-24   
sp|O48928.1|C77A3_SOYBN  RecName: Full=Cytochrome P450 77A3             108   3e-24   Glycine max [soybeans]
ref|XP_008347045.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    107   4e-24   
gb|EMS60370.1|  Cytochrome P450 77A3                                    105   4e-24   Triticum urartu
ref|XP_006360482.1|  PREDICTED: cytochrome P450 77A1-like               107   5e-24   
ref|XP_008375581.1|  PREDICTED: cytochrome P450 77A3-like               107   6e-24   
ref|NP_001132177.1|  uncharacterized protein LOC100193602               107   6e-24   
ref|XP_003556278.2|  PREDICTED: cytochrome P450 77A3-like               108   6e-24   
ref|XP_010032100.1|  PREDICTED: cytochrome P450 77A3-like isoform X1    107   7e-24   Eucalyptus grandis [rose gum]
gb|AGZ83070.1|  CYP77A20                                                107   7e-24   Solanum tuberosum [potatoes]
ref|XP_009336991.1|  PREDICTED: cytochrome P450 77A3-like               107   8e-24   Pyrus x bretschneideri [bai li]
gb|KGN52206.1|  hypothetical protein Csa_5G615280                       106   1e-23   Cucumis sativus [cucumbers]
ref|XP_006289766.1|  hypothetical protein CARUB_v10003366mg             106   1e-23   
ref|XP_009610308.1|  PREDICTED: cytochrome P450 77A1-like               106   1e-23   Nicotiana tomentosiformis
ref|XP_007010384.1|  Cytochrome P450 77A3                               106   1e-23   
ref|XP_007143825.1|  hypothetical protein PHAVU_007G104800g             106   1e-23   Phaseolus vulgaris [French bean]
tpg|DAA37962.1|  TPA: putative cytochrome P450 superfamily protein      107   2e-23   
ref|XP_008456581.1|  PREDICTED: cytochrome P450 77A3-like               105   2e-23   Cucumis melo [Oriental melon]
gb|ABC59108.1|  cytochrome P450 monooxygenase CYP77A12                  103   2e-23   Medicago truncatula
gb|KJB73379.1|  hypothetical protein B456_011G229800                    105   2e-23   Gossypium raimondii
ref|XP_003581190.2|  PREDICTED: cytochrome P450 77A4-like               105   2e-23   Brachypodium distachyon [annual false brome]
gb|AGT16500.1|  hypothetical protein SHCRBa_022_D13_R_80                105   2e-23   Saccharum hybrid cultivar R570
ref|XP_010486076.1|  PREDICTED: cytochrome P450 77A4-like               105   3e-23   Camelina sativa [gold-of-pleasure]
gb|AGT16905.1|  cytochrome P450                                         105   3e-23   Saccharum hybrid cultivar R570
ref|XP_009778850.1|  PREDICTED: cytochrome P450 77A1-like               105   3e-23   Nicotiana sylvestris
ref|XP_011032810.1|  PREDICTED: cytochrome P450 77A3-like               105   4e-23   Populus euphratica
ref|XP_010464733.1|  PREDICTED: cytochrome P450 77A4-like               105   4e-23   Camelina sativa [gold-of-pleasure]
ref|XP_010486669.1|  PREDICTED: cytochrome P450 77A4                    105   4e-23   Camelina sativa [gold-of-pleasure]
ref|XP_002446399.1|  hypothetical protein SORBIDRAFT_06g015320          105   4e-23   Sorghum bicolor [broomcorn]
gb|KDO46108.1|  hypothetical protein CISIN_1g010526mg                   104   5e-23   Citrus sinensis [apfelsine]
ref|XP_006436671.1|  hypothetical protein CICLE_v10031286mg             104   5e-23   Citrus clementina [clementine]
ref|XP_010312564.1|  PREDICTED: cytochrome P450 77A1                    104   6e-23   
ref|XP_002311965.1|  CYP77A3p family protein                            104   6e-23   Populus trichocarpa [western balsam poplar]
ref|XP_006398921.1|  hypothetical protein EUTSA_v10016078mg             104   7e-23   Eutrema salsugineum [saltwater cress]
ref|XP_004307039.1|  PREDICTED: cytochrome P450 77A3-like               104   7e-23   Fragaria vesca subsp. vesca
ref|XP_008231991.1|  PREDICTED: cytochrome P450 77A3-like               104   8e-23   Prunus mume [ume]
emb|CDX80914.1|  BnaC03g01680D                                          103   8e-23   
gb|KEH43423.1|  cytochrome P450 family 87 protein                       104   8e-23   Medicago truncatula
ref|XP_007219021.1|  hypothetical protein PRUPE_ppa004373mg             103   1e-22   Prunus persica
emb|CDY11297.1|  BnaA03g01330D                                          103   1e-22   Brassica napus [oilseed rape]
ref|XP_010490980.1|  PREDICTED: cytochrome P450 77A4                    103   1e-22   Camelina sativa [gold-of-pleasure]
ref|XP_009609997.1|  PREDICTED: cytochrome P450 77A1-like               103   1e-22   Nicotiana tomentosiformis
ref|XP_009130829.1|  PREDICTED: cytochrome P450 77A4                    103   1e-22   Brassica rapa
ref|XP_006407539.1|  hypothetical protein EUTSA_v10020529mg             103   2e-22   Eutrema salsugineum [saltwater cress]
gb|KJB49031.1|  hypothetical protein B456_008G098700                    102   2e-22   Gossypium raimondii
ref|XP_004173844.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    102   2e-22   
gb|AAO42093.1|  putative cytochrome p450                                102   3e-22   Arabidopsis thaliana [mouse-ear cress]
ref|NP_187668.1|  cytochrome P450, family 77, subfamily A, polype...    102   3e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004140895.1|  PREDICTED: cytochrome P450 77A3-like               102   3e-22   Cucumis sativus [cucumbers]
ref|XP_002882683.1|  CYP77A6                                            102   3e-22   
gb|KFK38447.1|  hypothetical protein AALP_AA3G114600                    103   4e-22   Arabis alpina [alpine rockcress]
ref|XP_009146826.1|  PREDICTED: cytochrome P450 77A4                    102   5e-22   Brassica rapa
emb|CDY08591.1|  BnaA05g28270D                                          102   5e-22   Brassica napus [oilseed rape]
gb|EYU38068.1|  hypothetical protein MIMGU_mgv1a004860mg                101   9e-22   Erythranthe guttata [common monkey flower]
ref|XP_010552931.1|  PREDICTED: cytochrome P450 77A4                    100   2e-21   Tarenaya hassleriana [spider flower]
ref|XP_006297449.1|  hypothetical protein CARUB_v10013470mg             100   2e-21   Capsella rubella
ref|XP_010423551.1|  PREDICTED: cytochrome P450 77A4-like               100   2e-21   Camelina sativa [gold-of-pleasure]
ref|XP_010452364.1|  PREDICTED: cytochrome P450 77A4-like               100   2e-21   Camelina sativa [gold-of-pleasure]
emb|CDY00955.1|  BnaC05g42450D                                          100   2e-21   
gb|AJD25187.1|  cytochrome P450 CYP77A27                              99.4    4e-21   Salvia miltiorrhiza [Chinese salvia]
gb|EPS69622.1|  hypothetical protein M569_05145                       98.6    6e-21   Genlisea aurea
ref|XP_010032101.1|  PREDICTED: cytochrome P450 77A3-like isoform X2  97.8    8e-21   
emb|CAN68641.1|  hypothetical protein VITISV_030808                   92.8    8e-19   Vitis vinifera
ref|NP_196083.1|  cytochrome P450, family 77, subfamily A, polype...  92.0    2e-18   Arabidopsis thaliana [mouse-ear cress]
emb|CDX70209.1|  BnaA10g25580D                                        91.7    2e-18   
ref|XP_010423555.1|  PREDICTED: cytochrome P450 77A4-like             92.0    2e-18   Camelina sativa [gold-of-pleasure]
ref|XP_009122576.1|  PREDICTED: cytochrome P450 77A4                  91.7    2e-18   Brassica rapa
ref|XP_010490979.1|  PREDICTED: cytochrome P450 77A4-like             91.7    2e-18   Camelina sativa [gold-of-pleasure]
ref|NP_187667.1|  cytochrome P450 protein UNE9                        91.3    3e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002882682.1|  CYP77A7                                          91.3    3e-18   
ref|XP_006287416.1|  hypothetical protein CARUB_v10000621mg           91.3    4e-18   
ref|XP_002871106.1|  CYP77A9                                          90.5    5e-18   Arabidopsis lyrata subsp. lyrata
emb|CDY44872.1|  BnaC09g50720D                                        88.6    2e-17   Brassica napus [oilseed rape]
ref|XP_006407540.1|  hypothetical protein EUTSA_v10022031mg           88.6    3e-17   Eutrema salsugineum [saltwater cress]
ref|XP_010266363.1|  PREDICTED: cytochrome P450 89A2-like             86.3    2e-16   Nelumbo nucifera [Indian lotus]
gb|KFK24906.1|  hypothetical protein AALP_AA8G040400                  83.6    1e-15   Arabis alpina [alpine rockcress]
ref|XP_002267628.2|  PREDICTED: cytochrome P450 89A2-like             84.0    1e-15   
ref|XP_009622536.1|  PREDICTED: cytochrome P450 89A2-like             83.2    2e-15   Nicotiana tomentosiformis
ref|XP_004235319.1|  PREDICTED: cytochrome P450 89A2-like             82.8    3e-15   Solanum lycopersicum
ref|XP_004298097.2|  PREDICTED: cytochrome P450 89A2-like             82.0    5e-15   Fragaria vesca subsp. vesca
ref|XP_009782165.1|  PREDICTED: cytochrome P450 89A2-like             81.3    1e-14   Nicotiana sylvestris
ref|XP_006652247.1|  PREDICTED: cytochrome P450 77A4-like             80.5    1e-14   
ref|XP_010276940.1|  PREDICTED: cytochrome P450 89A2-like             80.9    1e-14   Nelumbo nucifera [Indian lotus]
ref|XP_010662058.1|  PREDICTED: cytochrome P450 89A2-like             80.9    1e-14   Vitis vinifera
ref|XP_002266528.2|  PREDICTED: cytochrome P450 89A2-like isoform X2  80.5    2e-14   
ref|XP_009603616.1|  PREDICTED: cytochrome P450 89A2-like             80.5    2e-14   Nicotiana tomentosiformis
ref|XP_002520014.1|  cytochrome P450, putative                        80.1    2e-14   Ricinus communis
gb|KHN37844.1|  Cytochrome P450 77A3                                  79.7    3e-14   Glycine soja [wild soybean]
ref|XP_010934624.1|  PREDICTED: cytochrome P450 89A2-like             79.3    5e-14   
gb|KHN00917.1|  Cytochrome P450 77A3                                  78.6    6e-14   Glycine soja [wild soybean]
ref|XP_006828882.1|  hypothetical protein AMTR_s00001p00181860        78.6    8e-14   Amborella trichopoda
gb|KDP36974.1|  hypothetical protein JCGZ_08566                       78.2    1e-13   Jatropha curcas
gb|KCW58442.1|  hypothetical protein EUGRSUZ_H01119                   77.4    1e-13   Eucalyptus grandis [rose gum]
ref|XP_010042755.1|  PREDICTED: cytochrome P450 89A2-like             78.2    1e-13   
gb|KCW58464.1|  hypothetical protein EUGRSUZ_H011462                  74.7    1e-13   Eucalyptus grandis [rose gum]
ref|XP_010040474.1|  PREDICTED: cytochrome P450 89A2-like             78.2    1e-13   
ref|XP_004295152.1|  PREDICTED: cytochrome P450 89A2-like             77.8    2e-13   Fragaria vesca subsp. vesca
ref|XP_006437390.1|  hypothetical protein CICLE_v10031693mg           77.0    2e-13   
ref|XP_007219004.1|  hypothetical protein PRUPE_ppa004199mg           77.0    3e-13   Prunus persica
gb|AFK73721.1|  cytochrome P450                                       76.6    3e-13   Papaver somniferum
ref|XP_006408299.1|  hypothetical protein EUTSA_v10022173mg           76.6    4e-13   Eutrema salsugineum [saltwater cress]
ref|XP_009382325.1|  PREDICTED: cytochrome P450 89A2-like             76.6    4e-13   
emb|CBI26429.3|  unnamed protein product                              73.9    4e-13   Vitis vinifera
gb|KDO42609.1|  hypothetical protein CISIN_1g008732mg                 76.6    4e-13   Citrus sinensis [apfelsine]
gb|KDP39556.1|  hypothetical protein JCGZ_02576                       76.6    5e-13   Jatropha curcas
ref|XP_006851423.1|  hypothetical protein AMTR_s00040p00085270        76.3    5e-13   Amborella trichopoda
ref|XP_003556196.1|  PREDICTED: cytochrome P450 89A2                  75.9    7e-13   Glycine max [soybeans]
ref|XP_006484709.1|  PREDICTED: cytochrome P450 89A2-like             75.9    8e-13   Citrus sinensis [apfelsine]
ref|XP_008459157.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...  75.5    9e-13   
ref|XP_006437395.1|  hypothetical protein CICLE_v10033803mg           75.9    9e-13   Citrus clementina [clementine]
ref|XP_007208889.1|  hypothetical protein PRUPE_ppa026664mg           75.5    9e-13   Prunus persica
gb|KDO39082.1|  hypothetical protein CISIN_1g037361mg                 75.5    9e-13   Citrus sinensis [apfelsine]
ref|XP_010069933.1|  PREDICTED: cytochrome P450 89A2-like             75.5    1e-12   Eucalyptus grandis [rose gum]
gb|KCW58456.1|  hypothetical protein EUGRSUZ_H01138                   75.1    1e-12   Eucalyptus grandis [rose gum]
ref|XP_006347570.1|  PREDICTED: cytochrome P450 89A2-like             75.1    1e-12   Solanum tuberosum [potatoes]
emb|CDP14026.1|  unnamed protein product                              75.1    2e-12   Coffea canephora [robusta coffee]
gb|EPS60584.1|  hypothetical protein M569_14219                       74.3    2e-12   Genlisea aurea
ref|XP_011085115.1|  PREDICTED: cytochrome P450 89A2-like             75.1    2e-12   Sesamum indicum [beniseed]
gb|KCW58452.1|  hypothetical protein EUGRSUZ_H01131                   74.7    2e-12   Eucalyptus grandis [rose gum]
ref|XP_003556183.1|  PREDICTED: cytochrome P450 89A2-like             74.7    2e-12   Glycine max [soybeans]
ref|XP_010069930.1|  PREDICTED: cytochrome P450 89A2-like             74.7    2e-12   Eucalyptus grandis [rose gum]
ref|XP_010069934.1|  PREDICTED: cytochrome P450 89A2-like             74.3    2e-12   Eucalyptus grandis [rose gum]
ref|XP_010069928.1|  PREDICTED: cytochrome P450 89A2-like             74.3    2e-12   Eucalyptus grandis [rose gum]
gb|KCW44075.1|  hypothetical protein EUGRSUZ_L025191                  74.3    2e-12   Eucalyptus grandis [rose gum]
ref|XP_009609017.1|  PREDICTED: cytochrome P450 89A2-like             74.3    3e-12   Nicotiana tomentosiformis
ref|XP_006437392.1|  hypothetical protein CICLE_v10033851mg           73.9    3e-12   Citrus clementina [clementine]
ref|XP_006484712.1|  PREDICTED: cytochrome P450 89A2-like             73.9    3e-12   Citrus sinensis [apfelsine]
gb|KDO42607.1|  hypothetical protein CISIN_1g010248mg                 73.9    3e-12   Citrus sinensis [apfelsine]
ref|XP_004156750.1|  PREDICTED: cytochrome P450 89A2-like             73.9    3e-12   
ref|XP_010026134.1|  PREDICTED: cytochrome P450 89A2-like             73.6    4e-12   
ref|XP_010087442.1|  Cytochrome P450 89A2                             73.9    4e-12   Morus notabilis
gb|KDP21787.1|  hypothetical protein JCGZ_00574                       73.9    4e-12   Jatropha curcas
ref|XP_002265797.1|  PREDICTED: cytochrome P450 89A2-like             73.6    4e-12   
ref|XP_008797181.1|  PREDICTED: cytochrome P450 89A2-like             73.6    4e-12   Phoenix dactylifera
ref|XP_008459160.1|  PREDICTED: cytochrome P450 89A2-like             73.6    4e-12   Cucumis melo [Oriental melon]
ref|XP_004171686.1|  PREDICTED: cytochrome P450 89A2-like             73.6    4e-12   
gb|KCW58467.1|  hypothetical protein EUGRSUZ_H01148                   73.6    4e-12   Eucalyptus grandis [rose gum]
emb|CAN64477.1|  hypothetical protein VITISV_017161                   73.6    4e-12   Vitis vinifera
ref|XP_007029747.1|  Cytochrome P450, family 87, subfamily A, pol...  73.6    5e-12   
ref|XP_004503696.1|  PREDICTED: cytochrome P450 89A2-like             73.6    5e-12   Cicer arietinum [garbanzo]
ref|XP_010919362.1|  PREDICTED: cytochrome P450 89A2-like             73.2    5e-12   Elaeis guineensis
ref|XP_010069936.1|  PREDICTED: cytochrome P450 89A2-like             73.6    5e-12   Eucalyptus grandis [rose gum]
ref|XP_010934623.1|  PREDICTED: cytochrome P450 89A2-like             73.2    5e-12   Elaeis guineensis
ref|XP_003529422.1|  PREDICTED: cytochrome P450 89A2-like             73.2    5e-12   Glycine max [soybeans]
ref|XP_010558680.1|  PREDICTED: cytochrome P450 89A9                  73.2    5e-12   Tarenaya hassleriana [spider flower]
emb|CBI26427.3|  unnamed protein product                              70.5    6e-12   Vitis vinifera
gb|KFK22926.1|  hypothetical protein AALP_AAs43288U000100             73.6    6e-12   Arabis alpina [alpine rockcress]
ref|XP_006347571.1|  PREDICTED: cytochrome P450 89A2-like             72.8    7e-12   Solanum tuberosum [potatoes]
ref|XP_010276939.1|  PREDICTED: cytochrome P450 89A2-like             72.8    8e-12   Nelumbo nucifera [Indian lotus]
emb|CDX92041.1|  BnaC03g33430D                                        72.8    8e-12   
ref|XP_008800986.1|  PREDICTED: cytochrome P450 89A2-like             72.8    8e-12   Phoenix dactylifera
gb|KDO42606.1|  hypothetical protein CISIN_1g031562mg                 69.7    9e-12   Citrus sinensis [apfelsine]
gb|ACJ85763.1|  unknown                                               70.1    9e-12   Medicago truncatula
emb|CAN77555.1|  hypothetical protein VITISV_039373                   72.8    9e-12   Vitis vinifera
gb|KGN63393.1|  hypothetical protein Csa_2G437040                     72.8    9e-12   Cucumis sativus [cucumbers]
ref|XP_004171687.1|  PREDICTED: cytochrome P450 89A2-like             72.8    9e-12   
gb|KJB18538.1|  hypothetical protein B456_003G058600                  72.4    9e-12   Gossypium raimondii
gb|KDP27354.1|  hypothetical protein JCGZ_20178                       72.4    1e-11   Jatropha curcas
ref|XP_010662054.1|  PREDICTED: cytochrome P450 89A2-like             72.4    1e-11   Vitis vinifera
ref|XP_009134728.1|  PREDICTED: cytochrome P450 89A9                  72.4    1e-11   Brassica rapa
gb|KFK38058.1|  hypothetical protein AALP_AA3G064600                  72.8    1e-11   
ref|XP_010662069.1|  PREDICTED: cytochrome P450 89A2                  72.4    1e-11   
ref|XP_006380441.1|  hypothetical protein POPTR_0007s059452g          69.3    1e-11   
ref|XP_002519889.1|  cytochrome P450, putative                        72.4    1e-11   
ref|XP_010026131.1|  PREDICTED: cytochrome P450 89A2-like             72.4    1e-11   
ref|XP_010069929.1|  PREDICTED: cytochrome P450 89A2-like             72.4    1e-11   
ref|XP_003612570.1|  Cytochrome P450 89A2                             72.4    1e-11   
emb|CDY69752.1|  BnaAnng31420D                                        72.0    1e-11   
ref|XP_011470353.1|  PREDICTED: cytochrome P450 89A2-like isoform X2  72.0    1e-11   
ref|XP_004309203.1|  PREDICTED: cytochrome P450 89A2-like isoform X1  72.0    1e-11   
ref|XP_002266269.2|  PREDICTED: cytochrome P450 89A2-like             72.0    1e-11   
emb|CAN77554.1|  hypothetical protein VITISV_039372                   72.0    1e-11   
ref|XP_003613284.1|  Cytochrome P450                                  72.0    2e-11   
ref|XP_002524034.1|  cytochrome P450, putative                        71.6    2e-11   
gb|KGN63395.1|  hypothetical protein Csa_2G437050                     71.6    2e-11   
ref|XP_004148112.1|  PREDICTED: cytochrome P450 89A2-like             72.0    2e-11   
ref|XP_004309202.2|  PREDICTED: cytochrome P450 89A2-like isoform X2  71.6    2e-11   
ref|XP_003634014.2|  PREDICTED: cytochrome P450 89A2-like isoform X1  71.6    2e-11   
ref|XP_011470351.1|  PREDICTED: cytochrome P450 89A2-like isoform X1  71.6    2e-11   
ref|XP_004308075.2|  PREDICTED: cytochrome P450 89A2-like isoform X3  71.6    2e-11   
ref|XP_011470352.1|  PREDICTED: cytochrome P450 89A2-like isoform X4  71.6    2e-11   
ref|XP_004489872.1|  PREDICTED: cytochrome P450 89A2-like             71.6    2e-11   
ref|XP_010485689.1|  PREDICTED: cytochrome P450 89A9 isoform X2       71.2    2e-11   
ref|XP_008234223.1|  PREDICTED: cytochrome P450 89A2-like             71.6    2e-11   
ref|XP_003556213.1|  PREDICTED: cytochrome P450 89A2-like             71.2    2e-11   
gb|KCW45185.1|  hypothetical protein EUGRSUZ_L01186                   69.3    3e-11   
ref|XP_010485688.1|  PREDICTED: cytochrome P450 89A9 isoform X1       71.2    3e-11   
ref|XP_008374071.1|  PREDICTED: cytochrome P450 89A2-like             71.2    3e-11   
ref|XP_002884382.1|  CYP89A9                                          71.2    3e-11   
ref|XP_006298969.1|  hypothetical protein CARUB_v10015095mg           71.2    3e-11   
ref|XP_010463797.1|  PREDICTED: cytochrome P450 89A9-like             70.9    3e-11   
ref|XP_010662052.1|  PREDICTED: cytochrome P450 89A2                  70.9    3e-11   
emb|CAN69345.1|  hypothetical protein VITISV_006018                   70.9    3e-11   
ref|XP_007219018.1|  hypothetical protein PRUPE_ppa004356mg           70.9    3e-11   
ref|XP_004512444.1|  PREDICTED: cytochrome P450 89A2-like             70.9    4e-11   
ref|XP_008379819.1|  PREDICTED: cytochrome P450 89A2-like             70.9    4e-11   
ref|XP_010247935.1|  PREDICTED: cytochrome P450 89A2-like             70.5    4e-11   
ref|XP_009385971.1|  PREDICTED: cytochrome P450 89A2-like             70.9    4e-11   
dbj|BAB89608.1|  putative cytochrome P450                             70.5    4e-11   
ref|XP_009407856.1|  PREDICTED: cytochrome P450 89A2-like             70.5    5e-11   
gb|EAY73941.1|  hypothetical protein OsI_01826                        70.5    5e-11   
gb|KDO42608.1|  hypothetical protein CISIN_1g047776mg                 70.5    5e-11   
ref|XP_006484713.1|  PREDICTED: cytochrome P450 89A2-like             70.5    5e-11   
ref|XP_004148097.1|  PREDICTED: cytochrome P450 89A2-like             70.5    5e-11   
ref|XP_006361087.1|  PREDICTED: cytochrome P450 89A2-like             70.5    6e-11   
ref|XP_004241332.1|  PREDICTED: cytochrome P450 89A2-like             70.1    6e-11   
ref|XP_009340064.1|  PREDICTED: cytochrome P450 89A2-like             70.1    6e-11   
ref|XP_010511136.1|  PREDICTED: cytochrome P450 89A9-like             70.1    7e-11   
ref|XP_010528673.1|  PREDICTED: cytochrome P450 89A2-like             69.3    7e-11   
gb|KCW58462.1|  hypothetical protein EUGRSUZ_H011452                  67.4    7e-11   
ref|XP_011005628.1|  PREDICTED: cytochrome P450 89A2-like             69.7    8e-11   
ref|XP_006380437.1|  hypothetical protein POPTR_0007s05920g           69.7    8e-11   
ref|XP_006484710.1|  PREDICTED: cytochrome P450 89A2-like             69.7    8e-11   
ref|XP_006437393.1|  hypothetical protein CICLE_v10031272mg           69.7    9e-11   
ref|XP_010069932.1|  PREDICTED: cytochrome P450 89A2-like             69.7    1e-10   
gb|AFK40361.1|  unknown                                               68.9    1e-10   
ref|XP_011028246.1|  PREDICTED: cytochrome P450 89A2-like             69.3    1e-10   
ref|XP_002303473.2|  hypothetical protein POPTR_0003s10370g           69.3    1e-10   
ref|XP_006437391.1|  hypothetical protein CICLE_v10031236mg           69.3    1e-10   
ref|XP_004148096.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...  69.3    1e-10   
ref|XP_011005627.1|  PREDICTED: cytochrome P450 89A2-like             69.3    1e-10   
gb|KJB46082.1|  hypothetical protein B456_007G347800                  69.3    1e-10   
ref|XP_009411124.1|  PREDICTED: cytochrome P450 89A2-like             69.3    1e-10   
gb|KDP39557.1|  hypothetical protein JCGZ_02577                       69.3    1e-10   
ref|XP_010026125.1|  PREDICTED: cytochrome P450 89A2-like             68.9    1e-10   
ref|XP_002524041.1|  cytochrome P450, putative                        69.3    1e-10   
ref|XP_011005629.1|  PREDICTED: cytochrome P450 89A2-like             69.3    1e-10   
ref|XP_002524042.1|  cytochrome P450, putative                        69.3    1e-10   
ref|XP_008379877.1|  PREDICTED: cytochrome P450 89A2-like             69.3    1e-10   
gb|KJB80554.1|  hypothetical protein B456_013G103400                  68.9    1e-10   
ref|XP_008459270.1|  PREDICTED: cytochrome P450 89A2-like             68.9    2e-10   
gb|ABC59091.1|  cytochrome P450 monooxygenase CYP89A28                68.9    2e-10   
ref|XP_003593326.1|  Cytochrome P450 89A2                             68.9    2e-10   
ref|XP_008374073.1|  PREDICTED: cytochrome P450 89A2-like             68.9    2e-10   
ref|XP_003529424.1|  PREDICTED: cytochrome P450 89A2-like             68.9    2e-10   
ref|XP_004171811.1|  PREDICTED: cytochrome P450 89A9-like             68.6    2e-10   
ref|XP_006388469.1|  hypothetical protein POPTR_0177s00210g           68.6    2e-10   
ref|XP_007029748.1|  Cytochrome P450, family 87, subfamily A, pol...  68.6    2e-10   
ref|XP_003593330.1|  Cytochrome P450 89A2                             68.6    2e-10   
ref|XP_010525140.1|  PREDICTED: cytochrome P450 89A2-like             68.6    2e-10   
ref|XP_007218984.1|  hypothetical protein PRUPE_ppa003980mg           68.6    2e-10   
ref|XP_006365724.1|  PREDICTED: cytochrome P450 89A9-like             68.2    2e-10   
ref|XP_004148113.1|  PREDICTED: cytochrome P450 89A2-like             66.6    3e-10   
gb|KHN42996.1|  Cytochrome P450 89A9                                  68.2    3e-10   
ref|XP_003529423.1|  PREDICTED: cytochrome P450 89A2-like             68.2    3e-10   
ref|XP_004236761.1|  PREDICTED: cytochrome P450 89A9-like             68.2    3e-10   
ref|XP_008797231.1|  PREDICTED: cytochrome P450 89A2-like             68.2    3e-10   
ref|XP_003593333.1|  Cytochrome P450 monooxygenase CYP89A28           68.2    3e-10   
ref|XP_004156751.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...  68.2    3e-10   
ref|XP_003593337.1|  Cytochrome P450 monooxygenase CYP89A28           68.2    3e-10   
gb|AJD25210.1|  cytochrome P450 CYP89A115                             67.8    3e-10   
ref|NP_186997.1|  cytochrome P450, family 87, subfamily A, polype...  67.8    4e-10   
ref|XP_004148095.1|  PREDICTED: cytochrome P450 89A2-like             67.8    4e-10   
gb|AAL11575.1|AF424581_1  AT3g03470/T21P5_11                          67.8    4e-10   
gb|KCW58461.1|  hypothetical protein EUGRSUZ_H01144                   67.8    4e-10   
ref|XP_010941433.1|  PREDICTED: cytochrome P450 89A2-like             67.8    4e-10   
ref|XP_008459156.1|  PREDICTED: cytochrome P450 89A2-like             67.8    4e-10   
ref|XP_010528671.1|  PREDICTED: cytochrome P450 89A2-like             67.4    5e-10   
gb|KDO39081.1|  hypothetical protein CISIN_1g0404891mg                66.6    5e-10   
ref|XP_004169992.1|  PREDICTED: cytochrome P450 89A2-like             67.4    5e-10   
ref|XP_009342956.1|  PREDICTED: cytochrome P450 89A2-like             67.4    6e-10   
ref|XP_010026126.1|  PREDICTED: cytochrome P450 89A2-like             67.4    6e-10   
ref|XP_002524040.1|  cytochrome P450, putative                        67.4    6e-10   
ref|XP_004485639.1|  PREDICTED: cytochrome P450 89A2-like             67.0    6e-10   
ref|XP_007029750.1|  Cytochrome P450, family 87, subfamily A, pol...  67.0    6e-10   
ref|XP_002268331.1|  PREDICTED: cytochrome P450 89A2                  67.0    7e-10   
ref|XP_010680105.1|  PREDICTED: cytochrome P450 89A2-like             67.0    7e-10   
ref|XP_007029515.1|  Cytochrome P450, family 87, subfamily A, pol...  67.0    7e-10   
ref|XP_006380439.1|  hypothetical protein POPTR_0007s059402g          66.6    7e-10   
ref|XP_006388471.1|  hypothetical protein POPTR_0177s002202g          64.3    7e-10   
gb|KCW58445.1|  hypothetical protein EUGRSUZ_H01123                   67.0    8e-10   
emb|CAN75215.1|  hypothetical protein VITISV_003516                   67.4    8e-10   
ref|XP_004235317.1|  PREDICTED: cytochrome P450 89A2-like             67.0    8e-10   
ref|XP_011007445.1|  PREDICTED: cytochrome P450 89A2-like             67.0    8e-10   
ref|XP_006484711.1|  PREDICTED: cytochrome P450 89A2-like             66.6    8e-10   
ref|XP_006437394.1|  hypothetical protein CICLE_v10031268mg           66.6    8e-10   
ref|XP_010553818.1|  PREDICTED: cytochrome P450 89A2-like             66.6    9e-10   
ref|XP_010941434.1|  PREDICTED: cytochrome P450 89A2-like             66.6    9e-10   
ref|XP_002309993.2|  hypothetical protein POPTR_0007s05960g           66.6    9e-10   
ref|XP_010026133.1|  PREDICTED: cytochrome P450 89A2-like             66.2    1e-09   
ref|XP_009340042.1|  PREDICTED: cytochrome P450 89A2-like             66.2    1e-09   
gb|KCW44073.1|  hypothetical protein EUGRSUZ_L02518                   66.2    1e-09   
gb|AAZ52550.1|  cytochrome P450                                       66.2    1e-09   
ref|XP_006430999.1|  hypothetical protein CICLE_v10011479mg           66.2    1e-09   
ref|XP_010026135.1|  PREDICTED: cytochrome P450 89A2-like             66.2    1e-09   
gb|KDO72347.1|  hypothetical protein CISIN_1g038386mg                 66.2    1e-09   
ref|XP_004963408.1|  PREDICTED: cytochrome P450 89A2-like             66.2    1e-09   
ref|XP_008644885.1|  PREDICTED: cytochrome P450 89A2-like             65.9    2e-09   
ref|XP_003579360.1|  PREDICTED: cytochrome P450 89A2-like             65.9    2e-09   
ref|XP_002319774.2|  Cytochrome P450 89A2 family protein              65.9    2e-09   
ref|XP_002978564.1|  hypothetical protein SELMODRAFT_108700           65.9    2e-09   
ref|XP_010934621.1|  PREDICTED: cytochrome P450 89A2-like             65.9    2e-09   
dbj|BAJ90040.1|  predicted protein                                    65.9    2e-09   
ref|XP_002466942.1|  hypothetical protein SORBIDRAFT_01g017160        65.9    2e-09   
ref|XP_007029752.1|  Cytochrome P450 89A2                             65.9    2e-09   
ref|XP_007131475.1|  hypothetical protein PHAVU_011G016700g           65.5    2e-09   
gb|KCW45182.1|  hypothetical protein EUGRSUZ_L011821                  63.2    3e-09   
dbj|BAJ95348.1|  predicted protein                                    65.5    3e-09   
ref|XP_006361088.1|  PREDICTED: cytochrome P450 89A2-like             65.1    3e-09   
dbj|BAD27939.1|  putative cytochrome P450                             65.1    3e-09   
dbj|BAJ85066.1|  predicted protein                                    65.1    3e-09   
ref|XP_010069931.1|  PREDICTED: cytochrome P450 89A2-like             65.1    3e-09   
ref|XP_002524036.1|  cytochrome P450, putative                        65.1    3e-09   
ref|XP_010069927.1|  PREDICTED: cytochrome P450 89A2-like             64.7    4e-09   
ref|XP_003593328.1|  Cytochrome P450 89A2                             64.7    4e-09   
ref|XP_004166175.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...  64.7    4e-09   
ref|XP_002466416.1|  hypothetical protein SORBIDRAFT_01g007420        64.7    4e-09   
ref|XP_002970486.1|  hypothetical protein SELMODRAFT_22493            64.3    5e-09   
gb|KGN49900.1|  hypothetical protein Csa_5G139780                     64.7    5e-09   
ref|XP_004145912.1|  PREDICTED: cytochrome P450 89A2-like             64.7    5e-09   
ref|XP_010672161.1|  PREDICTED: cytochrome P450 89A2-like             64.3    5e-09   
ref|NP_001064139.1|  Os10g0139700                                     64.3    5e-09   
gb|EEC66552.1|  hypothetical protein OsI_32710                        64.3    5e-09   
tpg|DAA51513.1|  TPA: putative cytochrome P450 superfamily protein    64.3    6e-09   
ref|XP_010026130.1|  PREDICTED: cytochrome P450 89A2-like             64.3    6e-09   
ref|XP_008665450.1|  PREDICTED: isoflavone 2'-hydroxylase-like        64.3    6e-09   
dbj|BAJ91738.1|  predicted protein                                    64.3    6e-09   
dbj|BAK07729.1|  predicted protein                                    64.3    6e-09   
ref|XP_002300106.2|  hypothetical protein POPTR_0001s33810g           63.9    6e-09   
ref|XP_007029749.1|  Cytochrome P450, family 87, subfamily A, pol...  64.3    7e-09   
ref|XP_011015670.1|  PREDICTED: cytochrome P450 89A2-like             63.9    7e-09   
gb|AAG13498.1|AC068924_3  putative cytochrome P450                    63.9    8e-09   
ref|XP_010934620.1|  PREDICTED: cytochrome P450 89A2-like             63.9    8e-09   
ref|XP_010680926.1|  PREDICTED: cytochrome P450 89A2-like             63.5    9e-09   
gb|KFK33249.1|  hypothetical protein AALP_AA6G350100                  63.5    9e-09   
gb|KJB26702.1|  hypothetical protein B456_004G255300                  63.5    9e-09   
gb|EAZ15260.1|  hypothetical protein OsJ_30679                        63.5    1e-08   
gb|KFK23793.1|  hypothetical protein AALP_AAs64732U000200             63.5    1e-08   
ref|XP_006662172.1|  PREDICTED: cytochrome P450 89A2-like             63.5    1e-08   
gb|AAP54612.2|  transposon protein, putative, unclassified            63.5    1e-08   
ref|XP_008379868.1|  PREDICTED: cytochrome P450 89A2-like             63.2    1e-08   
ref|XP_002447302.1|  hypothetical protein SORBIDRAFT_06g032390        63.5    1e-08   
ref|XP_009622945.1|  PREDICTED: isoflavone 2'-hydroxylase-like        63.2    1e-08   
ref|XP_004986722.1|  PREDICTED: cytochrome P450 89A2-like             63.2    1e-08   
ref|XP_009340043.1|  PREDICTED: cytochrome P450 89A2-like             63.2    1e-08   
emb|CDY52965.1|  BnaCnng23930D                                        63.2    1e-08   
gb|KEH21087.1|  cytochrome P450 family protein                        63.2    1e-08   
ref|XP_003577002.1|  PREDICTED: cytochrome P450 89A2-like             63.2    1e-08   
ref|XP_007157767.1|  hypothetical protein PHAVU_002G097000g           63.2    1e-08   
gb|EMS66240.1|  Cytochrome P450 89A2                                  62.4    1e-08   
ref|XP_009128469.1|  PREDICTED: cytochrome P450 89A2-like             62.8    2e-08   
ref|XP_008374072.1|  PREDICTED: cytochrome P450 89A2-like             63.2    2e-08   
dbj|BAK06941.1|  predicted protein                                    62.8    2e-08   
ref|XP_010941086.1|  PREDICTED: cytochrome P450 89A2-like             62.8    2e-08   
emb|CDY56131.1|  BnaA02g20200D                                        62.8    2e-08   
ref|XP_006302157.1|  hypothetical protein CARUB_v10020166mg           62.8    2e-08   
ref|XP_010040475.1|  PREDICTED: cytochrome P450 89A2-like             62.8    2e-08   
ref|XP_002464772.1|  hypothetical protein SORBIDRAFT_01g026530        62.8    2e-08   
ref|XP_004151744.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...  62.8    2e-08   
ref|NP_176673.1|  cytochrome P450, family 87, subfamily A, polype...  62.4    2e-08   
gb|AAY78666.1|  putative cytochrome P450                              62.4    2e-08   
emb|CCP37680.1|  cytochrome P450                                      62.4    2e-08   
gb|EMT33820.1|  Cytochrome P450 89A2                                  59.7    2e-08   
ref|XP_004300130.1|  PREDICTED: cytochrome P450 89A2-like             62.4    2e-08   
emb|CBI26430.3|  unnamed protein product                              60.8    2e-08   
ref|XP_011019051.1|  PREDICTED: cytochrome P450 89A2-like             62.4    3e-08   
ref|XP_008797233.1|  PREDICTED: cytochrome P450 89A2-like             62.4    3e-08   
ref|XP_011070808.1|  PREDICTED: cytochrome P450 76C2-like             62.0    3e-08   
emb|CDP21186.1|  unnamed protein product                              60.1    3e-08   
ref|NP_178922.1|  putative cytochrome P450                            62.0    3e-08   
emb|CBI26442.3|  unnamed protein product                              61.2    3e-08   
ref|XP_008459941.1|  PREDICTED: cytochrome P450 89A2-like             62.0    3e-08   
ref|XP_009340041.1|  PREDICTED: cytochrome P450 89A2-like             62.0    3e-08   
ref|XP_010442231.1|  PREDICTED: cytochrome P450 89A2-like             62.0    3e-08   
ref|XP_003574176.1|  PREDICTED: cytochrome P450 89A2-like             62.0    3e-08   
ref|XP_010482059.1|  PREDICTED: cytochrome P450 89A2-like             62.0    3e-08   
ref|XP_004140568.1|  PREDICTED: cytochrome P450 89A9-like             62.0    4e-08   
gb|KFK33248.1|  hypothetical protein AALP_AA6G350000                  61.6    4e-08   
ref|XP_004982616.1|  PREDICTED: cytochrome P450 89A2-like             61.6    4e-08   
ref|XP_004157623.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...  61.6    4e-08   
dbj|BAJ94552.1|  predicted protein                                    61.6    4e-08   
dbj|BAK06687.1|  predicted protein                                    61.6    4e-08   
ref|XP_004984273.1|  PREDICTED: cytochrome P450 89A2-like             61.6    4e-08   
gb|EAZ16679.1|  hypothetical protein OsJ_32154                        61.6    4e-08   
ref|XP_003593332.1|  Cytochrome P450 monooxygenase CYP89A28           61.6    5e-08   
ref|XP_004984420.1|  PREDICTED: cytochrome P450 89A2-like             61.2    5e-08   
ref|XP_002311360.2|  hypothetical protein POPTR_0008s09850g           61.2    5e-08   
ref|XP_010276945.1|  PREDICTED: cytochrome P450 89A2-like             61.2    5e-08   
ref|XP_010229551.1|  PREDICTED: isoflavone 3'-hydroxylase-like        61.2    5e-08   
gb|EMT05658.1|  Isoflavone 2'-hydroxylase                             60.8    5e-08   
ref|XP_006419167.1|  hypothetical protein EUTSA_v10002491mg           61.2    5e-08   



