BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001O18

Length=487
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010093709.1|  hypothetical protein L484_019050                   236   2e-76   Morus notabilis
ref|XP_010264244.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    234   7e-76   Nelumbo nucifera [Indian lotus]
ref|XP_011018294.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    234   8e-76   Populus euphratica
ref|XP_010258983.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    231   7e-75   Nelumbo nucifera [Indian lotus]
ref|XP_007039883.1|  NADH dehydrogenase 1 beta subcomplex subunit 8     231   7e-75   
ref|XP_009378949.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    231   9e-75   Pyrus x bretschneideri [bai li]
ref|XP_011070110.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    231   1e-74   Sesamum indicum [beniseed]
ref|XP_010055510.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    231   1e-74   Eucalyptus grandis [rose gum]
ref|XP_009770592.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    231   1e-74   Nicotiana sylvestris
ref|XP_010662384.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    230   2e-74   Vitis vinifera
ref|XP_007215154.1|  hypothetical protein PRUPE_ppa013399mg             229   4e-74   Prunus persica
ref|XP_006355476.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    229   6e-74   Solanum tuberosum [potatoes]
ref|XP_008228960.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    229   6e-74   Prunus mume [ume]
ref|XP_010530067.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    229   7e-74   Tarenaya hassleriana [spider flower]
ref|XP_008343083.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    228   2e-73   
ref|XP_004245753.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    228   2e-73   Solanum lycopersicum
ref|NP_001235493.1|  uncharacterized protein LOC100499749               228   2e-73   Glycine max [soybeans]
emb|CDP09936.1|  unnamed protein product                                228   2e-73   Coffea canephora [robusta coffee]
ref|XP_009602608.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    228   2e-73   Nicotiana tomentosiformis
ref|XP_007161348.1|  hypothetical protein PHAVU_001G061600g             229   2e-73   Phaseolus vulgaris [French bean]
ref|XP_007155645.1|  hypothetical protein PHAVU_003G219300g             227   5e-73   Phaseolus vulgaris [French bean]
ref|XP_006398455.1|  hypothetical protein EUTSA_v10001074mg             227   5e-73   Eutrema salsugineum [saltwater cress]
ref|XP_004516831.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    227   5e-73   Cicer arietinum [garbanzo]
gb|KHG13058.1|  hypothetical protein F383_17357                         226   7e-73   Gossypium arboreum [tree cotton]
ref|XP_002518112.1|  conserved hypothetical protein                     226   1e-72   Ricinus communis
gb|ABK94153.1|  unknown                                                 226   1e-72   Populus trichocarpa [western balsam poplar]
emb|CDY17725.1|  BnaA06g35440D                                          226   2e-72   Brassica napus [oilseed rape]
gb|KJB21488.1|  hypothetical protein B456_004G200300                    225   2e-72   Gossypium raimondii
gb|KHG01041.1|  hypothetical protein F383_21717                         225   2e-72   Gossypium arboreum [tree cotton]
emb|CDY41058.1|  BnaA09g18370D                                          225   2e-72   Brassica napus [oilseed rape]
gb|EYU32869.1|  hypothetical protein MIMGU_mgv1a016342mg                225   3e-72   Erythranthe guttata [common monkey flower]
ref|XP_009101408.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    224   4e-72   Brassica rapa
gb|EPS58672.1|  hypothetical protein M569_16139                         224   4e-72   Genlisea aurea
gb|KHN09808.1|  NADH dehydrogenase [ubiquinone] 1 beta subcomplex...    224   5e-72   Glycine soja [wild soybean]
ref|XP_006281322.1|  hypothetical protein CARUB_v10027375mg             224   5e-72   Capsella rubella
ref|XP_004147198.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    224   7e-72   Cucumis sativus [cucumbers]
ref|XP_011466981.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    224   9e-72   Fragaria vesca subsp. vesca
emb|CDX77778.1|  BnaC07g20320D                                          224   9e-72   
ref|XP_009114266.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    223   1e-71   Brassica rapa
gb|KJB51916.1|  hypothetical protein B456_008G237800                    223   1e-71   Gossypium raimondii
ref|XP_010919522.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    223   2e-71   Elaeis guineensis
emb|CDY40556.1|  BnaC02g33360D                                          223   2e-71   Brassica napus [oilseed rape]
emb|CDY28920.1|  BnaA02g25560D                                          223   2e-71   Brassica napus [oilseed rape]
ref|XP_010441437.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    222   5e-71   Camelina sativa [gold-of-pleasure]
ref|XP_009128982.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    222   5e-71   Brassica rapa
gb|KFK31361.1|  hypothetical protein AALP_AA6G102500                    221   9e-71   Arabis alpina [alpine rockcress]
gb|KJB21491.1|  hypothetical protein B456_004G200300                    221   1e-70   Gossypium raimondii
gb|AGL09490.1|  NADH dehydrogenase 1 beta subcomplex subunit 8          219   7e-70   Hydnora visseri
ref|XP_008786987.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    218   1e-69   Phoenix dactylifera
ref|XP_010494996.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    218   2e-69   Camelina sativa [gold-of-pleasure]
ref|XP_003608732.1|  hypothetical protein MTR_4g101140                  218   2e-69   Medicago truncatula
ref|XP_008796817.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    215   2e-68   Phoenix dactylifera
ref|XP_009101407.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    214   1e-67   Brassica rapa
ref|XP_010919523.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    212   3e-67   
ref|XP_008381184.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    211   5e-67   
ref|XP_006440353.1|  hypothetical protein CICLE_v10022867mg             210   2e-66   Citrus clementina [clementine]
ref|XP_010518861.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    203   1e-63   Tarenaya hassleriana [spider flower]
ref|XP_006830041.1|  hypothetical protein AMTR_s00124p00115680          200   2e-62   Amborella trichopoda
ref|XP_010264245.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    199   3e-62   Nelumbo nucifera [Indian lotus]
ref|NP_568684.1|  uncharacterized protein                               199   3e-62   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002863335.1|  hypothetical protein ARALYDRAFT_494216             197   2e-61   Arabidopsis lyrata subsp. lyrata
ref|XP_011018295.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    196   5e-61   Populus euphratica
ref|XP_010258984.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    196   5e-61   Nelumbo nucifera [Indian lotus]
ref|XP_009400677.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    196   7e-61   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006355519.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    196   1e-60   
gb|ACJ84169.1|  unknown                                                 194   2e-60   Medicago truncatula
gb|ABD64969.1|  hypothetical protein 25.t00006                          194   4e-60   Brassica oleracea
ref|XP_006368197.1|  hypothetical protein POPTR_0001s00430g             191   3e-59   
gb|ABD64995.1|  hypothetical protein 26.t00015                          191   8e-59   Brassica oleracea
gb|ABD64927.1|  hypothetical protein 24.t00002                          190   2e-58   Brassica oleracea
ref|XP_010695116.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    189   4e-58   
ref|NP_001065325.1|  Os10g0551600                                       185   1e-56   
ref|XP_003608733.1|  hypothetical protein MTR_4g101140                  184   2e-56   
gb|EEC67413.1|  hypothetical protein OsI_34583                          184   5e-56   Oryza sativa Indica Group [Indian rice]
ref|XP_008796813.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    183   7e-56   Phoenix dactylifera
ref|NP_001131355.1|  uncharacterized protein LOC100192676               183   7e-56   Zea mays [maize]
ref|XP_008796814.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    183   1e-55   
dbj|BAJ85316.1|  predicted protein                                      182   1e-55   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008796812.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    183   3e-55   
ref|XP_006662581.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    181   3e-55   Oryza brachyantha
emb|CDY25957.1|  BnaC09g20300D                                          192   7e-55   Brassica napus [oilseed rape]
gb|KDP39850.1|  hypothetical protein JCGZ_03381                         176   3e-53   Jatropha curcas
ref|XP_006440354.1|  hypothetical protein CICLE_v10022867mg             176   5e-53   
ref|XP_008659958.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    174   2e-52   
ref|XP_003574306.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    173   6e-52   Brachypodium distachyon [annual false brome]
ref|NP_001142497.1|  uncharacterized protein LOC100274725               172   1e-51   Zea mays [maize]
ref|XP_002467527.1|  hypothetical protein SORBIDRAFT_01g029640          172   2e-51   Sorghum bicolor [broomcorn]
ref|XP_004983722.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    171   2e-51   Setaria italica
ref|NP_001144293.1|  uncharacterized protein LOC100277176               167   1e-49   
ref|XP_008659963.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    158   2e-46   
gb|ABK23873.1|  unknown                                                 157   1e-45   Picea sitchensis
gb|EMT16400.1|  hypothetical protein F775_28617                         153   4e-44   
gb|KJB21489.1|  hypothetical protein B456_004G200300                    151   1e-43   Gossypium raimondii
gb|AGL09494.1|  NADH dehydrogenase 1 beta subcomplex subunit 8          150   1e-43   Thottea sp. JN-2013
gb|AGL09493.1|  NADH dehydrogenase 1 beta subcomplex subunit 8          150   1e-43   Piper nigrum
gb|AGL09491.1|  NADH dehydrogenase 1 beta subcomplex subunit 8          150   2e-43   Manekia incurva
gb|AGL09486.1|  NADH dehydrogenase 1 beta subcomplex subunit 8          149   6e-43   Asimina triloba [pawpaw]
gb|KJB51917.1|  hypothetical protein B456_008G237800                    149   8e-43   Gossypium raimondii
emb|CBI31907.3|  unnamed protein product                                155   2e-42   Vitis vinifera
gb|AGL09497.1|  NADH dehydrogenase 1 beta subcomplex subunit 8          147   2e-42   Zippelia begoniifolia
gb|AGL09485.1|  NADH dehydrogenase 1 beta subcomplex subunit 8          147   3e-42   Asarum caudatum
ref|XP_010934141.1|  PREDICTED: LOW QUALITY PROTEIN: NADH dehydro...    149   4e-42   
gb|AGL09496.1|  NADH dehydrogenase 1 beta subcomplex subunit 8          146   6e-42   Xymalos monospora
gb|AGL09488.1|  NADH dehydrogenase 1 beta subcomplex subunit 8          146   7e-42   Chloranthus fortunei
gb|AGL09492.1|  NADH dehydrogenase 1 beta subcomplex subunit 8          144   3e-41   Peperomia prostrata
gb|AFW87915.1|  hypothetical protein ZEAMMB73_145461                    145   5e-41   
ref|XP_001753451.1|  predicted protein                                  144   7e-41   
gb|AGL09487.1|  NADH dehydrogenase 1 beta subcomplex subunit 8          142   2e-40   Calycanthus occidentalis [California-allspice]
gb|AGL09489.1|  NADH dehydrogenase 1 beta subcomplex subunit 8          138   6e-39   Hernandia nymphaeifolia [kayu jambu hutan]
gb|AGL09495.1|  NADH dehydrogenase 1 beta subcomplex subunit 8          134   4e-37   Verhuellia lunaria
gb|KCW71992.1|  hypothetical protein EUGRSUZ_E00445                     133   7e-37   Eucalyptus grandis [rose gum]
gb|KJB21490.1|  hypothetical protein B456_004G200300                    132   2e-36   Gossypium raimondii
gb|ADY38662.1|  hypothetical protein                                    128   1e-34   Wolffia arrhiza
gb|AFP49345.1|  hypothetical protein                                    125   5e-34   Olea europaea
ref|XP_002440834.1|  hypothetical protein SORBIDRAFT_09g008006          107   5e-27   
ref|XP_002504368.1|  predicted protein                                89.4    2e-19   Micromonas commoda
gb|AGU36714.1|  kinesin-related protein                               77.4    1e-15   Helianthus petiolaris
gb|AGU36715.1|  kinesin-related protein                               77.4    1e-15   Helianthus annuus
gb|AGU36716.1|  kinesin-related protein                               77.4    1e-15   Helianthus annuus
gb|AGU36718.1|  kinesin-related protein                               77.4    1e-15   Helianthus annuus
gb|AGU36724.1|  kinesin-related protein                               77.4    1e-15   Helianthus annuus
ref|XP_001420082.1|  predicted protein                                79.0    2e-15   Ostreococcus lucimarinus CCE9901
ref|XP_005649552.1|  hypothetical protein COCSUDRAFT_52742            77.0    2e-14   Coccomyxa subellipsoidea C-169
ref|NP_001236148.1|  uncharacterized protein LOC100306514             77.0    2e-14   
ref|XP_007510211.1|  predicted protein                                75.9    4e-14   Bathycoccus prasinos
ref|XP_010229345.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...  70.1    2e-12   Brachypodium distachyon [annual false brome]
ref|XP_003064828.1|  predicted protein                                71.6    4e-12   Micromonas pusilla CCMP1545
ref|XP_003081497.1|  unnamed protein product                          64.7    2e-10   
gb|AFK49234.1|  unknown                                               64.3    3e-10   Lotus japonicus
emb|CEF99290.1|  unnamed product                                      58.9    2e-08   Ostreococcus tauri
ref|XP_002968302.1|  hypothetical protein SELMODRAFT_409541           54.7    1e-06   
ref|XP_001700273.1|  predicted protein                                47.0    7e-04   Chlamydomonas reinhardtii
ref|XP_008908747.1|  hypothetical protein PPTG_14011                  46.6    7e-04   Phytophthora parasitica INRA-310



>ref|XP_010093709.1| hypothetical protein L484_019050 [Morus notabilis]
 gb|EXB54489.1| hypothetical protein L484_019050 [Morus notabilis]
Length=125

 Score =   236 bits (601),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 112/125 (90%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = +2

Query  50   MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  229
            MAGRLS  A+ IMGG GVV RSVASSLR R+GMGLPVGKHIVP+KPLPVNDEL+WDNGTP
Sbjct  1    MAGRLSNVASKIMGGNGVVCRSVASSLRLRSGMGLPVGKHIVPEKPLPVNDELVWDNGTP  60

Query  230  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVE  409
            FPEPCIDRIADTVGKYEALAW+CGGLGFFASLGL+AVWNDKASKIPFTPKVYPYDNL+VE
Sbjct  61   FPEPCIDRIADTVGKYEALAWLCGGLGFFASLGLLAVWNDKASKIPFTPKVYPYDNLRVE  120

Query  410  LGGEP  424
            LGGEP
Sbjct  121  LGGEP  125



>ref|XP_010264244.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial isoform X1 [Nelumbo nucifera]
Length=125

 Score =   234 bits (597),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 109/125 (87%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = +2

Query  50   MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  229
            MAGRLS  A+ IMGG GV+ RSVASSLR R+GMGLPVGKHI+PDKPLPVNDEL+WDNGTP
Sbjct  1    MAGRLSNVASRIMGGNGVIGRSVASSLRLRSGMGLPVGKHIIPDKPLPVNDELLWDNGTP  60

Query  230  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVE  409
            FPEPC+DRIADTVGKYEALAW+CGGLGFFASLGL+ VWNDKASKIPFTPKVYPYDNL+VE
Sbjct  61   FPEPCLDRIADTVGKYEALAWLCGGLGFFASLGLLVVWNDKASKIPFTPKVYPYDNLRVE  120

Query  410  LGGEP  424
            LGGEP
Sbjct  121  LGGEP  125



>ref|XP_011018294.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial isoform X1 [Populus euphratica]
Length=125

 Score =   234 bits (596),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 110/125 (88%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = +2

Query  50   MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  229
            MAGRLS  A+ IMGG GVV+RSVASS+R R+GMGLPVGKHIVPDKP+PVNDELMWDNGT 
Sbjct  1    MAGRLSNVASQIMGGNGVVSRSVASSIRLRSGMGLPVGKHIVPDKPIPVNDELMWDNGTA  60

Query  230  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVE  409
            FPEPCIDRIADTVGKYEALAW+CGGLGFFASLGL+ VWNDKAS IPFTPKVYPYDNLKVE
Sbjct  61   FPEPCIDRIADTVGKYEALAWLCGGLGFFASLGLLVVWNDKASTIPFTPKVYPYDNLKVE  120

Query  410  LGGEP  424
            LGGEP
Sbjct  121  LGGEP  125



>ref|XP_010258983.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial-like isoform X1 [Nelumbo nucifera]
Length=125

 Score =   231 bits (590),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 109/125 (87%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = +2

Query  50   MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  229
            M+GRLS  A+ IMGG GVV RSVASSLR R+GMGLPVGKHIVP+KPLPVNDEL+WDNGTP
Sbjct  1    MSGRLSNVASRIMGGNGVVGRSVASSLRLRSGMGLPVGKHIVPEKPLPVNDELVWDNGTP  60

Query  230  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVE  409
            FPEPC+DRIADTVGKYEALAW+CGGLGFFASLGL+AVWNDKAS IPFTPKVYPYDNL+VE
Sbjct  61   FPEPCLDRIADTVGKYEALAWLCGGLGFFASLGLLAVWNDKASXIPFTPKVYPYDNLRVE  120

Query  410  LGGEP  424
            LGGEP
Sbjct  121  LGGEP  125



>ref|XP_007039883.1| NADH dehydrogenase 1 beta subcomplex subunit 8 [Theobroma cacao]
 gb|EOY24384.1| NADH dehydrogenase 1 beta subcomplex subunit 8 [Theobroma cacao]
Length=125