>ref|XP_009803416.1| PREDICTED: cytochrome P450 77A3 [Nicotiana sylvestris]
Length=510

 Score =   201 bits (512),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 115/136 (85%), Positives = 125/136 (92%), Gaps = 0/136 (0%)
 Frame = +2

Query  101  MELMDAAILLLATVFLCLWXRYWSVTgggpxnlppgppgwplvgnlFQVVLQRRPFIYVV  280
            ME+MD   L LA +FLC+W +YWSVTGGG  NLPPGPPGWPLVGNLFQV+LQRRPFI++V
Sbjct  1    MEVMDIVTLGLAILFLCVWWKYWSVTGGGKKNLPPGPPGWPLVGNLFQVILQRRPFIFIV  60

Query  281  RDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPADSPIRLIFSVGKCAI  460
            RDLR KYGPIFTMQMGQRTLVI+TSSELIHEALVQ GP+FA+RPADSPIRLIFSVGKCAI
Sbjct  61   RDLRKKYGPIFTMQMGQRTLVIITSSELIHEALVQNGPLFASRPADSPIRLIFSVGKCAI  120

Query  461  NSAEYGPLWRALLRNF  508
            NSAEYGPLWRAL RNF
Sbjct  121  NSAEYGPLWRALRRNF  136



>ref|XP_009612631.1| PREDICTED: cytochrome P450 77A1 [Nicotiana tomentosiformis]
Length=510

 Score =   196 bits (499),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 114/136 (84%), Positives = 124/136 (91%), Gaps = 0/136 (0%)
 Frame = +2

Query  101  MELMDAAILLLATVFLCLWXRYWSVTgggpxnlppgppgwplvgnlFQVVLQRRPFIYVV  280
            ME+MD   L LA +FL +W +YWSVTGGG  NLPPGPPGWPLVGNLFQV+LQRRPFI++V
Sbjct  1    MEVMDIVTLGLAILFLFVWWKYWSVTGGGKKNLPPGPPGWPLVGNLFQVILQRRPFIFIV  60

Query  281  RDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPADSPIRLIFSVGKCAI  460
            RDLR KYGPIFTMQMGQRTLVI+TSSELIHEALVQ GP+FA+RPADSPIRLIFSVGKCAI
Sbjct  61   RDLRKKYGPIFTMQMGQRTLVIITSSELIHEALVQNGPLFASRPADSPIRLIFSVGKCAI  120

Query  461  NSAEYGPLWRALLRNF  508
            NSAEYGPLWRAL RNF
Sbjct  121  NSAEYGPLWRALRRNF  136



>ref|XP_006348097.1| PREDICTED: cytochrome P450 77A3-like [Solanum tuberosum]
Length=508

 Score =   194 bits (493),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 113/136 (83%), Positives = 123/136 (90%), Gaps = 0/136 (0%)
 Frame = +2

Query  101  MELMDAAILLLATVFLCLWXRYWSVTgggpxnlppgppgwplvgnlFQVVLQRRPFIYVV  280
            ME+MD  +L LA +F  +W +YWS+TGGG  NLPPGPPGWPLVGNLFQV+LQRRPFIYVV
Sbjct  1    MEVMDILLLGLAILFYFVWWKYWSITGGGKKNLPPGPPGWPLVGNLFQVILQRRPFIYVV  60

Query  281  RDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPADSPIRLIFSVGKCAI  460
            RDLR KYGPIFTMQMGQRTLVI+TSSELIHEALVQ GP+FA+RP DSPIRLIFSVGKCAI
Sbjct  61   RDLRKKYGPIFTMQMGQRTLVIITSSELIHEALVQNGPLFASRPPDSPIRLIFSVGKCAI  120

Query  461  NSAEYGPLWRALLRNF  508
            NSAEYGPLWRAL RNF
Sbjct  121  NSAEYGPLWRALRRNF  136



>ref|XP_011086180.1| PREDICTED: cytochrome P450 77A3-like [Sesamum indicum]
Length=511

 Score =   191 bits (485),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 113/136 (83%), Positives = 123/136 (90%), Gaps = 0/136 (0%)
 Frame = +2

Query  101  MELMDAAILLLATVFLCLWXRYWSVTgggpxnlppgppgwplvgnlFQVVLQRRPFIYVV  280
            MEL+D  +L++A VFL LW RYWS TGGG  NLPPGPPGWPLVGNLFQV+LQRR FIYVV
Sbjct  1    MELLDILLLVVAAVFLRLWWRYWSATGGGSRNLPPGPPGWPLVGNLFQVILQRRHFIYVV  60

Query  281  RDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPADSPIRLIFSVGKCAI  460
            RDLR KYGPIFTMQMGQRTLVI+TSSELIHEALVQ+G +FA+RP DSPIRLIFSVGKCAI
Sbjct  61   RDLRAKYGPIFTMQMGQRTLVIITSSELIHEALVQKGALFASRPPDSPIRLIFSVGKCAI  120

Query  461  NSAEYGPLWRALLRNF  508
            NSAEYGPLWR+L RNF
Sbjct  121  NSAEYGPLWRSLRRNF  136



>gb|KDP20776.1| hypothetical protein JCGZ_21247 [Jatropha curcas]
Length=506

 Score =   189 bits (480),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 111/136 (82%), Positives = 122/136 (90%), Gaps = 0/136 (0%)
 Frame = +2

Query  101  MELMDAAILLLATVFLCLWXRYWSVTgggpxnlppgppgwplvgnlFQVVLQRRPFIYVV  280
            M+++D  IL  A +FL LW RYWS+TGGG  NLPPGPPGWPLVGNLFQV+LQRRPFI++V
Sbjct  1    MDIIDLLILCSALIFLRLWWRYWSITGGGAINLPPGPPGWPLVGNLFQVILQRRPFIFIV  60

Query  281  RDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPADSPIRLIFSVGKCAI  460
            RDLR KYGPIFTMQMGQRTLVIVTSSELIHEALVQ+G  FA+RPADSPIRL+FSVGKCAI
Sbjct  61   RDLREKYGPIFTMQMGQRTLVIVTSSELIHEALVQRGSTFASRPADSPIRLVFSVGKCAI  120

Query  461  NSAEYGPLWRALLRNF  508
            NSAEYGPLWR L RNF
Sbjct  121  NSAEYGPLWRTLRRNF  136



>ref|XP_002305592.1| cytochrome P450 family protein [Populus trichocarpa]
 gb|EEE86103.1| cytochrome P450 family protein [Populus trichocarpa]
Length=505

 Score =   187 bits (476),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 111/136 (82%), Positives = 125/136 (92%), Gaps = 0/136 (0%)
 Frame = +2

Query  101  MELMDAAILLLATVFLCLWXRYWSVTgggpxnlppgppgwplvgnlFQVVLQRRPFIYVV  280
            M+L+D  IL +A +F  LW R+WSVTGGGP NLPPGPPGWP+VGNLFQ++LQRRPFIYVV
Sbjct  1    MDLIDLLILCIALMFARLWWRHWSVTGGGPRNLPPGPPGWPIVGNLFQIILQRRPFIYVV  60

Query  281  RDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPADSPIRLIFSVGKCAI  460
            RDLR KYGPIFT+QMGQRTLVIVTSSELIHEALVQ+GP FA+RPADSPIRL+FSVGKCAI
Sbjct  61   RDLRAKYGPIFTLQMGQRTLVIVTSSELIHEALVQRGPTFASRPADSPIRLVFSVGKCAI  120

Query  461  NSAEYGPLWRALLRNF  508
            NSAEYGPLWR+L +NF
Sbjct  121  NSAEYGPLWRSLRKNF  136



>ref|XP_010316601.1| PREDICTED: cytochrome P450 77A1 [Solanum lycopersicum]
Length=508

 Score =   187 bits (475),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 114/136 (84%), Positives = 124/136 (91%), Gaps = 0/136 (0%)
 Frame = +2

Query  101  MELMDAAILLLATVFLCLWXRYWSVTgggpxnlppgppgwplvgnlFQVVLQRRPFIYVV  280
            ME+MD  +L LA +FL +W +YWS+TGGG  NLPPGPPGWPLVGNLFQV+LQRRPFIYVV
Sbjct  1    MEVMDILLLGLAILFLFIWWKYWSITGGGKKNLPPGPPGWPLVGNLFQVILQRRPFIYVV  60

Query  281  RDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPADSPIRLIFSVGKCAI  460
            RDLR KYGPIFTMQMGQRTLVI+TSSELIHEALVQ GP+FA+RP DSPIRLIFSVGKCAI
Sbjct  61   RDLRKKYGPIFTMQMGQRTLVIITSSELIHEALVQNGPLFASRPPDSPIRLIFSVGKCAI  120

Query  461  NSAEYGPLWRALLRNF  508
            NSAEYGPLWRAL RNF
Sbjct  121  NSAEYGPLWRALRRNF  136



>gb|EYU33905.1| hypothetical protein MIMGU_mgv1a004759mg [Erythranthe guttata]
Length=511

 Score =   187 bits (475),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 110/136 (81%), Positives = 122/136 (90%), Gaps = 0/136 (0%)
 Frame = +2

Query  101  MELMDAAILLLATVFLCLWXRYWSVTgggpxnlppgppgwplvgnlFQVVLQRRPFIYVV  280
            MEL+D  +L LA  FL +W R+ S TGGG  NLPPGPPGWP+VGNLFQV+LQRRPFI+VV
Sbjct  1    MELIDIVVLCLAAFFLRMWWRHCSTTGGGSKNLPPGPPGWPVVGNLFQVILQRRPFIFVV  60

Query  281  RDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPADSPIRLIFSVGKCAI  460
            RDLR KYGPIFTMQMGQRTLVI+TSSELIHEALVQ+G +FA+RPADSPIRLIFSVGKCAI
Sbjct  61   RDLREKYGPIFTMQMGQRTLVIITSSELIHEALVQKGALFASRPADSPIRLIFSVGKCAI  120

Query  461  NSAEYGPLWRALLRNF  508
            NSAEYGPLWR+L RNF
Sbjct  121  NSAEYGPLWRSLRRNF  136



>ref|XP_002518512.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF43899.1| cytochrome P450, putative [Ricinus communis]
Length=505

 Score =   184 bits (467),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 110/136 (81%), Positives = 119/136 (88%), Gaps = 0/136 (0%)
 Frame = +2

Query  101  MELMDAAILLLATVFLCLWXRYWSVTgggpxnlppgppgwplvgnlFQVVLQRRPFIYVV  280
            M+ +D  I     +FL +W RYWSVTGGGP NLPPGPPGWPLVGNLFQV+LQRRPFIY+V
Sbjct  1    MDWIDFLIFCSTLIFLPIWWRYWSVTGGGPKNLPPGPPGWPLVGNLFQVILQRRPFIYIV  60

Query  281  RDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPADSPIRLIFSVGKCAI  460
            RDLR KYGPIFTMQMGQRTLVIVTSS LIHEALVQ+GP FA+RP DSPIRL+FSVGKCAI
Sbjct  61   RDLRAKYGPIFTMQMGQRTLVIVTSSGLIHEALVQRGPTFASRPPDSPIRLVFSVGKCAI  120

Query  461  NSAEYGPLWRALLRNF  508
            NSAEYGPLWR L RNF
Sbjct  121  NSAEYGPLWRTLRRNF  136



>ref|XP_011037689.1| PREDICTED: cytochrome P450 77A4-like [Populus euphratica]
Length=505

 Score =   184 bits (466),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 107/136 (79%), Positives = 122/136 (90%), Gaps = 0/136 (0%)
 Frame = +2

Query  101  MELMDAAILLLATVFLCLWXRYWSVTgggpxnlppgppgwplvgnlFQVVLQRRPFIYVV  280
            M+L+D   L +A +   LW R+WSVTG GP NLPPGPPGWP+VGNLFQ++LQRRPFIY+V
Sbjct  1    MDLIDLLSLCIALILARLWWRHWSVTGSGPRNLPPGPPGWPIVGNLFQIILQRRPFIYIV  60

Query  281  RDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPADSPIRLIFSVGKCAI  460
            RDLR KYGPIFT+QMGQRTLVIVTSSELIHEALVQ+GP FA+RPADSPIRL+FSVGKCAI
Sbjct  61   RDLRAKYGPIFTLQMGQRTLVIVTSSELIHEALVQRGPTFASRPADSPIRLVFSVGKCAI  120

Query  461  NSAEYGPLWRALLRNF  508
            NSAEYGPLWR+L +NF
Sbjct  121  NSAEYGPLWRSLRKNF  136



>ref|XP_007204450.1| hypothetical protein PRUPE_ppa026370mg [Prunus persica]
 gb|EMJ05649.1| hypothetical protein PRUPE_ppa026370mg [Prunus persica]
Length=516

 Score =   182 bits (463),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 107/134 (80%), Positives = 118/134 (88%), Gaps = 0/134 (0%)
 Frame = +2

Query  107  LMDAAILLLATVFLCLWXRYWSVTgggpxnlppgppgwplvgnlFQVVLQRRPFIYVVRD  286
            +MD   L L  VFL LW RYWSVTGGG  NLPPGPPGWP+VGNL QV+LQRRPFI+VVRD
Sbjct  4    IMDLLFLCLGLVFLRLWWRYWSVTGGGRRNLPPGPPGWPVVGNLIQVILQRRPFIFVVRD  63

Query  287  LRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPADSPIRLIFSVGKCAINS  466
            LR KYGPIF+MQMGQRTL+IVTSS+LIHE LVQ+GP FA+RPADSPIRL+FSVGKCAINS
Sbjct  64   LRAKYGPIFSMQMGQRTLIIVTSSDLIHEGLVQRGPEFASRPADSPIRLLFSVGKCAINS  123

Query  467  AEYGPLWRALLRNF  508
            AEYGP+WR L RNF
Sbjct  124  AEYGPVWRTLRRNF  137



>ref|XP_009363721.1| PREDICTED: cytochrome P450 77A1-like [Pyrus x bretschneideri]
Length=537

 Score =   182 bits (461),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 107/134 (80%), Positives = 117/134 (87%), Gaps = 0/134 (0%)
 Frame = +2

Query  107  LMDAAILLLATVFLCLWXRYWSVTgggpxnlppgppgwplvgnlFQVVLQRRPFIYVVRD  286
            +MD  ++ L  VF  LW RYWSVTG G  NLPPGPPGWP+VGNL QV+LQRR FIYVVRD
Sbjct  5    MMDVVLVCLGLVFFRLWWRYWSVTGDGRKNLPPGPPGWPIVGNLIQVILQRRHFIYVVRD  64

Query  287  LRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPADSPIRLIFSVGKCAINS  466
            LR KYGPIFTMQMGQRTL+IVTSS+LIHEALVQ+GP FA+RPADSPIRL+FSVGKCAINS
Sbjct  65   LRPKYGPIFTMQMGQRTLIIVTSSDLIHEALVQRGPEFASRPADSPIRLLFSVGKCAINS  124

Query  467  AEYGPLWRALLRNF  508
            AEYGPLWR L RNF
Sbjct  125  AEYGPLWRTLRRNF  138



>ref|XP_006468005.1| PREDICTED: cytochrome P450 77A3-like [Citrus sinensis]
Length=508

 Score =   180 bits (457),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 107/136 (79%), Positives = 120/136 (88%), Gaps = 0/136 (0%)
 Frame = +2

Query  101  MELMDAAILLLATVFLCLWXRYWSVTgggpxnlppgppgwplvgnlFQVVLQRRPFIYVV  280
            M+L+D  IL+   +FLCLW RY S TGGGP NLPPGP GWPLVGNL QV+LQRR FI++V
Sbjct  1    MDLIDLVILISGLIFLCLWWRYSSTTGGGPKNLPPGPRGWPLVGNLVQVILQRRHFIFIV  60

Query  281  RDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPADSPIRLIFSVGKCAI  460
            RDLR KYGPIFTMQMGQRT+VIVTSS+LIHEALVQ+GP FA+RP DSPIRL+FSVGKCAI
Sbjct  61   RDLRKKYGPIFTMQMGQRTMVIVTSSQLIHEALVQRGPEFASRPPDSPIRLVFSVGKCAI  120

Query  461  NSAEYGPLWRALLRNF  508
            NSAEYGPLWR+L RNF
Sbjct  121  NSAEYGPLWRSLRRNF  136



>ref|XP_006449061.1| hypothetical protein CICLE_v10014970mg [Citrus clementina]
 gb|ESR62301.1| hypothetical protein CICLE_v10014970mg [Citrus clementina]
Length=508

 Score =   180 bits (457),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 107/136 (79%), Positives = 120/136 (88%), Gaps = 0/136 (0%)
 Frame = +2

Query  101  MELMDAAILLLATVFLCLWXRYWSVTgggpxnlppgppgwplvgnlFQVVLQRRPFIYVV  280
            M+L+D  IL+   +FLCLW RY S TGGGP NLPPGP GWPLVGNL QV+LQRR FI++V
Sbjct  1    MDLIDLVILISGLIFLCLWWRYSSTTGGGPKNLPPGPRGWPLVGNLVQVILQRRHFIFIV  60

Query  281  RDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPADSPIRLIFSVGKCAI  460
            RDLR KYGPIFTMQMGQRT+VIVTSS+LIHEALVQ+GP FA+RP DSPIRL+FSVGKCAI
Sbjct  61   RDLRKKYGPIFTMQMGQRTMVIVTSSQLIHEALVQRGPEFASRPPDSPIRLVFSVGKCAI  120

Query  461  NSAEYGPLWRALLRNF  508
            NSAEYGPLWR+L RNF
Sbjct  121  NSAEYGPLWRSLRRNF  136



>ref|XP_008367238.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 77A1-like [Malus 
domestica]
Length=537

 Score =   180 bits (456),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 107/134 (80%), Positives = 118/134 (88%), Gaps = 0/134 (0%)
 Frame = +2

Query  107  LMDAAILLLATVFLCLWXRYWSVTgggpxnlppgppgwplvgnlFQVVLQRRPFIYVVRD  286
            +MD  ++ L  +F  LW RYWSVTGGGP NLPPGPPGWP+VGNL QV+LQRR FIYVVRD
Sbjct  5    MMDVVLVCLGLIFFRLWWRYWSVTGGGPKNLPPGPPGWPIVGNLIQVILQRRHFIYVVRD  64

Query  287  LRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPADSPIRLIFSVGKCAINS  466
            LR KYGPIFTMQMGQRTL+IVTSS+LIHEALVQ+GP FA+RPADSPIRL+FSVGKCAINS
Sbjct  65   LRAKYGPIFTMQMGQRTLIIVTSSDLIHEALVQRGPEFASRPADSPIRLLFSVGKCAINS  124

Query  467  AEYGPLWRALLRNF  508
            AEYGP WR L RNF
Sbjct  125  AEYGPFWRTLRRNF  138



>gb|KDO75503.1| hypothetical protein CISIN_1g036686mg [Citrus sinensis]
Length=508

 Score =   179 bits (454),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 107/136 (79%), Positives = 120/136 (88%), Gaps = 0/136 (0%)
 Frame = +2

Query  101  MELMDAAILLLATVFLCLWXRYWSVTgggpxnlppgppgwplvgnlFQVVLQRRPFIYVV  280
            M+L+D  IL+   +FLCLW RY S TGGGP NLPPGP GWPLVGNL QV+LQRR FI++V
Sbjct  1    MDLIDLVILISGFIFLCLWWRYSSTTGGGPKNLPPGPRGWPLVGNLVQVILQRRHFIFIV  60

Query  281  RDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPADSPIRLIFSVGKCAI  460
            RDLR KYGPIFTMQMGQRT+VIVTSS+LIHEALVQ+GP FA+RP DSPIRL+FSVGKCAI
Sbjct  61   RDLRKKYGPIFTMQMGQRTVVIVTSSQLIHEALVQRGPEFASRPPDSPIRLVFSVGKCAI  120

Query  461  NSAEYGPLWRALLRNF  508
            NSAEYGPLWR+L RNF
Sbjct  121  NSAEYGPLWRSLRRNF  136



>ref|XP_009370410.1| PREDICTED: cytochrome P450 77A1-like [Pyrus x bretschneideri]
Length=537

 Score =   179 bits (455),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 107/134 (80%), Positives = 117/134 (87%), Gaps = 0/134 (0%)
 Frame = +2

Query  107  LMDAAILLLATVFLCLWXRYWSVTgggpxnlppgppgwplvgnlFQVVLQRRPFIYVVRD  286
            +MD  ++ L  VF  LW RYWSVTGGG  NLPPGPPGWP+VGNL QV+LQRR FIYVVRD
Sbjct  5    MMDVVLVCLGLVFFRLWWRYWSVTGGGRKNLPPGPPGWPIVGNLIQVILQRRHFIYVVRD  64

Query  287  LRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPADSPIRLIFSVGKCAINS  466
            LR KYGPIFTMQMGQRTL+IVTSS+LIHEALVQ+GP FA+RPADSPIRL+FSVGKCAINS
Sbjct  65   LRPKYGPIFTMQMGQRTLIIVTSSDLIHEALVQRGPEFASRPADSPIRLLFSVGKCAINS  124

Query  467  AEYGPLWRALLRNF  508
            AEYGPLWR L RN 
Sbjct  125  AEYGPLWRTLRRNL  138



>ref|XP_008439972.1| PREDICTED: cytochrome P450 77A1 [Cucumis melo]
Length=513

 Score =   178 bits (451),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 108/136 (79%), Positives = 122/136 (90%), Gaps = 0/136 (0%)
 Frame = +2

Query  101  MELMDAAILLLATVFLCLWXRYWSVTgggpxnlppgppgwplvgnlFQVVLQRRPFIYVV  280
            MEL+DA +LL A +F  LW RYWS TGGG  NLPPGPPGWP+VGNL QV+LQRRPFI+V 
Sbjct  1    MELLDATLLLFAFLFFSLWWRYWSATGGGSKNLPPGPPGWPIVGNLIQVILQRRPFIFVA  60

Query  281  RDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPADSPIRLIFSVGKCAI  460
            RDLR KYGPIFTMQMGQRTL+IV+S+ELIHEALVQ+GP+FA+RPADSPIRL+FSVGKCA+
Sbjct  61   RDLREKYGPIFTMQMGQRTLIIVSSAELIHEALVQRGPLFASRPADSPIRLVFSVGKCAV  120

Query  461  NSAEYGPLWRALLRNF  508
            NSAEYGPLWR L RNF
Sbjct  121  NSAEYGPLWRTLRRNF  136



>gb|ABD97101.1| cytochrome P450 monooxygenase CYP77B5 [Medicago truncatula]
Length=380

 Score =   175 bits (443),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 102/136 (75%), Positives = 115/136 (85%), Gaps = 0/136 (0%)
 Frame = +2

Query  101  MELMDAAILLLATVFLCLWXRYWSVTgggpxnlppgppgwplvgnlFQVVLQRRPFIYVV  280
            ME +D  + L A  FL  W R WS TGGG  NLPPG PGWP+VGNLFQV+LQRRPFIY+V
Sbjct  1    MEFIDVIMFLFALAFLRWWWRRWSKTGGGTKNLPPGVPGWPIVGNLFQVILQRRPFIYIV  60

Query  281  RDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPADSPIRLIFSVGKCAI  460
            RDLR KYGPIFTMQMGQRTL+IVT ++LIHEAL+Q+GP FA+RP DSPIRLIFS+GKCAI
Sbjct  61   RDLRLKYGPIFTMQMGQRTLIIVTEADLIHEALIQRGPQFASRPKDSPIRLIFSMGKCAI  120

Query  461  NSAEYGPLWRALLRNF  508
            NSAEYGPLWR+L RN 
Sbjct  121  NSAEYGPLWRSLRRNL  136



>ref|XP_004155597.1| PREDICTED: cytochrome P450 77A1-like [Cucumis sativus]
Length=513

 Score =   177 bits (449),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 108/136 (79%), Positives = 121/136 (89%), Gaps = 0/136 (0%)
 Frame = +2

Query  101  MELMDAAILLLATVFLCLWXRYWSVTgggpxnlppgppgwplvgnlFQVVLQRRPFIYVV  280
            MEL DA +LL A +F  LW RYWS TGGG  NLPPGPPGWP+VGNL QV+LQRRPFI+V 
Sbjct  1    MELQDAVLLLFAFLFFSLWWRYWSATGGGSKNLPPGPPGWPIVGNLIQVILQRRPFIFVA  60

Query  281  RDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPADSPIRLIFSVGKCAI  460
            RDLR KYGPIFTMQMGQRTL+IV+S+ELIHEALVQ+GP+FA+RPADSPIRL+FSVGKCA+
Sbjct  61   RDLREKYGPIFTMQMGQRTLIIVSSAELIHEALVQRGPLFASRPADSPIRLVFSVGKCAV  120

Query  461  NSAEYGPLWRALLRNF  508
            NSAEYGPLWR L RNF
Sbjct  121  NSAEYGPLWRTLRRNF  136



>ref|XP_004305483.2| PREDICTED: cytochrome P450 77A4 [Fragaria vesca subsp. vesca]
Length=511

 Score =   177 bits (448),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 103/136 (76%), Positives = 116/136 (85%), Gaps = 0/136 (0%)
 Frame = +2

Query  101  MELMDAAILLLATVFLCLWXRYWSVTgggpxnlppgppgwplvgnlFQVVLQRRPFIYVV  280
            M+LMD  IL+LA VFL LW RY SV G    NLPPGPPGWP+VGNL QV+L+ RPFI+VV
Sbjct  3    MDLMDVLILVLAAVFLRLWWRYCSVAGEQKKNLPPGPPGWPVVGNLIQVILEGRPFIFVV  62

Query  281  RDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPADSPIRLIFSVGKCAI  460
            RDLR KYGPIFTMQMGQRTL+I+TSS+LIHE LVQ+   FA+RP+DSPIRLIFSVGKCAI
Sbjct  63   RDLRKKYGPIFTMQMGQRTLIIITSSDLIHEGLVQRSAEFASRPSDSPIRLIFSVGKCAI  122

Query  461  NSAEYGPLWRALLRNF  508
            NSA+YGPLWR L RNF
Sbjct  123  NSAQYGPLWRTLRRNF  138



>ref|XP_004134754.1| PREDICTED: cytochrome P450 77A1-like [Cucumis sativus]
 gb|KGN49124.1| hypothetical protein Csa_6G514850 [Cucumis sativus]
Length=513

 Score =   176 bits (447),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 108/136 (79%), Positives = 121/136 (89%), Gaps = 0/136 (0%)
 Frame = +2

Query  101  MELMDAAILLLATVFLCLWXRYWSVTgggpxnlppgppgwplvgnlFQVVLQRRPFIYVV  280
            MEL DA +LL A +F  LW RYWS TGGG  NLPPGPPGWP+VGNL QV+LQRRPFI+V 
Sbjct  1    MELKDAILLLFAFLFFSLWWRYWSATGGGSKNLPPGPPGWPIVGNLIQVILQRRPFIFVA  60

Query  281  RDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPADSPIRLIFSVGKCAI  460
            RDLR KYGPIFTMQMGQRTL+IV+S+ELIHEALVQ+GP+FA+RPADSPIRL+FSVGKCA+
Sbjct  61   RDLREKYGPIFTMQMGQRTLIIVSSAELIHEALVQRGPLFASRPADSPIRLVFSVGKCAV  120

Query  461  NSAEYGPLWRALLRNF  508
            NSAEYGPLWR L RNF
Sbjct  121  NSAEYGPLWRTLRRNF  136



>gb|KJB69319.1| hypothetical protein B456_011G016000 [Gossypium raimondii]
Length=506

 Score =   176 bits (446),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 105/136 (77%), Positives = 120/136 (88%), Gaps = 0/136 (0%)
 Frame = +2

Query  101  MELMDAAILLLATVFLCLWXRYWSVTgggpxnlppgppgwplvgnlFQVVLQRRPFIYVV  280
            MEL+D  I+ LA +F+  W RYWSVTGGGP NLPPGPPGWPLVGNL QV+LQRR FI+++
Sbjct  1    MELIDIFIIGLALIFIRFWWRYWSVTGGGPKNLPPGPPGWPLVGNLIQVILQRRHFIFII  60

Query  281  RDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPADSPIRLIFSVGKCAI  460
            R+LR KYGPIFTMQMGQRT+VIVT S+LIHEALVQ+GP FA+RP DSPIRL+FSVGKCAI
Sbjct  61   RELRKKYGPIFTMQMGQRTMVIVTDSKLIHEALVQRGPDFASRPPDSPIRLLFSVGKCAI  120

Query  461  NSAEYGPLWRALLRNF  508
            NSAEYGPLWR L +NF
Sbjct  121  NSAEYGPLWRTLRKNF  136



>ref|XP_003610402.1| Cytochrome P450 [Medicago truncatula]
 gb|AES92599.1| cytochrome P450 family 87 protein [Medicago truncatula]
Length=508

 Score =   175 bits (444),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 102/136 (75%), Positives = 115/136 (85%), Gaps = 0/136 (0%)
 Frame = +2

Query  101  MELMDAAILLLATVFLCLWXRYWSVTgggpxnlppgppgwplvgnlFQVVLQRRPFIYVV  280
            ME +D  + L A  FL  W R WS TGGG  NLPPG PGWP+VGNLFQV+LQRRPFIY+V
Sbjct  1    MEFIDVIMFLFALAFLRWWWRRWSKTGGGTKNLPPGVPGWPIVGNLFQVILQRRPFIYIV  60

Query  281  RDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPADSPIRLIFSVGKCAI  460
            RDLR KYGPIFTMQMGQRTL+IVT ++LIHEAL+Q+GP FA+RP DSPIRLIFS+GKCAI
Sbjct  61   RDLRLKYGPIFTMQMGQRTLIIVTEADLIHEALIQRGPQFASRPKDSPIRLIFSMGKCAI  120

Query  461  NSAEYGPLWRALLRNF  508
            NSAEYGPLWR+L RN 
Sbjct  121  NSAEYGPLWRSLRRNL  136



>ref|XP_004508228.1| PREDICTED: uncharacterized protein LOC101501316 [Cicer arietinum]
Length=1078

 Score =   179 bits (455),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 107/136 (79%), Positives = 118/136 (87%), Gaps = 0/136 (0%)
 Frame = +2

Query  98   AMELMDAAILLLATVFLCLWXRYWSVTgggpxnlppgppgwplvgnlFQVVLQRRPFIYV  277
            +MEL+D  +L  A  FL  W R WS TGGG  NLPPGPPGWP+VGNLFQV+LQRRPFIYV
Sbjct  570  SMELVDIIMLFFALAFLRWWWRRWSKTGGGAKNLPPGPPGWPIVGNLFQVILQRRPFIYV  629

Query  278  VRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPADSPIRLIFSVGKCA  457
            VRDLR KYGPIFTMQMGQRTL+IVTSS LIHEAL+Q+GP FA+RP DSPIRLIFS+GKCA
Sbjct  630  VRDLREKYGPIFTMQMGQRTLIIVTSSNLIHEALIQRGPQFASRPKDSPIRLIFSMGKCA  689

Query  458  INSAEYGPLWRALLRN  505
            INSAEYGPLWR+L RN
Sbjct  690  INSAEYGPLWRSLRRN  705



>ref|XP_002265911.1| PREDICTED: cytochrome P450 77A1 [Vitis vinifera]
 emb|CBI23188.3| unnamed protein product [Vitis vinifera]
Length=508

 Score =   175 bits (443),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 104/119 (87%), Positives = 110/119 (92%), Gaps = 0/119 (0%)
 Frame = +2

Query  152  LWXRYWSVTgggpxnlppgppgwplvgnlFQVVLQRRPFIYVVRDLRXKYGPIFTMQMGQ  331
             W RYWSVTGGGP NLPPGPPGWPLVGNL QV+LQRRPFIYVVRDLR KYGPIFT+QMGQ
Sbjct  18   FWWRYWSVTGGGPKNLPPGPPGWPLVGNLVQVILQRRPFIYVVRDLRAKYGPIFTLQMGQ  77

Query  332  RTLVIVTSSELIHEALVQQGPIFANRPADSPIRLIFSVGKCAINSAEYGPLWRALLRNF  508
            RTLVIVTSSELIHEALVQ+GPIFA+RP DSP RL+FSVGKCAINSA+YGPLWR L RNF
Sbjct  78   RTLVIVTSSELIHEALVQRGPIFASRPEDSPTRLVFSVGKCAINSAQYGPLWRTLRRNF  136



>ref|XP_010101456.1| Cytochrome P450 77A3 [Morus notabilis]
 gb|EXB88439.1| Cytochrome P450 77A3 [Morus notabilis]
Length=498

 Score =   174 bits (442),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 110/136 (81%), Positives = 123/136 (90%), Gaps = 0/136 (0%)
 Frame = +2

Query  101  MELMDAAILLLATVFLCLWXRYWSVTgggpxnlppgppgwplvgnlFQVVLQRRPFIYVV  280
            ME++D  IL  A +FL LW ++WSVTGGGP NLPPGPPGWPLVGNL +V+LQ RPFI+++
Sbjct  1    MEIIDIVILFAALLFLRLWWKHWSVTGGGPKNLPPGPPGWPLVGNLMKVILQPRPFIFLM  60

Query  281  RDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPADSPIRLIFSVGKCAI  460
            RDLR KYGPIFTMQMGQRTL+IVTSSELIHEALVQ+GP FA+RPADSPIRLIFSVGKCAI
Sbjct  61   RDLRKKYGPIFTMQMGQRTLIIVTSSELIHEALVQRGPEFASRPADSPIRLIFSVGKCAI  120

Query  461  NSAEYGPLWRALLRNF  508
            NSAEYGPLWRAL RNF
Sbjct  121  NSAEYGPLWRALRRNF  136



>ref|XP_010276015.1| PREDICTED: cytochrome P450 77A3 [Nelumbo nucifera]
Length=512

 Score =   173 bits (439),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 100/118 (85%), Positives = 109/118 (92%), Gaps = 0/118 (0%)
 Frame = +2

Query  155  WXRYWSVTgggpxnlppgppgwplvgnlFQVVLQRRPFIYVVRDLRXKYGPIFTMQMGQR  334
            W RYWSVTGGG  NLPPGPPGWPLVGNL QV+LQRRPFIYVVRDLR KYGPIFTMQMGQR
Sbjct  19   WWRYWSVTGGGSKNLPPGPPGWPLVGNLVQVLLQRRPFIYVVRDLRTKYGPIFTMQMGQR  78

Query  335  TLVIVTSSELIHEALVQQGPIFANRPADSPIRLIFSVGKCAINSAEYGPLWRALLRNF  508
            TL+I+TS++LIHEALVQ+GP+FA+RPADSP RL+FSVGKC INSAEYGPLWR L RNF
Sbjct  79   TLIIITSAQLIHEALVQKGPLFASRPADSPTRLLFSVGKCTINSAEYGPLWRTLRRNF  136



>ref|XP_010052825.1| PREDICTED: cytochrome P450 77A2 [Eucalyptus grandis]
 gb|KCW76940.1| hypothetical protein EUGRSUZ_D01302 [Eucalyptus grandis]
Length=533

 Score =   174 bits (440),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 102/141 (72%), Positives = 112/141 (79%), Gaps = 5/141 (4%)
 Frame = +2

Query  101  MELMDAAILLLATVFLCLWXRYW-----SVTgggpxnlppgppgwplvgnlFQVVLQRRP  265
            MEL+D  +  LA V LCLW RY      +        LPPGPPGWPLVGNL QV+LQ RP
Sbjct  1    MELLDILVFGLAAVLLCLWWRYSPSPVSATAHRPERRLPPGPPGWPLVGNLLQVILQNRP  60

Query  266  FIYVVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPADSPIRLIFSV  445
            FIYVVRDLR +YGPIFTM+MGQRTLVIVTSS+LIHEALVQ+GP+FA RP DSP RL+FSV
Sbjct  61   FIYVVRDLRARYGPIFTMKMGQRTLVIVTSSQLIHEALVQRGPLFATRPPDSPTRLVFSV  120

Query  446  GKCAINSAEYGPLWRALLRNF  508
            GKCAINSAEYGPLWR L RNF
Sbjct  121  GKCAINSAEYGPLWRTLRRNF  141



>emb|CDP04373.1| unnamed protein product [Coffea canephora]
Length=512

 Score =   172 bits (436),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 106/136 (78%), Positives = 117/136 (86%), Gaps = 0/136 (0%)
 Frame = +2

Query  101  MELMDAAILLLATVFLCLWXRYWSVTgggpxnlppgppgwplvgnlFQVVLQRRPFIYVV  280
            ME  D  ILL   +   LW RYWSVTGGG  NLPPGPPGWPLVGNLFQV+LQ + FI+VV
Sbjct  1    MEWTDLVILLAVALLFRLWWRYWSVTGGGAKNLPPGPPGWPLVGNLFQVILQGKHFIFVV  60

Query  281  RDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPADSPIRLIFSVGKCAI  460
            RDLR KYGPIFTMQMGQRTL++VTS ELIHEALVQ+GP+FA+RPADSPIRL+FSVGKCAI
Sbjct  61   RDLRAKYGPIFTMQMGQRTLIVVTSPELIHEALVQKGPLFASRPADSPIRLLFSVGKCAI  120

Query  461  NSAEYGPLWRALLRNF  508
            NSAEYGPLWR+L RN 
Sbjct  121  NSAEYGPLWRSLRRNL  136



>ref|XP_008242488.1| PREDICTED: cytochrome P450 77A3 [Prunus mume]
Length=517

 Score =   172 bits (436),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 107/134 (80%), Positives = 118/134 (88%), Gaps = 0/134 (0%)
 Frame = +2

Query  107  LMDAAILLLATVFLCLWXRYWSVTgggpxnlppgppgwplvgnlFQVVLQRRPFIYVVRD  286
            +MD   L L  VFL LW RYWSVTGGG  NLPPGPPGWP+VGNL QV+LQRRPFI+VVRD
Sbjct  4    IMDILFLCLGLVFLLLWWRYWSVTGGGRRNLPPGPPGWPVVGNLIQVILQRRPFIFVVRD  63

Query  287  LRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPADSPIRLIFSVGKCAINS  466
            LR KYGPIF+MQMGQRTL+IVTSS+LIHE LVQ+GP FA+RPADSPIRL+FSVGKCAINS
Sbjct  64   LRAKYGPIFSMQMGQRTLIIVTSSDLIHEGLVQRGPEFASRPADSPIRLLFSVGKCAINS  123

Query  467  AEYGPLWRALLRNF  508
            AEYGP+WR L RNF
Sbjct  124  AEYGPVWRTLRRNF  137



>ref|XP_007026022.1| Cytochrome P450, family 77, subfamily B, polypeptide 1 [Theobroma 
cacao]
 gb|EOY28644.1| Cytochrome P450, family 77, subfamily B, polypeptide 1 [Theobroma 
cacao]
Length=505

 Score =   171 bits (433),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 103/136 (76%), Positives = 119/136 (88%), Gaps = 0/136 (0%)
 Frame = +2

Query  101  MELMDAAILLLATVFLCLWXRYWSVTgggpxnlppgppgwplvgnlFQVVLQRRPFIYVV  280
            MEL+D  ++ LA +FL LW RYWSVTGGGP NLPPGPPGWPLVGNL QV+LQRR FI++V
Sbjct  1    MELVDLFVIGLALIFLRLWWRYWSVTGGGPKNLPPGPPGWPLVGNLIQVILQRRHFIFIV  60

Query  281  RDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPADSPIRLIFSVGKCAI  460
            R+LR  YGPIFT++MGQRT+VIVT S LIHEALVQ+GP FA+RP DSPIRL+FS+GKCAI
Sbjct  61   RELRKIYGPIFTLRMGQRTMVIVTDSRLIHEALVQRGPTFASRPPDSPIRLVFSMGKCAI  120

Query  461  NSAEYGPLWRALLRNF  508
            NSAEYGPLWR L +NF
Sbjct  121  NSAEYGPLWRTLRKNF  136



>gb|KDP20777.1| hypothetical protein JCGZ_21248 [Jatropha curcas]
Length=505

 Score =   171 bits (432),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 99/136 (73%), Positives = 115/136 (85%), Gaps = 1/136 (1%)
 Frame = +2

Query  101  MELMDAAILLLATVFLCLWXRYWSVTgggpxnlppgppgwplvgnlFQVVLQRRPFIYVV  280
            MEL+D  IL  + VFL LW R + +T     NLPPGPPGWPLVGNLFQV+ QRR FI+++
Sbjct  1    MELIDLFILCFSFVFLALWWRSF-LTPTKSKNLPPGPPGWPLVGNLFQVIFQRRHFIFII  59

Query  281  RDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPADSPIRLIFSVGKCAI  460
            RDLR KYGPIFTM+MGQRTLVIVTS +LIHEAL+Q+GP+FA+RP DSPIRL+FSVGKCA+
Sbjct  60   RDLRKKYGPIFTMKMGQRTLVIVTSPDLIHEALIQRGPVFASRPPDSPIRLVFSVGKCAV  119

Query  461  NSAEYGPLWRALLRNF  508
            NSAEYGPLWR L RNF
Sbjct  120  NSAEYGPLWRTLRRNF  135



>ref|XP_009362723.1| PREDICTED: cytochrome P450 77A3-like [Pyrus x bretschneideri]
Length=538

 Score =   170 bits (430),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 105/135 (78%), Positives = 117/135 (87%), Gaps = 1/135 (1%)
 Frame = +2

Query  107  LMDAAILLLATVFLCLWXRYW-SVTgggpxnlppgppgwplvgnlFQVVLQRRPFIYVVR  283
            +MD  ++ L  +F  LW RY  SVTGGGP NLPPGPPGWP+VGNL QV+LQRR FIYVVR
Sbjct  5    MMDVVLVCLGLIFFLLWWRYCRSVTGGGPKNLPPGPPGWPIVGNLIQVILQRRHFIYVVR  64

Query  284  DLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPADSPIRLIFSVGKCAIN  463
            DLR KYGPIFTM+MGQRTL+IVTSS+LIHEALVQ+GP FA+RPADSPIRL+FSVGKCAIN
Sbjct  65   DLRAKYGPIFTMKMGQRTLIIVTSSDLIHEALVQRGPEFASRPADSPIRLLFSVGKCAIN  124

Query  464  SAEYGPLWRALLRNF  508
            SAEYGP WR L RNF
Sbjct  125  SAEYGPFWRTLRRNF  139



>gb|KJB68589.1| hypothetical protein B456_010G252700 [Gossypium raimondii]
Length=506

 Score =   169 bits (429),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 101/136 (74%), Positives = 118/136 (87%), Gaps = 0/136 (0%)
 Frame = +2

Query  101  MELMDAAILLLATVFLCLWXRYWSVTgggpxnlppgppgwplvgnlFQVVLQRRPFIYVV  280
            ME +D +I++LA +FL LW RYWS TGGGP NLPPGPPGWPLVGNL Q++LQR+ FI++V
Sbjct  1    MEFLDLSIIVLALIFLRLWWRYWSTTGGGPKNLPPGPPGWPLVGNLIQIILQRQHFIFIV  60

Query  281  RDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPADSPIRLIFSVGKCAI  460
            R LR +YGPIF+MQMGQRT+VIVT S LIHEALVQ+GP FA+RP DSPIRL+FSVGK AI
Sbjct  61   RGLRKRYGPIFSMQMGQRTMVIVTDSRLIHEALVQRGPTFASRPPDSPIRLVFSVGKRAI  120

Query  461  NSAEYGPLWRALLRNF  508
            NSAEYGPLWR L +NF
Sbjct  121  NSAEYGPLWRTLRKNF  136



>ref|XP_002304925.2| hypothetical protein POPTR_0004s01860g [Populus trichocarpa]
 gb|EEE85436.2| hypothetical protein POPTR_0004s01860g [Populus trichocarpa]
Length=507

 Score =   169 bits (427),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 103/137 (75%), Positives = 117/137 (85%), Gaps = 1/137 (1%)
 Frame = +2

Query  101  MELMDAAILLLATVFLCLWXRYWSV-TgggpxnlppgppgwplvgnlFQVVLQRRPFIYV  277
            MEL+D  IL L   FL +W R +SV  GGG  NLPPGPPGWPLVGNLFQ++L+RR FI+V
Sbjct  1    MELIDLLILGLTLFFLAIWWRSFSVVNGGGAKNLPPGPPGWPLVGNLFQIILERRHFIFV  60

Query  278  VRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPADSPIRLIFSVGKCA  457
            +RDLR KYGPIF+MQMGQ TLVIVTS +LIHEALVQ+GPIFA+RP DSPIRL+FSVGKCA
Sbjct  61   IRDLRKKYGPIFSMQMGQSTLVIVTSPDLIHEALVQKGPIFASRPPDSPIRLVFSVGKCA  120

Query  458  INSAEYGPLWRALLRNF  508
            +NSAEYGPLWR L RNF
Sbjct  121  VNSAEYGPLWRTLRRNF  137



>ref|XP_008375760.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 77A3 [Malus domestica]
Length=535

 Score =   169 bits (427),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 106/134 (79%), Positives = 116/134 (87%), Gaps = 2/134 (1%)
 Frame = +2

Query  107  LMDAAILLLATVFLCLWXRYWSVTgggpxnlppgppgwplvgnlFQVVLQRRPFIYVVRD  286
            +MD  ++ L  VF  LW RYWS  GGG  NLPPGPPGWP+VGNL QV+LQRR FIYVVRD
Sbjct  5    MMDVVLVCLVLVFFRLWWRYWS--GGGRKNLPPGPPGWPIVGNLIQVILQRRHFIYVVRD  62

Query  287  LRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPADSPIRLIFSVGKCAINS  466
            LR KYGPIFTMQMGQRTL+IVTSS+LIHEALVQ+GP FA+RPADSPIRL+FSVGKCAINS
Sbjct  63   LRAKYGPIFTMQMGQRTLIIVTSSDLIHEALVQRGPEFASRPADSPIRLLFSVGKCAINS  122

Query  467  AEYGPLWRALLRNF  508
            AEYGPLWR L RNF
Sbjct  123  AEYGPLWRTLRRNF  136



>gb|EMT07121.1| hypothetical protein F775_44004 [Aegilops tauschii]
Length=153

 Score =   159 bits (402),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 72/88 (82%), Positives = 83/88 (94%), Gaps = 0/88 (0%)
 Frame = +2

Query  245  VVLQRRPFIYVVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPADSP  424
            V+LQRRPF+YVVRDLR KYGPIFTM+MGQRTLVIVT ++LIH+ALV+QGP+FA+RPADSP
Sbjct  18   VILQRRPFMYVVRDLREKYGPIFTMRMGQRTLVIVTDADLIHDALVKQGPMFASRPADSP  77

Query  425  IRLIFSVGKCAINSAEYGPLWRALLRNF  508
            IRL+FSVGKC +NSA YGPLWRAL RNF
Sbjct  78   IRLLFSVGKCTVNSAPYGPLWRALRRNF  105



>ref|XP_002518513.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF43900.1| cytochrome P450, putative [Ricinus communis]
Length=505

 Score =   167 bits (424),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 102/136 (75%), Positives = 113/136 (83%), Gaps = 1/136 (1%)
 Frame = +2

Query  101  MELMDAAILLLATVFLCLWXRYWSVTgggpxnlppgppgwplvgnlFQVVLQRRPFIYVV  280
            MEL+D  I  L+ +FL LW R      G   NLPPGPPGWPLVGNLFQV+LQRR FI+V+
Sbjct  1    MELIDLFITSLSFIFLGLWWRR-CFCSGKSKNLPPGPPGWPLVGNLFQVILQRRHFIFVI  59

Query  281  RDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPADSPIRLIFSVGKCAI  460
            RDLR KYGPIFTMQMGQRTLVIVTS ELIHEALVQ+GP+FA+RP DSPIR +FSVGKCA+
Sbjct  60   RDLRKKYGPIFTMQMGQRTLVIVTSPELIHEALVQRGPVFASRPPDSPIRSVFSVGKCAV  119

Query  461  NSAEYGPLWRALLRNF  508
            NSAEYGPLWR L RNF
Sbjct  120  NSAEYGPLWRTLRRNF  135



>ref|XP_011037690.1| PREDICTED: cytochrome P450 77A1-like [Populus euphratica]
Length=507

 Score =   166 bits (421),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 102/137 (74%), Positives = 117/137 (85%), Gaps = 1/137 (1%)
 Frame = +2

Query  101  MELMDAAILLLATVFLCLWXRYWSV-TgggpxnlppgppgwplvgnlFQVVLQRRPFIYV  277
            MEL+D  IL L   FL +W R +SV  GGG  NLPPGPPGWPLVGNLFQ++L+RR FI+V
Sbjct  1    MELIDLLILGLTLFFLAIWWRSFSVVNGGGAKNLPPGPPGWPLVGNLFQIMLERRHFIFV  60

Query  278  VRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPADSPIRLIFSVGKCA  457
            +RDLR KYGPIF+M+MGQ TLVIVTS +LIHEALVQ+GPIFA+RP DSPIRL+FSVGKCA
Sbjct  61   IRDLRKKYGPIFSMKMGQSTLVIVTSPDLIHEALVQKGPIFASRPPDSPIRLVFSVGKCA  120

Query  458  INSAEYGPLWRALLRNF  508
            +NSAEYGPLWR L RNF
Sbjct  121  VNSAEYGPLWRTLRRNF  137



>ref|XP_003549954.2| PREDICTED: cytochrome P450 77A2-like [Glycine max]
Length=523

 Score =   166 bits (420),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 101/137 (74%), Positives = 118/137 (86%), Gaps = 0/137 (0%)
 Frame = +2

Query  98   AMELMDAAILLLATVFLCLWXRYWSVTgggpxnlppgppgwplvgnlFQVVLQRRPFIYV  277
             M+  D  +L L  +F+  W R WS TGGGP NLPPGPPGWP+VGNLFQV+LQRR FIYV
Sbjct  13   TMQATDIILLGLGLLFVRWWWRRWSTTGGGPKNLPPGPPGWPIVGNLFQVILQRRHFIYV  72

Query  278  VRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPADSPIRLIFSVGKCA  457
            +RDLR KYGPIF+MQMGQRTL+IV+S+ELIHEAL+Q+GP+FA+RP DSPIRLIFS+GKCA
Sbjct  73   IRDLRKKYGPIFSMQMGQRTLIIVSSAELIHEALIQRGPLFASRPRDSPIRLIFSMGKCA  132

Query  458  INSAEYGPLWRALLRNF  508
            INSAEYGPLWR L +NF
Sbjct  133  INSAEYGPLWRTLRKNF  149



>gb|KHN03460.1| Cytochrome P450 77A1 [Glycine soja]
Length=486

 Score =   166 bits (419),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 101/136 (74%), Positives = 118/136 (87%), Gaps = 0/136 (0%)
 Frame = +2

Query  101  MELMDAAILLLATVFLCLWXRYWSVTgggpxnlppgppgwplvgnlFQVVLQRRPFIYVV  280
            M+  D  +L L  +F+  W R WS TGGGP NLPPGPPGWP+VGNLFQV+LQRR FIYV+
Sbjct  1    MQATDIILLGLGLLFVRWWWRRWSTTGGGPKNLPPGPPGWPIVGNLFQVILQRRHFIYVI  60

Query  281  RDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPADSPIRLIFSVGKCAI  460
            RDLR KYGPIF+MQMGQRTL+IV+S+ELIHEAL+Q+GP+FA+RP DSPIRLIFS+GKCAI
Sbjct  61   RDLRKKYGPIFSMQMGQRTLIIVSSAELIHEALIQRGPLFASRPRDSPIRLIFSMGKCAI  120

Query  461  NSAEYGPLWRALLRNF  508
            NSAEYGPLWR L +NF
Sbjct  121  NSAEYGPLWRTLRKNF  136



>ref|XP_002437457.1| hypothetical protein SORBIDRAFT_10g027430 [Sorghum bicolor]
 gb|EER88824.1| hypothetical protein SORBIDRAFT_10g027430 [Sorghum bicolor]
Length=521

 Score =   166 bits (420),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 74/90 (82%), Positives = 86/90 (96%), Gaps = 0/90 (0%)
 Frame = +2

Query  239  FQVVLQRRPFIYVVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPAD  418
            FQV+LQRRPF+YVVRDLR KYGPIFTM+MGQRTL++VTS++LIHEALV+QGP+FA+RPAD
Sbjct  46   FQVILQRRPFMYVVRDLREKYGPIFTMRMGQRTLIVVTSADLIHEALVKQGPMFASRPAD  105

Query  419  SPIRLIFSVGKCAINSAEYGPLWRALLRNF  508
            SPIRL+FSVGKC +NSA YGPLWRAL RNF
Sbjct  106  SPIRLLFSVGKCTVNSAPYGPLWRALRRNF  135



>emb|CDY65267.1| BnaCnng46320D [Brassica napus]
Length=229

 Score =   158 bits (400),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 94/138 (68%), Positives = 109/138 (79%), Gaps = 2/138 (1%)
 Frame = +2

Query  101  MELMDAAILLLATVFLCLWXRYWSV--TgggpxnlppgppgwplvgnlFQVVLQRRPFIY  274
            M+L D  I L A  FL LW R +S   +     N+PPGP GWPLVGNL QV+ QRR F++
Sbjct  1    MDLTDVFIFLFALYFLNLWWRRYSSGRSSQCRLNIPPGPKGWPLVGNLLQVISQRRHFVF  60

Query  275  VVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPADSPIRLIFSVGKC  454
            ++RDLR KYGPIFTMQMGQRT++IVT  +LIHEALVQ+GP FA+RP DSPIRL+FSVGKC
Sbjct  61   LMRDLRKKYGPIFTMQMGQRTMIIVTDEKLIHEALVQRGPTFASRPPDSPIRLMFSVGKC  120

Query  455  AINSAEYGPLWRALLRNF  508
            AINSAEYGPLWR L RNF
Sbjct  121  AINSAEYGPLWRTLRRNF  138



>dbj|BAK06611.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=528

 Score =   164 bits (416),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 87/136 (64%), Positives = 103/136 (76%), Gaps = 1/136 (1%)
 Frame = +2

Query  101  MELMDAAILLLATVFLCLWXRYWSVTgggpxnlppgppgwplvgnlFQVVLQRRPFIYVV  280
            M++ D  +L  A V   +W R  S TGG     P  P    +    FQV+LQRRPF+YVV
Sbjct  1    MDVNDVLLLASAVVLGLMWWRRCSKTGGVDGLPPGPPGWPVVGNL-FQVILQRRPFMYVV  59

Query  281  RDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPADSPIRLIFSVGKCAI  460
            RDLR KYGPIFTM+MGQRTLVIVT ++LIH+ALV+QGP+FA+RPADSPIRL+FSVGKC +
Sbjct  60   RDLREKYGPIFTMRMGQRTLVIVTDADLIHDALVKQGPMFASRPADSPIRLLFSVGKCTV  119

Query  461  NSAEYGPLWRALLRNF  508
            NSA YGPLWRAL RNF
Sbjct  120  NSAPYGPLWRALRRNF  135



>ref|XP_003528678.1| PREDICTED: cytochrome P450 77A1-like [Glycine max]
Length=504

 Score =   164 bits (415),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 97/118 (82%), Positives = 108/118 (92%), Gaps = 0/118 (0%)
 Frame = +2

Query  155  WXRYWSVTgggpxnlppgppgwplvgnlFQVVLQRRPFIYVVRDLRXKYGPIFTMQMGQR  334
            W R WS TGGGP NLPPGPPGWP+VGNLFQV+LQRR FIYV+RDL  KYGPIFTMQMGQR
Sbjct  19   WWRRWSTTGGGPKNLPPGPPGWPIVGNLFQVILQRRHFIYVIRDLHKKYGPIFTMQMGQR  78

Query  335  TLVIVTSSELIHEALVQQGPIFANRPADSPIRLIFSVGKCAINSAEYGPLWRALLRNF  508
            TL+IV+S+ELIHEAL+Q+GP+FA+RP DSPIRLIFSVGKCAINSAEYGPLWR L +NF
Sbjct  79   TLIIVSSAELIHEALIQRGPLFASRPKDSPIRLIFSVGKCAINSAEYGPLWRTLRKNF  136



>ref|NP_001141481.1| uncharacterized protein LOC100273592 precursor [Zea mays]
 gb|ACN34097.1| unknown [Zea mays]
 gb|AFW69072.1| putative cytochrome P450 superfamily protein [Zea mays]
Length=519

 Score =   163 bits (413),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 73/90 (81%), Positives = 84/90 (93%), Gaps = 0/90 (0%)
 Frame = +2

Query  239  FQVVLQRRPFIYVVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPAD  418
            FQV+LQRRPF+YVVRDLR KYGPIFTM+MGQRTL++VTS+ELIHEALV+QGP+FA+RP D
Sbjct  46   FQVILQRRPFMYVVRDLREKYGPIFTMRMGQRTLIVVTSAELIHEALVKQGPMFASRPED  105

Query  419  SPIRLIFSVGKCAINSAEYGPLWRALLRNF  508
            SP RL+FSVGKC +NSA YGPLWRAL RNF
Sbjct  106  SPTRLLFSVGKCTVNSAPYGPLWRALRRNF  135



>gb|ACF86457.1| unknown [Zea mays]
Length=519

 Score =   162 bits (411),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 72/90 (80%), Positives = 84/90 (93%), Gaps = 0/90 (0%)
 Frame = +2

Query  239  FQVVLQRRPFIYVVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPAD  418
            FQV+LQRRPF+YVVRDLR KYGPIFTM+MGQRTL++VTS+ELIHEALV+QGP+FA+RP D
Sbjct  46   FQVILQRRPFMYVVRDLREKYGPIFTMRMGQRTLIVVTSAELIHEALVKQGPMFASRPED  105

Query  419  SPIRLIFSVGKCAINSAEYGPLWRALLRNF  508
            SP RL+FSVGKC +NSA YGP+WRAL RNF
Sbjct  106  SPTRLLFSVGKCTVNSAPYGPMWRALRRNF  135



>ref|XP_004966222.1| PREDICTED: cytochrome P450 77A3-like [Setaria italica]
Length=513

 Score =   162 bits (411),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 72/90 (80%), Positives = 84/90 (93%), Gaps = 0/90 (0%)
 Frame = +2

Query  239  FQVVLQRRPFIYVVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPAD  418
            FQV+LQRRPF+YVVRDLR KYGPIFTM+MGQRTL++VTS++LIHEALV+QGP+FA+RP D
Sbjct  46   FQVILQRRPFMYVVRDLREKYGPIFTMRMGQRTLIVVTSADLIHEALVKQGPMFASRPED  105

Query  419  SPIRLIFSVGKCAINSAEYGPLWRALLRNF  508
            SP RL+FSVGKC +NSA YGPLWRAL RNF
Sbjct  106  SPTRLLFSVGKCTVNSAPYGPLWRALRRNF  135



>ref|XP_006657255.1| PREDICTED: cytochrome P450 77A3-like [Oryza brachyantha]
Length=529

 Score =   162 bits (410),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 72/90 (80%), Positives = 83/90 (92%), Gaps = 0/90 (0%)
 Frame = +2

Query  239  FQVVLQRRPFIYVVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPAD  418
            FQV+LQRRPF+YVVRDLR KYGPIFTM+MGQRTL++VT +ELIHEALV+QGP+FA+RP D
Sbjct  47   FQVILQRRPFMYVVRDLREKYGPIFTMRMGQRTLIVVTDAELIHEALVKQGPMFASRPED  106

Query  419  SPIRLIFSVGKCAINSAEYGPLWRALLRNF  508
            SP RL+FSVGKC +NSA YGPLWRAL RNF
Sbjct  107  SPTRLLFSVGKCTVNSAPYGPLWRALRRNF  136



>ref|XP_007153928.1| hypothetical protein PHAVU_003G076900g [Phaseolus vulgaris]
 gb|ESW25922.1| hypothetical protein PHAVU_003G076900g [Phaseolus vulgaris]
Length=510

 Score =   162 bits (409),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 102/137 (74%), Positives = 117/137 (85%), Gaps = 0/137 (0%)
 Frame = +2

Query  98   AMELMDAAILLLATVFLCLWXRYWSVTgggpxnlppgppgwplvgnlFQVVLQRRPFIYV  277
             M L D  +L  A +FLC W R  + TGGGP NLPPGPPGWP+VGNLFQV+LQRR FIYV
Sbjct  4    TMHLNDLLLLAFAFLFLCWWWRRCTTTGGGPKNLPPGPPGWPIVGNLFQVILQRRHFIYV  63

Query  278  VRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPADSPIRLIFSVGKCA  457
            +RDLR KYGPIFTMQMGQRTL+IVTS++LIHEAL+Q+GP+FA+RP DSPIRLIFS+GKCA
Sbjct  64   IRDLRKKYGPIFTMQMGQRTLIIVTSADLIHEALIQRGPLFASRPQDSPIRLIFSMGKCA  123

Query  458  INSAEYGPLWRALLRNF  508
            INSAEYGPLWR L +N 
Sbjct  124  INSAEYGPLWRTLRKNL  140



>ref|XP_010227164.1| PREDICTED: cytochrome P450 77A1 [Brachypodium distachyon]
Length=522

 Score =   161 bits (408),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 73/90 (81%), Positives = 84/90 (93%), Gaps = 0/90 (0%)
 Frame = +2

Query  239  FQVVLQRRPFIYVVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPAD  418
            FQV+LQRRPF+YVVRDLR KYGPIFTM+MGQRTL+IVT  +LIH+ALV+QGP+FA+RPAD
Sbjct  46   FQVILQRRPFMYVVRDLRQKYGPIFTMRMGQRTLIIVTCPDLIHDALVRQGPMFASRPAD  105