 Score =   231 bits (590),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 110/125 (88%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = +2

Query  50   MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  229
            MAGRLS  A+ IMGG G+V+RSVASSLR R+GMGLPVGKHIVPDKPLPVNDEL+WDNGT 
Sbjct  1    MAGRLSNVASRIMGGNGIVSRSVASSLRLRSGMGLPVGKHIVPDKPLPVNDELIWDNGTS  60

Query  230  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVE  409
            FPEPCIDRIADTVGKYEALAWMCGGL FFASLGL+A WNDKASKIPFTPKVYPYDNL+VE
Sbjct  61   FPEPCIDRIADTVGKYEALAWMCGGLSFFASLGLLAWWNDKASKIPFTPKVYPYDNLRVE  120

Query  410  LGGEP  424
            LGGEP
Sbjct  121  LGGEP  125



>ref|XP_009378949.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial [Pyrus x bretschneideri]
Length=125

 Score =   231 bits (589),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 110/125 (88%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = +2

Query  50   MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  229
            MAGRLS  A+ IMGG GVV+RSVASSLR RAGMGLPVGKHIVPDKPLPVNDEL+WDNGTP
Sbjct  1    MAGRLSSVASKIMGGNGVVSRSVASSLRVRAGMGLPVGKHIVPDKPLPVNDELIWDNGTP  60

Query  230  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVE  409
            FPEPCIDRIADTVGKYEALAW+CGGL  FA LGL+AVWNDKASKIPF+PKVYPYDNL+VE
Sbjct  61   FPEPCIDRIADTVGKYEALAWLCGGLSCFAGLGLLAVWNDKASKIPFSPKVYPYDNLRVE  120

Query  410  LGGEP  424
            LGGEP
Sbjct  121  LGGEP  125



>ref|XP_011070110.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial [Sesamum indicum]
Length=125

 Score =   231 bits (589),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 108/125 (86%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = +2

Query  50   MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  229
            MAGRLS  A+ IMGG G+V+RS A+SLR R+GMGLPVGKHIVPDKPLPVNDEL+WDNGT 
Sbjct  1    MAGRLSHVASRIMGGNGIVSRSAAASLRQRSGMGLPVGKHIVPDKPLPVNDELVWDNGTA  60

Query  230  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVE  409
            FPEPCIDRIADTVGKYEALAW+CGGLGFFASLG +AVWNDKASKIPFTPKVYPYDNL+VE
Sbjct  61   FPEPCIDRIADTVGKYEALAWLCGGLGFFASLGFLAVWNDKASKIPFTPKVYPYDNLRVE  120

Query  410  LGGEP  424
            LGGEP
Sbjct  121  LGGEP  125



>ref|XP_010055510.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial [Eucalyptus grandis]
 gb|KCW71991.1| hypothetical protein EUGRSUZ_E00445 [Eucalyptus grandis]
Length=125

 Score =   231 bits (589),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 111/125 (89%), Positives = 116/125 (93%), Gaps = 0/125 (0%)
 Frame = +2

Query  50   MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  229
            MAGRLS  A+ IMGG GVVARS ASSLR RAGMGLPVGKHIVPDKPL VNDEL+WDNGT 
Sbjct  1    MAGRLSHVASRIMGGNGVVARSAASSLRLRAGMGLPVGKHIVPDKPLHVNDELVWDNGTA  60

Query  230  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVE  409
            FPEPCIDRIADTVGKYEALAW+CGGLGFFASLGL+AVWNDKASKIPF PKVYPYDNL+VE
Sbjct  61   FPEPCIDRIADTVGKYEALAWLCGGLGFFASLGLLAVWNDKASKIPFAPKVYPYDNLRVE  120

Query  410  LGGEP  424
            LGGEP
Sbjct  121  LGGEP  125



>ref|XP_009770592.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial [Nicotiana sylvestris]
Length=125

 Score =   231 bits (588),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 112/125 (90%), Positives = 115/125 (92%), Gaps = 0/125 (0%)
 Frame = +2

Query  50   MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  229
            MAGRLS AAA IMGG GVVARSVASSLRTRAGMGLPVGKHIVPDKPL VNDEL WDNGTP
Sbjct  1    MAGRLSNAAARIMGGNGVVARSVASSLRTRAGMGLPVGKHIVPDKPLGVNDELTWDNGTP  60

Query  230  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVE  409
            FPEPCIDRIADTVGKYEALAW+ GGL FF  LGL+AVWNDKAS IPFTPKVYPYDNL+VE
Sbjct  61   FPEPCIDRIADTVGKYEALAWLSGGLSFFVGLGLLAVWNDKASTIPFTPKVYPYDNLRVE  120

Query  410  LGGEP  424
            LGGEP
Sbjct  121  LGGEP  125



>ref|XP_010662384.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial [Vitis vinifera]
Length=125

 Score =   230 bits (587),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 109/125 (87%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = +2

Query  50   MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  229
            MAGRLS  A+ IMGG GVV+RSVASSL  R+GMGLPVGKHIVP+KPLPVNDEL+WDNGTP
Sbjct  1    MAGRLSNVASRIMGGSGVVSRSVASSLPLRSGMGLPVGKHIVPNKPLPVNDELIWDNGTP  60

Query  230  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVE  409
            FPEPCIDRIA+TVGKYEALAWMCGGL FFASLGL+AVWNDKASKIPFTP+VYPYDNL+VE
Sbjct  61   FPEPCIDRIAETVGKYEALAWMCGGLSFFASLGLLAVWNDKASKIPFTPRVYPYDNLRVE  120

Query  410  LGGEP  424
            LGGEP
Sbjct  121  LGGEP  125



>ref|XP_007215154.1| hypothetical protein PRUPE_ppa013399mg [Prunus persica]
 gb|EMJ16353.1| hypothetical protein PRUPE_ppa013399mg [Prunus persica]
Length=125

 Score =   229 bits (585),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 109/125 (87%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = +2

Query  50   MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  229
            MAGRLS  A+ IMGG GVV+RSVASSLR RAGMGLPVGKHIVP++PL VNDEL+WDNGTP
Sbjct  1    MAGRLSSVASKIMGGNGVVSRSVASSLRLRAGMGLPVGKHIVPNRPLHVNDELVWDNGTP  60

Query  230  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVE  409
            FPEPCIDRIADTVGKYEALAW+CGGL FFASLGL+AVWNDKASKIPF PKVYPYDNL+VE
Sbjct  61   FPEPCIDRIADTVGKYEALAWLCGGLSFFASLGLLAVWNDKASKIPFAPKVYPYDNLRVE  120

Query  410  LGGEP  424
            LGGEP
Sbjct  121  LGGEP  125



>ref|XP_006355476.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial-like [Solanum tuberosum]
Length=125

 Score =   229 bits (584),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 110/125 (88%), Positives = 114/125 (91%), Gaps = 0/125 (0%)
 Frame = +2

Query  50   MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  229
            MAGRLS  A  IMGG GVVARSVASSLRTRAGMGLPVGKHIVPDKPL VNDEL WDNGTP
Sbjct  1    MAGRLSNVATRIMGGNGVVARSVASSLRTRAGMGLPVGKHIVPDKPLHVNDELTWDNGTP  60

Query  230  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVE  409
            FPEPCIDRIADTVGKYEALAW+CGGL  F  +GL+AVWNDKASKIPFTPKVYPYDNL+VE
Sbjct  61   FPEPCIDRIADTVGKYEALAWLCGGLSCFVGIGLLAVWNDKASKIPFTPKVYPYDNLRVE  120

Query  410  LGGEP  424
            LGGEP
Sbjct  121  LGGEP  125



>ref|XP_008228960.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial [Prunus mume]
Length=125

 Score =   229 bits (584),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 109/125 (87%), Positives = 116/125 (93%), Gaps = 0/125 (0%)
 Frame = +2

Query  50   MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  229
            MAGRLS  A+ IMGG GVV+RSVASSLR RAGMGLPVGKHIVP+ PL VNDEL+WDNGTP
Sbjct  1    MAGRLSSVASKIMGGNGVVSRSVASSLRLRAGMGLPVGKHIVPNSPLHVNDELVWDNGTP  60

Query  230  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVE  409
            FPEPCIDRIADTVGKYEALAW+CGGL FFASLGL+AVWNDKASKIPF PKVYPYDNL+VE
Sbjct  61   FPEPCIDRIADTVGKYEALAWLCGGLSFFASLGLLAVWNDKASKIPFAPKVYPYDNLRVE  120

Query  410  LGGEP  424
            LGGEP
Sbjct  121  LGGEP  125



>ref|XP_010530067.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial [Tarenaya hassleriana]
Length=125

 Score =   229 bits (583),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 108/125 (86%), Positives = 116/125 (93%), Gaps = 0/125 (0%)
 Frame = +2

Query  50   MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  229
            MAGRLS  A+ IMGG GV+ARSV SS+R RAGMGLPVGKHIVPDKPLPVNDEL+WDNGT 
Sbjct  1    MAGRLSGVASRIMGGNGVIARSVGSSIRLRAGMGLPVGKHIVPDKPLPVNDELVWDNGTA  60

Query  230  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVE  409
            FPEPC+DRIADTVGKYEAL W+CGGLGFFA+LGL AVWNDKASKIPFTPKVYPYDNL+VE
Sbjct  61   FPEPCVDRIADTVGKYEALGWLCGGLGFFATLGLAAVWNDKASKIPFTPKVYPYDNLRVE  120

Query  410  LGGEP  424
            LGGEP
Sbjct  121  LGGEP  125



>ref|XP_008343083.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial [Malus domestica]
 ref|XP_008353844.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial [Malus domestica]
Length=125

 Score =   228 bits (581),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 109/125 (87%), Positives = 115/125 (92%), Gaps = 0/125 (0%)
 Frame = +2

Query  50   MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  229
            MAGRLS  A+ IMGG GVV+RSVASSLR RAGMGLPVGKHIVPDKPLPVNDEL+WDNGTP
Sbjct  1    MAGRLSSVASKIMGGNGVVSRSVASSLRVRAGMGLPVGKHIVPDKPLPVNDELVWDNGTP  60

Query  230  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVE  409
            FPEPC DRIADTVGKYEALAW+CGGL  FA LGL+AVWNDKASKIPF PKVYPYDNL+VE
Sbjct  61   FPEPCXDRIADTVGKYEALAWLCGGLSCFAGLGLLAVWNDKASKIPFAPKVYPYDNLRVE  120

Query  410  LGGEP  424
            LGGEP
Sbjct  121  LGGEP  125



>ref|XP_004245753.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial [Solanum lycopersicum]
Length=125

 Score =   228 bits (581),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 109/125 (87%), Positives = 114/125 (91%), Gaps = 0/125 (0%)
 Frame = +2

Query  50   MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  229
            MAGRLS  A  IMGG GVVARS+ASSLRTRAGMGLPVGKHIVPDKPL VNDEL WDNGTP
Sbjct  1    MAGRLSNVATRIMGGNGVVARSLASSLRTRAGMGLPVGKHIVPDKPLHVNDELTWDNGTP  60

Query  230  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVE  409
            FPEPCIDRIADTVGKYEALAW+CGGL  F  +GL+AVWNDKASKIPFTPKVYPYDNL+VE
Sbjct  61   FPEPCIDRIADTVGKYEALAWLCGGLSCFVGIGLLAVWNDKASKIPFTPKVYPYDNLRVE  120

Query  410  LGGEP  424
            LGGEP
Sbjct  121  LGGEP  125



>ref|NP_001235493.1| uncharacterized protein LOC100499749 [Glycine max]
 gb|ACU13472.1| unknown [Glycine max]
 gb|KHN04354.1| NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, 
mitochondrial [Glycine soja]
Length=125

 Score =   228 bits (581),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = +2

Query  50   MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  229
            MAGRL+ AA+ I+GG GVV RSVASSLR R+GMGLPVGKH VPDKPLP+N+EL+WDNGT 
Sbjct  1    MAGRLTNAASRILGGNGVVYRSVASSLRLRSGMGLPVGKHYVPDKPLPMNEELLWDNGTA  60

Query  230  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVE  409
            FPEPCIDRIADTVGKYEALAW+CGGL FFASLGL+AVWNDKASKIPFTPKVYPYDNL+VE
Sbjct  61   FPEPCIDRIADTVGKYEALAWLCGGLSFFASLGLLAVWNDKASKIPFTPKVYPYDNLRVE  120

Query  410  LGGEP  424
            LGGEP
Sbjct  121  LGGEP  125



>emb|CDP09936.1| unnamed protein product [Coffea canephora]
Length=125

 Score =   228 bits (580),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 108/125 (86%), Positives = 116/125 (93%), Gaps = 0/125 (0%)
 Frame = +2

Query  50   MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  229
            MAGRLS  A+ IMGG GVVARSV SSLR R+GMGLPVGKHIVPDKPLPVNDEL+WDNGTP
Sbjct  1    MAGRLSHMASRIMGGNGVVARSVGSSLRLRSGMGLPVGKHIVPDKPLPVNDELVWDNGTP  60

Query  230  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVE  409
            FPEPCIDRIA+TVGKYEAL+WMCGGLGFFASLGL+AVWNDKASKIP+TPKVYPY NL+ E
Sbjct  61   FPEPCIDRIAETVGKYEALSWMCGGLGFFASLGLLAVWNDKASKIPYTPKVYPYGNLRAE  120

Query  410  LGGEP  424
            LG EP
Sbjct  121  LGEEP  125



>ref|XP_009602608.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial [Nicotiana tomentosiformis]
Length=125

 Score =   228 bits (580),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 110/125 (88%), Positives = 113/125 (90%), Gaps = 0/125 (0%)
 Frame = +2

Query  50   MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  229
            MAGRLS AA  IMGG GVVARSV SSLRTRAGMGLPVGKHIVPDKPL VNDEL WDNGTP
Sbjct  1    MAGRLSNAAVRIMGGNGVVARSVVSSLRTRAGMGLPVGKHIVPDKPLGVNDELTWDNGTP  60

Query  230  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVE  409
            FPEPCIDRIADTVGKYEALAW+ GGL FF  LGL+AVWNDKAS IPFTPKVYPYDNL+VE
Sbjct  61   FPEPCIDRIADTVGKYEALAWLSGGLSFFVGLGLLAVWNDKASTIPFTPKVYPYDNLRVE  120

Query  410  LGGEP  424
            LGGEP
Sbjct  121  LGGEP  125



>ref|XP_007161348.1| hypothetical protein PHAVU_001G061600g [Phaseolus vulgaris]
 gb|ESW33342.1| hypothetical protein PHAVU_001G061600g [Phaseolus vulgaris]
Length=156

 Score =   229 bits (583),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = +2

Query  50   MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  229
            MAGRL+ AA+ I+GG GVV RSVASSLR R+GMGLPVGKH VPDKPLP+N+EL+WDNGTP
Sbjct  32   MAGRLTNAASRILGGNGVVYRSVASSLRLRSGMGLPVGKHYVPDKPLPMNEELLWDNGTP  91

Query  230  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVE  409
            FPEPCIDRIADTVGKYEALAW+CGGL  FASLGL+AVWNDKASKIPFTPKVYPYDNL+VE
Sbjct  92   FPEPCIDRIADTVGKYEALAWLCGGLSCFASLGLLAVWNDKASKIPFTPKVYPYDNLRVE  151

Query  410  LGGEP  424
            LGGEP
Sbjct  152  LGGEP  156



>ref|XP_007155645.1| hypothetical protein PHAVU_003G219300g [Phaseolus vulgaris]
 gb|ESW27639.1| hypothetical protein PHAVU_003G219300g [Phaseolus vulgaris]
Length=125

 Score =   227 bits (578),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 106/125 (85%), Positives = 116/125 (93%), Gaps = 0/125 (0%)
 Frame = +2

Query  50   MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  229
            MAGRL+  A+ I+GG GVV RSVASSLR R+GMGLPVGKH VPDKPLP+N+EL+WDNGTP
Sbjct  1    MAGRLTNTASRILGGNGVVYRSVASSLRLRSGMGLPVGKHYVPDKPLPMNEELLWDNGTP  60

Query  230  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVE  409
            FPEPCIDRIADTVGKYEALAW+CGGL FFASLGL+AVWNDKASKIPF PKVYPYDNL+VE
Sbjct  61   FPEPCIDRIADTVGKYEALAWLCGGLSFFASLGLLAVWNDKASKIPFAPKVYPYDNLRVE  120

Query  410  LGGEP  424
            LGGEP
Sbjct  121  LGGEP  125



>ref|XP_006398455.1| hypothetical protein EUTSA_v10001074mg [Eutrema salsugineum]
 gb|ESQ39908.1| hypothetical protein EUTSA_v10001074mg [Eutrema salsugineum]
Length=125

 Score =   227 bits (578),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 108/125 (86%), Positives = 115/125 (92%), Gaps = 0/125 (0%)
 Frame = +2