Query  419  SPIRLIFSVGKCAINSAEYGPLWRALLRNF  508
            SPIRL+FSVGKC +NSA YGPLWRAL RNF
Sbjct  106  SPIRLLFSVGKCTVNSAPYGPLWRALRRNF  135



>ref|XP_008784547.1| PREDICTED: cytochrome P450 77A3-like [Phoenix dactylifera]
Length=515

 Score =   160 bits (406),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 94/138 (68%), Positives = 114/138 (83%), Gaps = 2/138 (1%)
 Frame = +2

Query  101  MELMDAAILLLATVFLCLWXRYWSVT--gggpxnlppgppgwplvgnlFQVVLQRRPFIY  274
            M+L+D  ++L   +   LW R WS +   G P  LPPGPPGWP+VGNLFQV+LQRRPF+Y
Sbjct  1    MDLIDLLVILATFLLGALWWRRWSRSGGSGAPGELPPGPPGWPVVGNLFQVILQRRPFMY  60

Query  275  VVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPADSPIRLIFSVGKC  454
            VVRDLR +YGPIFTM+MGQRTL+IVTS++LIHEALVQ+GP+FA+RP+DS  RL+FS GKC
Sbjct  61   VVRDLRTRYGPIFTMRMGQRTLIIVTSADLIHEALVQKGPLFASRPSDSLTRLLFSAGKC  120

Query  455  AINSAEYGPLWRALLRNF  508
             INSA YGPLWR+L RNF
Sbjct  121  TINSAAYGPLWRSLRRNF  138



>ref|XP_009412014.1| PREDICTED: cytochrome P450 77A3-like [Musa acuminata subsp. malaccensis]
Length=510

 Score =   160 bits (406),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 71/90 (79%), Positives = 84/90 (93%), Gaps = 0/90 (0%)
 Frame = +2

Query  239  FQVVLQRRPFIYVVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPAD  418
            FQV+L+RRPF+YVVRDLR +YGPIFTM+MGQRTL+IVTS++LIHEALVQ+GP+FA+RPAD
Sbjct  44   FQVILERRPFMYVVRDLRKRYGPIFTMRMGQRTLIIVTSADLIHEALVQRGPLFASRPAD  103

Query  419  SPIRLIFSVGKCAINSAEYGPLWRALLRNF  508
            SP RL+FS GKC +NSA YGPLWRAL RNF
Sbjct  104  SPTRLLFSAGKCTVNSAAYGPLWRALRRNF  133



>ref|XP_010931808.1| PREDICTED: cytochrome P450 77A3 [Elaeis guineensis]
Length=518

 Score =   159 bits (403),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 95/138 (69%), Positives = 113/138 (82%), Gaps = 2/138 (1%)
 Frame = +2

Query  101  MELMDAAILLLATVFLCLWXRYWSVT--gggpxnlppgppgwplvgnlFQVVLQRRPFIY  274
            M+L+D  ++L   +   LW R  S T   G P  LPPGPPGWP+VGNLFQV+LQRRPF+Y
Sbjct  1    MDLIDMLLILATFLLAALWWRRCSRTGGSGAPGELPPGPPGWPVVGNLFQVILQRRPFMY  60

Query  275  VVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPADSPIRLIFSVGKC  454
            VVRDLR +YGPIFTM+MGQRTLVI+TS++LIHEALVQ+GP+FA+RPADSP RL+FS  KC
Sbjct  61   VVRDLRTRYGPIFTMRMGQRTLVIITSADLIHEALVQKGPLFASRPADSPTRLLFSARKC  120

Query  455  AINSAEYGPLWRALLRNF  508
             INSA YGPLWR+L RNF
Sbjct  121  TINSAAYGPLWRSLRRNF  138



>ref|XP_011086181.1| PREDICTED: cytochrome P450 77A3-like [Sesamum indicum]
Length=511

 Score =   159 bits (402),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 98/117 (84%), Positives = 104/117 (89%), Gaps = 1/117 (1%)
 Frame = +2

Query  161  RYWSVTgggpxnlppgppgwplvgnlFQVVLQRRPFIYVVRDLRXKYGPIFTMQMGQRTL  340
            RYWS TG  P NLPPGPPGWPLVGNLFQV+LQRR FIYVVRDLR KYGPIFTMQMGQRTL
Sbjct  21   RYWSATGREPRNLPPGPPGWPLVGNLFQVILQRRHFIYVVRDLRAKYGPIFTMQMGQRTL  80

Query  341  VIVTSSELIHEALVQQGPIFANRPAD-SPIRLIFSVGKCAINSAEYGPLWRALLRNF  508
            VIVTSSELIHEAL+Q+G +FA+R  D SPIRLIFSVGKC IN AEYGPLWR+L RNF
Sbjct  81   VIVTSSELIHEALIQKGAVFASRAPDYSPIRLIFSVGKCEINLAEYGPLWRSLRRNF  137



>emb|CDY64815.1| BnaA08g31590D [Brassica napus]
Length=510

 Score =   159 bits (401),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 88/138 (64%), Positives = 101/138 (73%), Gaps = 2/138 (1%)
 Frame = +2

Query  101  MELMDAAILLLATVFLCLWXRYWSVTgggpxnlppgppgwp--lvgnlFQVVLQRRPFIY  274
            M+L D  I L A  FL LW R +S        L   P      LVGNL QV+ QRR F++
Sbjct  1    MDLTDVFIFLFALYFLNLWWRRYSSARSSQCCLNIPPGPKGWPLVGNLLQVISQRRHFVF  60

Query  275  VVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPADSPIRLIFSVGKC  454
            ++RDLR KYGPIFTMQMGQRT++IVT  +LIHEALVQ+GP FA+RP DSPIRL+FSVGKC
Sbjct  61   LMRDLRKKYGPIFTMQMGQRTMIIVTDEKLIHEALVQRGPTFASRPPDSPIRLMFSVGKC  120

Query  455  AINSAEYGPLWRALLRNF  508
            AINSAEYGPLWR L RNF
Sbjct  121  AINSAEYGPLWRTLRRNF  138



>ref|XP_009110714.1| PREDICTED: cytochrome P450 77A3-like [Brassica rapa]
Length=510

 Score =   158 bits (400),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 94/138 (68%), Positives = 109/138 (79%), Gaps = 2/138 (1%)
 Frame = +2

Query  101  MELMDAAILLLATVFLCLWXRYWSV--TgggpxnlppgppgwplvgnlFQVVLQRRPFIY  274
            M+L D  I L A  FL LW R +S   +     N+PPGP GWPLVGNL QV+ QRR F++
Sbjct  1    MDLTDVFIFLFALYFLNLWWRRYSSGRSNQCRLNIPPGPKGWPLVGNLLQVISQRRHFVF  60

Query  275  VVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPADSPIRLIFSVGKC  454
            ++RDLR KYGPIFTMQMGQRT++IVT  +LIHEALVQ+GP FA+RP DSPIRL+FSVGKC
Sbjct  61   LMRDLRKKYGPIFTMQMGQRTMIIVTDEKLIHEALVQRGPTFASRPPDSPIRLMFSVGKC  120

Query  455  AINSAEYGPLWRALLRNF  508
            AINSAEYGPLWR L RNF
Sbjct  121  AINSAEYGPLWRTLRRNF  138



>gb|KJB67165.1| hypothetical protein B456_010G178900 [Gossypium raimondii]
Length=505

 Score =   158 bits (400),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 98/136 (72%), Positives = 115/136 (85%), Gaps = 0/136 (0%)
 Frame = +2

Query  101  MELMDAAILLLATVFLCLWXRYWSVTgggpxnlppgppgwplvgnlFQVVLQRRPFIYVV  280
            MELMD  I+ LA +F+ LW RY SV GGGP NLPPGPPGWP VGNL Q++LQRR F+++V
Sbjct  1    MELMDLFIIGLALIFIRLWWRYSSVAGGGPKNLPPGPPGWPFVGNLIQIILQRRHFVFIV  60

Query  281  RDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPADSPIRLIFSVGKCAI  460
             +LR  YGPIFT++MGQRT+VIVT S LIHEALVQ+G  FA+RP DSPIRL+FSVGKCAI
Sbjct  61   GELRKLYGPIFTLRMGQRTMVIVTDSTLIHEALVQKGHTFASRPPDSPIRLVFSVGKCAI  120

Query  461  NSAEYGPLWRALLRNF  508
            NSAEYGPLWR+L +NF
Sbjct  121  NSAEYGPLWRSLRKNF  136



>ref|XP_008812264.1| PREDICTED: cytochrome P450 77A3-like [Phoenix dactylifera]
Length=516

 Score =   158 bits (399),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 70/90 (78%), Positives = 84/90 (93%), Gaps = 0/90 (0%)
 Frame = +2

Query  239  FQVVLQRRPFIYVVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPAD  418
            FQV+LQRRPF+YVVRDLR +YGPIF+M+MGQRTL+I+TS++LIHEALVQ+GP+FA+RPAD
Sbjct  49   FQVILQRRPFMYVVRDLRLRYGPIFSMRMGQRTLIIITSADLIHEALVQKGPLFASRPAD  108

Query  419  SPIRLIFSVGKCAINSAEYGPLWRALLRNF  508
            SP RL+FS GKC INSAEYG LWR+L RNF
Sbjct  109  SPTRLLFSAGKCTINSAEYGLLWRSLRRNF  138



>ref|XP_006858061.1| hypothetical protein AMTR_s00062p00048540 [Amborella trichopoda]
 gb|ERN19528.1| hypothetical protein AMTR_s00062p00048540 [Amborella trichopoda]
Length=518

 Score =   157 bits (398),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 91/134 (68%), Positives = 106/134 (79%), Gaps = 0/134 (0%)
 Frame = +2

Query  107  LMDAAILLLATVFLCLWXRYWSVTgggpxnlppgppgwplvgnlFQVVLQRRPFIYVVRD  286
            L D   ++       LW + WS TGGG   LPPGPPGWP++GNL QVVLQ RPFI+VVRD
Sbjct  18   LSDILFVVTCLAIASLWWQRWSRTGGGRTGLPPGPPGWPIIGNLGQVVLQNRPFIFVVRD  77

Query  287  LRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPADSPIRLIFSVGKCAINS  466
            LR KYGPIFTMQMGQRTL+I+T + LIHEAL+Q+GP+FA+RP DSP RL+FSVGKC +NS
Sbjct  78   LRAKYGPIFTMQMGQRTLIIITDAALIHEALIQKGPLFASRPVDSPTRLVFSVGKCTVNS  137

Query  467  AEYGPLWRALLRNF  508
            AEYGPLWR L RN 
Sbjct  138  AEYGPLWRTLRRNL  151



>ref|XP_010553430.1| PREDICTED: cytochrome P450 77A3 [Tarenaya hassleriana]
Length=504

 Score =   157 bits (397),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 82/136 (60%), Positives = 95/136 (70%), Gaps = 2/136 (1%)
 Frame = +2

Query  101  MELMDAAILLLATVFLCLWXRYWSVTgggpxnlppgppgwplvgnlFQVVLQRRPFIYVV  280
            MEL D  I  L   FLCLW R +  +G       P             V+LQRR F++++
Sbjct  1    MELTDIVIFFLVLYFLCLWWRRYGGSGRRNLPPGPPGWPLVGNL--VGVLLQRRHFVFMM  58

Query  281  RDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPADSPIRLIFSVGKCAI  460
            RDLR KYGPIFTMQMGQRT++IVT  +LIHEALVQ+G  FA+RP DSPIRL+FSVGKCAI
Sbjct  59   RDLRKKYGPIFTMQMGQRTMIIVTDEKLIHEALVQRGATFASRPRDSPIRLMFSVGKCAI  118

Query  461  NSAEYGPLWRALLRNF  508
            NSAEYGPLWR L RNF
Sbjct  119  NSAEYGPLWRILRRNF  134



>ref|XP_010665549.1| PREDICTED: cytochrome P450 77A4 [Beta vulgaris subsp. vulgaris]
Length=512

 Score =   157 bits (396),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 93/118 (79%), Positives = 107/118 (91%), Gaps = 0/118 (0%)
 Frame = +2

Query  155  WXRYWSVTgggpxnlppgppgwplvgnlFQVVLQRRPFIYVVRDLRXKYGPIFTMQMGQR  334
            W R WS TGGGP NLPPGPPGWP+VGNLFQV+LQRRPF+YVV+DLR  YGPIFTM+MGQ+
Sbjct  19   WWRRWSTTGGGPRNLPPGPPGWPIVGNLFQVILQRRPFMYVVQDLRKTYGPIFTMKMGQK  78

Query  335  TLVIVTSSELIHEALVQQGPIFANRPADSPIRLIFSVGKCAINSAEYGPLWRALLRNF  508
            T+VI+T  ELIHEALVQ+G +FA+RPA+SP RL+FS+GKCAINSAEYGPLWRAL RNF
Sbjct  79   TMVILTGRELIHEALVQRGALFASRPAESPTRLVFSLGKCAINSAEYGPLWRALRRNF  136



>ref|XP_002889880.1| CYP77B1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH66139.1| CYP77B1 [Arabidopsis lyrata subsp. lyrata]
Length=510

 Score =   156 bits (394),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 87/138 (63%), Positives = 101/138 (73%), Gaps = 2/138 (1%)
 Frame = +2

Query  101  MELMDAAILLLATVFLCLWXRYWSVTgggpxnlppgppgwp--lvgnlFQVVLQRRPFIY  274
            M L D  I L A  F+ LW R +S  G     L   P      LVGNL QV+LQRR F++
Sbjct  1    MNLTDVIIFLFALYFINLWWRRYSSAGSSQCRLNIPPGPKGWPLVGNLLQVILQRRHFVF  60

Query  275  VVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPADSPIRLIFSVGKC  454
            ++RDLR KYGPIFTMQMGQRT++I+T  +LIHEALVQ+GP FA+RP DSPIRL+FSVGKC
Sbjct  61   LMRDLRKKYGPIFTMQMGQRTMIIITDEKLIHEALVQRGPTFASRPPDSPIRLMFSVGKC  120

Query  455  AINSAEYGPLWRALLRNF  508
            AINSAEYG LWR L RNF
Sbjct  121  AINSAEYGSLWRTLRRNF  138



>ref|XP_010476093.1| PREDICTED: cytochrome P450 77A3-like [Camelina sativa]
Length=511

 Score =   155 bits (393),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 87/138 (63%), Positives = 102/138 (74%), Gaps = 2/138 (1%)
 Frame = +2

Query  101  MELMDAAILLLATVFLCLWXRYWSVTgggpxnlppgppgwp--lvgnlFQVVLQRRPFIY  274
            M+L D  I L A  F+ LW R +S  G    +L   P      LVGNL QV+ QRR F++
Sbjct  1    MDLTDVIIFLFALYFINLWWRRFSSAGKSQCSLNIPPGPKGWPLVGNLLQVIFQRRHFVF  60

Query  275  VVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPADSPIRLIFSVGKC  454
            ++RDLR KYGPIFTMQMGQRT++IVT  +LIHEALVQ+GP FA+RP DSPIRL+FSVGKC
Sbjct  61   LMRDLRKKYGPIFTMQMGQRTMIIVTDEKLIHEALVQRGPTFASRPPDSPIRLMFSVGKC  120

Query  455  AINSAEYGPLWRALLRNF  508
            AINSAEYG LWR L RNF
Sbjct  121  AINSAEYGSLWRTLRRNF  138



>ref|XP_010458565.1| PREDICTED: cytochrome P450 77A3-like [Camelina sativa]
Length=510

 Score =   155 bits (392),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 87/138 (63%), Positives = 102/138 (74%), Gaps = 2/138 (1%)
 Frame = +2

Query  101  MELMDAAILLLATVFLCLWXRYWSVTgggpxnlppgppgwp--lvgnlFQVVLQRRPFIY  274
            M+L D  I L A  F+ LW R +S  G    +L   P      LVGNL QV+ QRR F++
Sbjct  1    MDLTDVIIFLFALYFINLWWRRFSSAGKSQCSLNIPPGPKGWPLVGNLLQVIFQRRHFVF  60

Query  275  VVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPADSPIRLIFSVGKC  454
            ++RDLR KYGPIFTMQMGQRT++IVT  +LIHEALVQ+GP FA+RP DSPIRL+FSVGKC
Sbjct  61   LMRDLRKKYGPIFTMQMGQRTMIIVTDEKLIHEALVQRGPTFASRPPDSPIRLMFSVGKC  120

Query  455  AINSAEYGPLWRALLRNF  508
            AINSAEYG LWR L RNF
Sbjct  121  AINSAEYGSLWRTLRRNF  138



>ref|XP_010493054.1| PREDICTED: cytochrome P450 77A3-like [Camelina sativa]
Length=511

 Score =   155 bits (392),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 87/138 (63%), Positives = 102/138 (74%), Gaps = 2/138 (1%)
 Frame = +2

Query  101  MELMDAAILLLATVFLCLWXRYWSVTgggpxnlppgppgwp--lvgnlFQVVLQRRPFIY  274
            M+L D  I L A  F+ LW R +S  G    +L   P      LVGNL QV+ QRR F++
Sbjct  1    MDLTDVIIFLFALYFINLWWRRFSSAGKSQCSLNIPPGPKGWPLVGNLLQVIFQRRHFVF  60

Query  275  VVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPADSPIRLIFSVGKC  454
            ++RDLR KYGPIFTMQMGQRT++IVT  +LIHEALVQ+GP FA+RP DSPIRL+FSVGKC
Sbjct  61   LMRDLRKKYGPIFTMQMGQRTMIIVTDEKLIHEALVQRGPTFASRPPDSPIRLMFSVGKC  120

Query  455  AINSAEYGPLWRALLRNF  508
            AINSAEYG LWR L RNF
Sbjct  121  AINSAEYGSLWRTLRRNF  138



>ref|XP_006307273.1| hypothetical protein CARUB_v10008888mg [Capsella rubella]
 gb|EOA40171.1| hypothetical protein CARUB_v10008888mg [Capsella rubella]
Length=510

 Score =   155 bits (392),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 87/138 (63%), Positives = 102/138 (74%), Gaps = 2/138 (1%)
 Frame = +2

Query  101  MELMDAAILLLATVFLCLWXRYWSVTgggpxnlppgppgwp--lvgnlFQVVLQRRPFIY  274
            M+L D  I L A  F+ LW R +S  G    NL   P      LVGNL QV+ QRR F++
Sbjct  1    MDLTDVIIFLFALYFINLWWRRFSSAGRSQCNLNIPPGPKGWPLVGNLLQVIFQRRHFVF  60

Query  275  VVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPADSPIRLIFSVGKC  454
            ++RDLR KYGPIFTMQMGQRT++I+T  +LIHEALVQ+GP FA+RP DSPIRL+FSVGKC
Sbjct  61   IMRDLRKKYGPIFTMQMGQRTMIIITDEKLIHEALVQRGPTFASRPPDSPIRLMFSVGKC  120

Query  455  AINSAEYGPLWRALLRNF  508
            AINSAEYG LWR L RNF
Sbjct  121  AINSAEYGSLWRTLRRNF  138



>ref|NP_001058373.1| Os06g0680700 [Oryza sativa Japonica Group]
 dbj|BAD45490.1| putative cytochrome P450 [Oryza sativa Japonica Group]
 dbj|BAD45883.1| putative cytochrome P450 [Oryza sativa Japonica Group]
 dbj|BAF20287.1| Os06g0680700 [Oryza sativa Japonica Group]
 gb|EEC81184.1| hypothetical protein OsI_24186 [Oryza sativa Indica Group]
Length=535

 Score =   155 bits (392),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 69/90 (77%), Positives = 81/90 (90%), Gaps = 0/90 (0%)
 Frame = +2

Query  239  FQVVLQRRPFIYVVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPAD  418
            FQV+LQRRPF+YVVRDLR KYGPIFTM+MGQRTL++VT ++LIH+ALV+QG  FA+RP D
Sbjct  47   FQVILQRRPFMYVVRDLREKYGPIFTMRMGQRTLIVVTDADLIHDALVKQGAAFASRPED  106

Query  419  SPIRLIFSVGKCAINSAEYGPLWRALLRNF  508
            SP RL+FSVGKC +NSA YGPLWRAL RNF
Sbjct  107  SPTRLLFSVGKCTVNSAPYGPLWRALRRNF  136



>gb|EEE66224.1| hypothetical protein OsJ_22376 [Oryza sativa Japonica Group]
Length=535

 Score =   155 bits (392),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 69/90 (77%), Positives = 81/90 (90%), Gaps = 0/90 (0%)
 Frame = +2

Query  239  FQVVLQRRPFIYVVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPAD  418
            FQV+LQRRPF+YVVRDLR KYGPIFTM+MGQRTL++VT ++LIH+ALV+QG  FA+RP D
Sbjct  47   FQVILQRRPFMYVVRDLREKYGPIFTMRMGQRTLIVVTDADLIHDALVKQGAAFASRPED  106

Query  419  SPIRLIFSVGKCAINSAEYGPLWRALLRNF  508
            SP RL+FSVGKC +NSA YGPLWRAL RNF
Sbjct  107  SPTRLLFSVGKCTVNSAPYGPLWRALRRNF  136



>ref|XP_010102452.1| Cytochrome P450 77A3 [Morus notabilis]
 gb|EXB93488.1| Cytochrome P450 77A3 [Morus notabilis]
Length=506

 Score =   155 bits (391),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 72/89 (81%), Positives = 80/89 (90%), Gaps = 0/89 (0%)
 Frame = +2

Query  242  QVVLQRRPFIYVVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPADS  421
            QV+L RR F++++RDLR KYGPIFTMQMGQRTL+IVTSS+LIHEA VQ+G  FANRPADS
Sbjct  44   QVILYRRAFVFMMRDLRKKYGPIFTMQMGQRTLIIVTSSKLIHEATVQRGACFANRPADS  103

Query  422  PIRLIFSVGKCAINSAEYGPLWRALLRNF  508
            PIRLIFS GKC INSAEYGPLWRAL RNF
Sbjct  104  PIRLIFSSGKCTINSAEYGPLWRALRRNF  132



>ref|NP_172626.1| cytochrome P450, family 77, subfamily B, polypeptide 1 [Arabidopsis 
thaliana]
 gb|AAD30263.1|AC007296_24 Strong similarity to gb|U61231 cytochrome P450 from Arabidopsis 
thaliana and is a member of the PF|00067 Cytochrome P450 
family. ESTs gb|Z30775 and gb|Z30776 come from this gene [Arabidopsis 
thaliana]
 gb|AAM61354.1| putative cytochrome P450 [Arabidopsis thaliana]
 dbj|BAF01194.1| cytochrome P450 like protein [Arabidopsis thaliana]
 gb|AEE28758.1| cytochrome P450, family 77, subfamily B, polypeptide 1 [Arabidopsis 
thaliana]
Length=510

 Score =   155 bits (391),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 92/138 (67%), Positives = 109/138 (79%), Gaps = 2/138 (1%)
 Frame = +2

Query  101  MELMDAAILLLATVFLCLW-XRYWSV-TgggpxnlppgppgwplvgnlFQVVLQRRPFIY  274
            M+L D  I L A  F+ LW  RY+S  +     N+PPGP GWPLVGNL QV+ QRR F++
Sbjct  1    MDLTDVIIFLFALYFINLWWRRYFSAGSSQCSLNIPPGPKGWPLVGNLLQVIFQRRHFVF  60

Query  275  VVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPADSPIRLIFSVGKC  454
            ++RDLR KYGPIFTMQMGQRT++I+T  +LIHEALVQ+GP FA+RP DSPIRL+FSVGKC
Sbjct  61   LMRDLRKKYGPIFTMQMGQRTMIIITDEKLIHEALVQRGPTFASRPPDSPIRLMFSVGKC  120

Query  455  AINSAEYGPLWRALLRNF  508
            AINSAEYG LWR L RNF
Sbjct  121  AINSAEYGSLWRTLRRNF  138



>ref|XP_011086179.1| PREDICTED: cytochrome P450 77A3-like [Sesamum indicum]
Length=510

 Score =   154 bits (388),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 95/117 (81%), Positives = 105/117 (90%), Gaps = 1/117 (1%)
 Frame = +2

Query  161  RYWSVTgggpxnlppgppgwplvgnlFQVVLQRRPFIYVVRDLRXKYGPIFTMQMGQRTL  340
            RYWS  G GP NLPPGPPGWPLVGNLFQV+LQRR F++VVRDLR KYGPIFTMQMGQRTL
Sbjct  21   RYWSAMGRGPRNLPPGPPGWPLVGNLFQVILQRRLFMHVVRDLRAKYGPIFTMQMGQRTL  80

Query  341  VIVTSSELIHEALVQQGPIFANRPAD-SPIRLIFSVGKCAINSAEYGPLWRALLRNF  508
            VIVTSSELIHEAL+Q+G +FA+RP D SPIRLIFS+G+C IN AEYGPLWR+L RNF
Sbjct  81   VIVTSSELIHEALIQKGAVFASRPPDYSPIRLIFSLGRCEINLAEYGPLWRSLRRNF  137



>ref|XP_009393330.1| PREDICTED: cytochrome P450 77A3-like [Musa acuminata subsp. malaccensis]
Length=510

 Score =   153 bits (387),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 69/90 (77%), Positives = 80/90 (89%), Gaps = 0/90 (0%)
 Frame = +2

Query  239  FQVVLQRRPFIYVVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPAD  418
            FQV+LQRRPF+YVVRDLR +YGPIFTM+MGQRTL+IV+S +LIHEALVQ GP+ A+RPAD
Sbjct  44   FQVILQRRPFMYVVRDLRERYGPIFTMRMGQRTLIIVSSPDLIHEALVQMGPLLASRPAD  103

Query  419  SPIRLIFSVGKCAINSAEYGPLWRALLRNF  508
            SP RL+FS G C +NSA YGPLWRAL RNF
Sbjct  104  SPTRLLFSSGNCTVNSAPYGPLWRALRRNF  133



>gb|KFK31941.1| hypothetical protein AALP_AA6G179900 [Arabis alpina]
Length=510

 Score =   153 bits (386),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 84/138 (61%), Positives = 100/138 (72%), Gaps = 2/138 (1%)
 Frame = +2

Query  101  MELMDAAILLLATVFLCLWXRYWSVTgggpxnlppgppgwp--lvgnlFQVVLQRRPFIY  274
            M+L D  I   A  F+ LW R +S  G     +   P      LVGNL QV+ QRR F++
Sbjct  1    MDLTDVIIFFFALYFINLWWRRYSSAGRSQCRMNIPPGPKGWPLVGNLLQVIFQRRHFVF  60

Query  275  VVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPADSPIRLIFSVGKC  454
            ++RDLR  YGPIFTMQMGQRT++I+T  +LIHEALVQ+GP FA+RPADSPIRL+FSVGKC
Sbjct  61   LMRDLRKMYGPIFTMQMGQRTMIIITDEKLIHEALVQRGPTFASRPADSPIRLMFSVGKC  120

Query  455  AINSAEYGPLWRALLRNF  508
            AINSAEYG LWR L RNF
Sbjct  121  AINSAEYGSLWRTLRRNF  138



>ref|XP_006417335.1| hypothetical protein EUTSA_v10007399mg [Eutrema salsugineum]
 gb|ESQ35688.1| hypothetical protein EUTSA_v10007399mg [Eutrema salsugineum]
Length=510

 Score =   152 bits (383),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 85/138 (62%), Positives = 100/138 (72%), Gaps = 2/138 (1%)
 Frame = +2

Query  101  MELMDAAILLLATVFLCLWXRYWSVTgggpxnlppgppgwp--lvgnlFQVVLQRRPFIY  274
            M+L D  I L A  F+  W R +S  G     L   P      LVGNL QV+ QR+ F++
Sbjct  1    MDLTDVIIFLFALYFINFWWRRYSSAGSSQCRLNIPPGPKGWPLVGNLLQVISQRQHFVF  60

Query  275  VVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPADSPIRLIFSVGKC  454
            ++RDLR KYGPIFTMQMGQRT++IVT  +LIHEALVQ+GP FA+RP DSPIRL+FSVGKC
Sbjct  61   LMRDLRKKYGPIFTMQMGQRTMIIVTDEKLIHEALVQRGPTFASRPPDSPIRLMFSVGKC  120

Query  455  AINSAEYGPLWRALLRNF  508
            AINSAEYG LWR L RNF
Sbjct  121  AINSAEYGSLWRTLRRNF  138



>ref|XP_009118184.1| PREDICTED: cytochrome P450 77A3 [Brassica rapa]
Length=510

 Score =   150 bits (379),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 82/141 (58%), Positives = 94/141 (67%), Gaps = 8/141 (6%)
 Frame = +2

Query  101  MELMDAAILLLATVFLCLWXRYWSVTgggpxnlppgppgwplvg-----nlFQVVLQRRP  265
            M+L D  I L A  FL LW   W        +           G     NL QV+ Q R 
Sbjct  1    MDLTDVIIFLFALYFLNLW---WRRYSSSRSSQCRMNIPPGPKGWPLVGNLLQVIFQGRH  57

Query  266  FIYVVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPADSPIRLIFSV  445
            F++++RDLR KYGPIFTMQMGQRT++IVT  +LIHEALVQ+GP FA+RP DSPIRLIFSV
Sbjct  58   FVFIMRDLRKKYGPIFTMQMGQRTMIIVTDEKLIHEALVQRGPTFASRPPDSPIRLIFSV  117

Query  446  GKCAINSAEYGPLWRALLRNF  508
            GKCAINSAEYG LWR L RNF
Sbjct  118  GKCAINSAEYGSLWRTLRRNF  138



>emb|CDY34640.1| BnaC08g41990D [Brassica napus]
Length=510

 Score =   149 bits (377),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 82/141 (58%), Positives = 94/141 (67%), Gaps = 8/141 (6%)
 Frame = +2

Query  101  MELMDAAILLLATVFLCLWXRYWSVTgggpxnlppgppgwplvg-----nlFQVVLQRRP  265
            M+L D  I L A  FL LW   W        +           G     NL QV+ Q R 
Sbjct  1    MDLTDVIIFLFALYFLNLW---WRRYSSSRSSQCRMNIPPGPKGWPLVGNLLQVIFQGRH  57

Query  266  FIYVVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPADSPIRLIFSV  445
            F++++RDLR KYGPIFTMQMGQRT++IVT  +LIHEALVQ+GP FA+RP DSPIRLIFSV
Sbjct  58   FVFIMRDLRKKYGPIFTMQMGQRTMIIVTDEKLIHEALVQRGPTFASRPPDSPIRLIFSV  117

Query  446  GKCAINSAEYGPLWRALLRNF  508
            GKCAINSAEYG LWR L RNF
Sbjct  118  GKCAINSAEYGSLWRILRRNF  138



>gb|EPS68900.1| hypothetical protein M569_05868, partial [Genlisea aurea]
Length=504

 Score =   146 bits (369),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 91/137 (66%), Positives = 112/137 (82%), Gaps = 5/137 (4%)
 Frame = +2

Query  101  MELMDAAILLL-ATVFLCLWXRYWSVTgggpxnlppgppgwplvgnlFQVVLQRRPFIYV  277
            MEL++AA+L+  A VF  LW   W V      NLPPGPPGWP+VGNLFQ++LQ R F++ 
Sbjct  1    MELLNAALLISSAAVFAVLW---W-VGKKPRKNLPPGPPGWPIVGNLFQIILQGRHFVFY  56

Query  278  VRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPADSPIRLIFSVGKCA  457
             R+LR KYGPIFT++MGQRTLV+V+SSEL+HEALVQ+G +FA+RP +SPIRLIFS GKC 
Sbjct  57   ARELREKYGPIFTLKMGQRTLVVVSSSELMHEALVQRGALFASRPPESPIRLIFSSGKCT  116

Query  458  INSAEYGPLWRALLRNF  508
            INSAEYGP+WR+L RNF
Sbjct  117  INSAEYGPVWRSLRRNF  133



>ref|XP_010278187.1| PREDICTED: cytochrome P450 77A2-like [Nelumbo nucifera]
Length=520

 Score =   124 bits (310),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 53/89 (60%), Positives = 71/89 (80%), Gaps = 0/89 (0%)
 Frame = +2

Query  239  FQVVLQRRPFIYVVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPAD  418
            FQV L  +PF   +RDLR KYGPIFT++MG RT++IV+S+ELIHEAL+++G +FANRP +
Sbjct  64   FQVALSGKPFFQYIRDLRPKYGPIFTLKMGTRTMIIVSSAELIHEALIEKGQVFANRPRE  123

Query  419  SPIRLIFSVGKCAINSAEYGPLWRALLRN  505
            +P R +FS  K  +NSA YGP+WR+L RN
Sbjct  124  NPTRTVFSCDKFTVNSALYGPVWRSLRRN  152



>ref|XP_006851629.1| hypothetical protein AMTR_s00040p00200250 [Amborella trichopoda]
 gb|ERN13159.1| hypothetical protein AMTR_s00040p00200250 [Amborella trichopoda]
Length=496

 Score =   121 bits (304),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 51/89 (57%), Positives = 70/89 (79%), Gaps = 0/89 (0%)
 Frame = +2

Query  239  FQVVLQRRPFIYVVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPAD  418
             Q+    +PF+++V +L  KYGPIFT++MG RTL++++S+EL HEAL+Q+G  FANRPA+
Sbjct  44   LQIARSGKPFVFIVNELSQKYGPIFTLKMGARTLIVISSAELAHEALIQKGQTFANRPAE  103

Query  419  SPIRLIFSVGKCAINSAEYGPLWRALLRN  505
            +P R IFS  K  +NSAEYGPLWR+L RN
Sbjct  104  TPTRAIFSSHKKTVNSAEYGPLWRSLRRN  132



>gb|EAZ30650.1| hypothetical protein OsJ_14702 [Oryza sativa Japonica Group]
Length=521

 Score =   120 bits (301),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 70/90 (78%), Gaps = 0/90 (0%)
 Frame = +2

Query  239  FQVVLQRRPFIYVVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPAD  418
             QVV   +PFI+ +RDLR +YGPI  +QMG RTLV+++S+EL+HEALV++G  FA RPA+
Sbjct  51   LQVVFAGKPFIHYIRDLRREYGPIVKLQMGVRTLVVISSAELVHEALVEKGREFATRPAE  110

Query  419  SPIRLIFSVGKCAINSAEYGPLWRALLRNF  508
            SPIR IFS GK  +NSA YGP WR+L RN 
Sbjct  111  SPIRSIFSSGKFTVNSAVYGPEWRSLRRNM  140



>emb|CAE04891.3| OSJNBa0042I15.13 [Oryza sativa Japonica Group]
Length=520

 Score =   120 bits (301),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 70/90 (78%), Gaps = 0/90 (0%)
 Frame = +2

Query  239  FQVVLQRRPFIYVVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPAD  418
             QVV   +PFI+ +RDLR +YGPI  +QMG RTLV+++S+EL+HEALV++G  FA RPA+
Sbjct  51   LQVVFAGKPFIHYIRDLRREYGPIVKLQMGVRTLVVISSAELVHEALVEKGREFATRPAE  110

Query  419  SPIRLIFSVGKCAINSAEYGPLWRALLRNF  508
            SPIR IFS GK  +NSA YGP WR+L RN 
Sbjct  111  SPIRSIFSSGKFTVNSAVYGPEWRSLRRNM  140



>emb|CAH66495.1| H0321H01.4 [Oryza sativa Indica Group]
 emb|CAH66519.1| OSIGBa0142C11.7 [Oryza sativa Indica Group]
Length=528

 Score =   120 bits (300),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 70/90 (78%), Gaps = 0/90 (0%)
 Frame = +2

Query  239  FQVVLQRRPFIYVVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPAD  418
             QVV   +PFI+ +RDLR +YGPI  +QMG RTLV+++S+EL+HEALV++G  FA RPA+
Sbjct  59   LQVVFAGKPFIHYIRDLRREYGPIVKLQMGVRTLVVISSAELVHEALVEKGREFATRPAE  118

Query  419  SPIRLIFSVGKCAINSAEYGPLWRALLRNF  508
            SPIR IFS GK  +NSA YGP WR+L RN 
Sbjct  119  SPIRSIFSSGKFTVNSAVYGPEWRSLRRNM  148



>gb|EEC77233.1| hypothetical protein OsI_15783 [Oryza sativa Indica Group]
Length=298

 Score =   117 bits (294),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 54/88 (61%), Positives = 69/88 (78%), Gaps = 0/88 (0%)
 Frame = +2

Query  245  VVLQRRPFIYVVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPADSP  424
            VV   +PFI+ +RDLR +YGPI  +QMG RTLV+++S+EL+HEALV++G  FA RPA+SP
Sbjct  37   VVFAGKPFIHYIRDLRREYGPIVKLQMGVRTLVVISSAELVHEALVEKGREFATRPAESP  96

Query  425  IRLIFSVGKCAINSAEYGPLWRALLRNF  508
            IR IFS GK  +NSA YGP WR+L RN 
Sbjct  97   IRSIFSSGKFTVNSAVYGPEWRSLRRNM  124



>ref|XP_009760347.1| PREDICTED: cytochrome P450 77A2 [Nicotiana sylvestris]
Length=513

 Score =   119 bits (299),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 50/89 (56%), Positives = 70/89 (79%), Gaps = 0/89 (0%)
 Frame = +2

Query  239  FQVVLQRRPFIYVVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPAD  418
            FQV   R+PF   VRDLR KYG IFT++MG RT++I++S+EL+HEALVQ+G +FA+RP +
Sbjct  56   FQVARSRKPFFQYVRDLRPKYGSIFTLKMGTRTMIIISSAELVHEALVQKGQVFASRPRE  115

Query  419  SPIRLIFSVGKCAINSAEYGPLWRALLRN  505
            +P R +FS  K  +N+A YGP+WR+L +N
Sbjct  116  NPTRTVFSCDKFTVNAAVYGPVWRSLRKN  144



>ref|XP_009392677.1| PREDICTED: cytochrome P450 77A2-like [Musa acuminata subsp. malaccensis]
Length=510

 Score =   117 bits (294),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 52/89 (58%), Positives = 70/89 (79%), Gaps = 0/89 (0%)
 Frame = +2

Query  239  FQVVLQRRPFIYVVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPAD  418
            FQV    +P I++VRDLR +YGPIFT++MG RTL++VTS EL HEAL+++G +FA+RPA+
Sbjct  54   FQVAFAGKPMIHLVRDLRLRYGPIFTLRMGARTLIVVTSPELAHEALIEKGQLFASRPAE  113

Query  419  SPIRLIFSVGKCAINSAEYGPLWRALLRN  505
            + IR +FS  K  +NSA YGP WR+L RN
Sbjct  114  TTIRSVFSCNKFTVNSAVYGPEWRSLRRN  142



>ref|NP_001052719.1| Os04g0407900 [Oryza sativa Japonica Group]
 dbj|BAF14633.1| Os04g0407900, partial [Oryza sativa Japonica Group]
Length=467

 Score =   116 bits (291),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/87 (61%), Positives = 68/87 (78%), Gaps = 0/87 (0%)
 Frame = +2

Query  248  VLQRRPFIYVVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPADSPI  427
            V   +PFI+ +RDLR +YGPI  +QMG RTLV+++S+EL+HEALV++G  FA RPA+SPI
Sbjct  1    VFAGKPFIHYIRDLRREYGPIVKLQMGVRTLVVISSAELVHEALVEKGREFATRPAESPI  60

Query  428  RLIFSVGKCAINSAEYGPLWRALLRNF  508
            R IFS GK  +NSA YGP WR+L RN 
Sbjct  61   RSIFSSGKFTVNSAVYGPEWRSLRRNM  87



>ref|XP_010110167.1| Cytochrome P450 77A3 [Morus notabilis]
 gb|EXC25405.1| Cytochrome P450 77A3 [Morus notabilis]
Length=501

 Score =   115 bits (287),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 51/89 (57%), Positives = 69/89 (78%), Gaps = 0/89 (0%)
 Frame = +2

Query  239  FQVVLQRRPFIYVVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPAD  418
            FQVV   +PF   VR+LR  YGPIFT++MG RTL+I++ ++L+HEALV++G IFA+RP +
Sbjct  47   FQVVRSGKPFFEYVRELRDTYGPIFTLKMGTRTLIILSDTKLVHEALVEKGAIFASRPRE  106

Query  419  SPIRLIFSVGKCAINSAEYGPLWRALLRN  505
            +P R IFS  K  +NSA YGP+WR+L RN
Sbjct  107  NPTRNIFSCNKFTVNSAVYGPVWRSLRRN  135



>ref|XP_004239717.1| PREDICTED: cytochrome P450 77A2 [Solanum lycopersicum]
Length=511

 Score =   114 bits (286),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 46/89 (52%), Positives = 70/89 (79%), Gaps = 0/89 (0%)
 Frame = +2

Query  239  FQVVLQRRPFIYVVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPAD  418
             QV    +PF  ++R+LR KYGPIFT++MG RT++I+++++L+HEALVQ+G IFA+RP +
Sbjct  56   LQVARSGKPFFQIMRELRQKYGPIFTLRMGTRTMIIISNADLVHEALVQKGQIFASRPRE  115

Query  419  SPIRLIFSVGKCAINSAEYGPLWRALLRN  505
            +P R +FS  K  +N+A YGP+WR+L +N
Sbjct  116  NPTRTVFSCDKFTVNAAVYGPVWRSLRKN  144



>ref|XP_009603326.1| PREDICTED: cytochrome P450 77A2 [Nicotiana tomentosiformis]
Length=513

 Score =   114 bits (284),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 48/89 (54%), Positives = 69/89 (78%), Gaps = 0/89 (0%)
 Frame = +2

Query  239  FQVVLQRRPFIYVVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPAD  418
            FQV    +PF   VRDLR KYG IFT++MG RT++I++S++L+HEALVQ+G +FA+RP +
Sbjct  56   FQVAHSGKPFFQYVRDLRPKYGSIFTLKMGTRTMIIISSADLVHEALVQKGQVFASRPRE  115

Query  419  SPIRLIFSVGKCAINSAEYGPLWRALLRN  505
            +P R +FS  K  +N+A YGP+WR+L +N
Sbjct  116  NPTRTVFSCDKFTVNAAVYGPVWRSLRKN  144



>ref|XP_006345856.1| PREDICTED: cytochrome P450 77A2-like [Solanum tuberosum]
Length=511

 Score =   114 bits (284),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 45/89 (51%), Positives = 70/89 (79%), Gaps = 0/89 (0%)
 Frame = +2

Query  239  FQVVLQRRPFIYVVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPAD  418
             QV    +PF  ++R+LR KYGPIFT++MG RT++I+++++L+HEALVQ+G +FA+RP +
Sbjct  56   LQVARSGKPFFQIMRELRQKYGPIFTLRMGTRTMIIISNADLVHEALVQKGQVFASRPRE  115

Query  419  SPIRLIFSVGKCAINSAEYGPLWRALLRN  505
            +P R +FS  K  +N+A YGP+WR+L +N
Sbjct  116  NPTRTVFSCDKFTVNAAVYGPVWRSLRKN  144



>ref|XP_009414952.1| PREDICTED: cytochrome P450 77A2-like [Musa acuminata subsp. malaccensis]
Length=537

 Score =   114 bits (285),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 50/89 (56%), Positives = 68/89 (76%), Gaps = 0/89 (0%)
 Frame = +2

Query  239  FQVVLQRRPFIYVVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPAD  418
            FQV    +P I++V DLR +YGP+FT++MG RTL++VTS EL HEAL+++G +FA+RP +
Sbjct  81   FQVAFAGKPLIHLVHDLRRQYGPMFTLRMGARTLIVVTSPELAHEALIEKGQLFASRPTE  140

Query  419  SPIRLIFSVGKCAINSAEYGPLWRALLRN  505
            S IR +FS  K  +NSA YGP WR+L RN
Sbjct  141  STIRSVFSCNKFTVNSAVYGPEWRSLRRN  169



>gb|AGZ83069.1| CYP77A19 [Solanum tuberosum]
Length=511

 Score =   114 bits (284),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 45/89 (51%), Positives = 70/89 (79%), Gaps = 0/89 (0%)
 Frame = +2

Query  239  FQVVLQRRPFIYVVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPAD  418
             QV    +PF  ++R+LR KYGPIFT++MG RT++I+++++L+HEALVQ+G +FA+RP +
Sbjct  56   LQVARSGKPFFQIMRELRQKYGPIFTLRMGTRTMIIISNADLVHEALVQKGQVFASRPRE  115

Query  419  SPIRLIFSVGKCAINSAEYGPLWRALLRN  505
            +P R +FS  K  +N+A YGP+WR+L +N
Sbjct  116  NPTRTVFSCDKFTVNAAVYGPVWRSLRKN  144



>gb|AJD25188.1| cytochrome P450 CYP77A28 [Salvia miltiorrhiza]
Length=505

 Score =   112 bits (281),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 47/89 (53%), Positives = 69/89 (78%), Gaps = 0/89 (0%)
 Frame = +2

Query  239  FQVVLQRRPFIYVVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPAD  418
            FQV    +PF   +RDL   YGPIFT++MG RT+++V S++L +EAL+++GPIFA RP++
Sbjct  51   FQVAFSGKPFFQYIRDLLPIYGPIFTLKMGTRTMIVVASNDLAYEALIEKGPIFATRPSE  110

Query  419  SPIRLIFSVGKCAINSAEYGPLWRALLRN  505
            +P R+IFS  K ++N+A YGP+WR+L RN
Sbjct  111  NPTRIIFSSNKFSVNAAYYGPVWRSLRRN  139



>ref|XP_008775191.1| PREDICTED: cytochrome P450 77A2 [Phoenix dactylifera]
Length=524

 Score =   112 bits (279),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 49/89 (55%), Positives = 69/89 (78%), Gaps = 0/89 (0%)
 Frame = +2

Query  239  FQVVLQRRPFIYVVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPAD  418
            FQV L  + FI++ RDL  +YGPIFT++MG RTL+++++ EL HEAL+++G +FA+RPA+
Sbjct  67   FQVALSGKLFIHLARDLFKEYGPIFTLRMGARTLIVISTPELAHEALIEKGQLFASRPAE  126

Query  419  SPIRLIFSVGKCAINSAEYGPLWRALLRN  505
            +P R IFS  K  +NSA YGP WR+L RN
Sbjct  127  NPTRTIFSCDKFTVNSAVYGPEWRSLRRN  155



>ref|XP_010940445.1| PREDICTED: cytochrome P450 77A2 [Elaeis guineensis]
Length=524

 Score =   112 bits (279),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 49/89 (55%), Positives = 69/89 (78%), Gaps = 0/89 (0%)
 Frame = +2

Query  239  FQVVLQRRPFIYVVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPAD  418
            FQV L  + FI++ RDL  +YGPIFT++MG RTL+++ ++EL HEAL+++G +FA+RPA+
Sbjct  67   FQVALSGKLFIHLARDLFKEYGPIFTLRMGARTLIVIGTAELAHEALIEKGQLFASRPAE  126

Query  419  SPIRLIFSVGKCAINSAEYGPLWRALLRN  505
            +P R IFS  K  +NSA YGP WR+L RN
Sbjct  127  NPTRTIFSCDKFTVNSAVYGPEWRSLRRN  155



>ref|XP_011101640.1| PREDICTED: cytochrome P450 77A2-like [Sesamum indicum]
Length=531

 Score =   111 bits (278),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 48/89 (54%), Positives = 68/89 (76%), Gaps = 0/89 (0%)
 Frame = +2

Query  239  FQVVLQRRPFIYVVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPAD  418
            FQV    +PF   VR+L  KYGPI T++MG RT++I++S+EL +EAL+++GPIFA+RP +
Sbjct  75   FQVARSGKPFFQYVRELLPKYGPILTLKMGTRTMIIISSAELAYEALIEKGPIFASRPRE  134

Query  419  SPIRLIFSVGKCAINSAEYGPLWRALLRN  505
            +P R IFS  K  +N+A YGP+WR+L RN
Sbjct  135  NPTRTIFSCNKFTVNAAVYGPVWRSLRRN  163



>gb|ADJ57933.1| cytochrome P450 [Solanum torvum]
Length=511

 Score =   111 bits (277),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 45/89 (51%), Positives = 71/89 (80%), Gaps = 0/89 (0%)
 Frame = +2

Query  239  FQVVLQRRPFIYVVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPAD  418
             QV    +PF  ++R+LR KYGPIFT++MG RT++I+++++L+HEALVQ+G +FA+RP +
Sbjct  56   LQVARSGKPFFQIMRELRQKYGPIFTLRMGTRTMIILSNADLVHEALVQKGQVFASRPRE  115

Query  419  SPIRLIFSVGKCAINSAEYGPLWRALLRN  505
            +P R +FS  K ++N+A YGP+WR+L +N
Sbjct  116  NPTRSVFSCDKFSVNAAVYGPVWRSLRKN  144



>dbj|BAJ85537.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=330

 Score =   109 bits (273),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 50/89 (56%), Positives = 68/89 (76%), Gaps = 0/89 (0%)
 Frame = +2

Query  239  FQVVLQRRPFIYVVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPAD  418
            FQV    + FI+ +RDLR +YGPI T++MG RTLV+++S+EL+HEALV++GP FA+RPA+
Sbjct  70   FQVAFSGKLFIHYIRDLRREYGPILTLRMGVRTLVVISSAELVHEALVEKGPEFASRPAE  129

Query  419  SPIRLIFSVGKCAINSAEYGPLWRALLRN  505
            +  R IFS  K  +NSA YG  WR+L RN
Sbjct  130  NTTRNIFSSNKFTVNSAVYGAEWRSLRRN  158



>emb|CDO99869.1| unnamed protein product [Coffea canephora]
Length=513

 Score =   110 bits (276),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 47/89 (53%), Positives = 68/89 (76%), Gaps = 0/89 (0%)
 Frame = +2

Query  239  FQVVLQRRPFIYVVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPAD  418
            FQV    +PF   VRDL   YGPIFT++MG RT++I+TS++L++EAL+++G IF++RP +
Sbjct  57   FQVARSGKPFFQYVRDLLPIYGPIFTLKMGTRTMIIITSADLVYEALIEKGQIFSSRPRE  116

Query  419  SPIRLIFSVGKCAINSAEYGPLWRALLRN  505
            +P R IFS  K  +N+A YGP+WR+L RN
Sbjct  117  NPTRTIFSCNKFTVNAALYGPVWRSLRRN  145



>ref|XP_010694692.1| PREDICTED: cytochrome P450 77A2-like [Beta vulgaris subsp. vulgaris]
Length=551

 Score =   111 bits (277),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 47/89 (53%), Positives = 67/89 (75%), Gaps = 0/89 (0%)
 Frame = +2

Query  239  FQVVLQRRPFIYVVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPAD  418
            FQV    +PF   VRDL  KYGPIFT++MG RT++I+++ +L HEAL+++G +FA RPA+
Sbjct  94   FQVANSGKPFFEYVRDLLPKYGPIFTLKMGSRTMIIISNGQLAHEALIEKGQVFATRPAE  153

Query  419  SPIRLIFSVGKCAINSAEYGPLWRALLRN  505
            +P R IFS  K  +N+A YGP+WR+L +N
Sbjct  154  TPTRAIFSCDKFTVNAAVYGPVWRSLRKN  182



>sp|P37123.1|C77A1_SOLME RecName: Full=Cytochrome P450 77A1; AltName: Full=CYPLXXVIIA1; 
AltName: Full=Cytochrome P-450EG6, partial [Solanum melongena]
 emb|CAA50647.1| P450 hydroxylase [Solanum melongena]
Length=499

 Score =   110 bits (274),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 49/89 (55%), Positives = 67/89 (75%), Gaps = 0/89 (0%)
 Frame = +2

Query  239  FQVVLQRRPFIYVVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPAD  418
            FQV    + F   +RDL+ KYG IFT++MG RT++IV S+EL HEAL+Q+G IFA+RP +
Sbjct  41   FQVAGSGKQFFEYIRDLKPKYGSIFTLKMGSRTMIIVASAELAHEALIQKGQIFASRPRE  100

Query  419  SPIRLIFSVGKCAINSAEYGPLWRALLRN  505
            +P R IFS  K ++N+A YGP+WR+L RN
Sbjct  101  NPTRTIFSCNKFSVNAAVYGPVWRSLRRN  129



>ref|XP_002530881.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF31487.1| cytochrome P450, putative [Ricinus communis]
Length=482

 Score =   109 bits (273),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 47/89 (53%), Positives = 66/89 (74%), Gaps = 0/89 (0%)
 Frame = +2

Query  239  FQVVLQRRPFIYVVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPAD  418
            FQV    +PF   + DL  KYGPIFT++MG RTL+I+T ++L+HEAL+++G +FA RP +
Sbjct  56   FQVARSGKPFFQYIEDLIPKYGPIFTLRMGTRTLIIITEAKLVHEALIERGSLFATRPRE  115

Query  419  SPIRLIFSVGKCAINSAEYGPLWRALLRN  505
            +P R IFS  K  +N+A YGP+WR+L RN
Sbjct  116  NPTRTIFSCNKFTVNAALYGPVWRSLRRN  144



>ref|XP_009778853.1| PREDICTED: cytochrome P450 77A1-like [Nicotiana sylvestris]
Length=258

 Score =   107 bits (268),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 44/89 (49%), Positives = 68/89 (76%), Gaps = 0/89 (0%)
 Frame = +2

Query  239  FQVVLQRRPFIYVVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPAD  418
            FQ+    + F   VR+L+ KYG IFT++MG RT+++V+S++L +EAL+++G IFA RP++
Sbjct  41   FQIASSGKQFFEYVRELKPKYGSIFTLKMGARTMIVVSSADLAYEALIEKGQIFATRPSE  100

Query  419  SPIRLIFSVGKCAINSAEYGPLWRALLRN  505
            +P R IFS  K ++N+A YGPLWR+L +N
Sbjct  101  TPTRTIFSCNKFSVNAAIYGPLWRSLRKN  129



>gb|AFO67234.1| putative cytochrome P450, partial [Aralia elata]
Length=162

 Score =   105 bits (261),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 43/89 (48%), Positives = 66/89 (74%), Gaps = 0/89 (0%)
 Frame = +2

Query  239  FQVVLQRRPFIYVVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPAD  418
            FQV    +PF   V+DL  KYGPI T++MG RT++I++S++L HEAL+++G +FA+R  +
Sbjct  55   FQVAGSGKPFFQYVKDLIPKYGPILTLKMGTRTMIIISSADLAHEALIEKGQVFASRSKE  114

Query  419  SPIRLIFSVGKCAINSAEYGPLWRALLRN  505
            +  R +FS  K  +NS++YGP+WR+L RN
Sbjct  115  NSTRTVFSSNKLTVNSSDYGPVWRSLRRN  143



>gb|KDP45018.1| hypothetical protein JCGZ_01518 [Jatropha curcas]
Length=513

 Score =   109 bits (273),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 46/89 (52%), Positives = 67/89 (75%), Gaps = 0/89 (0%)
 Frame = +2

Query  239  FQVVLQRRPFIYVVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPAD  418
            FQV    +PF   + +L  KYGPIFT++MG RTL+I++ ++L+HEAL+++GP+FA RP +
Sbjct  57   FQVARSGKPFFQYIEELLPKYGPIFTLKMGTRTLIILSDAKLVHEALIERGPLFATRPRE  116

Query  419  SPIRLIFSVGKCAINSAEYGPLWRALLRN  505
            +P R IFS  K  +N+A YGP+WR+L RN
Sbjct  117  NPTRAIFSCNKFTVNAALYGPVWRSLRRN  145



>gb|AAM66094.1| cytochrom P450-like protein [Arabidopsis thaliana]
Length=512

 Score =   109 bits (273),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 45/89 (51%), Positives = 66/89 (74%), Gaps = 0/89 (0%)
 Frame = +2

Query  239  FQVVLQRRPFIYVVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPAD  418
            FQ     +PF     DL+  YGPIFT++MG RT++I++ + L+HEAL+Q+G +FA+RPA+
Sbjct  55   FQFARSGKPFFEYAEDLKKTYGPIFTLRMGTRTMIILSDATLVHEALIQRGALFASRPAE  114

Query  419  SPIRLIFSVGKCAINSAEYGPLWRALLRN  505
            +P R IFS  K  +N+A+YGP+WR+L RN
Sbjct  115  NPTRTIFSCNKFTVNAAKYGPVWRSLRRN  143



>ref|NP_196086.1| cytochrome P450, family 77, subfamily A, polypeptide 4 [Arabidopsis 
thaliana]
 sp|Q9LZ31.1|C77A4_ARATH RecName: Full=Cytochrome P450 77A4; AltName: Full=Fatty acid 
epoxidase [Arabidopsis thaliana]
 emb|CAB86008.1| cytochrom P450-like protein [Arabidopsis thaliana]
 gb|AED90769.1| cytochrome P450, family 77, subfamily A, polypeptide 4 [Arabidopsis 
thaliana]
Length=512

 Score =   109 bits (273),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 45/89 (51%), Positives = 66/89 (74%), Gaps = 0/89 (0%)
 Frame = +2

Query  239  FQVVLQRRPFIYVVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPAD  418
            FQ     +PF     DL+  YGPIFT++MG RT++I++ + L+HEAL+Q+G +FA+RPA+
Sbjct  55   FQFARSGKPFFEYAEDLKKTYGPIFTLRMGTRTMIILSDATLVHEALIQRGALFASRPAE  114

Query  419  SPIRLIFSVGKCAINSAEYGPLWRALLRN  505
            +P R IFS  K  +N+A+YGP+WR+L RN
Sbjct  115  NPTRTIFSCNKFTVNAAKYGPVWRSLRRN  143



>gb|EPS63295.1| hypothetical protein M569_11489, partial [Genlisea aurea]
Length=496

 Score =   109 bits (272),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 48/89 (54%), Positives = 66/89 (74%), Gaps = 0/89 (0%)
 Frame = +2

Query  239  FQVVLQRRPFIYVVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPAD  418
            FQV L  +PF   +R+L  +YGPIFT++MG RT++IV+S EL HEAL+++G IFA RP +
Sbjct  43   FQVALSGKPFFQYIRELLPQYGPIFTLRMGNRTMIIVSSHELAHEALIEKGQIFATRPGE  102

Query  419  SPIRLIFSVGKCAINSAEYGPLWRALLRN  505
            +  R IFS  K  +N+A YGP+WR+L RN
Sbjct  103  TATRAIFSCNKFTVNAALYGPVWRSLRRN  131



>sp|P37124.1|C77A2_SOLME RecName: Full=Cytochrome P450 77A2; AltName: Full=CYPLXXVIIA2; 
AltName: Full=Cytochrome P-450EG5 [Solanum melongena]
 emb|CAA50646.1| CYP77A2 [Solanum melongena]
Length=511

 Score =   109 bits (272),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 43/89 (48%), Positives = 68/89 (76%), Gaps = 0/89 (0%)
 Frame = +2

Query  239  FQVVLQRRPFIYVVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPAD  418
             QV    +PF  ++R+LR KYGPIFT++MG RT++I+++++L+HEAL+ +G +FA RP +
Sbjct  56   LQVARSGKPFFQIMRELRQKYGPIFTLRMGTRTMIILSNADLVHEALILKGQVFATRPRE  115

Query  419  SPIRLIFSVGKCAINSAEYGPLWRALLRN  505
            +P R +FS  K  +N+A YGP+WR+L +N
Sbjct  116  NPTRTVFSCDKFTVNAAVYGPVWRSLRKN  144



>ref|XP_008345522.1| PREDICTED: cytochrome P450 77A3-like [Malus domestica]
Length=514

 Score =   109 bits (272),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 45/89 (51%), Positives = 65/89 (73%), Gaps = 0/89 (0%)
 Frame = +2

Query  239  FQVVLQRRPFIYVVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPAD  418
            FQ     +PF     DLR KYGPIFT++MG RT++I++ ++L+HEAL+++G +FA RP +
Sbjct  58   FQFARSGKPFFQYADDLRQKYGPIFTLKMGTRTMIILSDAKLVHEALIEKGAVFATRPRE  117

Query  419  SPIRLIFSVGKCAINSAEYGPLWRALLRN  505
            +P R IFS  K  +N+A YGP+WR+L RN
Sbjct  118  NPTRTIFSCNKFTVNAAVYGPVWRSLRRN  146



>ref|XP_008446777.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 77A3-like [Cucumis 
melo]
Length=503

 Score =   108 bits (271),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 45/89 (51%), Positives = 67/89 (75%), Gaps = 0/89 (0%)
 Frame = +2

Query  239  FQVVLQRRPFIYVVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPAD  418
            FQV L ++PF   + D R  YGPIFT++MG   +V+V+ S L+HEAL+++G +FA+RP +
Sbjct  43   FQVALSKKPFFEYIEDQRRIYGPIFTLKMGPTRMVVVSDSNLVHEALIKKGVVFADRPRE  102

Query  419  SPIRLIFSVGKCAINSAEYGPLWRALLRN  505
            +P R+IFS  K ++N+A YGP+WR+L RN
Sbjct  103  NPTRIIFSSNKFSVNAAVYGPIWRSLRRN  131



>ref|XP_004496181.1| PREDICTED: cytochrome P450 77A3-like [Cicer arietinum]
Length=521

 Score =   109 bits (272),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 43/89 (48%), Positives = 68/89 (76%), Gaps = 0/89 (0%)
 Frame = +2

Query  239  FQVVLQRRPFIYVVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPAD  418
            FQV    +PF   V+D++ KYG IFT++MG RT++I+T ++L+HEA++Q+G ++A+RP +
Sbjct  60   FQVANSGKPFFEYVKDMKAKYGSIFTLKMGTRTMIIITDAKLVHEAMIQKGALYASRPPE  119

Query  419  SPIRLIFSVGKCAINSAEYGPLWRALLRN  505
            +P R IFS  K  +N+A YGP+W++L RN
Sbjct  120  NPTRNIFSANKFTVNAAVYGPVWKSLRRN  148



>ref|XP_002270736.1| PREDICTED: cytochrome P450 77A2 [Vitis vinifera]
 emb|CBI40213.3| unnamed protein product [Vitis vinifera]
Length=515

 Score =   108 bits (271),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 46/89 (52%), Positives = 66/89 (74%), Gaps = 0/89 (0%)
 Frame = +2

Query  239  FQVVLQRRPFIYVVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPAD  418
            FQ     + F   VR+LR KYGPIFT++MG RT++I++S+EL HEAL+++G  FA+RP +
Sbjct  59   FQFARSGKQFFQYVRELRPKYGPIFTLKMGNRTMIIISSAELAHEALIEKGQSFASRPRE  118

Query  419  SPIRLIFSVGKCAINSAEYGPLWRALLRN  505
            +P R +FS  K  +N+A YGP+WR+L RN
Sbjct  119  NPTRTVFSCNKFTVNAAVYGPVWRSLRRN  147



>emb|CAN65790.1| hypothetical protein VITISV_042049 [Vitis vinifera]
Length=515

 Score =   108 bits (271),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 46/89 (52%), Positives = 66/89 (74%), Gaps = 0/89 (0%)
 Frame = +2

Query  239  FQVVLQRRPFIYVVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPAD  418
            FQ     + F   VR+LR KYGPIFT++MG RT++I++S+EL HEAL+++G  FA+RP +
Sbjct  59   FQFARSGKQFFQYVRELRPKYGPIFTLKMGNRTMIIISSAELAHEALIEKGQSFASRPRE  118

Query  419  SPIRLIFSVGKCAINSAEYGPLWRALLRN  505
            +P R +FS  K  +N+A YGP+WR+L RN
Sbjct  119  NPTRTVFSCNKFTVNAAVYGPVWRSLRRN  147



>ref|XP_003536307.2| PREDICTED: cytochrome P450 77A3-like [Glycine max]
Length=536

 Score =   109 bits (272),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 45/89 (51%), Positives = 65/89 (73%), Gaps = 0/89 (0%)
 Frame = +2

Query  239  FQVVLQRRPFIYVVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPAD  418
            FQV    +PF   V D+R KYG IFT++MG RT++I+T S+L+HEA++Q+G  +A RP +
Sbjct  72   FQVARSGKPFFEYVNDVRLKYGSIFTLKMGTRTMIILTDSKLVHEAMIQKGATYATRPPE  131

Query  419  SPIRLIFSVGKCAINSAEYGPLWRALLRN  505
            +P R IFS  K  +N+A YGP+W++L RN
Sbjct  132  NPTRTIFSENKFTVNAATYGPVWKSLRRN  160



>ref|XP_009778849.1| PREDICTED: cytochrome P450 77A1-like isoform X2 [Nicotiana sylvestris]
Length=501

 Score =   108 bits (270),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 46/89 (52%), Positives = 69/89 (78%), Gaps = 0/89 (0%)
 Frame = +2

Query  239  FQVVLQRRPFIYVVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPAD  418
            FQV    + F   +R+L+ KYG IFT++MG RT++IV+S++L +EAL+++GPIFA RP++
Sbjct  44   FQVAGSGKQFFEYIRELKPKYGSIFTLKMGARTMIIVSSADLAYEALIEKGPIFATRPSE  103

Query  419  SPIRLIFSVGKCAINSAEYGPLWRALLRN  505
            +P R IFS  K ++N+A YGPLWR+L +N
Sbjct  104  NPTRTIFSCNKFSVNAAIYGPLWRSLRKN  132



>ref|XP_009778848.1| PREDICTED: cytochrome P450 77A1-like isoform X1 [Nicotiana sylvestris]
Length=502

 Score =   108 bits (270),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 46/89 (52%), Positives = 69/89 (78%), Gaps = 0/89 (0%)
 Frame = +2

Query  239  FQVVLQRRPFIYVVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPAD  418
            FQV    + F   +R+L+ KYG IFT++MG RT++IV+S++L +EAL+++GPIFA RP++
Sbjct  44   FQVAGSGKQFFEYIRELKPKYGSIFTLKMGARTMIIVSSADLAYEALIEKGPIFATRPSE  103

Query  419  SPIRLIFSVGKCAINSAEYGPLWRALLRN  505
            +P R IFS  K ++N+A YGPLWR+L +N
Sbjct  104  NPTRTIFSCNKFSVNAAIYGPLWRSLRKN  132



>ref|XP_002871108.1| CYP77A4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47367.1| CYP77A4 [Arabidopsis lyrata subsp. lyrata]
Length=511

 Score =   108 bits (269),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 44/89 (49%), Positives = 66/89 (74%), Gaps = 0/89 (0%)
 Frame = +2

Query  239  FQVVLQRRPFIYVVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPAD  418
            FQ     +PF     +L+  YGPIFT++MG RT++I++ + L+HEAL+Q+G +FA+RPA+
Sbjct  54   FQFARSGKPFFEYAEELKKTYGPIFTLRMGTRTMIILSDASLVHEALIQRGALFASRPAE  113

Query  419  SPIRLIFSVGKCAINSAEYGPLWRALLRN  505
            +P R IFS  K  +N+A+YGP+WR+L RN
Sbjct  114  NPTRTIFSCNKFTVNAAKYGPVWRSLRRN  142



>sp|O48928.1|C77A3_SOYBN RecName: Full=Cytochrome P450 77A3 [Glycine max]
 gb|AAB94593.1| CYP77A3p [Glycine max]
Length=513

 Score =   108 bits (269),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 44/89 (49%), Positives = 65/89 (73%), Gaps = 0/89 (0%)
 Frame = +2

Query  239  FQVVLQRRPFIYVVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPAD  418
            FQV    +PF   V D+R KYG IFT++MG RT++I+T ++L+HEA++Q+G  +A RP +
Sbjct  51   FQVARSGKPFFEYVNDVRLKYGSIFTLKMGTRTMIILTDAKLVHEAMIQKGATYATRPPE  110

Query  419  SPIRLIFSVGKCAINSAEYGPLWRALLRN  505
            +P R IFS  K  +N+A YGP+W++L RN
Sbjct  111  NPTRTIFSENKFTVNAATYGPVWKSLRRN  139



>ref|XP_008347045.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 77A3-like [Malus 
domestica]
Length=514

 Score =   107 bits (268),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 44/89 (49%), Positives = 65/89 (73%), Gaps = 0/89 (0%)
 Frame = +2

Query  239  FQVVLQRRPFIYVVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPAD  418
            FQ     +PF     DLR KYGPIFT++MG RT++I++ ++L+HEAL+++G +FA RP +
Sbjct  58   FQFARSGKPFFEYADDLRKKYGPIFTLKMGNRTMIILSDAKLVHEALIEKGVVFATRPRE  117

Query  419  SPIRLIFSVGKCAINSAEYGPLWRALLRN  505
            +P R IFS  K  +N++ YGP+WR+L RN
Sbjct  118  NPTRTIFSCNKFTVNASIYGPVWRSLRRN  146