Query  50   MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  229
            MAGRLS  A+ IMGG GVVARS ASSLR RAGMGLPVGKHIVPDKPL VNDELMWDNGT 
Sbjct  1    MAGRLSGVASRIMGGNGVVARSAASSLRQRAGMGLPVGKHIVPDKPLSVNDELMWDNGTA  60

Query  230  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVE  409
            FPEPCIDRIADTVGKYEAL W+CGGLGFFA+LGL+AV NDKASK+PFTP+VYPYDNL+VE
Sbjct  61   FPEPCIDRIADTVGKYEALGWLCGGLGFFATLGLLAVLNDKASKVPFTPRVYPYDNLRVE  120

Query  410  LGGEP  424
            LGGEP
Sbjct  121  LGGEP  125



>ref|XP_004516831.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial-like [Cicer arietinum]
Length=125

 Score =   227 bits (578),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 106/125 (85%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = +2

Query  50   MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  229
            MAGRL+ AA+ I+GG GVV RSVASSLR R+GMGLPVGKH VP+KPLP+N+EL+WDNGTP
Sbjct  1    MAGRLTNAASRILGGNGVVHRSVASSLRLRSGMGLPVGKHYVPNKPLPMNEELLWDNGTP  60

Query  230  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVE  409
            FPEPCIDRIADTVGKYEALAW+CGGL FFASLGL+AVWNDKASK PFTPKVYPYDNL+VE
Sbjct  61   FPEPCIDRIADTVGKYEALAWLCGGLSFFASLGLLAVWNDKASKYPFTPKVYPYDNLRVE  120

Query  410  LGGEP  424
            LGGEP
Sbjct  121  LGGEP  125



>gb|KHG13058.1| hypothetical protein F383_17357 [Gossypium arboreum]
Length=125

 Score =   226 bits (577),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 107/124 (86%), Positives = 113/124 (91%), Gaps = 0/124 (0%)
 Frame = +2

Query  50   MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  229
            MAGRLS  A+ IMGG G+V+RS ASSLR R+GMGLPVGKHIVPDKPLPVNDELMWDNGT 
Sbjct  1    MAGRLSNVASKIMGGNGIVSRSAASSLRLRSGMGLPVGKHIVPDKPLPVNDELMWDNGTA  60

Query  230  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVE  409
            FPEPCIDRIADTVGKYEALAWMCGGL FFASLG +A WNDKASKIPF PKVYPYDNL+VE
Sbjct  61   FPEPCIDRIADTVGKYEALAWMCGGLSFFASLGFLAWWNDKASKIPFAPKVYPYDNLRVE  120

Query  410  LGGE  421
            LGGE
Sbjct  121  LGGE  124



>ref|XP_002518112.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF44245.1| conserved hypothetical protein [Ricinus communis]
Length=126

 Score =   226 bits (575),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 105/124 (85%), Positives = 115/124 (93%), Gaps = 0/124 (0%)
 Frame = +2

Query  53   AGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTPF  232
            AGRLS  A+ IMGG GVV+RS+ SSLR R+GMGLPVGKHIVPDKPLPVN+EL+WDNGTPF
Sbjct  3    AGRLSNVASRIMGGNGVVSRSIGSSLRLRSGMGLPVGKHIVPDKPLPVNEELVWDNGTPF  62

Query  233  PEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVEL  412
            PEPCIDRIADTVGKYEALAW+CGGL FFASLGL+AVWNDKASKIP+ PKVYPYDNL+ EL
Sbjct  63   PEPCIDRIADTVGKYEALAWLCGGLSFFASLGLLAVWNDKASKIPYVPKVYPYDNLRAEL  122

Query  413  GGEP  424
            GGEP
Sbjct  123  GGEP  126



>gb|ABK94153.1| unknown [Populus trichocarpa]
Length=125

 Score =   226 bits (575),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 113/125 (90%), Gaps = 0/125 (0%)
 Frame = +2

Query  50   MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  229
            MAGRLS  A+ IMGG GVV+RSVASSLR  +GMGLPVGKHIVPDKP+ VNDEL WDNGT 
Sbjct  1    MAGRLSNVASRIMGGNGVVSRSVASSLRLSSGMGLPVGKHIVPDKPISVNDELTWDNGTA  60

Query  230  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVE  409
            FPEPCIDRIADTVGKYEALAW+CGGLGFFASLGL+ VWNDKAS IPF PKVYPYDNLKVE
Sbjct  61   FPEPCIDRIADTVGKYEALAWLCGGLGFFASLGLLVVWNDKASTIPFAPKVYPYDNLKVE  120

Query  410  LGGEP  424
            LGGEP
Sbjct  121  LGGEP  125



>emb|CDY17725.1| BnaA06g35440D [Brassica napus]
Length=125

 Score =   226 bits (575),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 108/125 (86%), Positives = 115/125 (92%), Gaps = 0/125 (0%)
 Frame = +2

Query  50   MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  229
            MAGRLS  A+ IMGG GVVARS ASSLR RAGMGLPVGKHIVPDKPL VNDELMWDNGT 
Sbjct  1    MAGRLSGVASRIMGGNGVVARSNASSLRQRAGMGLPVGKHIVPDKPLSVNDELMWDNGTA  60

Query  230  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVE  409
            FPEPCIDRIADTVGKYEAL W+CGGLGFFA+LGL+AV NDKASK+PFTP+VYPYDNL+VE
Sbjct  61   FPEPCIDRIADTVGKYEALGWLCGGLGFFATLGLLAVVNDKASKVPFTPRVYPYDNLRVE  120

Query  410  LGGEP  424
            LGGEP
Sbjct  121  LGGEP  125



>gb|KJB21488.1| hypothetical protein B456_004G200300 [Gossypium raimondii]
Length=125

 Score =   225 bits (574),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 106/125 (85%), Positives = 114/125 (91%), Gaps = 0/125 (0%)
 Frame = +2

Query  50   MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  229
            MAGRLS  A+ IMGG GVV+RS+ASS R R+G+GLPVGKHIVPDKPLPVNDEL+WDNGT 
Sbjct  1    MAGRLSNVASRIMGGTGVVSRSIASSFRLRSGIGLPVGKHIVPDKPLPVNDELIWDNGTA  60

Query  230  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVE  409
            FPEPCIDRIADTVGKYEALAWMCGGL FFASLG +A WNDKASKIPF PKVYPYDNL+VE
Sbjct  61   FPEPCIDRIADTVGKYEALAWMCGGLSFFASLGFLAWWNDKASKIPFAPKVYPYDNLRVE  120

Query  410  LGGEP  424
            LGGEP
Sbjct  121  LGGEP  125



>gb|KHG01041.1| hypothetical protein F383_21717 [Gossypium arboreum]
Length=125

 Score =   225 bits (574),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 114/125 (91%), Gaps = 0/125 (0%)
 Frame = +2

Query  50   MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  229
            MAGRLS  A+ IMGG GVV+RSVASS R R+GMGLPVGKHIVPDKPLPVNDEL+WDNGT 
Sbjct  1    MAGRLSNVASRIMGGTGVVSRSVASSFRLRSGMGLPVGKHIVPDKPLPVNDELIWDNGTA  60

Query  230  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVE  409
            FPEPCIDRIADTVGKYEALAWMCGGL FFASLG +A WNDKASKIPF PKVYPYD+L+VE
Sbjct  61   FPEPCIDRIADTVGKYEALAWMCGGLSFFASLGFLAWWNDKASKIPFAPKVYPYDSLRVE  120

Query  410  LGGEP  424
            LGGEP
Sbjct  121  LGGEP  125



>emb|CDY41058.1| BnaA09g18370D [Brassica napus]
Length=125

 Score =   225 bits (574),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 108/125 (86%), Positives = 115/125 (92%), Gaps = 0/125 (0%)
 Frame = +2

Query  50   MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  229
            MAGRLS  A+ IMGG GVVARS ASSLR RAGMGLPVGKHIVPDKPL VNDELMWDNGT 
Sbjct  1    MAGRLSGVASRIMGGNGVVARSGASSLRQRAGMGLPVGKHIVPDKPLSVNDELMWDNGTA  60

Query  230  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVE  409
            FPEPCIDRIADTVGKYEAL W+CGGLGFFA+LGL+AV NDKASK+PFTP+VYPYDNL+VE
Sbjct  61   FPEPCIDRIADTVGKYEALGWLCGGLGFFATLGLLAVVNDKASKVPFTPRVYPYDNLRVE  120

Query  410  LGGEP  424
            LGGEP
Sbjct  121  LGGEP  125



>gb|EYU32869.1| hypothetical protein MIMGU_mgv1a016342mg [Erythranthe guttata]
Length=125

 Score =   225 bits (573),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 106/125 (85%), Positives = 114/125 (91%), Gaps = 0/125 (0%)
 Frame = +2

Query  50   MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  229
            MAGRLS  A+ IMGG GVV RSVA+SLR R+GMGLPVGKH+VPDKPLPVNDEL+WDNGTP
Sbjct  1    MAGRLSHVASRIMGGNGVVQRSVATSLRQRSGMGLPVGKHLVPDKPLPVNDELVWDNGTP  60

Query  230  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVE  409
            FPEPCIDRIADTVGKYEALAW+CGGL  FA LGL+AVWNDKAS IPF PKVYPYDNL+VE
Sbjct  61   FPEPCIDRIADTVGKYEALAWLCGGLSCFAGLGLLAVWNDKASTIPFAPKVYPYDNLRVE  120

Query  410  LGGEP  424
            LGGEP
Sbjct  121  LGGEP  125



>ref|XP_009101408.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial isoform X2 [Brassica rapa]
Length=125

 Score =   224 bits (572),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 115/125 (92%), Gaps = 0/125 (0%)
 Frame = +2

Query  50   MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  229
            MAGRLS  A+ IMGG GVVAR+ ASSLR RAGMGLPVGKHIVPDKPL VNDELMWDNGT 
Sbjct  1    MAGRLSGVASRIMGGNGVVARTNASSLRQRAGMGLPVGKHIVPDKPLSVNDELMWDNGTA  60

Query  230  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVE  409
            FPEPCIDRIADTVGKYEAL W+CGGLGFFA+LGL+AV NDKASK+PFTP+VYPYDNL+VE
Sbjct  61   FPEPCIDRIADTVGKYEALGWLCGGLGFFATLGLLAVVNDKASKVPFTPRVYPYDNLRVE  120

Query  410  LGGEP  424
            LGGEP
Sbjct  121  LGGEP  125



>gb|EPS58672.1| hypothetical protein M569_16139, partial [Genlisea aurea]
Length=124

 Score =   224 bits (572),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 104/124 (84%), Positives = 116/124 (94%), Gaps = 0/124 (0%)
 Frame = +2

Query  53   AGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTPF  232
            AGRLS  A+ I+GG   ++RS A+SLR RAGMGLPVGKHIVPDKPLPVNDEL+WDNGTPF
Sbjct  1    AGRLSHVASRILGGNCAISRSTAASLRRRAGMGLPVGKHIVPDKPLPVNDELVWDNGTPF  60

Query  233  PEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVEL  412
            PEPCIDRIADTVGKYEALAW+CGGLGFFASLGL+AVWNDKAS+IP+TPKV+PYDNL+VEL
Sbjct  61   PEPCIDRIADTVGKYEALAWLCGGLGFFASLGLLAVWNDKASRIPYTPKVFPYDNLRVEL  120

Query  413  GGEP  424
            GGEP
Sbjct  121  GGEP  124



>gb|KHN09808.1| NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, 
mitochondrial [Glycine soja]
Length=125

 Score =   224 bits (571),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 105/125 (84%), Positives = 115/125 (92%), Gaps = 0/125 (0%)
 Frame = +2

Query  50   MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  229
            MAGRL+ AA+ I+GG GVV RSVASSLR R+GMGLPVGKH VPDKPLP+N+EL+WDNGT 
Sbjct  1    MAGRLTNAASRILGGNGVVYRSVASSLRLRSGMGLPVGKHYVPDKPLPMNEELLWDNGTA  60

Query  230  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVE  409
            FPEPCIDRIADTVGKYEALAW+CGGL FFASLGL+AVWNDKASK PF PKVYPYDNL+VE
Sbjct  61   FPEPCIDRIADTVGKYEALAWLCGGLSFFASLGLLAVWNDKASKTPFAPKVYPYDNLRVE  120

Query  410  LGGEP  424
            LGGEP
Sbjct  121  LGGEP  125



>ref|XP_006281322.1| hypothetical protein CARUB_v10027375mg [Capsella rubella]
 gb|EOA14220.1| hypothetical protein CARUB_v10027375mg [Capsella rubella]
Length=125

 Score =   224 bits (571),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 115/125 (92%), Gaps = 0/125 (0%)
 Frame = +2

Query  50   MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  229
            MAGRLS  A+ IMGG GVVARSV SSLR RAGMGLPVGKHIVP+KPL VNDELMWDNGT 
Sbjct  1    MAGRLSGVASRIMGGNGVVARSVGSSLRQRAGMGLPVGKHIVPNKPLSVNDELMWDNGTA  60

Query  230  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVE  409
            FPEPCIDRIADTVGKYEALAW+ GGLGFFA+LGL+AV NDKASK+PFTP+VYPYDNL+VE
Sbjct  61   FPEPCIDRIADTVGKYEALAWLSGGLGFFATLGLLAVLNDKASKVPFTPRVYPYDNLRVE  120

Query  410  LGGEP  424
            LGGEP
Sbjct  121  LGGEP  125



>ref|XP_004147198.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial-like [Cucumis sativus]
 ref|XP_004166721.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial-like [Cucumis sativus]
 ref|XP_008448866.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial [Cucumis melo]
 gb|KGN55877.1| hypothetical protein Csa_3G021140 [Cucumis sativus]
Length=127

 Score =   224 bits (571),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 104/125 (83%), Positives = 115/125 (92%), Gaps = 0/125 (0%)
 Frame = +2

Query  50   MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  229
            MAG+L+   + I+GG GVV RS+ASSLR R+GMGLPVGKHIVPDKPLP NDEL+WDNGTP
Sbjct  1    MAGKLTNLGSKILGGNGVVGRSIASSLRLRSGMGLPVGKHIVPDKPLPENDELVWDNGTP  60

Query  230  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVE  409
            FPEPCIDRIADTVGKYEALAW+CGGLGFFASLG +AVWNDKASKIPF PKVYPYDNL+VE
Sbjct  61   FPEPCIDRIADTVGKYEALAWLCGGLGFFASLGFLAVWNDKASKIPFAPKVYPYDNLRVE  120

Query  410  LGGEP  424
            LGG+P
Sbjct  121  LGGDP  125



>ref|XP_011466981.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial [Fragaria vesca subsp. vesca]
Length=125

 Score =   224 bits (570),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 108/125 (86%), Positives = 113/125 (90%), Gaps = 0/125 (0%)
 Frame = +2

Query  50   MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  229
            MAGRLS AA+ IMGG GVV RSVASSLR RAGMGLPVGKHIVPD+PLPVNDEL WDNGTP
Sbjct  1    MAGRLSSAASKIMGGNGVVHRSVASSLRLRAGMGLPVGKHIVPDRPLPVNDELTWDNGTP  60

Query  230  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVE  409
            FPEPCIDRIADTVGKYEALAW+ GGL  F  LGL+AVWNDKASKIPF PKVYPYDNL+VE
Sbjct  61   FPEPCIDRIADTVGKYEALAWLTGGLSCFVGLGLLAVWNDKASKIPFAPKVYPYDNLRVE  120

Query  410  LGGEP  424
            LGGEP
Sbjct  121  LGGEP  125



>emb|CDX77778.1| BnaC07g20320D [Brassica napus]
Length=125

 Score =   224 bits (570),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 114/125 (91%), Gaps = 0/125 (0%)
 Frame = +2

Query  50   MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  229
            MAGRLS  A+ IMGG GVVARS ASSLR RAGMGLPVGKHIVPDKPL VNDELMWDNGT 
Sbjct  1    MAGRLSGVASRIMGGNGVVARSNASSLRQRAGMGLPVGKHIVPDKPLSVNDELMWDNGTA  60

Query  230  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVE  409
            FPEPCIDRIADTVGKYEAL W+CGGLGFFA+LGL+AV NDKASK+PF P+VYPYDNL+VE
Sbjct  61   FPEPCIDRIADTVGKYEALGWLCGGLGFFATLGLLAVVNDKASKVPFAPRVYPYDNLRVE  120

Query  410  LGGEP  424
            LGGEP
Sbjct  121  LGGEP  125



>ref|XP_009114266.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial-like [Brassica rapa]
Length=125

 Score =   223 bits (569),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 114/125 (91%), Gaps = 0/125 (0%)
 Frame = +2

Query  50   MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  229
            MAGRLS  A+ IMGG GVVARS ASSLR RAGMGLPVGKHI PDKPL VNDELMWDNGT 
Sbjct  1    MAGRLSGVASRIMGGNGVVARSGASSLRQRAGMGLPVGKHIAPDKPLSVNDELMWDNGTA  60