>gb|EMS60370.1| Cytochrome P450 77A3 [Triticum urartu]
Length=311

 Score =   105 bits (263),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 47/60 (78%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = +2

Query  329  QRTLVIVTSSELIHEALVQQGPIFANRPADSPIRLIFSVGKCAINSAEYGPLWRALLRNF  508
             RTLVIVT ++LIH+ALV+QGP+FA+RPADSPIRL+FSVGKC +NSA YGPLWRAL RNF
Sbjct  30   HRTLVIVTDADLIHDALVKQGPMFASRPADSPIRLLFSVGKCTVNSAPYGPLWRALRRNF  89



>ref|XP_006360482.1| PREDICTED: cytochrome P450 77A1-like [Solanum tuberosum]
Length=511

 Score =   107 bits (267),  Expect = 5e-24, Method: Composition-based stats.
 Identities = 46/89 (52%), Positives = 67/89 (75%), Gaps = 0/89 (0%)
 Frame = +2

Query  239  FQVVLQRRPFIYVVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPAD  418
            FQV    + F   +RDL+ KYG IFT++MG RT++I+TS++L HEAL+++G IFA+RP +
Sbjct  53   FQVAGSGKQFFEYIRDLKPKYGSIFTLKMGSRTMIIITSADLSHEALIEKGQIFASRPRE  112

Query  419  SPIRLIFSVGKCAINSAEYGPLWRALLRN  505
            +P R IFS  K  +N+A +GP+WR+L RN
Sbjct  113  NPTRTIFSCNKFTVNAAVHGPVWRSLRRN  141



>ref|XP_008375581.1| PREDICTED: cytochrome P450 77A3-like [Malus domestica]
Length=514

 Score =   107 bits (267),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 44/89 (49%), Positives = 65/89 (73%), Gaps = 0/89 (0%)
 Frame = +2

Query  239  FQVVLQRRPFIYVVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPAD  418
            FQ     +PF     DLR KYGPIFT++MG RT++I++ ++L+HEAL+++G +FA RP +
Sbjct  58   FQFARSGKPFFEYADDLRKKYGPIFTLKMGNRTMIILSDAKLVHEALIEKGVVFATRPRE  117

Query  419  SPIRLIFSVGKCAINSAEYGPLWRALLRN  505
            +P R IFS  K  +N++ YGP+WR+L RN
Sbjct  118  NPTRTIFSCNKFTVNASIYGPVWRSLRRN  146



>ref|NP_001132177.1| uncharacterized protein LOC100193602 [Zea mays]
 gb|ACF80918.1| unknown [Zea mays]
Length=545

 Score =   107 bits (268),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 49/90 (54%), Positives = 67/90 (74%), Gaps = 0/90 (0%)
 Frame = +2

Query  239  FQVVLQRRPFIYVVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPAD  418
            FQV    + FI+ +R+LR +YGPI T++MG+RTLVI++S+EL HEALV++G  FA+RP +
Sbjct  71   FQVAFSGKLFIHYIRELRKEYGPILTLRMGERTLVIISSAELAHEALVEKGREFASRPRE  130

Query  419  SPIRLIFSVGKCAINSAEYGPLWRALLRNF  508
            +  R IFS  K  +NSA YGP WR+L RN 
Sbjct  131  NTTRNIFSSNKLTVNSAVYGPEWRSLRRNM  160



>ref|XP_003556278.2| PREDICTED: cytochrome P450 77A3-like [Glycine max]
Length=622

 Score =   108 bits (269),  Expect = 6e-24, Method: Composition-based stats.
 Identities = 44/89 (49%), Positives = 65/89 (73%), Gaps = 0/89 (0%)
 Frame = +2

Query  239  FQVVLQRRPFIYVVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPAD  418
            FQV    +PF   V D+R KYG IFT++MG RT++I+T ++L+HEA++Q+G  +A RP +
Sbjct  160  FQVARSGKPFFEYVNDVRLKYGSIFTLKMGTRTMIILTDAKLVHEAMIQKGATYATRPPE  219

Query  419  SPIRLIFSVGKCAINSAEYGPLWRALLRN  505
            +P R IFS  K  +N+A YGP+W++L RN
Sbjct  220  NPTRTIFSENKFTVNAATYGPVWKSLRRN  248



>ref|XP_010032100.1| PREDICTED: cytochrome P450 77A3-like isoform X1 [Eucalyptus grandis]
 gb|KCW51494.1| hypothetical protein EUGRSUZ_J01011 [Eucalyptus grandis]
Length=506

 Score =   107 bits (266),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 46/89 (52%), Positives = 65/89 (73%), Gaps = 0/89 (0%)
 Frame = +2

Query  239  FQVVLQRRPFIYVVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPAD  418
            FQV    +PF   V DLR KYGPIFT++MG RT++I+  ++LIHEAL+++G +F  RP +
Sbjct  50   FQVARSGKPFFMYVEDLRPKYGPIFTLRMGTRTMIILADAKLIHEALIERGALFMTRPRE  109

Query  419  SPIRLIFSVGKCAINSAEYGPLWRALLRN  505
            +P R +FS  K  +N+A YGP+WR+L RN
Sbjct  110  NPTRAVFSCYKFTVNAAVYGPVWRSLRRN  138



>gb|AGZ83070.1| CYP77A20 [Solanum tuberosum]
Length=503

 Score =   107 bits (266),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 46/89 (52%), Positives = 67/89 (75%), Gaps = 0/89 (0%)
 Frame = +2

Query  239  FQVVLQRRPFIYVVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPAD  418
            FQV    + F   +RDL+ KYG IFT++MG RT++I+TS++L HEAL+++G IFA+RP +
Sbjct  45   FQVAGSGKQFFEYIRDLKPKYGSIFTLKMGSRTMIIITSADLSHEALIEKGQIFASRPRE  104

Query  419  SPIRLIFSVGKCAINSAEYGPLWRALLRN  505
            +P R IFS  K  +N+A +GP+WR+L RN
Sbjct  105  NPTRTIFSCNKFTVNAAVHGPVWRSLRRN  133



>ref|XP_009336991.1| PREDICTED: cytochrome P450 77A3-like [Pyrus x bretschneideri]
Length=514

 Score =   107 bits (266),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 44/89 (49%), Positives = 65/89 (73%), Gaps = 0/89 (0%)
 Frame = +2

Query  239  FQVVLQRRPFIYVVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPAD  418
            FQ     +PF     DLR KYGPIFT++MG RT++I++ ++L+HEAL+++G +FA RP +
Sbjct  58   FQFARSGKPFFEYADDLRKKYGPIFTLKMGTRTMIILSDAKLVHEALIEKGVVFATRPRE  117

Query  419  SPIRLIFSVGKCAINSAEYGPLWRALLRN  505
            +P R IFS  K  +N++ YGP+WR+L RN
Sbjct  118  NPTRTIFSCNKFTVNASIYGPVWRSLRRN  146



>gb|KGN52206.1| hypothetical protein Csa_5G615280 [Cucumis sativus]
Length=504

 Score =   106 bits (265),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 44/89 (49%), Positives = 65/89 (73%), Gaps = 0/89 (0%)
 Frame = +2

Query  239  FQVVLQRRPFIYVVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPAD  418
            FQV L ++PF   + D R  YG IFT++MG   +V+V+ S  +HEAL+++G IFA+RP +
Sbjct  43   FQVALSKKPFFEYIEDQRRIYGSIFTLKMGPTKMVVVSDSNFVHEALIKKGAIFADRPRE  102

Query  419  SPIRLIFSVGKCAINSAEYGPLWRALLRN  505
            +P R+IFS  K ++N+A YGP+WR+L RN
Sbjct  103  NPTRIIFSSNKFSVNAAVYGPIWRSLRRN  131



>ref|XP_006289766.1| hypothetical protein CARUB_v10003366mg [Capsella rubella]
 gb|EOA22664.1| hypothetical protein CARUB_v10003366mg [Capsella rubella]
Length=511

 Score =   106 bits (264),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 43/89 (48%), Positives = 67/89 (75%), Gaps = 0/89 (0%)
 Frame = +2

Query  239  FQVVLQRRPFIYVVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPAD  418
            FQ     +PF   V +L+  +GPIFT++MG RT++I++ + L+HEAL+++G +FA+RPA+
Sbjct  54   FQFAHSGKPFFEYVEELKKTHGPIFTLRMGTRTMIILSDANLVHEALIKRGALFASRPAE  113

Query  419  SPIRLIFSVGKCAINSAEYGPLWRALLRN  505
            +P R IFS  K  +N+A+YGP+WR+L RN
Sbjct  114  NPTRTIFSCNKFTVNAAKYGPVWRSLRRN  142



>ref|XP_009610308.1| PREDICTED: cytochrome P450 77A1-like [Nicotiana tomentosiformis]
Length=501

 Score =   106 bits (264),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 45/89 (51%), Positives = 68/89 (76%), Gaps = 0/89 (0%)
 Frame = +2

Query  239  FQVVLQRRPFIYVVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPAD  418
            FQ+    + F   VR+L+ KYG IFT++MG RT+++V+S++L +EAL+++G IFA RP++
Sbjct  41   FQIASSGKQFFEYVRELKPKYGSIFTLKMGARTMIVVSSADLAYEALIEKGQIFATRPSE  100

Query  419  SPIRLIFSVGKCAINSAEYGPLWRALLRN  505
            +P R IFS  K ++N+A YGPLWR+L RN
Sbjct  101  TPTRTIFSCNKFSVNAAIYGPLWRSLRRN  129



>ref|XP_007010384.1| Cytochrome P450 77A3 [Theobroma cacao]
 gb|EOY19194.1| Cytochrome P450 77A3 [Theobroma cacao]
Length=516

 Score =   106 bits (264),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 44/89 (49%), Positives = 64/89 (72%), Gaps = 0/89 (0%)
 Frame = +2

Query  239  FQVVLQRRPFIYVVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPAD  418
            FQ     +PF   V DLR KYGPIFT++MG RT++I++ ++L HEA +++G + A+RP +
Sbjct  60   FQAARSGKPFFEYVEDLRKKYGPIFTLRMGTRTMIILSDAKLCHEAFIEKGALLASRPRE  119

Query  419  SPIRLIFSVGKCAINSAEYGPLWRALLRN  505
            +P R IFS  K  +N+A YGP+WR+L RN
Sbjct  120  NPTRNIFSCNKFTVNAAVYGPVWRSLRRN  148



>ref|XP_007143825.1| hypothetical protein PHAVU_007G104800g [Phaseolus vulgaris]
 gb|ESW15819.1| hypothetical protein PHAVU_007G104800g [Phaseolus vulgaris]
Length=506

 Score =   106 bits (264),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 44/89 (49%), Positives = 65/89 (73%), Gaps = 0/89 (0%)
 Frame = +2

Query  239  FQVVLQRRPFIYVVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPAD  418
            FQV    +PF   V D+R KYG IFT++MG RT++I+T ++L+HEA++Q+G  +A RP +
Sbjct  46   FQVARSGKPFFEYVNDVRLKYGSIFTLKMGTRTMIILTDAKLVHEAMIQKGATYATRPPE  105

Query  419  SPIRLIFSVGKCAINSAEYGPLWRALLRN  505
            +P R IFS  K  +N+A YGP+W++L RN
Sbjct  106  NPTRTIFSENKFTVNAALYGPVWKSLRRN  134



>tpg|DAA37962.1| TPA: putative cytochrome P450 superfamily protein [Zea mays]
Length=612

 Score =   107 bits (266),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 49/89 (55%), Positives = 67/89 (75%), Gaps = 0/89 (0%)
 Frame = +2

Query  239  FQVVLQRRPFIYVVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPAD  418
            FQV    + FI+ +R+LR +YGPI T++MG+RTLVI++S+EL HEALV++G  FA+RP +
Sbjct  138  FQVAFSGKLFIHYIRELRKEYGPILTLRMGERTLVIISSAELAHEALVEKGREFASRPRE  197

Query  419  SPIRLIFSVGKCAINSAEYGPLWRALLRN  505
            +  R IFS  K  +NSA YGP WR+L RN
Sbjct  198  NTTRNIFSSNKLTVNSAVYGPEWRSLRRN  226



>ref|XP_008456581.1| PREDICTED: cytochrome P450 77A3-like [Cucumis melo]
Length=514

 Score =   105 bits (263),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 45/89 (51%), Positives = 67/89 (75%), Gaps = 0/89 (0%)
 Frame = +2

Query  239  FQVVLQRRPFIYVVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPAD  418
            FQV    + F   + D+R  YGPIFT+QMG RT++I++  +LIHEAL+++GP FA+RPA+
Sbjct  57   FQVARTGKHFFEYIEDIRQIYGPIFTLQMGARTMIILSGPDLIHEALIKRGPAFASRPAE  116

Query  419  SPIRLIFSVGKCAINSAEYGPLWRALLRN  505
            +P R++FS  K ++N+A YG +WR+L RN
Sbjct  117  NPTRIVFSNNKFSVNAAVYGGVWRSLRRN  145



>gb|ABC59108.1| cytochrome P450 monooxygenase CYP77A12 [Medicago truncatula]
Length=288

 Score =   103 bits (258),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 42/89 (47%), Positives = 66/89 (74%), Gaps = 0/89 (0%)
 Frame = +2

Query  239  FQVVLQRRPFIYVVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPAD  418
            FQV    + F   V+D++ KYG IFT++MG RT++I+T ++L+HEA +Q+G ++A+RP +
Sbjct  59   FQVARSGKQFQDYVKDMKAKYGSIFTLKMGTRTMIIITDAKLVHEAFIQKGALYASRPPE  118

Query  419  SPIRLIFSVGKCAINSAEYGPLWRALLRN  505
            +P R IFS  K  +N+A YGP+W++L RN
Sbjct  119  NPTRNIFSANKFTVNAAVYGPVWKSLRRN  147



>gb|KJB73379.1| hypothetical protein B456_011G229800 [Gossypium raimondii]
Length=505

 Score =   105 bits (263),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 44/89 (49%), Positives = 66/89 (74%), Gaps = 0/89 (0%)
 Frame = +2

Query  239  FQVVLQRRPFIYVVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPAD  418
            FQV    +PF   V +LR +YGPIFT++MG RT++I++ ++L HEA +++G +FA+RP +
Sbjct  46   FQVARSGKPFFEYVDELRHQYGPIFTLKMGTRTMIILSDAKLCHEAFIEKGVVFASRPRE  105

Query  419  SPIRLIFSVGKCAINSAEYGPLWRALLRN  505
            +P R IFS  K  +N+A YGP+WR+L RN
Sbjct  106  NPTRNIFSCNKFTVNAAVYGPVWRSLRRN  134



>ref|XP_003581190.2| PREDICTED: cytochrome P450 77A4-like [Brachypodium distachyon]
Length=523

 Score =   105 bits (263),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 50/90 (56%), Positives = 66/90 (73%), Gaps = 0/90 (0%)
 Frame = +2

Query  239  FQVVLQRRPFIYVVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPAD  418
            FQV    + FI+ +RDLR +YGPI T++MG RTLV+++S+EL HEALVQ+G  FA+RPA+
Sbjct  57   FQVAFSGKLFIHYIRDLRREYGPILTLRMGVRTLVVISSAELAHEALVQKGQEFASRPAE  116

Query  419  SPIRLIFSVGKCAINSAEYGPLWRALLRNF  508
            +  R IFS  K  +NSA YG  WR+L RN 
Sbjct  117  NATRNIFSSNKFTVNSAVYGAEWRSLRRNM  146



>gb|AGT16500.1| hypothetical protein SHCRBa_022_D13_R_80 [Saccharum hybrid cultivar 
R570]
Length=542

 Score =   105 bits (263),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 49/89 (55%), Positives = 66/89 (74%), Gaps = 0/89 (0%)
 Frame = +2

Query  239  FQVVLQRRPFIYVVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPAD  418
            FQV    + FI+ +RDLR +YGPI T++MG+RTLVI++S+EL HEALV++G  FA+RP +
Sbjct  74   FQVAFSGKLFIHYIRDLRKEYGPILTLRMGERTLVIISSAELAHEALVEKGQEFASRPRE  133

Query  419  SPIRLIFSVGKCAINSAEYGPLWRALLRN  505
            +  R IFS  K  +NSA YG  WR+L RN
Sbjct  134  NTTRNIFSSNKFTVNSAVYGAEWRSLRRN  162



>ref|XP_010486076.1| PREDICTED: cytochrome P450 77A4-like [Camelina sativa]
Length=513

 Score =   105 bits (262),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 42/89 (47%), Positives = 64/89 (72%), Gaps = 0/89 (0%)
 Frame = +2

Query  239  FQVVLQRRPFIYVVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPAD  418
            FQ    ++ F   V D+R KYGPIFT++MG RT++I++ S + H+ L+Q+GP+FA RP++
Sbjct  57   FQFARSKKQFYEYVDDVRNKYGPIFTLRMGSRTMIIISDSAIAHDVLIQRGPMFATRPSE  116

Query  419  SPIRLIFSVGKCAINSAEYGPLWRALLRN  505
            +P R IFS     +N++ YGP+WR+L RN
Sbjct  117  NPTRTIFSSNTFTVNASAYGPVWRSLRRN  145



>gb|AGT16905.1| cytochrome P450 [Saccharum hybrid cultivar R570]
Length=543

 Score =   105 bits (262),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 49/89 (55%), Positives = 66/89 (74%), Gaps = 0/89 (0%)
 Frame = +2

Query  239  FQVVLQRRPFIYVVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPAD  418
            FQV    + FI+ +RDLR +YGPI T++MG+RTLVI++S+EL HEALV++G  FA+RP +
Sbjct  74   FQVAFSGKLFIHYIRDLRKEYGPILTLRMGERTLVIISSAELAHEALVEKGREFASRPRE  133

Query  419  SPIRLIFSVGKCAINSAEYGPLWRALLRN  505
            +  R IFS  K  +NSA YG  WR+L RN
Sbjct  134  NTTRNIFSSNKFTVNSAVYGAEWRSLRRN  162



>ref|XP_009778850.1| PREDICTED: cytochrome P450 77A1-like [Nicotiana sylvestris]
Length=498

 Score =   105 bits (261),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 44/89 (49%), Positives = 68/89 (76%), Gaps = 0/89 (0%)
 Frame = +2

Query  239  FQVVLQRRPFIYVVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPAD  418
            FQ+    + F   VR+L+ KYG IFT++MG RT+++V+S++L +EAL+++G IFA RP++
Sbjct  41   FQIASSGKQFFEYVRELKPKYGSIFTLKMGARTMIVVSSADLAYEALIEKGQIFATRPSE  100

Query  419  SPIRLIFSVGKCAINSAEYGPLWRALLRN  505
            +P R IFS  K ++N+A YGPLWR+L +N
Sbjct  101  TPTRTIFSCNKFSVNAAIYGPLWRSLRKN  129



>ref|XP_011032810.1| PREDICTED: cytochrome P450 77A3-like [Populus euphratica]
Length=517

 Score =   105 bits (261),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 44/89 (49%), Positives = 65/89 (73%), Gaps = 0/89 (0%)
 Frame = +2

Query  239  FQVVLQRRPFIYVVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPAD  418
            FQV    +PF   V D+R KYG IFT++MG RT++I++ S+L HEAL+++G  FA+RP +
Sbjct  61   FQVAQSGKPFFEYVDDIRSKYGSIFTLKMGTRTMIIISDSKLAHEALIERGACFASRPKE  120

Query  419  SPIRLIFSVGKCAINSAEYGPLWRALLRN  505
            +P R +FS  K ++N+A YG +WR+L RN
Sbjct  121  NPTRTVFSCNKFSVNAAVYGSVWRSLRRN  149



>ref|XP_010464733.1| PREDICTED: cytochrome P450 77A4-like [Camelina sativa]
Length=513

 Score =   105 bits (261),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 42/89 (47%), Positives = 64/89 (72%), Gaps = 0/89 (0%)
 Frame = +2

Query  239  FQVVLQRRPFIYVVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPAD  418
            FQ    ++ F   V D+R KYGPIFT++MG RT++I++ S + H+ L+Q+GP+FA RP++
Sbjct  57   FQFARSKKQFYEYVDDVRNKYGPIFTLRMGSRTMIIISDSAIAHDVLIQRGPMFATRPSE  116

Query  419  SPIRLIFSVGKCAINSAEYGPLWRALLRN  505
            +P R IFS     +N++ YGP+WR+L RN
Sbjct  117  NPTRTIFSSNTFTVNASAYGPVWRSLRRN  145



>ref|XP_010486669.1| PREDICTED: cytochrome P450 77A4 [Camelina sativa]
Length=544

 Score =   105 bits (261),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 42/89 (47%), Positives = 64/89 (72%), Gaps = 0/89 (0%)
 Frame = +2

Query  239  FQVVLQRRPFIYVVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPAD  418
            FQ    ++ F   V D+R KYGPIFT++MG RT++I++ S + H+ L+Q+GP+FA RP++
Sbjct  88   FQFARSKKQFYEYVDDVRNKYGPIFTLRMGSRTMIIISDSAIAHDVLIQRGPMFATRPSE  147

Query  419  SPIRLIFSVGKCAINSAEYGPLWRALLRN  505
            +P R IFS     +N++ YGP+WR+L RN
Sbjct  148  NPTRTIFSSNTFTVNASAYGPVWRSLRRN  176



>ref|XP_002446399.1| hypothetical protein SORBIDRAFT_06g015320 [Sorghum bicolor]
 gb|EES10727.1| hypothetical protein SORBIDRAFT_06g015320 [Sorghum bicolor]
Length=544

 Score =   105 bits (261),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 49/89 (55%), Positives = 66/89 (74%), Gaps = 0/89 (0%)
 Frame = +2

Query  239  FQVVLQRRPFIYVVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPAD  418
            FQV    + FI+ +RDLR +YGPI T++MG+RTLVI++S+EL HEALV++G  FA+RP +
Sbjct  70   FQVAFSGKLFIHYIRDLRKEYGPILTLRMGERTLVIISSAELAHEALVEKGREFASRPRE  129

Query  419  SPIRLIFSVGKCAINSAEYGPLWRALLRN  505
            +  R IFS  K  +NSA YG  WR+L RN
Sbjct  130  NTTRNIFSSNKFTVNSAVYGAEWRSLRRN  158



>gb|KDO46108.1| hypothetical protein CISIN_1g010526mg [Citrus sinensis]
Length=508

 Score =   104 bits (260),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 45/89 (51%), Positives = 65/89 (73%), Gaps = 0/89 (0%)
 Frame = +2

Query  239  FQVVLQRRPFIYVVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPAD  418
            FQV    +PF   V DL   YGPIFT++MG RT++I++ ++L+HEAL+++G +FA RP +
Sbjct  49   FQVARSGKPFFKYVDDLLPIYGPIFTLRMGTRTMIILSDAKLVHEALIEKGSLFATRPRE  108

Query  419  SPIRLIFSVGKCAINSAEYGPLWRALLRN  505
            +P R IFS  K  +N+A YGP+WR+L RN
Sbjct  109  NPTRTIFSCNKFTVNAALYGPVWRSLRRN  137



>ref|XP_006436671.1| hypothetical protein CICLE_v10031286mg [Citrus clementina]
 ref|XP_006492188.1| PREDICTED: cytochrome P450 77A3-like [Citrus sinensis]
 gb|ESR49911.1| hypothetical protein CICLE_v10031286mg [Citrus clementina]
Length=508

 Score =   104 bits (260),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 45/89 (51%), Positives = 65/89 (73%), Gaps = 0/89 (0%)
 Frame = +2

Query  239  FQVVLQRRPFIYVVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPAD  418
            FQV    +PF   V DL   YGPIFT++MG RT++I++ ++L+HEAL+++G +FA RP +
Sbjct  49   FQVARSGKPFFKYVDDLLPIYGPIFTLRMGTRTMIILSDAKLVHEALIEKGSLFATRPRE  108

Query  419  SPIRLIFSVGKCAINSAEYGPLWRALLRN  505
            +P R IFS  K  +N+A YGP+WR+L RN
Sbjct  109  NPTRTIFSCNKFTVNAALYGPVWRSLRRN  137



>ref|XP_010312564.1| PREDICTED: cytochrome P450 77A1 [Solanum lycopersicum]
Length=503

 Score =   104 bits (259),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 46/89 (52%), Positives = 65/89 (73%), Gaps = 0/89 (0%)
 Frame = +2

Query  239  FQVVLQRRPFIYVVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPAD  418
            FQV    + F   +RDL+ KY  IFT++MG RT++IVTS++L HEAL+++G IFA+RP +
Sbjct  45   FQVAGSGKQFFQYIRDLKPKYDSIFTLKMGSRTMIIVTSADLAHEALIEKGQIFASRPKE  104

Query  419  SPIRLIFSVGKCAINSAEYGPLWRALLRN  505
            +P R IFS  K  +N+A YG +WR+L RN
Sbjct  105  NPTRTIFSCNKFTVNAAVYGAVWRSLRRN  133



>ref|XP_002311965.1| CYP77A3p family protein [Populus trichocarpa]
 gb|EEE89332.1| CYP77A3p family protein [Populus trichocarpa]
Length=514

 Score =   104 bits (259),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 44/89 (49%), Positives = 65/89 (73%), Gaps = 0/89 (0%)
 Frame = +2

Query  239  FQVVLQRRPFIYVVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPAD  418
            FQV    +PF   V D+R KYG IFT++MG RT++I++ ++L HEAL+++G  FA+RP +
Sbjct  58   FQVAQSGKPFFEYVDDIRSKYGSIFTLKMGTRTMIIISDAKLAHEALIERGACFASRPKE  117

Query  419  SPIRLIFSVGKCAINSAEYGPLWRALLRN  505
            +P R IFS  K ++N+A YG +WR+L RN
Sbjct  118  NPTRTIFSCNKFSVNAAVYGSVWRSLRRN  146



>ref|XP_006398921.1| hypothetical protein EUTSA_v10016078mg [Eutrema salsugineum]
 gb|ESQ40374.1| hypothetical protein EUTSA_v10016078mg [Eutrema salsugineum]
Length=510

 Score =   104 bits (259),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 42/89 (47%), Positives = 65/89 (73%), Gaps = 0/89 (0%)
 Frame = +2

Query  239  FQVVLQRRPFIYVVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPAD  418
            FQ     +PF     +++  YGPIFT++MG RT++I++ + L+ EAL+Q+G +FA+RPA+
Sbjct  54   FQFARSGKPFFEYAEEMKKTYGPIFTLRMGTRTMIILSDASLVREALIQRGALFASRPAE  113

Query  419  SPIRLIFSVGKCAINSAEYGPLWRALLRN  505
            +P R IFS  K  +N+A+YGP+WR+L RN
Sbjct  114  NPTRTIFSCNKFTVNAAKYGPVWRSLRRN  142



>ref|XP_004307039.1| PREDICTED: cytochrome P450 77A3-like [Fragaria vesca subsp. vesca]
Length=534

 Score =   104 bits (260),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 43/89 (48%), Positives = 66/89 (74%), Gaps = 0/89 (0%)
 Frame = +2

Query  239  FQVVLQRRPFIYVVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPAD  418
            FQV    +PF   V +LR KYGPIFT++MG RT++I++ ++L+HEAL+++G ++A RP +
Sbjct  78   FQVARSGKPFFVYVDELRHKYGPIFTLKMGTRTMIILSDAKLVHEALIEKGAVYATRPRE  137

Query  419  SPIRLIFSVGKCAINSAEYGPLWRALLRN  505
            +P R IFS  K  +N++ YG +WR+L RN
Sbjct  138  NPTRTIFSCNKFTVNASIYGSVWRSLRRN  166



>ref|XP_008231991.1| PREDICTED: cytochrome P450 77A3-like [Prunus mume]
Length=514

 Score =   104 bits (259),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 43/89 (48%), Positives = 66/89 (74%), Gaps = 0/89 (0%)
 Frame = +2

Query  239  FQVVLQRRPFIYVVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPAD  418
            FQ     + FI    +LR KYGPIFT++MG RT++I++ ++L+HEAL+++G +FA RP++
Sbjct  58   FQFSRSGKSFIEYADELRLKYGPIFTLRMGARTMIILSDAKLVHEALIEKGVVFATRPSE  117

Query  419  SPIRLIFSVGKCAINSAEYGPLWRALLRN  505
            +P R IFS  K  +N++ YGP+WR+L RN
Sbjct  118  NPTRTIFSCNKFTVNASLYGPVWRSLRRN  146



>emb|CDX80914.1| BnaC03g01680D [Brassica napus]
Length=503

 Score =   103 bits (258),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 43/89 (48%), Positives = 64/89 (72%), Gaps = 0/89 (0%)
 Frame = +2

Query  239  FQVVLQRRPFIYVVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPAD  418
            FQ     + F     +L+  YGPIFT++MG RT++I++ + L+HEAL+Q+G +FA RPA+
Sbjct  51   FQFARSGKQFFEYAEELKKTYGPIFTVRMGTRTMIILSDASLVHEALIQRGSLFATRPAE  110

Query  419  SPIRLIFSVGKCAINSAEYGPLWRALLRN  505
            +P R IFS  K  +N+A+YGP+WR+L RN
Sbjct  111  NPTRTIFSCDKFTVNAAKYGPVWRSLRRN  139



>gb|KEH43423.1| cytochrome P450 family 87 protein [Medicago truncatula]
Length=520

 Score =   104 bits (259),  Expect = 8e-23, Method: Composition-based stats.
 Identities = 42/89 (47%), Positives = 66/89 (74%), Gaps = 0/89 (0%)
 Frame = +2

Query  239  FQVVLQRRPFIYVVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPAD  418
            FQV    + F   V+D++ KYG IFT++MG RT++I+T ++L+HEA +Q+G ++A+RP +
Sbjct  59   FQVARSGKQFQDYVKDMKAKYGSIFTLKMGTRTMIIITDAKLVHEAFIQKGALYASRPPE  118

Query  419  SPIRLIFSVGKCAINSAEYGPLWRALLRN  505
            +P R IFS  K  +N+A YGP+W++L RN
Sbjct  119  NPTRNIFSANKFTVNAAVYGPVWKSLRRN  147



>ref|XP_007219021.1| hypothetical protein PRUPE_ppa004373mg [Prunus persica]
 gb|EMJ20220.1| hypothetical protein PRUPE_ppa004373mg [Prunus persica]
Length=514

 Score =   103 bits (258),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 43/89 (48%), Positives = 66/89 (74%), Gaps = 0/89 (0%)
 Frame = +2

Query  239  FQVVLQRRPFIYVVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPAD  418
            FQ     + FI    +LR KYGPIFT++MG RT++I++ ++L+HEAL+++G +FA RP++
Sbjct  58   FQFSRSGKSFIEYADELRLKYGPIFTLRMGTRTMIILSDAKLVHEALIEKGVVFATRPSE  117

Query  419  SPIRLIFSVGKCAINSAEYGPLWRALLRN  505
            +P R IFS  K  +N++ YGP+WR+L RN
Sbjct  118  NPTRTIFSCNKFTVNASLYGPVWRSLRRN  146



>emb|CDY11297.1| BnaA03g01330D [Brassica napus]
Length=503

 Score =   103 bits (257),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 43/89 (48%), Positives = 64/89 (72%), Gaps = 0/89 (0%)
 Frame = +2

Query  239  FQVVLQRRPFIYVVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPAD  418
            FQ     + F     +L+  YGPIFT++MG RT++I++ + L+HEAL+Q+G +FA RPA+
Sbjct  51   FQFARSGKQFFEYAEELKKTYGPIFTVRMGTRTMIILSDAALVHEALIQRGSLFATRPAE  110

Query  419  SPIRLIFSVGKCAINSAEYGPLWRALLRN  505
            +P R IFS  K  +N+A+YGP+WR+L RN
Sbjct  111  NPTRTIFSCDKFTVNAAKYGPVWRSLRRN  139



>ref|XP_010490980.1| PREDICTED: cytochrome P450 77A4 [Camelina sativa]
Length=512

 Score =   103 bits (257),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 43/89 (48%), Positives = 64/89 (72%), Gaps = 0/89 (0%)
 Frame = +2

Query  239  FQVVLQRRPFIYVVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPAD  418
            FQ     + F     +L+ KYG I T++MG RT++I++ + L+HEAL+++GP+FA RPA+
Sbjct  55   FQFARSGKSFFEYAEELKQKYGGILTVRMGTRTMIILSDANLVHEALIKRGPLFATRPAE  114

Query  419  SPIRLIFSVGKCAINSAEYGPLWRALLRN  505
            SP R IFS  K  +N+A+YGP+WR+L RN
Sbjct  115  SPTRTIFSCDKFTVNAAKYGPVWRSLRRN  143



>ref|XP_009609997.1| PREDICTED: cytochrome P450 77A1-like [Nicotiana tomentosiformis]
Length=501

 Score =   103 bits (257),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/89 (51%), Positives = 67/89 (75%), Gaps = 0/89 (0%)
 Frame = +2

Query  239  FQVVLQRRPFIYVVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPAD  418
            FQV    + F   + +L+ KYG IFT++MG RT++IV+S++L +EAL+++G IFA RP++
Sbjct  44   FQVAGSGKQFFEYITELKPKYGSIFTLKMGARTMIIVSSADLAYEALIEKGQIFATRPSE  103

Query  419  SPIRLIFSVGKCAINSAEYGPLWRALLRN  505
            +P R IFS  K ++N+A YGPLWR+L RN
Sbjct  104  NPTRTIFSCNKFSVNAAIYGPLWRSLRRN  132



>ref|XP_009130829.1| PREDICTED: cytochrome P450 77A4 [Brassica rapa]
Length=533

 Score =   103 bits (257),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 43/89 (48%), Positives = 64/89 (72%), Gaps = 0/89 (0%)
 Frame = +2

Query  239  FQVVLQRRPFIYVVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPAD  418
            FQ     + F     +L+  YGPIFT++MG RT++I++ + L+HEAL+Q+G +FA RPA+
Sbjct  81   FQFARSGKQFFEYAEELKKTYGPIFTVRMGTRTMIILSDATLVHEALIQRGSLFATRPAE  140

Query  419  SPIRLIFSVGKCAINSAEYGPLWRALLRN  505
            +P R IFS  K  +N+A+YGP+WR+L RN
Sbjct  141  NPTRTIFSCDKFTVNAAKYGPVWRSLRRN  169



>ref|XP_006407539.1| hypothetical protein EUTSA_v10020529mg [Eutrema salsugineum]
 gb|ESQ48992.1| hypothetical protein EUTSA_v10020529mg [Eutrema salsugineum]
Length=513