Query  230  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVE  409
            FPEPCIDRIADTVGKYEAL W+CGGLGFFA+LGL+AV NDKASK+PFTP+VYPYDNL+VE
Sbjct  61   FPEPCIDRIADTVGKYEALGWLCGGLGFFATLGLLAVVNDKASKVPFTPRVYPYDNLRVE  120

Query  410  LGGEP  424
            LGGEP
Sbjct  121  LGGEP  125



>gb|KJB51916.1| hypothetical protein B456_008G237800 [Gossypium raimondii]
Length=125

 Score =   223 bits (569),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 105/125 (84%), Positives = 113/125 (90%), Gaps = 0/125 (0%)
 Frame = +2

Query  50   MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  229
            MAGRLS  A+ +MGG G+V+RS ASSLR R+GMGLPVGKHIVPDKPL VNDEL+WDNGT 
Sbjct  1    MAGRLSNVASKLMGGNGIVSRSAASSLRLRSGMGLPVGKHIVPDKPLSVNDELIWDNGTA  60

Query  230  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVE  409
            FPEPCIDRIADTVGKYEALAWMCGGL FFASLG +A WNDKASKIPF PKVYPYDNL+VE
Sbjct  61   FPEPCIDRIADTVGKYEALAWMCGGLSFFASLGFLAWWNDKASKIPFAPKVYPYDNLRVE  120

Query  410  LGGEP  424
            LGGEP
Sbjct  121  LGGEP  125



>ref|XP_010919522.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial-like isoform X1 [Elaeis guineensis]
Length=125

 Score =   223 bits (568),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 116/125 (93%), Gaps = 0/125 (0%)
 Frame = +2

Query  50   MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  229
            MAGRLS   + IMGG GVV RS+ SSLRTR+GMGLPVGKHIVPDKPLPV+DEL+WDNGTP
Sbjct  1    MAGRLSSVGSRIMGGNGVVGRSLVSSLRTRSGMGLPVGKHIVPDKPLPVHDELVWDNGTP  60

Query  230  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVE  409
            +PEPC+DR+A T+GKYEAL W+CGGLGFFA+LGL+AVWNDKASKIP+TPKVYPYDNL+VE
Sbjct  61   YPEPCVDRLAPTIGKYEALGWLCGGLGFFATLGLLAVWNDKASKIPYTPKVYPYDNLRVE  120

Query  410  LGGEP  424
            LGGEP
Sbjct  121  LGGEP  125



>emb|CDY40556.1| BnaC02g33360D [Brassica napus]
Length=125

 Score =   223 bits (567),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 105/125 (84%), Positives = 114/125 (91%), Gaps = 0/125 (0%)
 Frame = +2

Query  50   MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  229
            MAGRLS  A+ IMGG GVVARS ASSLR RAGMGLPVGKHIVPDKPL VNDELMWDNGT 
Sbjct  1    MAGRLSGVASRIMGGNGVVARSAASSLRQRAGMGLPVGKHIVPDKPLSVNDELMWDNGTA  60

Query  230  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVE  409
            FPEPCIDRIADTVGKYEAL W+CGGL FFA+LG++AV NDKASK+PF+P+VYPYDNL+VE
Sbjct  61   FPEPCIDRIADTVGKYEALGWLCGGLSFFAALGMLAVLNDKASKVPFSPRVYPYDNLRVE  120

Query  410  LGGEP  424
            LGGEP
Sbjct  121  LGGEP  125



>emb|CDY28920.1| BnaA02g25560D [Brassica napus]
Length=125

 Score =   223 bits (567),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 105/125 (84%), Positives = 113/125 (90%), Gaps = 0/125 (0%)
 Frame = +2

Query  50   MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  229
            MAGRLS  A+ IMGG G+VARS ASSLR RAGMGLPVGKHIVPDKPL VNDELMWDNGT 
Sbjct  1    MAGRLSGVASRIMGGNGIVARSAASSLRQRAGMGLPVGKHIVPDKPLSVNDELMWDNGTA  60

Query  230  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVE  409
            FPEPCIDRIADTVGKYEAL W+CGGL FFA LG++AV NDKASK+PFTP+VYPYDNL+VE
Sbjct  61   FPEPCIDRIADTVGKYEALGWLCGGLSFFAGLGMLAVLNDKASKVPFTPRVYPYDNLRVE  120

Query  410  LGGEP  424
            LGGEP
Sbjct  121  LGGEP  125



>ref|XP_010441437.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial [Camelina sativa]
 ref|XP_010481304.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial [Camelina sativa]
Length=125

 Score =   222 bits (565),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 105/125 (84%), Positives = 115/125 (92%), Gaps = 0/125 (0%)
 Frame = +2

Query  50   MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  229
            MAGRLS  A+ IMGG GVVARSV SSLR R+GMGLPVGKHIVP+KPL VNDELMWDNGT 
Sbjct  1    MAGRLSGVASRIMGGNGVVARSVGSSLRQRSGMGLPVGKHIVPNKPLSVNDELMWDNGTA  60

Query  230  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVE  409
            FPEPCIDRIADTVGKYEALAW+ GGLGFFA+LGL+AV+NDKAS +PFTP+VYPYDNL+VE
Sbjct  61   FPEPCIDRIADTVGKYEALAWLSGGLGFFAALGLLAVFNDKASTVPFTPRVYPYDNLRVE  120

Query  410  LGGEP  424
            LGGEP
Sbjct  121  LGGEP  125



>ref|XP_009128982.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial-like [Brassica rapa]
Length=125

 Score =   222 bits (565),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 104/125 (83%), Positives = 113/125 (90%), Gaps = 0/125 (0%)
 Frame = +2

Query  50   MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  229
            MAGRLS  A+ IMGG G+VARS ASSLR RAGMGLPVGKHIVPDKPL VNDELMWDNGT 
Sbjct  1    MAGRLSGVASRIMGGNGIVARSAASSLRQRAGMGLPVGKHIVPDKPLSVNDELMWDNGTA  60

Query  230  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVE  409
            FPEPCIDRIADTVGKYEAL W+CGGL FF +LG++AV NDKASK+PFTP+VYPYDNL+VE
Sbjct  61   FPEPCIDRIADTVGKYEALGWLCGGLSFFGALGMLAVLNDKASKVPFTPRVYPYDNLRVE  120

Query  410  LGGEP  424
            LGGEP
Sbjct  121  LGGEP  125



>gb|KFK31361.1| hypothetical protein AALP_AA6G102500 [Arabis alpina]
Length=125

 Score =   221 bits (563),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 105/125 (84%), Positives = 115/125 (92%), Gaps = 0/125 (0%)
 Frame = +2

Query  50   MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  229
            MAGRLS  A+ IMGG GVVARSV SSLR RAGMGLPVGKHIVP+KPL VNDELMWDNGT 
Sbjct  1    MAGRLSGVASRIMGGNGVVARSVGSSLRQRAGMGLPVGKHIVPNKPLSVNDELMWDNGTA  60

Query  230  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVE  409
            FPEPCIDRIADTVGKYEAL W+CGGLGFFA+LGL+AV+NDKAS +P+TP+VYPYDNL+VE
Sbjct  61   FPEPCIDRIADTVGKYEALGWLCGGLGFFAALGLLAVFNDKASTVPWTPRVYPYDNLRVE  120

Query  410  LGGEP  424
            LGGEP
Sbjct  121  LGGEP  125



>gb|KJB21491.1| hypothetical protein B456_004G200300 [Gossypium raimondii]
Length=126

 Score =   221 bits (563),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 106/126 (84%), Positives = 114/126 (90%), Gaps = 1/126 (1%)
 Frame = +2

Query  50   MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  229
            MAGRLS  A+ IMGG GVV+RS+ASS R R+G+GLPVGKHIVPDKPLPVNDEL+WDNGT 
Sbjct  1    MAGRLSNVASRIMGGTGVVSRSIASSFRLRSGIGLPVGKHIVPDKPLPVNDELIWDNGTA  60

Query  230  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPF-TPKVYPYDNLKV  406
            FPEPCIDRIADTVGKYEALAWMCGGL FFASLG +A WNDKASKIPF  PKVYPYDNL+V
Sbjct  61   FPEPCIDRIADTVGKYEALAWMCGGLSFFASLGFLAWWNDKASKIPFQAPKVYPYDNLRV  120

Query  407  ELGGEP  424
            ELGGEP
Sbjct  121  ELGGEP  126



>gb|AGL09490.1| NADH dehydrogenase 1 beta subcomplex subunit 8, partial [Hydnora 
visseri]
Length=125

 Score =   219 bits (557),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 100/125 (80%), Positives = 116/125 (93%), Gaps = 0/125 (0%)
 Frame = +2

Query  50   MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  229
            MAGRL++ A+ I+GG GVV+RSV+ SLR R+GMGLPVG HIVP+ PLPVNDEL+WDNGTP
Sbjct  1    MAGRLAKVASRIVGGDGVVSRSVSLSLRHRSGMGLPVGSHIVPNNPLPVNDELVWDNGTP  60

Query  230  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVE  409
            FPEPC+DRIA T+GKYE LAW+CGGLGFFASLGL+AVWNDKASK+PFTPK+YPYDNL+VE
Sbjct  61   FPEPCVDRIAPTIGKYEGLAWLCGGLGFFASLGLLAVWNDKASKLPFTPKIYPYDNLRVE  120

Query  410  LGGEP  424
            LGGEP
Sbjct  121  LGGEP  125



>ref|XP_008786987.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial-like [Phoenix dactylifera]
Length=125

 Score =   218 bits (555),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 100/125 (80%), Positives = 113/125 (90%), Gaps = 0/125 (0%)
 Frame = +2

Query  50   MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  229
            MAGRLS   + IMGG GVV RS+ASSLRTR+GMGLPVGKHIVPDKPLP +DEL+WDNGTP
Sbjct  1    MAGRLSSLGSRIMGGNGVVGRSLASSLRTRSGMGLPVGKHIVPDKPLPTHDELVWDNGTP  60

Query  230  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVE  409
            +PEPCIDR+A T+GKYEAL W+CGGL FFA +GL+ VWNDKASKIP+TPKVYPYDNL+VE
Sbjct  61   YPEPCIDRLAPTIGKYEALGWLCGGLSFFAVIGLLTVWNDKASKIPYTPKVYPYDNLRVE  120

Query  410  LGGEP  424
            LGGEP
Sbjct  121  LGGEP  125



>ref|XP_010494996.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial-like [Camelina sativa]
Length=125

 Score =   218 bits (555),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 104/125 (83%), Positives = 113/125 (90%), Gaps = 0/125 (0%)
 Frame = +2

Query  50   MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  229
            MAGRLS  A+ IMGG GVVARSV SSLR R+GMGLPVGKHIVP+KPL VNDELMWDNGT 
Sbjct  1    MAGRLSGVASRIMGGNGVVARSVGSSLRQRSGMGLPVGKHIVPNKPLSVNDELMWDNGTA  60

Query  230  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVE  409
            FPEPCIDRIADTVGKYEALAW+ GGLGFFA+LGL+AV NDKAS +PFT +VYPYDNL+VE
Sbjct  61   FPEPCIDRIADTVGKYEALAWLSGGLGFFAALGLLAVVNDKASTVPFTRRVYPYDNLRVE  120

Query  410  LGGEP  424
            LGGEP
Sbjct  121  LGGEP  125



>ref|XP_003608732.1| hypothetical protein MTR_4g101140 [Medicago truncatula]
 gb|AES90929.1| NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8 [Medicago 
truncatula]
 gb|AFK36027.1| unknown [Medicago truncatula]
Length=125

 Score =   218 bits (554),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 112/125 (90%), Gaps = 0/125 (0%)
 Frame = +2

Query  50   MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  229
            MAGRL+  A+ I+GG GVV RSVASSLR R+GMGLPVGKH VP+KPLP+N+EL WDNGTP
Sbjct  1    MAGRLTNVASQILGGNGVVHRSVASSLRLRSGMGLPVGKHYVPNKPLPMNEELTWDNGTP  60

Query  230  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVE  409
            FPEPCIDRIADTVGKYEALAW+CGGL  FA LGL+AVWNDKASK PF PKVYPYDNL+VE
Sbjct  61   FPEPCIDRIADTVGKYEALAWLCGGLSCFAGLGLLAVWNDKASKTPFAPKVYPYDNLRVE  120

Query  410  LGGEP  424
            LGGEP
Sbjct  121  LGGEP  125



>ref|XP_008796817.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial-like isoform X4 [Phoenix dactylifera]
Length=125

 Score =   215 bits (548),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 98/125 (78%), Positives = 113/125 (90%), Gaps = 0/125 (0%)
 Frame = +2

Query  50   MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  229
            MAGRLS   + IMGG GVV RS+ SSLR R+GMGLPVGKHIVPDKPLPV+DEL+WDNGTP
Sbjct  1    MAGRLSSVGSRIMGGHGVVGRSLGSSLRNRSGMGLPVGKHIVPDKPLPVHDELVWDNGTP  60

Query  230  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVE  409
            +PEPCIDR+A T+GKYEAL W+CGGLG FA++GL+AVWNDKASK+P+TPKVYPYDNL+VE
Sbjct  61   YPEPCIDRLAPTIGKYEALGWLCGGLGIFATIGLLAVWNDKASKVPYTPKVYPYDNLRVE  120

Query  410  LGGEP  424
            LG EP
Sbjct  121  LGEEP  125



>ref|XP_009101407.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial isoform X1 [Brassica rapa]
Length=143

 Score =   214 bits (544),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 107/143 (75%), Positives = 115/143 (80%), Gaps = 18/143 (13%)
 Frame = +2

Query  50   MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  229
            MAGRLS  A+ IMGG GVVAR+ ASSLR RAGMGLPVGKHIVPDKPL VNDELMWDNGT 
Sbjct  1    MAGRLSGVASRIMGGNGVVARTNASSLRQRAGMGLPVGKHIVPDKPLSVNDELMWDNGTA  60

Query  230  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPF-------------  370
            FPEPCIDRIADTVGKYEAL W+CGGLGFFA+LGL+AV NDKASK+PF             
Sbjct  61   FPEPCIDRIADTVGKYEALGWLCGGLGFFATLGLLAVVNDKASKVPFGYLFSPFHGLSLI  120

Query  371  -----TPKVYPYDNLKVELGGEP  424
                 TP+VYPYDNL+VELGGEP
Sbjct  121  VLFLQTPRVYPYDNLRVELGGEP  143



>ref|XP_010919523.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial-like isoform X2 [Elaeis guineensis]
Length=122

 Score =   212 bits (540),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 100/125 (80%), Positives = 113/125 (90%), Gaps = 3/125 (2%)
 Frame = +2

Query  50   MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  229
            MAGRLS   + IMGG GVV RS+ SSLRTR+GMGLPVGKHIVPDKPLPV+DEL+WDNGTP
Sbjct  1    MAGRLSSVGSRIMGGNGVVGRSLVSSLRTRSGMGLPVGKHIVPDKPLPVHDELVWDNGTP  60

Query  230  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVE  409
            +PEPC+DR+A T+GKYEAL W+CGGLGFFA+LGL+AVWNDKASK   TPKVYPYDNL+VE
Sbjct  61   YPEPCVDRLAPTIGKYEALGWLCGGLGFFATLGLLAVWNDKASK---TPKVYPYDNLRVE  117

Query  410  LGGEP  424
            LGGEP
Sbjct  118  LGGEP  122



>ref|XP_008381184.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial-like [Malus domestica]
Length=125

 Score =   211 bits (538),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 99/125 (79%), Positives = 107/125 (86%), Gaps = 0/125 (0%)
 Frame = +2

Query  50   MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  229
            MAGRLS   + IMGG G+V+RS  SSL  R GMGLPVGKHIVPD+PLPVNDEL WD+GT 
Sbjct  1    MAGRLSSVISRIMGGSGIVSRSATSSLXLRXGMGLPVGKHIVPDRPLPVNDELXWDDGTS  60

Query  230  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVE  409
            FPEPCIDRI DTVGKYEALAW+CG L  FA LGL+AVWNDKASKIPF PKVYPYDNL+VE
Sbjct  61   FPEPCIDRITDTVGKYEALAWLCGSLSCFAXLGLLAVWNDKASKIPFAPKVYPYDNLQVE  120

Query  410  LGGEP  424
            LGGEP
Sbjct  121  LGGEP  125



>ref|XP_006440353.1| hypothetical protein CICLE_v10022867mg [Citrus clementina]
 ref|XP_006477235.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial-like [Citrus sinensis]
 gb|ESR53593.1| hypothetical protein CICLE_v10022867mg [Citrus clementina]
 gb|KDO61490.1| hypothetical protein CISIN_1g033216mg [Citrus sinensis]
Length=125

 Score =   210 bits (534),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 108/125 (86%), Positives = 115/125 (92%), Gaps = 0/125 (0%)
 Frame = +2

Query  50   MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  229
            MAGRLS  A+ IMGG GVV RSVASSLR R+GMGLPVGKHIVP+KPL VNDEL+WDNGTP
Sbjct  1    MAGRLSNVASQIMGGNGVVGRSVASSLRLRSGMGLPVGKHIVPNKPLSVNDELVWDNGTP  60