 Score =   103 bits (256),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 43/89 (48%), Positives = 62/89 (70%), Gaps = 0/89 (0%)
 Frame = +2

Query  239  FQVVLQRRPFIYVVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPAD  418
            FQ     + F     DLR KYGPI+T++MG RT++I++ S L H+AL+Q+GP+FA RP +
Sbjct  57   FQFARSGKQFYEYADDLRKKYGPIYTLRMGSRTMIIISDSTLAHDALIQRGPMFATRPKE  116

Query  419  SPIRLIFSVGKCAINSAEYGPLWRALLRN  505
            +P R IFS     +N++ YGP+WR+L RN
Sbjct  117  NPTRTIFSSNTFTVNASVYGPVWRSLRRN  145



>gb|KJB49031.1| hypothetical protein B456_008G098700 [Gossypium raimondii]
Length=519

 Score =   102 bits (255),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/89 (53%), Positives = 62/89 (70%), Gaps = 0/89 (0%)
 Frame = +2

Query  239  FQVVLQRRPFIYVVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPAD  418
            FQV    +PF   V DLR KYGPIFT++MG RT++I++ + L HEA +++G IFA RP +
Sbjct  60   FQVARSGKPFFQYVDDLRRKYGPIFTLRMGTRTIIILSDAMLCHEAFIEKGAIFAGRPRE  119

Query  419  SPIRLIFSVGKCAINSAEYGPLWRALLRN  505
            +P R IFS  K  +NSA YG  WR+L RN
Sbjct  120  NPTRNIFSCNKFTVNSAVYGLEWRSLRRN  148



>ref|XP_004173844.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 77A3-like [Cucumis 
sativus]
Length=513

 Score =   102 bits (255),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 43/89 (48%), Positives = 65/89 (73%), Gaps = 0/89 (0%)
 Frame = +2

Query  239  FQVVLQRRPFIYVVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPAD  418
            FQV    + F   + D+R  YGPI T+QMG RT++I++  +LIHEAL+++GP FA+RP +
Sbjct  57   FQVARTGKHFFEYIEDIRHNYGPILTLQMGARTMIILSGPDLIHEALIKRGPAFASRPPE  116

Query  419  SPIRLIFSVGKCAINSAEYGPLWRALLRN  505
            +P R++FS  K ++N+A YG +WR+L RN
Sbjct  117  NPTRIVFSNNKFSVNAAVYGGVWRSLRRN  145



>gb|AAO42093.1| putative cytochrome p450 [Arabidopsis thaliana]
Length=513

 Score =   102 bits (255),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 63/89 (71%), Gaps = 0/89 (0%)
 Frame = +2

Query  239  FQVVLQRRPFIYVVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPAD  418
            FQ     + F   V D+R KYGPI+T++MG RT++I++ S L+H+ L+Q+GP+FA RP +
Sbjct  57   FQFARSGKQFYEYVDDVRKKYGPIYTLRMGSRTMIIISDSALVHDVLIQRGPMFATRPTE  116

Query  419  SPIRLIFSVGKCAINSAEYGPLWRALLRN  505
            +P R IFS     +N++ YGP+WR+L +N
Sbjct  117  NPTRTIFSSNTFTVNASAYGPVWRSLRKN  145



>ref|NP_187668.1| cytochrome P450, family 77, subfamily A, polypeptide 6 [Arabidopsis 
thaliana]
 gb|AAG51390.1|AC011560_22 putative cytochrome P450; 45201-43660 [Arabidopsis thaliana]
 gb|AAF76359.1| cytochrome P450, putative [Arabidopsis thaliana]
 gb|AAV97806.1| At3g10570 [Arabidopsis thaliana]
 gb|AAX12870.1| At3g10570 [Arabidopsis thaliana]
 gb|AEE74926.1| cytochrome P450, family 77, subfamily A, polypeptide 6 [Arabidopsis 
thaliana]
Length=513

 Score =   102 bits (255),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 63/89 (71%), Gaps = 0/89 (0%)
 Frame = +2

Query  239  FQVVLQRRPFIYVVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPAD  418
            FQ     + F   V D+R KYGPI+T++MG RT++I++ S L+H+ L+Q+GP+FA RP +
Sbjct  57   FQFARSGKQFYEYVDDVRKKYGPIYTLRMGSRTMIIISDSALVHDVLIQRGPMFATRPTE  116

Query  419  SPIRLIFSVGKCAINSAEYGPLWRALLRN  505
            +P R IFS     +N++ YGP+WR+L +N
Sbjct  117  NPTRTIFSSNTFTVNASAYGPVWRSLRKN  145



>ref|XP_004140895.1| PREDICTED: cytochrome P450 77A3-like [Cucumis sativus]
 gb|KGN46023.1| Cytochrome P450 77A3 [Cucumis sativus]
Length=513

 Score =   102 bits (255),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 43/89 (48%), Positives = 65/89 (73%), Gaps = 0/89 (0%)
 Frame = +2

Query  239  FQVVLQRRPFIYVVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPAD  418
            FQV    + F   + D+R  YGPI T+QMG RT++I++  +LIHEAL+++GP FA+RP +
Sbjct  57   FQVARTGKHFFEYIEDIRHNYGPILTLQMGARTMIILSGPDLIHEALIKRGPAFASRPPE  116

Query  419  SPIRLIFSVGKCAINSAEYGPLWRALLRN  505
            +P R++FS  K ++N+A YG +WR+L RN
Sbjct  117  NPTRIVFSNNKFSVNAALYGGVWRSLRRN  145



>ref|XP_002882683.1| CYP77A6 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58942.1| CYP77A6 [Arabidopsis lyrata subsp. lyrata]
Length=513

 Score =   102 bits (255),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 63/89 (71%), Gaps = 0/89 (0%)
 Frame = +2

Query  239  FQVVLQRRPFIYVVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPAD  418
            FQ     + F   V D+R KYGPI+T++MG RT++I++ S L+H+ L+Q+GP+FA RP +
Sbjct  57   FQFARSGKQFYEYVDDVRKKYGPIYTLRMGSRTMIIISDSALVHDVLIQRGPMFATRPTE  116

Query  419  SPIRLIFSVGKCAINSAEYGPLWRALLRN  505
            +P R IFS     +N++ YGP+WR+L +N
Sbjct  117  NPTRTIFSSNTFTVNASAYGPVWRSLRKN  145



>gb|KFK38447.1| hypothetical protein AALP_AA3G114600 [Arabis alpina]
Length=1027

 Score =   103 bits (258),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 44/89 (49%), Positives = 62/89 (70%), Gaps = 0/89 (0%)
 Frame = +2

Query  239  FQVVLQRRPFIYVVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPAD  418
            FQ     + F   V DLR KYGPIFT++MG RT++I++ S L H+ L+Q+GP+FA RP +
Sbjct  571  FQFARSGKQFYEYVDDLRKKYGPIFTLRMGSRTMIIISDSTLAHDVLIQRGPMFATRPKE  630

Query  419  SPIRLIFSVGKCAINSAEYGPLWRALLRN  505
            +P R IFS     +N++ YGP+WR+L RN
Sbjct  631  NPTRTIFSSNTFTVNASVYGPVWRSLRRN  659


 Score = 95.1 bits (235),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 42/89 (47%), Positives = 61/89 (69%), Gaps = 0/89 (0%)
 Frame = +2

Query  239  FQVVLQRRPFIYVVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPAD  418
            FQ+    + F   V DLR  YGPI T+++G RTL+I++ + L HEAL+++G  FA RP +
Sbjct  57   FQLTNSGKQFFEYVDDLRKIYGPILTLRLGTRTLIIISDANLAHEALIERGAQFATRPIE  116

Query  419  SPIRLIFSVGKCAINSAEYGPLWRALLRN  505
            +P R IFS  +  ++SA YGP+WR+L RN
Sbjct  117  TPTRKIFSSSEITVHSAMYGPVWRSLRRN  145



>ref|XP_009146826.1| PREDICTED: cytochrome P450 77A4 [Brassica rapa]
Length=516

 Score =   102 bits (253),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 62/89 (70%), Gaps = 0/89 (0%)
 Frame = +2

Query  239  FQVVLQRRPFIYVVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPAD  418
            FQ    ++ F     DLR KYGPI+T++MG RT++I++ + L H+ L+Q+GP+FA RP +
Sbjct  60   FQFARSKKQFYEYADDLREKYGPIYTLRMGSRTMIIISDATLAHDVLIQRGPMFATRPKE  119

Query  419  SPIRLIFSVGKCAINSAEYGPLWRALLRN  505
            +P R IFS     +N++ YGP+WR+L RN
Sbjct  120  NPTRTIFSSNTFTVNASVYGPVWRSLRRN  148



>emb|CDY08591.1| BnaA05g28270D [Brassica napus]
Length=516

 Score =   102 bits (253),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 62/89 (70%), Gaps = 0/89 (0%)
 Frame = +2

Query  239  FQVVLQRRPFIYVVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPAD  418
            FQ    ++ F     DLR KYGPI+T++MG RT++I++ + L H+ L+Q+GP+FA RP +
Sbjct  60   FQFARSKKQFYEYADDLREKYGPIYTLRMGSRTMIIISDATLAHDVLIQRGPMFATRPKE  119

Query  419  SPIRLIFSVGKCAINSAEYGPLWRALLRN  505
            +P R IFS     +N++ YGP+WR+L RN
Sbjct  120  NPTRTIFSSNTFTVNASVYGPVWRSLRRN  148



>gb|EYU38068.1| hypothetical protein MIMGU_mgv1a004860mg [Erythranthe guttata]
Length=507

 Score =   101 bits (251),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 44/89 (49%), Positives = 65/89 (73%), Gaps = 0/89 (0%)
 Frame = +2

Query  239  FQVVLQRRPFIYVVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPAD  418
            FQV    +PF   VR+L   YGPI T++MG RT++I++S++L  EAL+++G +FA+RP +
Sbjct  51   FQVARSGKPFFQYVRELIPIYGPILTLKMGTRTMIIISSADLAKEALIEKGQVFASRPRE  110

Query  419  SPIRLIFSVGKCAINSAEYGPLWRALLRN  505
            +P R IFS  K  +N+A YGP+WR+L RN
Sbjct  111  NPTRTIFSCDKFTVNAALYGPVWRSLRRN  139



>ref|XP_010552931.1| PREDICTED: cytochrome P450 77A4 [Tarenaya hassleriana]
Length=526

 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 45/89 (51%), Positives = 62/89 (70%), Gaps = 0/89 (0%)
 Frame = +2

Query  239  FQVVLQRRPFIYVVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPAD  418
            FQ     + F     +LR  YGPIFT++MG RT++IV+ + L HEAL+Q+G +FA RPA+
Sbjct  70   FQFARSGKQFFEYADELRKVYGPIFTLRMGIRTMIIVSDANLAHEALIQRGALFATRPAE  129

Query  419  SPIRLIFSVGKCAINSAEYGPLWRALLRN  505
            +P R IFS  K  +N+A YGP+WR+L RN
Sbjct  130  NPTRSIFSCNKFTVNAAMYGPVWRSLRRN  158



>ref|XP_006297449.1| hypothetical protein CARUB_v10013470mg [Capsella rubella]
 gb|EOA30347.1| hypothetical protein CARUB_v10013470mg [Capsella rubella]
Length=515

 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 42/89 (47%), Positives = 61/89 (69%), Gaps = 0/89 (0%)
 Frame = +2

Query  239  FQVVLQRRPFIYVVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPAD  418
            FQ     + F   V D+R KYGPIFT++MG RT++I++ S L H+ L+Q+GP+FA RP +
Sbjct  59   FQFARSGKQFYEYVDDVRSKYGPIFTLRMGSRTMIIISDSALAHDVLIQRGPMFATRPTE  118

Query  419  SPIRLIFSVGKCAINSAEYGPLWRALLRN  505
            +  R IFS     +N++ YGP+WR+L RN
Sbjct  119  NSTRTIFSSNTFTVNASAYGPVWRSLRRN  147



>ref|XP_010423551.1| PREDICTED: cytochrome P450 77A4-like [Camelina sativa]
Length=540

 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 42/89 (47%), Positives = 63/89 (71%), Gaps = 0/89 (0%)
 Frame = +2

Query  239  FQVVLQRRPFIYVVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPAD  418
            FQ     + F     +L+ KYG I T++MG RT++I++ + L+HEAL+++G +FA RPA+
Sbjct  83   FQFARSGKSFFEYAEELKQKYGGILTVRMGTRTMIILSDANLVHEALIKRGALFATRPAE  142

Query  419  SPIRLIFSVGKCAINSAEYGPLWRALLRN  505
            SP R IFS  K  +N+A+YGP+WR+L RN
Sbjct  143  SPTRTIFSCDKFTVNAAKYGPVWRSLRRN  171



>ref|XP_010452364.1| PREDICTED: cytochrome P450 77A4-like [Camelina sativa]
Length=513

 Score =   100 bits (248),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 42/89 (47%), Positives = 63/89 (71%), Gaps = 0/89 (0%)
 Frame = +2

Query  239  FQVVLQRRPFIYVVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPAD  418
            FQ     + F     +L+ KYG I T++MG RT++I++ + L+HEAL+++G +FA RPA+
Sbjct  56   FQFARSGKSFFEYAEELKQKYGGILTVRMGTRTMIILSDANLVHEALIKRGALFATRPAE  115

Query  419  SPIRLIFSVGKCAINSAEYGPLWRALLRN  505
            SP R IFS  K  +N+A+YGP+WR+L RN
Sbjct  116  SPTRTIFSCDKFTVNAAKYGPVWRSLRRN  144



>emb|CDY00955.1| BnaC05g42450D [Brassica napus]
Length=516

 Score =   100 bits (248),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 61/89 (69%), Gaps = 0/89 (0%)
 Frame = +2

Query  239  FQVVLQRRPFIYVVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPAD  418
            FQ     + F     DLR KYGPI+T++MG RT++I++ + L H+ L+Q+GP+FA RP +
Sbjct  60   FQFARSGKQFYEYADDLREKYGPIYTLRMGSRTMIIISDATLAHDVLIQRGPMFATRPKE  119

Query  419  SPIRLIFSVGKCAINSAEYGPLWRALLRN  505
            +P R IFS     +N++ YGP+WR+L RN
Sbjct  120  NPTRTIFSSNTFTVNASVYGPVWRSLRRN  148



>gb|AJD25187.1| cytochrome P450 CYP77A27 [Salvia miltiorrhiza]
Length=512

 Score = 99.4 bits (246),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 44/89 (49%), Positives = 65/89 (73%), Gaps = 0/89 (0%)
 Frame = +2

Query  239  FQVVLQRRPFIYVVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPAD  418
            FQV    +PF   VR+L  KYGPI T++MG RT++I++S++L++EAL  +G +FA+RP +
Sbjct  56   FQVARSGKPFFQYVRELIPKYGPIVTLKMGTRTMIIISSADLVYEALNSKGQVFASRPRE  115

Query  419  SPIRLIFSVGKCAINSAEYGPLWRALLRN  505
            +P R IFS  K  +N+A YG +WR+L RN
Sbjct  116  NPTRTIFSCDKFTVNAALYGGVWRSLRRN  144



>gb|EPS69622.1| hypothetical protein M569_05145, partial [Genlisea aurea]
Length=470

 Score = 98.6 bits (244),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 43/89 (48%), Positives = 64/89 (72%), Gaps = 0/89 (0%)
 Frame = +2

Query  239  FQVVLQRRPFIYVVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPAD  418
            FQV    + F   VR+L   YGPI T++MG RT++I++ ++L HEAL+++G +FA+RP +
Sbjct  19   FQVARSGKQFFQYVRELIPVYGPIMTVRMGTRTMIIISGADLAHEALIEKGQVFASRPRE  78

Query  419  SPIRLIFSVGKCAINSAEYGPLWRALLRN  505
            +P R IFS  K  +N+A YGP+WR+L RN
Sbjct  79   TPTRTIFSCDKFTVNAAVYGPVWRSLRRN  107



>ref|XP_010032101.1| PREDICTED: cytochrome P450 77A3-like isoform X2 [Eucalyptus grandis]
Length=446

 Score = 97.8 bits (242),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 59/76 (78%), Gaps = 0/76 (0%)
 Frame = +2

Query  278  VRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPADSPIRLIFSVGKCA  457
            V DLR KYGPIFT++MG RT++I+  ++LIHEAL+++G +F  RP ++P R +FS  K  
Sbjct  3    VEDLRPKYGPIFTLRMGTRTMIILADAKLIHEALIERGALFMTRPRENPTRAVFSCYKFT  62

Query  458  INSAEYGPLWRALLRN  505
            +N+A YGP+WR+L RN
Sbjct  63   VNAAVYGPVWRSLRRN  78



>emb|CAN68641.1| hypothetical protein VITISV_030808 [Vitis vinifera]
Length=484

 Score = 92.8 bits (229),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 41/49 (84%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +2

Query  362  LIHEALVQQGPIFANRPADSPIRLIFSVGKCAINSAEYGPLWRALLRNF  508
            LIHEALVQ+GPIFA+RP DSP RL+FSVGKCAINSA+YGPLWR L RNF
Sbjct  64   LIHEALVQRGPIFASRPEDSPTRLVFSVGKCAINSAQYGPLWRTLRRNF  112



>ref|NP_196083.1| cytochrome P450, family 77, subfamily A, polypeptide 9 [Arabidopsis 
thaliana]
 emb|CAB85569.1| cytochrome P450-like protein [Arabidopsis thaliana]
 gb|AED90767.1| cytochrome P450, family 77, subfamily A, polypeptide 9 [Arabidopsis 
thaliana]
Length=509

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/89 (45%), Positives = 60/89 (67%), Gaps = 0/89 (0%)
 Frame = +2

Query  239  FQVVLQRRPFIYVVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPAD  418
             Q     + F   V ++R  YGPIFT++MG RT++I++ + L H+AL+++G  FA RPA+
Sbjct  52   LQFARSGKQFFEYVDEMRNIYGPIFTLKMGIRTMIIISDANLAHQALIERGAQFATRPAE  111

Query  419  SPIRLIFSVGKCAINSAEYGPLWRALLRN  505
            +P R IFS     ++SA YGP+WR+L RN
Sbjct  112  TPTRKIFSSSDITVHSAMYGPVWRSLRRN  140



>emb|CDX70209.1| BnaA10g25580D [Brassica napus]
Length=500

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 39/89 (44%), Positives = 59/89 (66%), Gaps = 0/89 (0%)
 Frame = +2

Query  239  FQVVLQRRPFIYVVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPAD  418
            FQ     + F   V +++  YGPI T++MG RT++I++ + L HEAL+++G  FA RP +
Sbjct  44   FQFARSGKQFFEYVDEMKKTYGPILTLRMGIRTMIIISDANLAHEALIERGAQFATRPVE  103

Query  419  SPIRLIFSVGKCAINSAEYGPLWRALLRN  505
            +P R IFS     ++SA YGP+WR+L RN
Sbjct  104  TPTRKIFSSSDITVHSAMYGPVWRSLRRN  132



>ref|XP_010423555.1| PREDICTED: cytochrome P450 77A4-like [Camelina sativa]
Length=508

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 58/82 (71%), Gaps = 0/82 (0%)
 Frame = +2

Query  260  RPFIYVVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPADSPIRLIF  439
            + F   V ++R  YGPIFT++MG RT++I++ S L H+AL+++G  FA RP ++P R IF
Sbjct  58   KQFFEYVDEMRNIYGPIFTLKMGIRTMIIISDSNLAHQALIERGAQFATRPVETPTRKIF  117

Query  440  SVGKCAINSAEYGPLWRALLRN  505
            S     ++SA YGP+WR+L RN
Sbjct  118  SSSDITVHSAMYGPVWRSLRRN  139



>ref|XP_009122576.1| PREDICTED: cytochrome P450 77A4 [Brassica rapa]
Length=500

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 39/89 (44%), Positives = 59/89 (66%), Gaps = 0/89 (0%)
 Frame = +2

Query  239  FQVVLQRRPFIYVVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPAD  418
            FQ     + F   V +++  YGPI T++MG RT++I++ + L HEAL+++G  FA RP +
Sbjct  44   FQFARSGKQFFEYVDEMKKTYGPILTLRMGIRTMIIISDANLAHEALIERGAQFATRPVE  103

Query  419  SPIRLIFSVGKCAINSAEYGPLWRALLRN  505
            +P R IFS     ++SA YGP+WR+L RN
Sbjct  104  TPTRKIFSSSDITVHSAMYGPVWRSLRRN  132



>ref|XP_010490979.1| PREDICTED: cytochrome P450 77A4-like [Camelina sativa]
Length=508

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 58/82 (71%), Gaps = 0/82 (0%)
 Frame = +2

Query  260  RPFIYVVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPADSPIRLIF  439
            + F   V ++R  YGPIFT++MG RT++I++ S L H+AL+++G  FA RP ++P R IF
Sbjct  58   KQFFEYVDEMRNIYGPIFTLKMGIRTMIIISDSNLAHQALIERGAQFATRPVETPTRKIF  117

Query  440  SVGKCAINSAEYGPLWRALLRN  505
            S     ++SA YGP+WR+L RN
Sbjct  118  SSSDITVHSAMYGPVWRSLRRN  139



>ref|NP_187667.1| cytochrome P450 protein UNE9 [Arabidopsis thaliana]
 gb|AAG51393.1|AC011560_25 putative cytochrome P450; 47418-45874 [Arabidopsis thaliana]
 gb|AAF76358.1| cytochrome P450, putative [Arabidopsis thaliana]
 gb|AEE74925.1| cytochrome P450 protein UNE9 [Arabidopsis thaliana]
Length=514

 Score = 91.3 bits (225),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 40/89 (45%), Positives = 59/89 (66%), Gaps = 0/89 (0%)
 Frame = +2

Query  239  FQVVLQRRPFIYVVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPAD  418
            FQ     + F   V DL   YGPI T+++G RT++I++ + L HEAL+++G  FA RP +
Sbjct  60   FQFTRSGKQFFEYVEDLVKIYGPILTLRLGTRTMIIISDASLAHEALIERGAQFATRPVE  119

Query  419  SPIRLIFSVGKCAINSAEYGPLWRALLRN  505
            +P R IFS  +  ++SA YGP+WR+L RN
Sbjct  120  TPTRKIFSSSEITVHSAMYGPVWRSLRRN  148



>ref|XP_002882682.1| CYP77A7 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58941.1| CYP77A7 [Arabidopsis lyrata subsp. lyrata]
Length=512

 Score = 91.3 bits (225),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 40/89 (45%), Positives = 59/89 (66%), Gaps = 0/89 (0%)
 Frame = +2

Query  239  FQVVLQRRPFIYVVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPAD  418
            FQ     + F   V DL   YGPI T+++G RT++I++ + L HEAL+++G  FA RP +
Sbjct  59   FQFTRSGKQFFEYVEDLVKIYGPILTLRLGTRTMIIISDASLAHEALIERGAQFATRPVE  118

Query  419  SPIRLIFSVGKCAINSAEYGPLWRALLRN  505
            +P R IFS  +  ++SA YGP+WR+L RN
Sbjct  119  TPTRKIFSSSEITVHSAMYGPVWRSLRRN  147



>ref|XP_006287416.1| hypothetical protein CARUB_v10000621mg, partial [Capsella rubella]
 gb|EOA20314.1| hypothetical protein CARUB_v10000621mg, partial [Capsella rubella]
Length=553

 Score = 91.3 bits (225),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 58/82 (71%), Gaps = 0/82 (0%)
 Frame = +2

Query  260  RPFIYVVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPADSPIRLIF  439
            + FI  V ++R  YGPI T++MG RT++I++ + L H+AL+++G  FA RP ++P R IF
Sbjct  103  KQFIEYVEEMRKMYGPILTLKMGIRTMIIISDANLAHQALIERGAQFATRPVETPTRKIF  162

Query  440  SVGKCAINSAEYGPLWRALLRN  505
            S     ++SA YGP+WR+L RN
Sbjct  163  SSSDITVHSAMYGPVWRSLRRN  184



>ref|XP_002871106.1| CYP77A9 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47365.1| CYP77A9 [Arabidopsis lyrata subsp. lyrata]
Length=506

 Score = 90.5 bits (223),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 57/82 (70%), Gaps = 0/82 (0%)
 Frame = +2

Query  260  RPFIYVVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPADSPIRLIF  439
            + F   V ++R  YGPIFT++MG RT++I++ + L H+AL+++G  FA RP ++P R IF
Sbjct  56   KQFFEYVDEMRKMYGPIFTLRMGIRTMIIISDANLAHQALIERGAQFATRPVETPTRKIF  115

Query  440  SVGKCAINSAEYGPLWRALLRN  505
            S     ++SA YGP+WR L RN
Sbjct  116  SSSDITVHSAMYGPVWRTLRRN  137



>emb|CDY44872.1| BnaC09g50720D [Brassica napus]
Length=496

 Score = 88.6 bits (218),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 60/89 (67%), Gaps = 0/89 (0%)
 Frame = +2

Query  239  FQVVLQRRPFIYVVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPAD  418
            FQ     + F   V +++  +GPI T++MG RT++I++ ++L H+AL+++G  FA RP +
Sbjct  44   FQFARSGKQFFEYVDEMKKIHGPILTLKMGIRTMIIISDADLAHQALIERGAQFATRPVE  103

Query  419  SPIRLIFSVGKCAINSAEYGPLWRALLRN  505
            +P R IFS     ++SA YGP+WR+L RN
Sbjct  104  TPTRKIFSSSDITVHSAMYGPVWRSLRRN  132



>ref|XP_006407540.1| hypothetical protein EUTSA_v10022031mg [Eutrema salsugineum]
 gb|ESQ48993.1| hypothetical protein EUTSA_v10022031mg [Eutrema salsugineum]
Length=520

 Score = 88.6 bits (218),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 59/88 (67%), Gaps = 0/88 (0%)
 Frame = +2

Query  242  QVVLQRRPFIYVVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPADS  421
            Q     + F   V +L   YGPIFT+++G RT++I++ + L HEAL+++G  FA RP ++
Sbjct  61   QFARSGKQFFEYVEELIDIYGPIFTLRLGSRTMIIISDASLAHEALIERGAQFATRPIET  120

Query  422  PIRLIFSVGKCAINSAEYGPLWRALLRN  505
            P R IFS  +  ++SA YGP+WR+L RN
Sbjct  121  PTRKIFSSSEITVHSAMYGPVWRSLRRN  148



>ref|XP_010266363.1| PREDICTED: cytochrome P450 89A2-like [Nelumbo nucifera]
Length=501

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/77 (51%), Positives = 54/77 (70%), Gaps = 0/77 (0%)
 Frame = +2

Query  275  VVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPADSPIRLIFSVGKC  454
            ++R+LR KYGPI  +Q+G R L+ +T+ +L H+AL+Q G  FA+RP   P+  IFS  + 
Sbjct  60   LLRNLRTKYGPILKLQIGSRRLIFITNHQLAHKALIQHGATFADRPPPLPMTRIFSSDQH  119

Query  455  AINSAEYGPLWRALLRN  505
             I+SA YGPLWR L RN
Sbjct  120  NISSAAYGPLWRLLRRN  136



>gb|KFK24906.1| hypothetical protein AALP_AA8G040400 [Arabis alpina]
Length=420

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 34/61 (56%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = +2

Query  323  MGQRTLVIVTSSELIHEALVQQGPIFANRPADSPIRLIFSVGKCAINSAEYGPLWRALLR  502
            MG RT++I++ + LIHEAL+Q+G  FA+RPA++P R IFS  K  +N+A+YGP+WR+L R
Sbjct  1    MGTRTMIIISDASLIHEALIQRGSQFASRPAENPTRTIFSCNKFTVNAAKYGPIWRSLRR  60

Query  503  N  505
            N
Sbjct  61   N  61



>ref|XP_002267628.2| PREDICTED: cytochrome P450 89A2-like [Vitis vinifera]
Length=575

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 40/81 (49%), Positives = 52/81 (64%), Gaps = 0/81 (0%)
 Frame = +2

Query  266  FIYVVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPADSPIRLIFSV  445
            F  V+R+L  KYGPI T+  G R ++ V+S  L H+ALVQ+G +FA+R    PI  IFS 
Sbjct  110  FEPVIRNLHSKYGPILTVHFGSRPVIFVSSDSLSHQALVQKGAVFADRTEALPISKIFSS  169

Query  446  GKCAINSAEYGPLWRALLRNF  508
             K  I++A YGP WR L RN 
Sbjct  170  NKHTISTAFYGPTWRVLRRNL  190



>ref|XP_009622536.1| PREDICTED: cytochrome P450 89A2-like [Nicotiana tomentosiformis]
Length=517

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/78 (46%), Positives = 53/78 (68%), Gaps = 0/78 (0%)
 Frame = +2

Query  275  VVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPADSPIRLIFSVGKC  454
            ++R+L+ KYGP+ T+ +G RT + V+S  L ++ALVQQG +F++RP   P   + S  + 
Sbjct  63   ILRNLKAKYGPLITLNIGSRTAIFVSSHSLAYQALVQQGAVFSDRPRAVPTSAVVSSNQR  122

Query  455  AINSAEYGPLWRALLRNF  508
             INSA YGP+WR L RN 
Sbjct  123  TINSAPYGPVWRLLRRNL  140



>ref|XP_004235319.1| PREDICTED: cytochrome P450 89A2-like [Solanum lycopersicum]
Length=517

 Score = 82.8 bits (203),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 36/78 (46%), Positives = 52/78 (67%), Gaps = 0/78 (0%)
 Frame = +2

Query  275  VVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPADSPIRLIFSVGKC  454
            ++RDL+ KYGP+ T+ +G R+ + V S  L ++ALVQQG IF+NRP   P   + +  + 
Sbjct  61   ILRDLKAKYGPLITLNIGSRSAIFVASHSLAYQALVQQGAIFSNRPKAGPTSAVVNSNQR  120

Query  455  AINSAEYGPLWRALLRNF  508
             I+SA YGP+WR L RN 
Sbjct  121  NISSAPYGPIWRLLRRNL  138



>ref|XP_004298097.2| PREDICTED: cytochrome P450 89A2-like [Fragaria vesca subsp. vesca]
Length=526

 Score = 82.0 bits (201),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 55/87 (63%), Gaps = 3/87 (3%)
 Frame = +2

Query  257  RRPFIYV---VRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPADSPI  427
            R+PF  +   +R+++  YGPI T+Q+G +  + ++S  L H+AL+Q G +FA+RP  S  
Sbjct  71   RKPFTELEPAIRNIQAHYGPIITVQIGSQPSIFISSRSLAHQALIQNGAVFADRPPASAT  130

Query  428  RLIFSVGKCAINSAEYGPLWRALLRNF  508
              IFS  +  INSA YGP WR L RN 
Sbjct  131  TKIFSSNQHEINSAPYGPTWRLLRRNL  157



>ref|XP_009782165.1| PREDICTED: cytochrome P450 89A2-like [Nicotiana sylvestris]
Length=517

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 53/78 (68%), Gaps = 0/78 (0%)
 Frame = +2

Query  275  VVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPADSPIRLIFSVGKC  454
            ++R+L+ KYGP+ T+ +G RT + V+S  L ++ALVQQG +F++RP   P   + S  + 
Sbjct  63   IIRNLKAKYGPLITLNIGSRTAIFVSSHSLAYQALVQQGAVFSDRPRAVPTSAVVSSNQR  122

Query  455  AINSAEYGPLWRALLRNF  508
             I+SA YGP+WR L RN 
Sbjct  123  NISSAPYGPVWRLLRRNL  140



>ref|XP_006652247.1| PREDICTED: cytochrome P450 77A4-like [Oryza brachyantha]
Length=442

 Score = 80.5 bits (197),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = +2

Query  323  MGQRTLVIVTSSELIHEALVQQGPIFANRPADSPIRLIFSVGKCAINSAEYGPLWRALLR  502
            MG RTLV+++S+EL+HEALV++G  FA RPA+S  R IFS  K  +NSA YGP WR+L R
Sbjct  1    MGVRTLVVISSAELVHEALVEKGREFATRPAESTTRTIFSSNKFTVNSAVYGPEWRSLRR  60

Query  503  NF  508
            N 
Sbjct  61   NM  62



>ref|XP_010276940.1| PREDICTED: cytochrome P450 89A2-like [Nelumbo nucifera]
Length=514

 Score = 80.9 bits (198),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 38/77 (49%), Positives = 49/77 (64%), Gaps = 0/77 (0%)
 Frame = +2

Query  275  VVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPADSPIRLIFSVGKC  454
            ++RDLR KYGPI  +  G    + +T+ EL H+A+VQ G  FA+RP   P   IFS  + 
Sbjct  62   ILRDLRTKYGPIVKLPTGSTPTIFITNHELAHKAIVQHGATFADRPPALPHASIFSSNQH  121

Query  455  AINSAEYGPLWRALLRN  505
             I SA+YGPLWR L RN
Sbjct  122  NIGSAKYGPLWRLLRRN  138



>ref|XP_010662058.1| PREDICTED: cytochrome P450 89A2-like [Vitis vinifera]
Length=521

 Score = 80.9 bits (198),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 50/78 (64%), Gaps = 0/78 (0%)
 Frame = +2

Query  275  VVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPADSPIRLIFSVGKC  454
            ++R+L  KYGPI T+Q+G R  + V+++ L H  LVQ G +FA+RP   P   IFS  + 
Sbjct  57   ILRNLHAKYGPIVTLQIGSRPAIFVSANSLAHRTLVQDGAVFADRPKALPTNRIFSSNQH  116

Query  455  AINSAEYGPLWRALLRNF  508
             I+SA YGP WR L RN 
Sbjct  117  NISSAVYGPTWRRLRRNL  134



>ref|XP_002266528.2| PREDICTED: cytochrome P450 89A2-like isoform X2 [Vitis vinifera]
Length=528

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 51/78 (65%), Gaps = 0/78 (0%)
 Frame = +2

Query  275  VVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPADSPIRLIFSVGKC  454
            ++R+L  KYGPI T+++G R  + ++ + L H+ALVQ G +FA+RPA  P   + S  + 
Sbjct  64   ILRNLHAKYGPILTLRIGSRPAIFISENSLAHQALVQNGAVFADRPAALPASRVMSSNQR  123

Query  455  AINSAEYGPLWRALLRNF  508
             INS+ YGP WR L RN 
Sbjct  124  NINSSPYGPTWRLLRRNL  141



>ref|XP_009603616.1| PREDICTED: cytochrome P450 89A2-like [Nicotiana tomentosiformis]
Length=522