Query  230  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVE  409
            FPEPCIDRIADTVGKYEAL W+ GGLGFFASLG +AVWNDKASKIPFTPKVYPYDNL+VE
Sbjct  61   FPEPCIDRIADTVGKYEALGWLLGGLGFFASLGALAVWNDKASKIPFTPKVYPYDNLRVE  120

Query  410  LGGEP  424
            LGGEP
Sbjct  121  LGGEP  125



>ref|XP_010518861.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial-like [Tarenaya hassleriana]
Length=137

 Score =   203 bits (517),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 96/112 (86%), Positives = 102/112 (91%), Gaps = 0/112 (0%)
 Frame = +2

Query  50   MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  229
            MAGRLS  A+ IMGG GVVARSV SSLR RAGMGLPVGKHIVPDKPLPVNDEL+WDNGT 
Sbjct  1    MAGRLSGVASRIMGGNGVVARSVGSSLRQRAGMGLPVGKHIVPDKPLPVNDELVWDNGTA  60

Query  230  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVY  385
            FPEPC+DRIADTVGKYEAL W+CGGLGFF +LGL AVWNDKASKIPFTPKV+
Sbjct  61   FPEPCVDRIADTVGKYEALGWLCGGLGFFVTLGLAAVWNDKASKIPFTPKVF  112



>ref|XP_006830041.1| hypothetical protein AMTR_s00124p00115680 [Amborella trichopoda]
 gb|ERM97457.1| hypothetical protein AMTR_s00124p00115680 [Amborella trichopoda]
Length=124

 Score =   200 bits (508),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 98/125 (78%), Positives = 111/125 (89%), Gaps = 1/125 (1%)
 Frame = +2

Query  50   MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  229
            MA +LS AAA I+GG   +     SSLR R+GMGLPVGKHIVPDKPLPVNDEL+WDNGT 
Sbjct  1    MAAKLSSAAARILGGN-GLLLRGRSSLRHRSGMGLPVGKHIVPDKPLPVNDELIWDNGTA  59

Query  230  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVE  409
            +PEPC+D++A TVG+YEALAW+CGGLGFFASLGL+AVWNDKASKIPFTPKVYPYDNL+VE
Sbjct  60   YPEPCLDKLATTVGEYEALAWLCGGLGFFASLGLLAVWNDKASKIPFTPKVYPYDNLRVE  119

Query  410  LGGEP  424
            LGGEP
Sbjct  120  LGGEP  124



>ref|XP_010264245.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial isoform X2 [Nelumbo nucifera]
Length=115

 Score =   199 bits (506),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 92/111 (83%), Positives = 101/111 (91%), Gaps = 0/111 (0%)
 Frame = +2

Query  50   MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  229
            MAGRLS  A+ IMGG GV+ RSVASSLR R+GMGLPVGKHI+PDKPLPVNDEL+WDNGTP
Sbjct  1    MAGRLSNVASRIMGGNGVIGRSVASSLRLRSGMGLPVGKHIIPDKPLPVNDELLWDNGTP  60

Query  230  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKV  382
            FPEPC+DRIADTVGKYEALAW+CGGLGFFASLGL+ VWNDKASKIPF   +
Sbjct  61   FPEPCLDRIADTVGKYEALAWLCGGLGFFASLGLLVVWNDKASKIPFVVTI  111



>ref|NP_568684.1| uncharacterized protein [Arabidopsis thaliana]
 sp|Q9FGK0.1|NDUB8_ARATH RecName: Full=NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial; Flags: Precursor [Arabidopsis thaliana]
 gb|AAL58924.1|AF462836_1 AT5g47570/MNJ7_16 [Arabidopsis thaliana]
 dbj|BAB09083.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAM19870.1| AT5g47570/MNJ7_16 [Arabidopsis thaliana]
 gb|AAM61542.1| unknown [Arabidopsis thaliana]
 gb|AED95533.1| uncharacterized protein AT5G47570 [Arabidopsis thaliana]
Length=125

 Score =   199 bits (507),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 113/125 (90%), Gaps = 0/125 (0%)
 Frame = +2

Query  50   MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  229
            MAGRLS  A+ IMGG GVVARSV SSLR RAGMGLPVGKHIVPDKPL VNDELMWDNGT 
Sbjct  1    MAGRLSGVASRIMGGNGVVARSVGSSLRQRAGMGLPVGKHIVPDKPLSVNDELMWDNGTA  60

Query  230  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVE  409
            FPEPCIDRIADTVGKYEALAW+ GGLGFF  LGL+AV NDKASK+PFTP+VYPYDNL+VE
Sbjct  61   FPEPCIDRIADTVGKYEALAWLSGGLGFFVGLGLLAVLNDKASKVPFTPRVYPYDNLRVE  120

Query  410  LGGEP  424
            LGGEP
Sbjct  121  LGGEP  125



>ref|XP_002863335.1| hypothetical protein ARALYDRAFT_494216 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39594.1| hypothetical protein ARALYDRAFT_494216 [Arabidopsis lyrata subsp. 
lyrata]
Length=125

 Score =   197 bits (502),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 108/125 (86%), Positives = 114/125 (91%), Gaps = 0/125 (0%)
 Frame = +2

Query  50   MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  229
            MAGRLS  A+ IMGG GVVARSV SSLR RAGMGLPVGKHIVPDKPL VNDELMWDNGT 
Sbjct  1    MAGRLSGVASRIMGGNGVVARSVGSSLRQRAGMGLPVGKHIVPDKPLSVNDELMWDNGTA  60

Query  230  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVE  409
            FPEPCIDRIADTVGKYEALAW+ GGLGFFA LGL+AV NDKASK+PFTP+VYPYDNL+VE
Sbjct  61   FPEPCIDRIADTVGKYEALAWLSGGLGFFAGLGLLAVLNDKASKVPFTPRVYPYDNLRVE  120

Query  410  LGGEP  424
            LGGEP
Sbjct  121  LGGEP  125



>ref|XP_011018295.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial isoform X2 [Populus euphratica]
Length=118

 Score =   196 bits (498),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 92/107 (86%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = +2

Query  50   MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  229
            MAGRLS  A+ IMGG GVV+RSVASS+R R+GMGLPVGKHIVPDKP+PVNDELMWDNGT 
Sbjct  1    MAGRLSNVASQIMGGNGVVSRSVASSIRLRSGMGLPVGKHIVPDKPIPVNDELMWDNGTA  60

Query  230  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPF  370
            FPEPCIDRIADTVGKYEALAW+CGGLGFFASLGL+ VWNDKAS IPF
Sbjct  61   FPEPCIDRIADTVGKYEALAWLCGGLGFFASLGLLVVWNDKASTIPF  107



>ref|XP_010258984.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial-like isoform X2 [Nelumbo nucifera]
Length=113

 Score =   196 bits (497),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 92/107 (86%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +2

Query  50   MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  229
            M+GRLS  A+ IMGG GVV RSVASSLR R+GMGLPVGKHIVP+KPLPVNDEL+WDNGTP
Sbjct  1    MSGRLSNVASRIMGGNGVVGRSVASSLRLRSGMGLPVGKHIVPEKPLPVNDELVWDNGTP  60

Query  230  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPF  370
            FPEPC+DRIADTVGKYEALAW+CGGLGFFASLGL+AVWNDKAS IPF
Sbjct  61   FPEPCLDRIADTVGKYEALAWLCGGLGFFASLGLLAVWNDKASXIPF  107



>ref|XP_009400677.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial [Musa acuminata subsp. malaccensis]
Length=125

 Score =   196 bits (498),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 101/125 (81%), Positives = 113/125 (90%), Gaps = 0/125 (0%)
 Frame = +2

Query  50   MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  229
            MAGRLS  A+ IMGG GV ARS AS+LR+R+GMG P+GKHIVPDKPLP + +L+WDNGTP
Sbjct  1    MAGRLSGVASRIMGGNGVAARSAASALRSRSGMGFPLGKHIVPDKPLPADHDLLWDNGTP  60

Query  230  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVE  409
            FPEPCIDRIA TVGKYEALAW+CGGL FFASLGL+AVWNDKASKIP+ PKVYPYDNL+VE
Sbjct  61   FPEPCIDRIAPTVGKYEALAWLCGGLSFFASLGLLAVWNDKASKIPYAPKVYPYDNLRVE  120

Query  410  LGGEP  424
            LGGEP
Sbjct  121  LGGEP  125



>ref|XP_006355519.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial-like [Solanum tuberosum]
Length=142

 Score =   196 bits (498),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 96/117 (82%), Positives = 101/117 (86%), Gaps = 1/117 (1%)
 Frame = +2

Query  50   MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  229
            MAGRLS  A  IMGG GVVARSVASSLRTRAGMGLPVGKHIVPDKPL VNDEL WDNGTP
Sbjct  1    MAGRLSNVATRIMGGNGVVARSVASSLRTRAGMGLPVGKHIVPDKPLHVNDELTWDNGTP  60

Query  230  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNL  400
            FPEPCIDRIADTVGKYEALAW+CGGL  F  +GL+AVWNDKASKIPF P   P ++L
Sbjct  61   FPEPCIDRIADTVGKYEALAWLCGGLSCFVGIGLLAVWNDKASKIPFFPTT-PSEHL  116



>gb|ACJ84169.1| unknown [Medicago truncatula]
Length=125

 Score =   194 bits (494),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 99/125 (79%), Positives = 109/125 (87%), Gaps = 0/125 (0%)
 Frame = +2

Query  50   MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  229
            MAGRL+  A+ I+GG GVV RSVASSLR R+ M LPVGKH VP+KPLP+N+EL WDNGTP
Sbjct  1    MAGRLTNVASQILGGNGVVHRSVASSLRLRSSMSLPVGKHYVPNKPLPMNEELTWDNGTP  60

Query  230  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVE  409
            FPEPCIDRIADTVGKYEA AW+CGGL  FA LGL+AVWNDKASK PF PKVYPYDNL+VE
Sbjct  61   FPEPCIDRIADTVGKYEASAWLCGGLSCFAGLGLLAVWNDKASKTPFAPKVYPYDNLRVE  120

Query  410  LGGEP  424
            LGGEP
Sbjct  121  LGGEP  125



>gb|ABD64969.1| hypothetical protein 25.t00006 [Brassica oleracea]
Length=134

 Score =   194 bits (493),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 91/111 (82%), Positives = 99/111 (89%), Gaps = 0/111 (0%)
 Frame = +2

Query  50   MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  229
            MAGRLS  A+ IMGG G+VARS ASSLR RAGMGLPVGKHIVPDKPL VNDELMWDNGT 
Sbjct  1    MAGRLSGVASRIMGGNGIVARSNASSLRQRAGMGLPVGKHIVPDKPLSVNDELMWDNGTA  60

Query  230  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKV  382
            FPEPCIDRIADTVGKYEAL W+CGGLGFFA+LGL+AV NDKASK+PF  ++
Sbjct  61   FPEPCIDRIADTVGKYEALGWLCGGLGFFATLGLLAVVNDKASKVPFVSEI  111



>ref|XP_006368197.1| hypothetical protein POPTR_0001s00430g [Populus trichocarpa]
 gb|ERP64766.1| hypothetical protein POPTR_0001s00430g [Populus trichocarpa]
Length=118

 Score =   191 bits (486),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 91/107 (85%), Positives = 97/107 (91%), Gaps = 0/107 (0%)
 Frame = +2

Query  50   MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  229
            MAGRLS  A+ IMGG GVV+RSVASSLR R+GMGLPVGKHIVPDKP+ VNDEL WDNGT 
Sbjct  1    MAGRLSNVASRIMGGNGVVSRSVASSLRLRSGMGLPVGKHIVPDKPISVNDELTWDNGTA  60

Query  230  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPF  370
            FPEPCIDRIADTVGKYEALAW+CGGLGFFASLGL+ VWNDKAS IPF
Sbjct  61   FPEPCIDRIADTVGKYEALAWLCGGLGFFASLGLLVVWNDKASTIPF  107



>gb|ABD64995.1| hypothetical protein 26.t00015 [Brassica oleracea]
Length=125

 Score =   191 bits (484),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 90/110 (82%), Positives = 97/110 (88%), Gaps = 0/110 (0%)
 Frame = +2

Query  50   MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  229
            MAGRLS  A+ IMGG GVVARS ASSLR RAGMGLPVGKHIVPDKPL VNDELMWDNGT 
Sbjct  1    MAGRLSGVASRIMGGNGVVARSAASSLRQRAGMGLPVGKHIVPDKPLSVNDELMWDNGTA  60

Query  230  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPK  379
            FPEPCIDRIADTVGKYEAL W+CGGL FFA+LG++AV NDKASK+PF  +
Sbjct  61   FPEPCIDRIADTVGKYEALGWLCGGLSFFAALGMLAVLNDKASKVPFVSE  110



>gb|ABD64927.1| hypothetical protein 24.t00002 [Brassica oleracea]
Length=126

 Score =   190 bits (482),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 92/112 (82%), Positives = 98/112 (88%), Gaps = 0/112 (0%)
 Frame = +2

Query  50   MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  229
            MAGRLS  A+ IMGG GVVARS ASSLR RAGMGLPVGKHIVPDK L VNDELMWDNGT 
Sbjct  1    MAGRLSGVASRIMGGNGVVARSGASSLRQRAGMGLPVGKHIVPDKRLSVNDELMWDNGTA  60

Query  230  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVY  385
            FPEPCIDRIADTVGKYEAL W+CGGLGFFA+LGL+AV NDKASK+PF   +Y
Sbjct  61   FPEPCIDRIADTVGKYEALGWLCGGLGFFATLGLLAVVNDKASKVPFVSDLY  112



>ref|XP_010695116.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial [Beta vulgaris subsp. vulgaris]
Length=128

 Score =   189 bits (479),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 88/117 (75%), Positives = 98/117 (84%), Gaps = 0/117 (0%)
 Frame = +2

Query  50   MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  229
            MAGRLS+ A+ ++GG GVV+RSV +SLR RAGMGLPVGKHIVPDK L VNDEL WDNGT 
Sbjct  1    MAGRLSKVASSMLGGNGVVSRSVGNSLRQRAGMGLPVGKHIVPDKSLSVNDELTWDNGTS  60

Query  230  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNL  400
            FPEPCIDRIADTVGKYEALAW+CGGLGFFA+LGL AVWNDKASK PF   +    + 
Sbjct  61   FPEPCIDRIADTVGKYEALAWLCGGLGFFATLGLAAVWNDKASKYPFVSFILQLSDF  117



>ref|NP_001065325.1| Os10g0551600 [Oryza sativa Japonica Group]
 gb|AAG13469.1|AC026758_6 unknown protein [Oryza sativa Japonica Group]
 gb|AAP54938.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF27162.1| Os10g0551600 [Oryza sativa Japonica Group]
 dbj|BAG88471.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE51371.1| hypothetical protein OsJ_32392 [Oryza sativa Japonica Group]
Length=125

 Score =   185 bits (469),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 108/125 (86%), Gaps = 0/125 (0%)
 Frame = +2

Query  50   MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  229
            MAGRL+ A + ++GG+G  AR+  S+LR RAGMGLPVG+HIVPDKPLP NDEL+WDNGTP
Sbjct  1    MAGRLTAAGSRVLGGQGAAARAAVSALRHRAGMGLPVGRHIVPDKPLPTNDELVWDNGTP  60

Query  230  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVE  409
            FPEPCIDR+A  +GKYEALAW+CGGLGFFA+LGL A  NDKASKIP+TPKVYP+DNL+ E
Sbjct  61   FPEPCIDRLAPHIGKYEALAWLCGGLGFFATLGLAATLNDKASKIPYTPKVYPFDNLREE  120

Query  410  LGGEP  424
            LG  P
Sbjct  121  LGDRP  125



>ref|XP_003608733.1| hypothetical protein MTR_4g101140 [Medicago truncatula]
 gb|AES90930.1| NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8 [Medicago 
truncatula]
Length=117

 Score =   184 bits (468),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 86/108 (80%), Positives = 95/108 (88%), Gaps = 0/108 (0%)
 Frame = +2

Query  50   MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  229
            MAGRL+  A+ I+GG GVV RSVASSLR R+GMGLPVGKH VP+KPLP+N+EL WDNGTP
Sbjct  1    MAGRLTNVASQILGGNGVVHRSVASSLRLRSGMGLPVGKHYVPNKPLPMNEELTWDNGTP  60

Query  230  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFT  373
            FPEPCIDRIADTVGKYEALAW+CGGL  FA LGL+AVWNDKASK PF 
Sbjct  61   FPEPCIDRIADTVGKYEALAWLCGGLSCFAGLGLLAVWNDKASKTPFV  108



>gb|EEC67413.1| hypothetical protein OsI_34583 [Oryza sativa Indica Group]
Length=125

 Score =   184 bits (466),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 91/125 (73%), Positives = 108/125 (86%), Gaps = 0/125 (0%)
 Frame = +2

Query  50   MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  229
            MAGRL+ A + ++GG+G  AR+  S+LR RAGMGLPVG+HIVPDKPLP NDEL+WDNGTP
Sbjct  1    MAGRLTAAGSRVLGGQGAAARAAVSALRHRAGMGLPVGRHIVPDKPLPTNDELVWDNGTP  60

Query  230  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVE  409
            FPEPCIDR+A  +GKYEALAW+CGGLGFFA+LGL A  N+KASKIP+TPKVYP+DNL+ E
Sbjct  61   FPEPCIDRLAPHIGKYEALAWLCGGLGFFATLGLAATLNNKASKIPYTPKVYPFDNLREE  120

Query  410  LGGEP  424
            LG  P
Sbjct  121  LGDRP  125



>ref|XP_008796813.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial-like isoform X2 [Phoenix dactylifera]
Length=132

 Score =   183 bits (465),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 82/108 (76%), Positives = 96/108 (89%), Gaps = 0/108 (0%)
 Frame = +2

Query  50   MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  229
            MAGRLS   + IMGG GVV RS+ SSLR R+GMGLPVGKHIVPDKPLPV+DEL+WDNGTP
Sbjct  1    MAGRLSSVGSRIMGGHGVVGRSLGSSLRNRSGMGLPVGKHIVPDKPLPVHDELVWDNGTP  60

Query  230  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFT  373
            +PEPCIDR+A T+GKYEAL W+CGGLG FA++GL+AVWNDKASK+P+ 
Sbjct  61   YPEPCIDRLAPTIGKYEALGWLCGGLGIFATIGLLAVWNDKASKVPYV  108



>ref|NP_001131355.1| uncharacterized protein LOC100192676 [Zea mays]
 gb|ACG35760.1| hypothetical protein [Zea mays]
Length=123

 Score =   183 bits (465),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 106/125 (85%), Gaps = 2/125 (2%)
 Frame = +2

Query  50   MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  229
            MAGRL+ A + I+   G  AR+  S+LR RAGMGLPVG+HIVPDKPLPVNDEL+WDNGTP
Sbjct  1    MAGRLTAAGSRIL--GGGGARAAXSALRHRAGMGLPVGRHIVPDKPLPVNDELVWDNGTP  58

Query  230  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVE  409
            FPEPCIDR+A  +GKYEALAW+CGGLGFFA+LG+ AV NDKAS IP+TPKVYPYDNL+ E
Sbjct  59   FPEPCIDRLAPHIGKYEALAWLCGGLGFFAALGMAAVVNDKASNIPYTPKVYPYDNLRAE  118

Query  410  LGGEP  424
            LG  P
Sbjct  119  LGDRP  123



>ref|XP_008796814.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial-like isoform X3 [Phoenix dactylifera]
Length=128

 Score =   183 bits (464),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 82/107 (77%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = +2

Query  50   MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  229
            MAGRLS   + IMGG GVV RS+ SSLR R+GMGLPVGKHIVPDKPLPV+DEL+WDNGTP
Sbjct  1    MAGRLSSVGSRIMGGHGVVGRSLGSSLRNRSGMGLPVGKHIVPDKPLPVHDELVWDNGTP  60

Query  230  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPF  370
            +PEPCIDR+A T+GKYEAL W+CGGLG FA++GL+AVWNDKASK+P+
Sbjct  61   YPEPCIDRLAPTIGKYEALGWLCGGLGIFATIGLLAVWNDKASKVPY  107



>dbj|BAJ85316.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=125

 Score =   182 bits (463),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 93/122 (76%), Positives = 107/122 (88%), Gaps = 0/122 (0%)
 Frame = +2

Query  50   MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  229
            MAGRL+   + IMGG G  AR+ AS+LR RAGMGLP G+HIVPDKPLPVNDEL+WDNGTP
Sbjct  1    MAGRLTAMGSRIMGGHGAAARAAASALRNRAGMGLPAGRHIVPDKPLPVNDELVWDNGTP  60

Query  230  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVE  409
            FPEPC+DR+A  +GKYEALAW+CGGL FFA+LGL AV NDKASK+P+TPKVYPYDNL+VE
Sbjct  61   FPEPCVDRLAPHIGKYEALAWLCGGLSFFAALGLAAVVNDKASKMPYTPKVYPYDNLRVE  120

Query  410  LG  415
            LG
Sbjct  121  LG  122



>ref|XP_008796812.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial-like isoform X1 [Phoenix dactylifera]
Length=156

 Score =   183 bits (464),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 82/107 (77%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = +2

Query  50   MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  229
            MAGRLS   + IMGG GVV RS+ SSLR R+GMGLPVGKHIVPDKPLPV+DEL+WDNGTP
Sbjct  1    MAGRLSSVGSRIMGGHGVVGRSLGSSLRNRSGMGLPVGKHIVPDKPLPVHDELVWDNGTP  60

Query  230  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPF  370
            +PEPCIDR+A T+GKYEAL W+CGGLG FA++GL+AVWNDKASK+P+
Sbjct  61   YPEPCIDRLAPTIGKYEALGWLCGGLGIFATIGLLAVWNDKASKVPY  107



>ref|XP_006662581.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial-like, partial [Oryza brachyantha]
Length=104

 Score =   181 bits (458),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 83/104 (80%), Positives = 93/104 (89%), Gaps = 0/104 (0%)
 Frame = +2

Query  113  SVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAW  292
            + AS+LR RAGMGLPVG+HIVPDKPLP NDEL+WDNGTPFPEPCIDR+A  +GKYEALAW
Sbjct  1    AAASALRHRAGMGLPVGRHIVPDKPLPTNDELLWDNGTPFPEPCIDRLAPHIGKYEALAW  60

Query  293  MCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVELGGEP  424
            +CGGLGFFA+LGL A  NDKASKIP+TPKVYPYDNL+ ELG  P
Sbjct  61   LCGGLGFFATLGLAAALNDKASKIPYTPKVYPYDNLREELGDRP  104



>emb|CDY25957.1| BnaC09g20300D [Brassica napus]
Length=553

 Score =   192 bits (488),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 92/124 (74%), Positives = 101/124 (81%), Gaps = 0/124 (0%)
 Frame = +2

Query  14   NPQISERSDHRKMAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLP  193
            N  + +     KMAGRL   A+ IMGG GVVARS A+SLR RAGMGLPVGKHIVPDK L 
Sbjct  416  NGDVGQACRLSKMAGRLFGVASRIMGGNGVVARSGAASLRQRAGMGLPVGKHIVPDKRLS  475

Query  194  VNDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFT  373
            VNDELMWDNGT FPEPCIDRIADTVGKYEAL W+CGGLGFFA+LGL+AV NDKASK+PF 
Sbjct  476  VNDELMWDNGTAFPEPCIDRIADTVGKYEALGWLCGGLGFFATLGLLAVVNDKASKVPFV  535

Query  374  PKVY  385
              +Y
Sbjct  536  SDLY  539



>gb|KDP39850.1| hypothetical protein JCGZ_03381 [Jatropha curcas]
Length=117

 Score =   176 bits (446),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 90/108 (83%), Positives = 99/108 (92%), Gaps = 0/108 (0%)
 Frame = +2

Query  50   MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  229
            MAGRLS  A+ IMGG  +V RSV+SSLR R+GMGLPVGKHIVPDKPLPVN+EL+WDNGTP
Sbjct  1    MAGRLSNVASRIMGGNSIVGRSVSSSLRLRSGMGLPVGKHIVPDKPLPVNEELVWDNGTP  60

Query  230  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFT  373
            FPEPCIDRIADTVGKYEALAW+CGGLGFFASLGL+ VWNDKASKIP+ 
Sbjct  61   FPEPCIDRIADTVGKYEALAWLCGGLGFFASLGLLVVWNDKASKIPYN  108



>ref|XP_006440354.1| hypothetical protein CICLE_v10022867mg [Citrus clementina]
 gb|ESR53594.1| hypothetical protein CICLE_v10022867mg [Citrus clementina]
 gb|KDO61491.1| hypothetical protein CISIN_1g033216mg [Citrus sinensis]
Length=112

 Score =   176 bits (445),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 91/110 (83%), Positives = 98/110 (89%), Gaps = 0/110 (0%)
 Frame = +2

Query  50   MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  229
            MAGRLS  A+ IMGG GVV RSVASSLR R+GMGLPVGKHIVP+KPL VNDEL+WDNGTP
Sbjct  1    MAGRLSNVASQIMGGNGVVGRSVASSLRLRSGMGLPVGKHIVPNKPLSVNDELVWDNGTP  60

Query  230  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPK  379
            FPEPCIDRIADTVGKYEAL W+ GGLGFFASLG +AVWNDKASKIPF  +
Sbjct  61   FPEPCIDRIADTVGKYEALGWLLGGLGFFASLGALAVWNDKASKIPFVSR  110



>ref|XP_008659958.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial-like [Zea mays]
 gb|ACF79732.1| unknown [Zea mays]
Length=123

 Score =   174 bits (441),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 93/125 (74%), Positives = 107/125 (86%), Gaps = 2/125 (2%)
 Frame = +2

Query  50   MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  229
            MAGRL+ A + I+   G  AR+ AS+LR RAGMGLPVG+HIVPDKPLPVNDEL+WDNGTP
Sbjct  1    MAGRLTAAGSRIL--GGGGARAAASALRHRAGMGLPVGRHIVPDKPLPVNDELVWDNGTP  58

Query  230  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVE  409
            FPEPCIDR+A  +GKYEALAW+CGGLGFFA+LG+ AV NDKAS IP+TPKVYPYDNL+ E
Sbjct  59   FPEPCIDRLAPHIGKYEALAWLCGGLGFFAALGMAAVVNDKASNIPYTPKVYPYDNLRAE  118

Query  410  LGGEP  424
            LG  P
Sbjct  119  LGDRP  123



>ref|XP_003574306.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial [Brachypodium distachyon]
Length=125

 Score =   173 bits (438),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 91/122 (75%), Positives = 106/122 (87%), Gaps = 0/122 (0%)
 Frame = +2

Query  50   MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  229
            MAGRL+   + ++GG G  AR+ AS+LR RAGMGLP G+HIVPDKPLP NDEL+WDNGTP
Sbjct  1    MAGRLTAMGSRVLGGHGAAARAAASALRHRAGMGLPAGRHIVPDKPLPTNDELVWDNGTP  60

Query  230  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVE  409
            FPEPC+DR+A  +GKYEALAW+CGGL FFA+LGL AV NDKASKIPFTPK+YPYDNL+VE
Sbjct  61   FPEPCVDRLAPHIGKYEALAWLCGGLSFFAALGLAAVANDKASKIPFTPKIYPYDNLRVE  120

Query  410  LG  415
            LG
Sbjct  121  LG  122



>ref|NP_001142497.1| uncharacterized protein LOC100274725 [Zea mays]
 gb|ACG24387.1| hypothetical protein [Zea mays]
 gb|ACG30533.1| hypothetical protein [Zea mays]
 gb|ACG44917.1| hypothetical protein [Zea mays]
 gb|ACG47173.1| hypothetical protein [Zea mays]
 tpg|DAA46215.1| TPA: hypothetical protein ZEAMMB73_636535 [Zea mays]
Length=125

 Score =   172 bits (436),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 108/125 (86%), Gaps = 0/125 (0%)
 Frame = +2

Query  50   MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  229
            MAGRL+ A   ++GG G  A + A++LR RAGMGLPVG+HIVPDKPLPVNDEL+WDNGTP
Sbjct  1    MAGRLTAAGFRVLGGGGARAAAAAAALRHRAGMGLPVGRHIVPDKPLPVNDELVWDNGTP  60

Query  230  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVE  409
            FPEPCIDR+A  +GKYEALAW+CGGLGFFA+LG+ AV NDKASKIP+TPKVYPYD+L+ E
Sbjct  61   FPEPCIDRLAPHIGKYEALAWLCGGLGFFAALGVAAVVNDKASKIPYTPKVYPYDSLRAE  120

Query  410  LGGEP  424
            LG  P
Sbjct  121  LGDRP  125



>ref|XP_002467527.1| hypothetical protein SORBIDRAFT_01g029640 [Sorghum bicolor]
 gb|EER94525.1| hypothetical protein SORBIDRAFT_01g029640 [Sorghum bicolor]
Length=124

 Score =   172 bits (435),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 106/125 (85%), Gaps = 2/125 (2%)
 Frame = +2

Query  50   MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  229
            MAGRL+ A + I+   G  AR+ AS+LR RAGMGLPVG+HIVPDKP+PVNDEL+WDNGTP
Sbjct  1    MAGRLTAAGSRIL--GGGGARAAASALRHRAGMGLPVGRHIVPDKPVPVNDELVWDNGTP  58

Query  230  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVE  409
            FPEPCIDR+A  +GKYEALAW+CGGLGFFA LG+ A  NDKASKIP+TPKVYPYDNL+ E
Sbjct  59   FPEPCIDRLAPHIGKYEALAWLCGGLGFFAVLGVAAAVNDKASKIPYTPKVYPYDNLRAE  118

Query  410  LGGEP  424
            LG  P
Sbjct  119  LGDRP  123



>ref|XP_004983722.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial-like [Setaria italica]
Length=123

 Score =   171 bits (434),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 107/125 (86%), Gaps = 2/125 (2%)
 Frame = +2

Query  50   MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  229
            MAGRL+ A + I+   G  AR+ A++LR RAGMGLPVG+HIVPDKPLP NDEL+WDNGTP
Sbjct  1    MAGRLTAAGSRIL--GGGGARAAAAALRHRAGMGLPVGRHIVPDKPLPTNDELLWDNGTP  58

Query  230  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVE  409
            FPEPCIDR+A  +GKYEALAW+CGGLGFFA+LG+ A  NDKASKIP+TPKVYPYDNL+VE
Sbjct  59   FPEPCIDRLAPHIGKYEALAWLCGGLGFFATLGVAAAVNDKASKIPYTPKVYPYDNLRVE  118

Query  410  LGGEP  424
            LG  P
Sbjct  119  LGDRP  123



>ref|NP_001144293.1| uncharacterized protein LOC100277176 [Zea mays]
 gb|ACG39358.1| hypothetical protein [Zea mays]
Length=123

 Score =   167 bits (422),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 86/93 (92%), Gaps = 0/93 (0%)
 Frame = +2

Query  146  MGLPVGKHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASL  325
            MGLPVG+HIVPDKPLPVNDEL+WDNGTPFPEPCIDR+A  +GKYEALAW+CGGLGFFA+L
Sbjct  31   MGLPVGRHIVPDKPLPVNDELVWDNGTPFPEPCIDRLAPHIGKYEALAWLCGGLGFFAAL  90

Query  326  GLMAVWNDKASKIPFTPKVYPYDNLKVELGGEP  424
            G+ AV N+KASKIP+TPKVYPYDNL+ ELG  P
Sbjct  91   GVAAVVNNKASKIPYTPKVYPYDNLRAELGDRP  123



>ref|XP_008659963.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial-like, partial [Zea mays]
Length=89

 Score =   158 bits (399),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 72/89 (81%), Positives = 81/89 (91%), Gaps = 0/89 (0%)
 Frame = +2

Query  158  VGKHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMA  337
            VG+HIVPDKPLPVNDEL+WDNGTPFPEPCIDR+A  +GKYEALAW+CGGLGFFA+LG+ A
Sbjct  1    VGRHIVPDKPLPVNDELVWDNGTPFPEPCIDRLAPHIGKYEALAWLCGGLGFFAALGMAA  60

Query  338  VWNDKASKIPFTPKVYPYDNLKVELGGEP  424
            V NDKAS IP+TPKVYPYDNL+ ELG  P
Sbjct  61   VVNDKASNIPYTPKVYPYDNLRAELGDRP  89



>gb|ABK23873.1| unknown [Picea sitchensis]
 gb|ABR17760.1| unknown [Picea sitchensis]
 gb|ACN39914.1| unknown [Picea sitchensis]
Length=130

 Score =   157 bits (398),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 73/110 (66%), Positives = 91/110 (83%), Gaps = 1/110 (1%)
 Frame = +2

Query  98   GVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTPFPEPCIDRIAD-TVGK  274
            G+VARS + SLR R+GMG+PVG    PDKPL +  EL+WD+G+ +PEP +DRIA   +GK
Sbjct  12   GMVARSASGSLRLRSGMGMPVGTTPPPDKPLHIQHELIWDDGSAYPEPALDRIAAPQIGK  71

Query  275  YEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVELGGEP  424
            YEALAW+CGGL FF  +GL+AVWNDKASKIP+TPK YP+DNL+VELGG+P
Sbjct  72   YEALAWLCGGLSFFGLVGLLAVWNDKASKIPYTPKEYPFDNLRVELGGDP  121



>gb|EMT16400.1| hypothetical protein F775_28617 [Aegilops tauschii]
Length=115

 Score =   153 bits (386),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 79/108 (73%), Positives = 92/108 (85%), Gaps = 0/108 (0%)
 Frame = +2

Query  50   MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  229
            MAGRL+   + IMGG G  AR+ AS+LR RAGMGLP G+HIVPDKPLPVNDEL+WDNGTP
Sbjct  1    MAGRLTAMGSRIMGGHGAAARAAASALRNRAGMGLPAGRHIVPDKPLPVNDELVWDNGTP  60