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 53/78 (68%), Gaps = 0/78 (0%)
 Frame = +2

Query  275  VVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPADSPIRLIFSVGKC  454
            ++R+L+ KYGP+ T+ +G RT + V+S  L ++ALVQQG +F++RP   P   + S  + 
Sbjct  63   ILRNLKAKYGPLITLNIGSRTAIFVSSHSLAYQALVQQGAVFSDRPRAVPTSAVVSSNQR  122

Query  455  AINSAEYGPLWRALLRNF  508
             I+SA YGP+WR L RN 
Sbjct  123  NISSAPYGPVWRLLRRNL  140



>ref|XP_002520014.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF42338.1| cytochrome P450, putative [Ricinus communis]
Length=520

 Score = 80.1 bits (196),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 50/78 (64%), Gaps = 0/78 (0%)
 Frame = +2

Query  275  VVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPADSPIRLIFSVGKC  454
            ++R LR KYGP+ T+++G R  + +T+  L HEALVQ G +FA+RP    I  I S  + 
Sbjct  60   ILRSLRAKYGPVITLRIGPRPAIFITTHSLAHEALVQNGAVFADRPPPLAISKIISSNQH  119

Query  455  AINSAEYGPLWRALLRNF  508
             I+SA YGP WR L RN 
Sbjct  120  NISSAPYGPTWRLLRRNL  137



>gb|KHN37844.1| Cytochrome P450 77A3 [Glycine soja]
Length=437

 Score = 79.7 bits (195),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = +2

Query  323  MGQRTLVIVTSSELIHEALVQQGPIFANRPADSPIRLIFSVGKCAINSAEYGPLWRALLR  502
            MG RT++I+T S+L+HEA++Q+G  +A RP ++P R IFS  K  +N+A YGP+W++L R
Sbjct  1    MGTRTMIILTDSKLVHEAMIQKGATYATRPPENPTRTIFSENKFTVNAATYGPVWKSLRR  60

Query  503  NF  508
            N 
Sbjct  61   NM  62



>ref|XP_010934624.1| PREDICTED: cytochrome P450 89A2-like [Elaeis guineensis]
Length=537

 Score = 79.3 bits (194),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 38/90 (42%), Positives = 54/90 (60%), Gaps = 0/90 (0%)
 Frame = +2

Query  239  FQVVLQRRPFIYVVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPAD  418
            FQV L  + FI++ RDL  +YGPIFT+ +  R  + +   +L H+ALVQ G  FA+R   
Sbjct  67   FQVALSGKLFIHLARDLFKEYGPIFTLHITSRPSIFIADRDLAHQALVQAGATFADRLTA  126

Query  419  SPIRLIFSVGKCAINSAEYGPLWRALLRNF  508
            +    + +  +  I+SA YGPLWR L RN 
Sbjct  127  TEASRLLTSNRHNISSAPYGPLWRLLRRNL  156



>gb|KHN00917.1| Cytochrome P450 77A3 [Glycine soja]
Length=435

 Score = 78.6 bits (192),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = +2

Query  323  MGQRTLVIVTSSELIHEALVQQGPIFANRPADSPIRLIFSVGKCAINSAEYGPLWRALLR  502
            MG RT++I+T ++L+HEA++Q+G  +A RP ++P R IFS  K  +N+A YGP+W++L R
Sbjct  1    MGTRTMIILTDAKLVHEAMIQKGATYATRPPENPTRTIFSENKFTVNAATYGPVWKSLRR  60

Query  503  NF  508
            N 
Sbjct  61   NM  62



>ref|XP_006828882.1| hypothetical protein AMTR_s00001p00181860 [Amborella trichopoda]
 gb|ERM96298.1| hypothetical protein AMTR_s00001p00181860 [Amborella trichopoda]
Length=494

 Score = 78.6 bits (192),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 49/73 (67%), Gaps = 0/73 (0%)
 Frame = +2

Query  287  LRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPADSPIRLIFSVGKCAINS  466
            L  KYGP+ T+++G+R  + VT+  + H ALVQQG  FA+RP  +P   +FS  +  I+S
Sbjct  60   LHKKYGPVLTLRLGRRPSIFVTTRAVAHRALVQQGAAFADRPPAAPASAVFSSRQHNISS  119

Query  467  AEYGPLWRALLRN  505
            A YGP+WR L RN
Sbjct  120  APYGPIWRVLRRN  132



>gb|KDP36974.1| hypothetical protein JCGZ_08566 [Jatropha curcas]
Length=512

 Score = 78.2 bits (191),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 46/77 (60%), Gaps = 0/77 (0%)
 Frame = +2

Query  275  VVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPADSPIRLIFSVGKC  454
            ++R L  K+GPIFT+ MG R  + +    L H+A VQ G +FA+RP   PI  I +  + 
Sbjct  58   ILRSLHSKFGPIFTLYMGSRPAIFIADRSLAHQAFVQNGAVFADRPPALPIAKIINSNQH  117

Query  455  AINSAEYGPLWRALLRN  505
             INSA YGP WR   RN
Sbjct  118  NINSASYGPTWRLFRRN  134



>gb|KCW58442.1| hypothetical protein EUGRSUZ_H01119, partial [Eucalyptus grandis]
Length=391

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 48/78 (62%), Gaps = 0/78 (0%)
 Frame = +2

Query  275  VVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPADSPIRLIFSVGKC  454
            V+R LR +YGP+ T+ +G R  V V S  L HEALV +G +FA+RP   P   + S  + 
Sbjct  66   VLRSLRARYGPMITLHVGPRPAVFVASQALAHEALVHRGALFADRPPPRPTDRLLSANQH  125

Query  455  AINSAEYGPLWRALLRNF  508
             ++S+ YGP WR L RN 
Sbjct  126  NVSSSSYGPTWRLLRRNL  143



>ref|XP_010042755.1| PREDICTED: cytochrome P450 89A2-like [Eucalyptus grandis]
Length=516

 Score = 78.2 bits (191),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/78 (46%), Positives = 48/78 (62%), Gaps = 0/78 (0%)
 Frame = +2

Query  275  VVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPADSPIRLIFSVGKC  454
            ++R L  +YGP+ T+ MG R  V V S  L HEALVQ+G +FA+RP  S    + S  + 
Sbjct  59   ILRSLHARYGPMVTLHMGSRPAVFVASPALAHEALVQRGAVFADRPPPSATMRLLSSNQH  118

Query  455  AINSAEYGPLWRALLRNF  508
             IN++ YGP WR L RN 
Sbjct  119  NINTSSYGPTWRLLRRNL  136



>gb|KCW58464.1| hypothetical protein EUGRSUZ_H011462, partial [Eucalyptus grandis]
Length=150

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 47/78 (60%), Gaps = 0/78 (0%)
 Frame = +2

Query  275  VVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPADSPIRLIFSVGKC  454
            ++R L  +YGP+ T+ +G    V V S  L HEALVQ+G +FA+RP  S    + S  + 
Sbjct  54   ILRSLHARYGPMVTLHIGSGPAVFVASPTLAHEALVQRGAVFADRPPPSATMRLLSSNQH  113

Query  455  AINSAEYGPLWRALLRNF  508
             IN++ YGP WR L RN 
Sbjct  114  NINTSSYGPTWRLLRRNL  131



>ref|XP_010040474.1| PREDICTED: cytochrome P450 89A2-like [Eucalyptus grandis]
 gb|KCW45186.1| hypothetical protein EUGRSUZ_L01189 [Eucalyptus grandis]
Length=520

 Score = 78.2 bits (191),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/78 (46%), Positives = 48/78 (62%), Gaps = 0/78 (0%)
 Frame = +2

Query  275  VVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPADSPIRLIFSVGKC  454
            V+R LR +YGP+ T+ +G R  V V S  L HEALV +G +FA+RP   P   + S  + 
Sbjct  61   VLRSLRARYGPMITLHVGPRPAVFVASQALAHEALVHRGALFADRPPPRPTDRLISANQH  120

Query  455  AINSAEYGPLWRALLRNF  508
             ++SA YGP WR L RN 
Sbjct  121  NVSSASYGPTWRLLRRNL  138



>ref|XP_004295152.1| PREDICTED: cytochrome P450 89A2-like [Fragaria vesca subsp. vesca]
Length=499

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 52/87 (60%), Gaps = 3/87 (3%)
 Frame = +2

Query  257  RRPFIY---VVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPADSPI  427
            R+PF     ++R L+ +YGPI T+Q+G R  + ++   L H AL+Q G +FA+RP   P 
Sbjct  47   RKPFSELEPIIRGLQSRYGPIITLQIGSRPAIFISDRSLAHHALIQNGAVFADRPPALPT  106

Query  428  RLIFSVGKCAINSAEYGPLWRALLRNF  508
              + S  +  I+SA YGP WR L RN 
Sbjct  107  NRVISSNQHNISSAVYGPTWRLLRRNL  133



>ref|XP_006437390.1| hypothetical protein CICLE_v10031693mg [Citrus clementina]
 gb|ESR50630.1| hypothetical protein CICLE_v10031693mg [Citrus clementina]
Length=410

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 48/77 (62%), Gaps = 0/77 (0%)
 Frame = +2

Query  275  VVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPADSPIRLIFSVGKC  454
            ++R L  KYGP+ T+ +G R  +I+    LIH+AL+Q   +FANRP  + I  I S  + 
Sbjct  91   IIRTLHSKYGPLITLHIGSRPAIIIADRFLIHQALIQNSAVFANRPPATAIAKITSSKQH  150

Query  455  AINSAEYGPLWRALLRN  505
             IN+A YGP WR L RN
Sbjct  151  NINTAAYGPTWRFLRRN  167



>ref|XP_007219004.1| hypothetical protein PRUPE_ppa004199mg [Prunus persica]
 gb|EMJ20203.1| hypothetical protein PRUPE_ppa004199mg [Prunus persica]
Length=523

 Score = 77.0 bits (188),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 50/78 (64%), Gaps = 0/78 (0%)
 Frame = +2

Query  275  VVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPADSPIRLIFSVGKC  454
            ++R+LR +YGPI T+++G R  V + +  L H+AL+Q G +FA+RP   P   I S  + 
Sbjct  63   ILRNLRAQYGPIITLRIGSRPAVFIANRSLAHQALIQNGAVFADRPPALPTNKIVSSNQH  122

Query  455  AINSAEYGPLWRALLRNF  508
             I+SA YGP WR L RN 
Sbjct  123  NISSAVYGPTWRLLRRNL  140



>gb|AFK73721.1| cytochrome P450 [Papaver somniferum]
Length=429

 Score = 76.6 bits (187),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 32/61 (52%), Positives = 46/61 (75%), Gaps = 0/61 (0%)
 Frame = +2

Query  323  MGQRTLVIVTSSELIHEALVQQGPIFANRPADSPIRLIFSVGKCAINSAEYGPLWRALLR  502
            MG RT+VI+T+  L HEAL+++G I A+RP ++  + IFS  K  +NSA+YGP+WR+L R
Sbjct  1    MGTRTIVIITTPGLAHEALIEKGTILASRPKENSTKTIFSSNKFTVNSADYGPVWRSLRR  60

Query  503  N  505
            N
Sbjct  61   N  61



>ref|XP_006408299.1| hypothetical protein EUTSA_v10022173mg [Eutrema salsugineum]
 gb|ESQ49752.1| hypothetical protein EUTSA_v10022173mg [Eutrema salsugineum]
Length=506

 Score = 76.6 bits (187),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 50/81 (62%), Gaps = 0/81 (0%)
 Frame = +2

Query  266  FIYVVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPADSPIRLIFSV  445
            F  V+RDL  ++GPI T+ +G +  + VT   L HEALVQ G +FA+RP   P   + + 
Sbjct  55   FQGVLRDLASRHGPIITLHVGSKPSIWVTDRSLAHEALVQNGAVFADRPLALPTTRVITS  114

Query  446  GKCAINSAEYGPLWRALLRNF  508
             +  I+S+ YGPLWR L RN 
Sbjct  115  NQHDIHSSVYGPLWRTLRRNL  135



>ref|XP_009382325.1| PREDICTED: cytochrome P450 89A2-like [Musa acuminata subsp. malaccensis]
Length=535

 Score = 76.6 bits (187),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 48/78 (62%), Gaps = 0/78 (0%)
 Frame = +2

Query  275  VVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPADSPIRLIFSVGKC  454
            V+RDLR +YGPI T+++  RT + V+   L H+ALV+ G  FA+RP   P     S  + 
Sbjct  81   VLRDLRPRYGPIVTLRIASRTSIFVSDPHLAHKALVEHGAAFADRPTPLPASRFLSNDRH  140

Query  455  AINSAEYGPLWRALLRNF  508
             I +A YGP+WR L RN 
Sbjct  141  NITTASYGPVWRLLRRNL  158



>emb|CBI26429.3| unnamed protein product [Vitis vinifera]
Length=229

 Score = 73.9 bits (180),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 47/78 (60%), Gaps = 0/78 (0%)
 Frame = +2

Query  272  YVVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPADSPIRLIFSVGK  451
            YVV+ L  K+GPI T+  G    + V S+ L ++ALVQ G +FA+RP       I +  +
Sbjct  64   YVVKSLHEKHGPIVTLPFGFNPAIFVASNSLAYQALVQNGAVFADRPPPPITSKIMASNQ  123

Query  452  CAINSAEYGPLWRALLRN  505
            C I+SA YGP WR L RN
Sbjct  124  CTISSAPYGPAWRLLRRN  141



>gb|KDO42609.1| hypothetical protein CISIN_1g008732mg [Citrus sinensis]
Length=556

 Score = 76.6 bits (187),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 48/77 (62%), Gaps = 0/77 (0%)
 Frame = +2

Query  275  VVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPADSPIRLIFSVGKC  454
            ++R L  KYGP+ T+ +G R  +I+    LIH+AL+Q   +FANRP  + I  I S  + 
Sbjct  91   IIRTLHSKYGPLITLHIGSRPAIIIADRFLIHQALIQNSAVFANRPPATAIAKITSSKQH  150

Query  455  AINSAEYGPLWRALLRN  505
             IN+A YGP WR L RN
Sbjct  151  NINTAAYGPTWRFLRRN  167



>gb|KDP39556.1| hypothetical protein JCGZ_02576 [Jatropha curcas]
Length=520

 Score = 76.6 bits (187),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 48/79 (61%), Gaps = 0/79 (0%)
 Frame = +2

Query  272  YVVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPADSPIRLIFSVGK  451
            + +R L  K GP+ T+ +G R  +I+    L H+AL+Q+G IFA+RP    IR I S  +
Sbjct  61   HFIRSLHNKLGPMITVHIGSRPAIIIADRSLAHQALIQKGAIFADRPEADTIRKISSCNQ  120

Query  452  CAINSAEYGPLWRALLRNF  508
              INS+ YGP WR L RN 
Sbjct  121  HNINSSFYGPTWRLLRRNL  139



>ref|XP_006851423.1| hypothetical protein AMTR_s00040p00085270 [Amborella trichopoda]
 gb|ERN13004.1| hypothetical protein AMTR_s00040p00085270 [Amborella trichopoda]
Length=496

 Score = 76.3 bits (186),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 50/77 (65%), Gaps = 0/77 (0%)
 Frame = +2

Query  278  VRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPADSPIRLIFSVGKCA  457
            +R L  KYGP+FT+++G    + V +  + H+ALVQQG  FA+RP   P+  +F+  +  
Sbjct  59   LRKLPKKYGPVFTLRLGGGLSIFVATRAVAHQALVQQGAKFADRPPAPPVSAVFTSQQHN  118

Query  458  INSAEYGPLWRALLRNF  508
            I++A YGPLWR L RN 
Sbjct  119  ISAAPYGPLWRVLRRNL  135



>ref|XP_003556196.1| PREDICTED: cytochrome P450 89A2 [Glycine max]
Length=512

 Score = 75.9 bits (185),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 37/85 (44%), Positives = 53/85 (62%), Gaps = 3/85 (4%)
 Frame = +2

Query  251  LQRRPFIYVVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPADSPIR  430
            ++  PF+   R L  K+GPIFT+++G R ++ + +  L H+AL+Q G IF++RP   P  
Sbjct  54   IELEPFL---RTLAAKHGPIFTLRIGSRPVIFIANRALAHQALIQNGSIFSDRPKALPAA  110

Query  431  LIFSVGKCAINSAEYGPLWRALLRN  505
             I S  +  INSA YG  WRAL RN
Sbjct  111  KIVSSNQHNINSAPYGATWRALRRN  135



>ref|XP_006484709.1| PREDICTED: cytochrome P450 89A2-like [Citrus sinensis]
Length=529

 Score = 75.9 bits (185),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 36/78 (46%), Positives = 49/78 (63%), Gaps = 0/78 (0%)
 Frame = +2

Query  275  VVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPADSPIRLIFSVGKC  454
            V+RDL  K GPI T+++G R ++ +    L ++ALVQ G +FA+RP   PI  I S  + 
Sbjct  59   VLRDLHSKLGPIVTLRIGSRPIIFIADHSLAYKALVQNGAVFADRPQALPINKIASSNQH  118

Query  455  AINSAEYGPLWRALLRNF  508
             I+SA YGP WR L RN 
Sbjct  119  NISSAFYGPTWRVLRRNL  136



>ref|XP_008459157.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 89A2-like [Cucumis 
melo]
Length=511

 Score = 75.5 bits (184),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 35/78 (45%), Positives = 48/78 (62%), Gaps = 0/78 (0%)
 Frame = +2

Query  275  VVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPADSPIRLIFSVGKC  454
            ++R+   KYGPI T+ +G R +V +    + H+ALV  G +FA+RP   P+  I S  + 
Sbjct  56   LLRNFVAKYGPIITLPVGTRPVVFIADPSIAHKALVLNGALFADRPPALPVAKIMSSNQH  115

Query  455  AINSAEYGPLWRALLRNF  508
             INSA YGPLWR L RN 
Sbjct  116  NINSASYGPLWRLLRRNL  133



>ref|XP_006437395.1| hypothetical protein CICLE_v10033803mg [Citrus clementina]
 gb|ESR50635.1| hypothetical protein CICLE_v10033803mg [Citrus clementina]
Length=529

 Score = 75.9 bits (185),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 36/78 (46%), Positives = 49/78 (63%), Gaps = 0/78 (0%)
 Frame = +2

Query  275  VVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPADSPIRLIFSVGKC  454
            V+RDL  K GPI T+++G R ++ +    L ++ALVQ G +FA+RP   PI  I S  + 
Sbjct  59   VLRDLHSKLGPIVTLRIGSRPIIFIADHSLAYKALVQNGAVFADRPQALPINKIASSNQH  118

Query  455  AINSAEYGPLWRALLRNF  508
             I+SA YGP WR L RN 
Sbjct  119  NISSAFYGPTWRVLRRNL  136



>ref|XP_007208889.1| hypothetical protein PRUPE_ppa026664mg [Prunus persica]
 gb|EMJ10088.1| hypothetical protein PRUPE_ppa026664mg [Prunus persica]
Length=516

 Score = 75.5 bits (184),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 47/78 (60%), Gaps = 0/78 (0%)
 Frame = +2

Query  275  VVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPADSPIRLIFSVGKC  454
            V+  LR  YGPI T+ +G R  + +T+ E  H ALV+ G +FA RPA      IF   +C
Sbjct  58   VLHHLRSNYGPIVTLHIGSRPAIFITTHEAAHRALVRNGTVFAGRPAALETTRIFFSNQC  117

Query  455  AINSAEYGPLWRALLRNF  508
             ++SA YGP+WR L +N 
Sbjct  118  TVSSAPYGPIWRLLRQNL  135



>gb|KDO39082.1| hypothetical protein CISIN_1g037361mg [Citrus sinensis]
Length=529

 Score = 75.5 bits (184),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 36/78 (46%), Positives = 49/78 (63%), Gaps = 0/78 (0%)
 Frame = +2

Query  275  VVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPADSPIRLIFSVGKC  454
            V+RDL  K GPI T+++G R ++ +    L ++ALVQ G +FA+RP   PI  I S  + 
Sbjct  59   VLRDLHSKLGPIVTLRIGSRPIIFIADHSLAYKALVQNGAVFADRPQALPINKIASSNQH  118

Query  455  AINSAEYGPLWRALLRNF  508
             I+SA YGP WR L RN 
Sbjct  119  NISSAFYGPTWRVLRRNL  136



>ref|XP_010069933.1| PREDICTED: cytochrome P450 89A2-like [Eucalyptus grandis]
Length=516

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 48/78 (62%), Gaps = 0/78 (0%)
 Frame = +2

Query  275  VVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPADSPIRLIFSVGKC  454
            V+R L  +YGP+ T+ +G R +V V S  L HEALV +G IFA+RP  S    + S  + 
Sbjct  59   VLRSLHARYGPMVTLHVGSRPIVFVASPALAHEALVHRGVIFADRPPPSATVRLTSSNQP  118

Query  455  AINSAEYGPLWRALLRNF  508
             IN+A YGP WR L RN 
Sbjct  119  NINAASYGPTWRLLRRNL  136



>gb|KCW58456.1| hypothetical protein EUGRSUZ_H01138, partial [Eucalyptus grandis]
Length=501

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 48/78 (62%), Gaps = 0/78 (0%)
 Frame = +2

Query  275  VVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPADSPIRLIFSVGKC  454
            V+R L  +YGP+ T+ +G R +V V S  L HEALV +G IFA+RP  S    + S  + 
Sbjct  59   VLRSLHARYGPMVTLHVGSRPIVFVASPALAHEALVHRGVIFADRPPPSATVRLTSSNQP  118

Query  455  AINSAEYGPLWRALLRNF  508
             IN+A YGP WR L RN 
Sbjct  119  NINAASYGPTWRLLRRNL  136



>ref|XP_006347570.1| PREDICTED: cytochrome P450 89A2-like [Solanum tuberosum]
Length=520

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 50/78 (64%), Gaps = 0/78 (0%)
 Frame = +2

Query  275  VVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPADSPIRLIFSVGKC  454
            ++RDL+ KYGP+ T+  G R  + V S  L ++ALVQQG +F++R    P   I S  + 
Sbjct  62   ILRDLKDKYGPLITINTGSRPNIYVASHSLAYQALVQQGAVFSDRLRALPTHAILSSNQR  121

Query  455  AINSAEYGPLWRALLRNF  508
            +I+SA YGP+WR L RN 
Sbjct  122  SISSAPYGPIWRLLRRNL  139



>emb|CDP14026.1| unnamed protein product [Coffea canephora]
Length=550

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 48/78 (62%), Gaps = 0/78 (0%)
 Frame = +2

Query  275  VVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPADSPIRLIFSVGKC  454
            V++ L+ KYGP+ ++ +G R  + V S  L H ALVQ G +F++RP   P   IF+  + 
Sbjct  61   VLQRLKAKYGPLISLTIGSRPSIFVASHSLAHRALVQNGAVFSDRPKSLPTAKIFNSNQH  120

Query  455  AINSAEYGPLWRALLRNF  508
             I+SA YGP WR L RN 
Sbjct  121  NISSARYGPTWRLLRRNL  138



>gb|EPS60584.1| hypothetical protein M569_14219, partial [Genlisea aurea]
Length=399

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 52/80 (65%), Gaps = 1/80 (1%)
 Frame = +2

Query  272  YVVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPADSPIRLIFSVGK  451
            +++R +  KYGP+  M++G R  V + S  + H+AL+Q G +F++RPA + I +  + G 
Sbjct  55   FILRRIAPKYGPLIAMRIGNRPFVFIGSRSVAHQALIQNGAVFSDRPAPTTISIYLNGGD  114

Query  452  -CAINSAEYGPLWRALLRNF  508
              +INSA+YGP WR L RN 
Sbjct  115  PLSINSAKYGPTWRFLRRNL  134



>ref|XP_011085115.1| PREDICTED: cytochrome P450 89A2-like [Sesamum indicum]
Length=525

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/79 (41%), Positives = 49/79 (62%), Gaps = 0/79 (0%)
 Frame = +2

Query  272  YVVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPADSPIRLIFSVGK  451
            +++R L+ +YGP+ T+++  R+ + + S  L H ALV  G IF++RPA  P   I +   
Sbjct  59   FILRRLKPRYGPLITLRIAHRSFIFIGSHSLAHHALVHNGAIFSDRPAPPPTSKILNRSP  118

Query  452  CAINSAEYGPLWRALLRNF  508
             AI+S+ YGP WR L RN 
Sbjct  119  KAISSSTYGPTWRLLRRNL  137



>gb|KCW58452.1| hypothetical protein EUGRSUZ_H01131 [Eucalyptus grandis]
Length=516

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 48/78 (62%), Gaps = 0/78 (0%)
 Frame = +2

Query  275  VVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPADSPIRLIFSVGKC  454
            V+R L  +YGP+ T+ +G R +V + S  L HEALV +G IFA+RP  S    + S  + 
Sbjct  59   VLRSLHARYGPMVTLHVGSRPIVFIASPSLAHEALVHRGVIFADRPPPSATIRLISSNQH  118

Query  455  AINSAEYGPLWRALLRNF  508
             IN++ YGP WR L RN 
Sbjct  119  NINTSSYGPTWRLLRRNL  136



>ref|XP_003556183.1| PREDICTED: cytochrome P450 89A2-like [Glycine max]
Length=500

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 47/78 (60%), Gaps = 0/78 (0%)
 Frame = +2

Query  275  VVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPADSPIRLIFSVGKC  454
            ++R+L  KYGPI T+ +G   ++ +    L H+AL+Q G +F++RP    I  I S  + 
Sbjct  57   ILRNLHTKYGPIVTLPIGSHRVIFIADRTLAHQALIQNGSLFSDRPKALAIGKILSCNQH  116

Query  455  AINSAEYGPLWRALLRNF  508
             INSA YGP WR L RN 
Sbjct  117  NINSASYGPTWRTLRRNL  134



>ref|XP_010069930.1| PREDICTED: cytochrome P450 89A2-like [Eucalyptus grandis]
Length=536

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 48/78 (62%), Gaps = 0/78 (0%)
 Frame = +2

Query  275  VVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPADSPIRLIFSVGKC  454
            V+R L  +YGP+ T+ +G R +V + S  L HEALV +G IFA+RP  S    + S  + 
Sbjct  79   VLRSLHARYGPMVTLHVGSRPIVFIASPSLAHEALVHRGVIFADRPPPSATIRLISSNQH  138

Query  455  AINSAEYGPLWRALLRNF  508
             IN++ YGP WR L RN 
Sbjct  139  NINTSSYGPTWRLLRRNL  156



>ref|XP_010069934.1| PREDICTED: cytochrome P450 89A2-like [Eucalyptus grandis]
 gb|KCW58460.1| hypothetical protein EUGRSUZ_H01143 [Eucalyptus grandis]
Length=516

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 48/78 (62%), Gaps = 0/78 (0%)
 Frame = +2

Query  275  VVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPADSPIRLIFSVGKC  454
            V+R L  +YGP+ T+ +G R +V + S  L HEALV +G IFA+RP  S    + S  + 
Sbjct  59   VLRSLHARYGPMVTLHVGSRPIVFIASPALAHEALVHRGVIFADRPPPSATIRLISSNQH  118

Query  455  AINSAEYGPLWRALLRNF  508
             IN++ YGP WR L RN 
Sbjct  119  NINTSSYGPTWRLLRRNL  136



>ref|XP_010069928.1| PREDICTED: cytochrome P450 89A2-like [Eucalyptus grandis]
 gb|KCW58448.1| hypothetical protein EUGRSUZ_H01126 [Eucalyptus grandis]
Length=516

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 47/78 (60%), Gaps = 0/78 (0%)
 Frame = +2

Query  275  VVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPADSPIRLIFSVGKC  454
            V+R L  +YGP+ T+ +G R  V V S  L HEALV +G IFA+RP  S    + S  + 
Sbjct  59   VLRSLHARYGPMVTLHVGSRPTVFVASPALAHEALVHRGVIFADRPPPSATIRLTSSNQP  118

Query  455  AINSAEYGPLWRALLRNF  508
             IN+A YGP WR L RN 
Sbjct  119  NINAASYGPTWRLLRRNL  136



>gb|KCW44075.1| hypothetical protein EUGRSUZ_L025191, partial [Eucalyptus grandis]
Length=489

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 47/78 (60%), Gaps = 0/78 (0%)
 Frame = +2

Query  275  VVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPADSPIRLIFSVGKC  454
            V+R L  +YGP+ T+ +G R  V V S  L HEAL+ +G IFA+RP  S    + S  + 
Sbjct  59   VLRSLHARYGPMVTLHVGSRPTVFVASPALAHEALIHRGAIFADRPPPSTTIRLLSSNQH  118

Query  455  AINSAEYGPLWRALLRNF  508
             IN++ YGP WR L RN 
Sbjct  119  NINTSSYGPTWRLLRRNL  136



>ref|XP_009609017.1| PREDICTED: cytochrome P450 89A2-like [Nicotiana tomentosiformis]
Length=534

 Score = 74.3 bits (181),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 35/80 (44%), Positives = 51/80 (64%), Gaps = 2/80 (3%)
 Frame = +2

Query  275  VVRDLRXKYGPIFTMQMG--QRTLVIVTSSELIHEALVQQGPIFANRPADSPIRLIFSVG  448
            ++RDL+ KYGP+F +++G   R  + V S  L + ALVQQG +F++RP  +   +I    
Sbjct  56   ILRDLKAKYGPLFNLRIGIISRPSIFVASHSLAYTALVQQGAVFSDRPKAAQTNVIIHSS  115

Query  449  KCAINSAEYGPLWRALLRNF  508
            +  I+SA YGPLWR L RN 
Sbjct  116  RINISSAPYGPLWRLLRRNL  135



>ref|XP_006437392.1| hypothetical protein CICLE_v10033851mg [Citrus clementina]
 gb|ESR50632.1| hypothetical protein CICLE_v10033851mg [Citrus clementina]
Length=515

 Score = 73.9 bits (180),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 47/77 (61%), Gaps = 0/77 (0%)
 Frame = +2

Query  275  VVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPADSPIRLIFSVGKC  454
             +R L  K+GPI T+ +G R  + ++   L H+AL+Q G +F++RP    +  + S  + 
Sbjct  60   TIRALHDKFGPIITLHIGSRPAIFISDRSLAHQALIQNGAVFSDRPPAGAVAKVTSSKQH  119

Query  455  AINSAEYGPLWRALLRN  505
            +INSA YGP WR L RN
Sbjct  120  SINSASYGPTWRLLRRN  136



>ref|XP_006484712.1| PREDICTED: cytochrome P450 89A2-like [Citrus sinensis]
Length=514

 Score = 73.9 bits (180),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 47/77 (61%), Gaps = 0/77 (0%)
 Frame = +2

Query  275  VVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPADSPIRLIFSVGKC  454
             +R L  K+GPI T+ +G R  + ++   L H+AL+Q G +F++RP    +  + S  + 
Sbjct  60   TIRALHDKFGPIITLHIGSRPAIFISDRSLAHQALIQNGAVFSDRPPAGAVAKVTSSKQH  119

Query  455  AINSAEYGPLWRALLRN  505
            +INSA YGP WR L RN
Sbjct  120  SINSASYGPTWRLLRRN  136



>gb|KDO42607.1| hypothetical protein CISIN_1g010248mg [Citrus sinensis]
Length=514

 Score = 73.9 bits (180),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 47/77 (61%), Gaps = 0/77 (0%)
 Frame = +2

Query  275  VVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPADSPIRLIFSVGKC  454
             +R L  K+GPI T+ +G R  + ++   L H+AL+Q G +F++RP    +  + S  + 
Sbjct  60   TIRALHDKFGPIITLHIGSRPAIFISDRSLAHQALIQNGAVFSDRPPAGAVAKVTSSKQH  119

Query  455  AINSAEYGPLWRALLRN  505
            +INSA YGP WR L RN
Sbjct  120  SINSASYGPTWRLLRRN  136



>ref|XP_004156750.1| PREDICTED: cytochrome P450 89A2-like [Cucumis sativus]
 gb|KGN63389.1| hypothetical protein Csa_2G435520 [Cucumis sativus]
Length=512

 Score = 73.9 bits (180),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 33/78 (42%), Positives = 47/78 (60%), Gaps = 0/78 (0%)
 Frame = +2

Query  275  VVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPADSPIRLIFSVGKC  454
            ++R    KYGPI T+ +G R ++ +    + H+ALV  G +FA+RP   P+  I +  + 
Sbjct  56   LLRSFVAKYGPIITLPIGTRPVIFIADPSIAHKALVLNGALFADRPPALPVAKIITSNQH  115

Query  455  AINSAEYGPLWRALLRNF  508
             INSA YGPLWR L RN 
Sbjct  116  NINSASYGPLWRLLRRNL  133



>ref|XP_010026134.1| PREDICTED: cytochrome P450 89A2-like [Eucalyptus grandis]
Length=459

 Score = 73.6 bits (179),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 47/78 (60%), Gaps = 0/78 (0%)
 Frame = +2

Query  275  VVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPADSPIRLIFSVGKC  454
            ++R L  +YGP+ T+ +G    V V S  L HEALVQ+G +FA+RP  S    + S  + 
Sbjct  54   ILRSLHARYGPMVTLHIGSGPAVFVASPTLAHEALVQRGAVFADRPPPSATMRLLSSNQH  113

Query  455  AINSAEYGPLWRALLRNF  508
             IN++ YGP WR L RN 
Sbjct  114  NINTSSYGPTWRLLRRNL  131



>ref|XP_010087442.1| Cytochrome P450 89A2 [Morus notabilis]
 gb|EXB29123.1| Cytochrome P450 89A2 [Morus notabilis]
Length=543

 Score = 73.9 bits (180),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 48/78 (62%), Gaps = 0/78 (0%)
 Frame = +2

Query  275  VVRDLRXKYGPIFTMQMGQRTLVIVTSSELIHEALVQQGPIFANRPADSPIRLIFSVGKC  454
            ++R++  KYGP+ ++++  R  V V    L H+ALVQ G +FA+RP  +P     S  + 
Sbjct  64   ILRNIHRKYGPVVSIRIAHRPAVFVADRTLAHQALVQNGAVFADRPPAAPTNRFLSSNQH  123

Query  455  AINSAEYGPLWRALLRNF  508
            +I+SA YGP WR L RN 
Sbjct  124  SISSAAYGPTWRLLRRNL  141



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 559877061510