Query  230  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFT  373
            FPEPC+DR+A  +GKYEALAW+CGGL FFA+LGL AV NDKASK+P+ 
Sbjct  61   FPEPCVDRLAPHIGKYEALAWLCGGLSFFAALGLAAVVNDKASKMPYA  108



>gb|KJB21489.1| hypothetical protein B456_004G200300 [Gossypium raimondii]
Length=93

 Score =   151 bits (381),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 78/125 (62%), Positives = 85/125 (68%), Gaps = 32/125 (26%)
 Frame = +2

Query  50   MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  229
            MAGRLS  A+ IMGG GVV+RS+ASS R R+G+GLPVGKHIVPDKPLPVNDEL+WDNGT 
Sbjct  1    MAGRLSNVASRIMGGTGVVSRSIASSFRLRSGIGLPVGKHIVPDKPLPVNDELIWDNGTA  60

Query  230  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVE  409
            FPEPCIDRIADTVGK                                 PKVYPYDNL+VE
Sbjct  61   FPEPCIDRIADTVGK--------------------------------APKVYPYDNLRVE  88

Query  410  LGGEP  424
            LGGEP
Sbjct  89   LGGEP  93



>gb|AGL09494.1| NADH dehydrogenase 1 beta subcomplex subunit 8, partial [Thottea 
sp. JN-2013]
Length=77

 Score =   150 bits (379),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 69/77 (90%), Positives = 74/77 (96%), Gaps = 0/77 (0%)
 Frame = +2

Query  164  KHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVW  343
            KHIV DKPLPVNDEL+WDNGTPFPEPCIDR+A T+GKYEALAW+CGGL FFASLGL+AVW
Sbjct  1    KHIVLDKPLPVNDELVWDNGTPFPEPCIDRLAPTIGKYEALAWLCGGLSFFASLGLLAVW  60

Query  344  NDKASKIPFTPKVYPYD  394
            NDKASKIPFTPKVYPYD
Sbjct  61   NDKASKIPFTPKVYPYD  77



>gb|AGL09493.1| NADH dehydrogenase 1 beta subcomplex subunit 8, partial [Piper 
nigrum]
Length=77

 Score =   150 bits (379),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 70/77 (91%), Positives = 74/77 (96%), Gaps = 0/77 (0%)
 Frame = +2

Query  164  KHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVW  343
            KHIV DKPLPVN+EL+WDNGT FPEPCIDRIA TVGKYEALAW+CGGLGFFASLGL+AVW
Sbjct  1    KHIVXDKPLPVNEELVWDNGTAFPEPCIDRIAPTVGKYEALAWLCGGLGFFASLGLLAVW  60

Query  344  NDKASKIPFTPKVYPYD  394
            NDKASKIPFTPKVYPYD
Sbjct  61   NDKASKIPFTPKVYPYD  77



>gb|AGL09491.1| NADH dehydrogenase 1 beta subcomplex subunit 8, partial [Manekia 
incurva]
Length=77

 Score =   150 bits (379),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 70/77 (91%), Positives = 73/77 (95%), Gaps = 0/77 (0%)
 Frame = +2

Query  164  KHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVW  343
            KHIV DKPLPVNDEL+WDNGT FPEPCIDRIA T+GKYEALAW+CGGL FFASLGLMAVW
Sbjct  1    KHIVLDKPLPVNDELVWDNGTAFPEPCIDRIAPTIGKYEALAWLCGGLSFFASLGLMAVW  60

Query  344  NDKASKIPFTPKVYPYD  394
            NDKASKIPFTPKVYPYD
Sbjct  61   NDKASKIPFTPKVYPYD  77



>gb|AGL09486.1| NADH dehydrogenase 1 beta subcomplex subunit 8, partial [Asimina 
triloba]
Length=78

 Score =   149 bits (375),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 67/78 (86%), Positives = 74/78 (95%), Gaps = 0/78 (0%)
 Frame = +2

Query  164  KHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVW  343
            KHIV DKP+PVNDEL+WDNGTPFPEPCIDR+A T+GKYEAL W+CGGLGFFA+LGL+AVW
Sbjct  1    KHIVXDKPVPVNDELVWDNGTPFPEPCIDRLAPTIGKYEALGWLCGGLGFFATLGLLAVW  60

Query  344  NDKASKIPFTPKVYPYDN  397
            NDKASKIPFTPKVYPYD 
Sbjct  61   NDKASKIPFTPKVYPYDK  78



>gb|KJB51917.1| hypothetical protein B456_008G237800 [Gossypium raimondii]
Length=93

 Score =   149 bits (375),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 77/125 (62%), Positives = 84/125 (67%), Gaps = 32/125 (26%)
 Frame = +2

Query  50   MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  229
            MAGRLS  A+ +MGG G+V+RS ASSLR R+GMGLPVGKHIVPDKPL VNDEL+WDNGT 
Sbjct  1    MAGRLSNVASKLMGGNGIVSRSAASSLRLRSGMGLPVGKHIVPDKPLSVNDELIWDNGTA  60

Query  230  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVE  409
            FPEPCIDRIADTVGK                                 PKVYPYDNL+VE
Sbjct  61   FPEPCIDRIADTVGK--------------------------------APKVYPYDNLRVE  88

Query  410  LGGEP  424
            LGGEP
Sbjct  89   LGGEP  93



>emb|CBI31907.3| unnamed protein product [Vitis vinifera]
Length=325

 Score =   155 bits (391),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 70/75 (93%), Positives = 74/75 (99%), Gaps = 0/75 (0%)
 Frame = +2

Query  146  MGLPVGKHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASL  325
            MGLPVGKHIVP+KPLPVNDEL+WDNGTPFPEPCIDRIA+TVGKYEALAWMCGGL FFASL
Sbjct  1    MGLPVGKHIVPNKPLPVNDELIWDNGTPFPEPCIDRIAETVGKYEALAWMCGGLSFFASL  60

Query  326  GLMAVWNDKASKIPF  370
            GL+AVWNDKASKIPF
Sbjct  61   GLLAVWNDKASKIPF  75



>gb|AGL09497.1| NADH dehydrogenase 1 beta subcomplex subunit 8, partial [Zippelia 
begoniifolia]
Length=77

 Score =   147 bits (371),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 68/77 (88%), Positives = 73/77 (95%), Gaps = 0/77 (0%)
 Frame = +2

Query  164  KHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVW  343
            KHIV DKPLPV+DEL+WDNGT FPEPCIDRIA TVGKYEALAW+CGGL FFASLGL+AVW
Sbjct  1    KHIVLDKPLPVHDELIWDNGTAFPEPCIDRIAPTVGKYEALAWLCGGLSFFASLGLLAVW  60

Query  344  NDKASKIPFTPKVYPYD  394
            NDKASK+PFTPKVYPYD
Sbjct  61   NDKASKVPFTPKVYPYD  77



>gb|AGL09485.1| NADH dehydrogenase 1 beta subcomplex subunit 8, partial [Asarum 
caudatum]
Length=77

 Score =   147 bits (370),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 68/76 (89%), Positives = 71/76 (93%), Gaps = 0/76 (0%)
 Frame = +2

Query  167  HIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWN  346
            HIV DKPLPVNDEL WDNGT FPEPCIDRIA T+GKYEALAW+CGGL FFASLGL+AVWN
Sbjct  2    HIVLDKPLPVNDELTWDNGTAFPEPCIDRIAPTIGKYEALAWLCGGLSFFASLGLLAVWN  61

Query  347  DKASKIPFTPKVYPYD  394
            DKASKIPFTPKVYPYD
Sbjct  62   DKASKIPFTPKVYPYD  77



>ref|XP_010934141.1| PREDICTED: LOW QUALITY PROTEIN: NADH dehydrogenase [ubiquinone] 
1 beta subcomplex subunit 8, mitochondrial [Elaeis guineensis]
Length=160

 Score =   149 bits (376),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 81/113 (72%), Positives = 93/113 (82%), Gaps = 2/113 (2%)
 Frame = +2

Query  50   MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGM--GLPVGKHIVPDKPLPVNDELMWDNG  223
            M GRLS   + IMGG GVV RS+ASSLR R+GM  GLPVGK IVPDKPLPV+DEL+ DNG
Sbjct  1    MVGRLSSVGSRIMGGNGVVGRSLASSLRNRSGMPRGLPVGKXIVPDKPLPVHDELVXDNG  60

Query  224  TPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKV  382
            TP PEPC DR+A T+GKYEAL W+ GGLGFFA+LGL+AVWNDKASK+P+   V
Sbjct  61   TPCPEPCXDRLAATIGKYEALGWLGGGLGFFATLGLLAVWNDKASKVPYFRNV  113



>gb|AGL09496.1| NADH dehydrogenase 1 beta subcomplex subunit 8, partial [Xymalos 
monospora]
Length=78

 Score =   146 bits (368),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 67/78 (86%), Positives = 73/78 (94%), Gaps = 0/78 (0%)
 Frame = +2

Query  164  KHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVW  343
            KHIV DKPLPVNDEL+WDNGTPFPEPCIDRIA ++GKYEALAW  GGLGFFAS+GL+AVW
Sbjct  1    KHIVXDKPLPVNDELVWDNGTPFPEPCIDRIAPSIGKYEALAWWLGGLGFFASIGLLAVW  60

Query  344  NDKASKIPFTPKVYPYDN  397
            NDKASK+PFTPKVYPYD 
Sbjct  61   NDKASKVPFTPKVYPYDK  78



>gb|AGL09488.1| NADH dehydrogenase 1 beta subcomplex subunit 8, partial [Chloranthus 
fortunei]
Length=78

 Score =   146 bits (368),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 67/77 (87%), Positives = 71/77 (92%), Gaps = 0/77 (0%)
 Frame = +2

Query  167  HIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWN  346
            HIV DKPLPVNDEL+WDNGTPFPEPCIDRIA  +GKYEAL W+CGGL FFASLGL+AVWN
Sbjct  2    HIVXDKPLPVNDELIWDNGTPFPEPCIDRIAPHIGKYEALGWLCGGLSFFASLGLLAVWN  61

Query  347  DKASKIPFTPKVYPYDN  397
            DKASKIPFTPKVYPYD 
Sbjct  62   DKASKIPFTPKVYPYDK  78



>gb|AGL09492.1| NADH dehydrogenase 1 beta subcomplex subunit 8, partial [Peperomia 
prostrata]
Length=78

 Score =   144 bits (364),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 65/78 (83%), Positives = 71/78 (91%), Gaps = 0/78 (0%)
 Frame = +2

Query  164  KHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVW  343
            KHIV DKPLPV+DEL WDNGTP+PEPCIDRIA  +GKYEALAW+CGGLGFF SLGL++VW
Sbjct  1    KHIVXDKPLPVDDELTWDNGTPYPEPCIDRIAPNIGKYEALAWLCGGLGFFTSLGLLSVW  60

Query  344  NDKASKIPFTPKVYPYDN  397
            NDKAS IPFTPKVYPYD 
Sbjct  61   NDKASSIPFTPKVYPYDK  78



>gb|AFW87915.1| hypothetical protein ZEAMMB73_145461 [Zea mays]
Length=117

 Score =   145 bits (365),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 92/107 (86%), Gaps = 2/107 (2%)
 Frame = +2

Query  50   MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  229
            MAGRL+ A + I+   G  AR+ AS+LR RAGMGLPVG+HIVPDKPLPVNDEL+WDNGTP
Sbjct  1    MAGRLTAAGSRIL--GGGGARAAASALRHRAGMGLPVGRHIVPDKPLPVNDELVWDNGTP  58

Query  230  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPF  370
            FPEPCIDR+A  +GKYEALAW+CGGLGFFA+LG+ AV NDKAS IP+
Sbjct  59   FPEPCIDRLAPHIGKYEALAWLCGGLGFFAALGMAAVVNDKASNIPY  105



>ref|XP_001753451.1| predicted protein [Physcomitrella patens]
 gb|EDQ81674.1| predicted protein [Physcomitrella patens]
Length=102

 Score =   144 bits (363),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 66/102 (65%), Positives = 82/102 (80%), Gaps = 0/102 (0%)
 Frame = +2

Query  116  VASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWM  295
            +AS++R RAG GLPVG   VP  PLP N EL+WD+G+PFPEPC+D +A  VGKYEALAW+
Sbjct  1    MASAMRLRAGAGLPVGSMEVPAHPLPENAELIWDDGSPFPEPCLDNVAPMVGKYEALAWL  60

Query  296  CGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVELGGE  421
             GG+G FA +G +A WNDKAS+IP+ P+ YPYD+LKVELG E
Sbjct  61   LGGMGLFAGIGGLAAWNDKASRIPWAPREYPYDDLKVELGKE  102



>gb|AGL09487.1| NADH dehydrogenase 1 beta subcomplex subunit 8, partial [Calycanthus 
occidentalis]
Length=78

 Score =   142 bits (357),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 62/78 (79%), Positives = 72/78 (92%), Gaps = 0/78 (0%)
 Frame = +2

Query  164  KHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVW  343
            KH V DKP+PVNDEL+WDNGTP+PEPC+DR+A ++GKYEALAW+CGGLGFFA+LGL AVW
Sbjct  1    KHJVXDKPVPVNDELVWDNGTPYPEPCLDRLAPSIGKYEALAWLCGGLGFFAALGLAAVW  60

Query  344  NDKASKIPFTPKVYPYDN  397
            NDKASK+PFTPKVY YD 
Sbjct  61   NDKASKVPFTPKVYXYDK  78



>gb|AGL09489.1| NADH dehydrogenase 1 beta subcomplex subunit 8, partial [Hernandia 
nymphaeifolia]
Length=78

 Score =   138 bits (348),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 64/78 (82%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = +2

Query  164  KHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVW  343
            KHIV DKPLPVNDEL+WDNGTPFPEPC+DRIA T+GKYE L W  GGLGFFAS+GL+AVW
Sbjct  1    KHIVXDKPLPVNDELVWDNGTPFPEPCLDRIAPTMGKYETLVWWFGGLGFFASIGLLAVW  60

Query  344  NDKASKIPFTPKVYPYDN  397
            NDKASKIP+TPKV PYD 
Sbjct  61   NDKASKIPYTPKVXPYDK  78



>gb|AGL09495.1| NADH dehydrogenase 1 beta subcomplex subunit 8, partial [Verhuellia 
lunaria]
Length=77

 Score =   134 bits (336),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 62/77 (81%), Positives = 68/77 (88%), Gaps = 0/77 (0%)
 Frame = +2

Query  164  KHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVW  343
            KHIV DKPLP + +L+WDNG+ F EPCIDRIA TVGKYEAL W+CGGL FFA LGL+AVW
Sbjct  1    KHIVLDKPLPADFDLIWDNGSAFQEPCIDRIAPTVGKYEALGWLCGGLSFFAGLGLLAVW  60

Query  344  NDKASKIPFTPKVYPYD  394
            NDKASKIPFTPKVYPYD
Sbjct  61   NDKASKIPFTPKVYPYD  77



>gb|KCW71992.1| hypothetical protein EUGRSUZ_E00445 [Eucalyptus grandis]
Length=91

 Score =   133 bits (335),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 67/84 (80%), Positives = 70/84 (83%), Gaps = 1/84 (1%)
 Frame = +2

Query  50   MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  229
            MAGRLS  A+ IMGG GVVARS ASSLR RAGMGLPVGKHIVPDKPL VNDEL+WDNGT 
Sbjct  1    MAGRLSHVASRIMGGNGVVARSAASSLRLRAGMGLPVGKHIVPDKPLHVNDELVWDNGTA  60

Query  230  FPEPCIDRIADTVGKYEAL-AWMC  298
            FPEPCIDRIADTVGK   L  + C
Sbjct  61   FPEPCIDRIADTVGKVGFLFIYFC  84



>gb|KJB21490.1| hypothetical protein B456_004G200300 [Gossypium raimondii]
Length=100

 Score =   132 bits (333),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 62/75 (83%), Positives = 68/75 (91%), Gaps = 0/75 (0%)
 Frame = +2

Query  50   MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  229
            MAGRLS  A+ IMGG GVV+RS+ASS R R+G+GLPVGKHIVPDKPLPVNDEL+WDNGT 
Sbjct  1    MAGRLSNVASRIMGGTGVVSRSIASSFRLRSGIGLPVGKHIVPDKPLPVNDELIWDNGTA  60

Query  230  FPEPCIDRIADTVGK  274
            FPEPCIDRIADTVGK
Sbjct  61   FPEPCIDRIADTVGK  75



>gb|ADY38662.1| hypothetical protein [Wolffia arrhiza]
Length=91

 Score =   128 bits (321),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 66/96 (69%), Positives = 81/96 (84%), Gaps = 6/96 (6%)
 Frame = +2

Query  50   MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  229
            MAGRL++    I+GG G++ RS +    +R+GMGLPVG+HIVPD+ LP NDEL+WDNGTP
Sbjct  1    MAGRLNR----ILGGSGLIGRSSSLR--SRSGMGLPVGRHIVPDRTLPENDELVWDNGTP  54

Query  230  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMA  337
            FPEPCIDR+A  +GKYEALAW+CGGLGFFASLGL+A
Sbjct  55   FPEPCIDRLAPHIGKYEALAWLCGGLGFFASLGLLA  90



>gb|AFP49345.1| hypothetical protein, partial [Olea europaea]
Length=64

 Score =   125 bits (314),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 58/61 (95%), Positives = 61/61 (100%), Gaps = 0/61 (0%)
 Frame = +2

Query  242  CIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVELGGE  421
            CIDRIADTVGKYEALAW+CGGLGFFASLGL+AVWNDKASKIPFTPKVYPYDNL+VELGGE
Sbjct  4    CIDRIADTVGKYEALAWLCGGLGFFASLGLLAVWNDKASKIPFTPKVYPYDNLRVELGGE  63

Query  422  P  424
            P
Sbjct  64   P  64



>ref|XP_002440834.1| hypothetical protein SORBIDRAFT_09g008006 [Sorghum bicolor]
 gb|EES19264.1| hypothetical protein SORBIDRAFT_09g008006 [Sorghum bicolor]
Length=61

 Score =   107 bits (267),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 48/61 (79%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = +2

Query  188  LPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIP  367
            LPVNDEL+WDNGTPFPEPCIDR+A  +GKYEALAW+C GLGFFA+LG+ A  NDKASKIP
Sbjct  1    LPVNDELLWDNGTPFPEPCIDRLAPHIGKYEALAWLCRGLGFFAALGVAAAVNDKASKIP  60

Query  368  F  370
            +
Sbjct  61   Y  61



>ref|XP_002504368.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO65626.1| predicted protein [Micromonas sp. RCC299]
Length=132

 Score = 89.4 bits (220),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 51/119 (43%), Positives = 68/119 (57%), Gaps = 1/119 (1%)
 Frame = +2

Query  62   LSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTPFPEP  241
            L +A +H  G +    R++  +  +RAGMG PV  H VP   LP   EL WD G  +PEP
Sbjct  13   LLRAVSHAPGTQVGGIRNLHVTAASRAGMGTPVPAHEVPTAELPEESELTWDCGDAYPEP  72

Query  242  CIDRIADTVGK-YEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVELG  415
             +D +   + K  EA A++ GGLG F S+  +A   DK S  PF  K +P+DNLK ELG
Sbjct  73   ALDVVPPHIVKPAEAAAYLFGGLGVFYSIYSLAKVVDKPSTQPFADKQFPFDNLKTELG  131



>gb|AGU36714.1| kinesin-related protein, partial [Helianthus petiolaris]
 gb|AGU36719.1| kinesin-related protein, partial [Helianthus annuus]
 gb|AGU36720.1| kinesin-related protein, partial [Helianthus annuus]
 gb|AGU36722.1| kinesin-related protein, partial [Helianthus annuus]
 gb|AGU36723.1| kinesin-related protein, partial [Helianthus annuus]
 gb|AGU36725.1| kinesin-related protein, partial [Helianthus annuus]
 gb|AGU36726.1| kinesin-related protein, partial [Helianthus annuus]
 gb|AGU36730.1| kinesin-related protein, partial [Helianthus annuus]
 gb|AGU36732.1| kinesin-related protein, partial [Helianthus annuus]
 gb|AGU36733.1| kinesin-related protein, partial [Helianthus annuus]
 gb|AGU36735.1| kinesin-related protein, partial [Helianthus annuus]
 gb|AGU36736.1| kinesin-related protein, partial [Helianthus annuus]
 gb|AGU36737.1| kinesin-related protein, partial [Helianthus annuus]
 gb|AGU36738.1| kinesin-related protein, partial [Helianthus annuus]
Length=42

 Score = 77.4 bits (189),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = +2

Query  248  DRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPF  370
            DRIADTVGKYEAL W+CGGLGFFA+LGLMA  NDKASKIP+
Sbjct  1    DRIADTVGKYEALGWLCGGLGFFATLGLMATLNDKASKIPY  41



>gb|AGU36715.1| kinesin-related protein, partial [Helianthus annuus]
 gb|AGU36717.1| kinesin-related protein, partial [Helianthus annuus]
 gb|AGU36721.1| kinesin-related protein, partial [Helianthus annuus]
 gb|AGU36727.1| kinesin-related protein, partial [Helianthus annuus]
 gb|AGU36728.1| kinesin-related protein, partial [Helianthus annuus]
 gb|AGU36729.1| kinesin-related protein, partial [Helianthus annuus]
 gb|AGU36731.1| kinesin-related protein, partial [Helianthus annuus]
 gb|AGU36734.1| kinesin-related protein, partial [Helianthus annuus]
Length=41

 Score = 77.4 bits (189),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = +2

Query  248  DRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPF  370
            DRIADTVGKYEAL W+CGGLGFFA+LGLMA  NDKASKIP+
Sbjct  1    DRIADTVGKYEALGWLCGGLGFFATLGLMATLNDKASKIPY  41



>gb|AGU36716.1| kinesin-related protein, partial [Helianthus annuus]
Length=42

 Score = 77.4 bits (189),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = +2

Query  248  DRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPF  370
            DRIADTVGKYEAL W+CGGLGFFA+LGLMA  NDKASKIP+
Sbjct  1    DRIADTVGKYEALGWLCGGLGFFATLGLMATLNDKASKIPY  41



>gb|AGU36718.1| kinesin-related protein, partial [Helianthus annuus]
Length=43

 Score = 77.4 bits (189),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = +2

Query  248  DRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPF  370
            DRIADTVGKYEAL W+CGGLGFFA+LGLMA  NDKASKIP+
Sbjct  1    DRIADTVGKYEALGWLCGGLGFFATLGLMATLNDKASKIPY  41



>gb|AGU36724.1| kinesin-related protein, partial [Helianthus annuus]
Length=43

 Score = 77.4 bits (189),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = +2

Query  248  DRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPF  370
            DRIADTVGKYEAL W+CGGLGFFA+LGLMA  NDKASKIP+
Sbjct  1    DRIADTVGKYEALGWLCGGLGFFATLGLMATLNDKASKIPY  41



>ref|XP_001420082.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO98375.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=125

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 45/124 (36%), Positives = 63/124 (51%), Gaps = 9/124 (7%)
 Frame = +2

Query  47   KMAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGT  226
            ++A RL++A        G   R VA+S R RAG+G  +     P + +P   EL WD G 
Sbjct  8    ELATRLARA--------GAKTRGVATSARARAGVGPAIEPTRAPVREIPEEAELTWDAGD  59

Query  227  PFPEPCIDRI-ADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLK  403
              PEP +D + A  V K  A  ++     F   +  +A   DK S  PF PK +PY+ L+
Sbjct  60   AHPEPALDDVPARIVTKARAATYLASAFAFLGGVYGLATMVDKPSTTPFAPKTFPYNGLE  119

Query  404  VELG  415
            VELG
Sbjct  120  VELG  123



>ref|XP_005649552.1| hypothetical protein COCSUDRAFT_52742 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE25008.1| hypothetical protein COCSUDRAFT_52742 [Coccomyxa subellipsoidea 
C-169]
Length=144

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 58/123 (47%), Positives = 78/123 (63%), Gaps = 6/123 (5%)
 Frame = +2

Query  50   MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  229
            MAGRL  A    +  R V+A      +R   G  + +G+ I  D+ LP +DEL+WD+G+ 
Sbjct  1    MAGRL--ANMRFLAQR-VMAPKAVLPVRGEGGGPVKMGRAI--DQALPEHDELLWDDGSA  55

Query  230  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVE  409
             PE C+D+    V KYEAL ++ GGLGF+  LG +A +NDKASK P+  K YPYDNLK E
Sbjct  56   QPEHCLDQFP-LVPKYEALGFLLGGLGFYFLLGQLARFNDKASKKPYVDKEYPYDNLKAE  114

Query  410  LGG  418
            +GG
Sbjct  115  MGG  117



>ref|NP_001236148.1| uncharacterized protein LOC100306514 [Glycine max]
 gb|ACU14719.1| unknown [Glycine max]
Length=166

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 42/89 (47%), Positives = 54/89 (61%), Gaps = 0/89 (0%)
 Frame = -3

Query  431  IPTALLQAPLSGCHMGIPSV*MGFWKLCHSRQPSVQEKQKIPIHHTSKPMLHTFQRYRQY  252
            +P    QAPL+ CHM I  V    W+LCHS QP++   +K  I HT++PMLHTF++ +QY
Sbjct  32   LPMVHHQAPLADCHMDILWVQTVSWRLCHSTQPTIPATRKNSIPHTARPMLHTFRQCQQY  91

Query  251  DQYRVPGTESHCPT*VHHSPGEVYREQYV  165
            D Y V   +  CPT V HS   V RE  V
Sbjct  92   DLYTVREMQCRCPTGVPHSWEGVCREHSV  120



>ref|XP_007510211.1| predicted protein [Bathycoccus prasinos]
 emb|CCO18556.1| predicted protein [Bathycoccus prasinos]
Length=145

 Score = 75.9 bits (185),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 43/104 (41%), Positives = 57/104 (55%), Gaps = 2/104 (2%)
 Frame = +2

Query  110  RSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTPFPEPCIDRI-ADTVGKYEAL  286
            RS+A++ +  AGMG P G    P +PL    EL+WD G   PE  +D + A  VGKYEAL
Sbjct  42   RSIATTTKINAGMGSPTGTAPAPTEPLEEEHELIWDAGDKHPETALDNLPAKIVGKYEAL  101

Query  287  AWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVELGG  418
              + G L F   +   A + DKA+  PF  +     +LK ELGG
Sbjct  102  GMLVGALCFMGGVYTFAGYYDKAASRPFVERDME-KSLKKELGG  144



>ref|XP_010229345.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial-like [Brachypodium distachyon]
Length=108

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 44/117 (38%), Positives = 53/117 (45%), Gaps = 37/117 (32%)
 Frame = +2

Query  146  MGLPVGKHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASL  325
            MGLP G  + P++P+ VN+EL+WDNGTPFP           G             FFA+L
Sbjct  1    MGLPAGNEVAPERPIRVNEELVWDNGTPFP-----------GDLRRPPRAPTSARFFAAL  49

Query  326  GLMAVWNDKASKIP--------------------------FTPKVYPYDNLKVELGG  418
            GL AV + K   +P                            PKVYPYDNL VELGG
Sbjct  50   GLAAVVSAKMPHVPDLGEVRRASEPLSLTILLSSTLAWQCLAPKVYPYDNLTVELGG  106



>ref|XP_003064828.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH51162.1| predicted protein [Micromonas pusilla CCMP1545]
Length=303

 Score = 71.6 bits (174),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 37/79 (47%), Positives = 47/79 (59%), Gaps = 1/79 (1%)
 Frame = +2

Query  188  LPVNDELMWDNGTPFPEPCIDRIADTV-GKYEALAWMCGGLGFFASLGLMAVWNDKASKI  364
            +P   EL WD G   PE  +D++ + V  K  A A +  GLGFF  L   A + DKAS +
Sbjct  217  IPEEAELTWDIGDGNPESALDKVPENVLSKRGAAALLATGLGFFVGLYHFAGYLDKASTV  276

Query  365  PFTPKVYPYDNLKVELGGE  421
            PF P+ YPY+NLK ELGG 
Sbjct  277  PFAPRTYPYNNLKEELGGH  295



>ref|XP_003081497.1| unnamed protein product [Ostreococcus tauri]
Length=123

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 42/120 (35%), Positives = 58/120 (48%), Gaps = 6/120 (5%)
 Frame = +2

Query  65   SQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTPFPEPC  244
            S  A   + GRGV  R+ ++ +    GMG  +     P + +P   EL WD G    EP 
Sbjct  9    SALARWTIAGRGV--RTTSARM---GGMGPAIEPTEAPTREMPEEAELTWDAGDKHHEPA  63

Query  245  IDRIAD-TVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVELGGE  421
            +D + +  V K  A  ++ G   F   +   AV  DK SK PF PK +PY+ L  ELG E
Sbjct  64   LDDVPEHIVTKNRAATYLVGAFCFLGCVYGTAVMVDKPSKTPFVPKEFPYNGLAKELGRE  123



>gb|AFK49234.1| unknown [Lotus japonicus]
Length=125

 Score = 64.3 bits (155),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 45/73 (62%), Gaps = 0/73 (0%)
 Frame = -3

Query  413  QAPLSGCHMGIPSV*MGFWKLCHSRQPSVQEKQKIPIHHTSKPMLHTFQRYRQYDQYRVP  234
            ++ L  CHM    V M  W+L HS  P++ E Q   I H ++PMLHTFQ+Y+Q D YRV 
Sbjct  5    KSSLPDCHMDTLWVQMESWRLYHSTLPTIPETQNNSIPHRARPMLHTFQQYQQCDLYRVR  64

Query  233  GTESHCPT*VHHS  195
              + H PT VHHS
Sbjct  65   VMKYHYPTQVHHS  77



>emb|CEF99290.1| unnamed product [Ostreococcus tauri]
Length=93

 Score = 58.9 bits (141),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 34/93 (37%), Positives = 45/93 (48%), Gaps = 1/93 (1%)
 Frame = +2

Query  146  MGLPVGKHIVPDKPLPVNDELMWDNGTPFPEPCIDRIAD-TVGKYEALAWMCGGLGFFAS  322
            MG  +     P + +P   EL WD G    EP +D + +  V K  A  ++ G   F   
Sbjct  1    MGPAIEPTEAPTREMPEEAELTWDAGDKHHEPALDDVPEHIVTKNRAATYLVGAFCFLGC  60

Query  323  LGLMAVWNDKASKIPFTPKVYPYDNLKVELGGE  421
            +   AV  DK SK PF PK +PY+ L  ELG E
Sbjct  61   VYGTAVMVDKPSKTPFVPKEFPYNGLAKELGRE  93



>ref|XP_002968302.1| hypothetical protein SELMODRAFT_409541 [Selaginella moellendorffii]
 ref|XP_002976075.1| hypothetical protein SELMODRAFT_443026 [Selaginella moellendorffii]
 gb|EFJ22980.1| hypothetical protein SELMODRAFT_443026 [Selaginella moellendorffii]
 gb|EFJ30556.1| hypothetical protein SELMODRAFT_409541 [Selaginella moellendorffii]
Length=136

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 40/119 (34%), Positives = 57/119 (48%), Gaps = 11/119 (9%)
 Frame = +2

Query  50   MAGR--LSQAAAHIMGG--RGVVARSVASSLRTRAG-MGLPVGKHIVPDKPLPVNDELMW  214
            MAG   L+ AA +      R    R   S++RTR+G  GLP+        P+P   EL W
Sbjct  1    MAGSSGLATAAKYFSSAMRRNAAIRQPLSAMRTRSGGWGLPLPPEEEVSAPVPEEYELWW  60

Query  215  DNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPY  391
                      +D     + K+EAL   C GL FFA LG++A +  K SK P+  + +P+
Sbjct  61   GGER------VDEDPTDIDKWEALGMCCAGLSFFAILGVLAHYRAKYSKRPYPLREFPW  113



>ref|XP_001700273.1| predicted protein [Chlamydomonas reinhardtii]
 gb|EDO98240.1| predicted protein [Chlamydomonas reinhardtii]
Length=149

 Score = 47.0 bits (110),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 47/106 (44%), Gaps = 6/106 (6%)
 Frame = +2

Query  86   MGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTPFPEPCIDRI---  256
            + G    A    ++L  +AG G PV     PDKPLP   EL WDNG    +P  D +   
Sbjct  6    LRGLARSALQAKNALPAKAGAGAPVKLAPRPDKPLPTWYELWWDNGYYPGQPAADFMFGA  65

Query  257  --ADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYP  388
               +    Y    W   GL   A    +A + D+ +++P  P+ YP
Sbjct  66   WPGNMTETYYLRFWSVFGLALAAPFYYVANFTDE-TRMPMVPQQYP  110



>ref|XP_008908747.1| hypothetical protein PPTG_14011 [Phytophthora parasitica INRA-310]
 gb|ETN06245.1| hypothetical protein PPTG_14011 [Phytophthora parasitica INRA-310]
Length=133

 Score = 46.6 bits (109),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 33/100 (33%), Positives = 51/100 (51%), Gaps = 8/100 (8%)
 Frame = +2

Query  65   SQAAAHIMGGRGVVARSVASSLRTRAGMGL-----PVGKHIVPDKPLPVNDELMWDNGTP  229
            S+  +H + G G+ A     +L TR G        P  +   P +PL    EL+W++G  
Sbjct  3    SRTLSHALRG-GLSANVRRQALATRGGHAHRPPPPPFARIKTPAQPLHEEAELVWNDGV-  60

Query  230  FPEPCIDRIADTVGKYEAL-AWMCGGLGFFASLGLMAVWN  346
             PE  ID  A  + KY+AL  W+CG  GF   +G++ ++N
Sbjct  61   APETLIDFDAPHIPKYQALRHWLCGLGGFVTLMGVVTLYN  100



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 559954506960