BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001O17

Length=521
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009776174.1|  PREDICTED: uncharacterized protein LOC104225989  88.6    1e-17   Nicotiana sylvestris
ref|XP_006366515.1|  PREDICTED: uncharacterized protein LOC102585370  84.3    3e-16   Solanum tuberosum [potatoes]
ref|XP_009619129.1|  PREDICTED: uncharacterized protein LOC104111192  84.3    4e-16   Nicotiana tomentosiformis
ref|XP_004244888.1|  PREDICTED: uncharacterized protein LOC101262938  77.8    5e-14   Solanum lycopersicum
emb|CAN69699.1|  hypothetical protein VITISV_001515                   72.4    6e-12   Vitis vinifera
ref|XP_002285361.1|  PREDICTED: uncharacterized protein LOC100262872  72.4    7e-12   Vitis vinifera
ref|XP_006450316.1|  hypothetical protein CICLE_v10008624mg           70.1    5e-11   Citrus clementina [clementine]
ref|XP_007011756.1|  Uncharacterized protein TCM_036932               68.6    1e-10   
gb|ABK92441.1|  unknown                                               66.2    2e-10   Populus trichocarpa [western balsam poplar]
ref|XP_002324318.2|  hypothetical protein POPTR_0018s02290g           66.2    1e-09   Populus trichocarpa [western balsam poplar]
ref|XP_011036648.1|  PREDICTED: uncharacterized protein LOC105134078  65.9    1e-09   Populus euphratica
gb|KDP33539.1|  hypothetical protein JCGZ_07110                       65.5    2e-09   Jatropha curcas
gb|KJB07669.1|  hypothetical protein B456_001G036600                  64.3    4e-09   Gossypium raimondii
ref|XP_010048907.1|  PREDICTED: uncharacterized protein LOC104437620  60.5    9e-08   Eucalyptus grandis [rose gum]
ref|XP_010265675.1|  PREDICTED: uncharacterized protein LOC104603360  60.1    1e-07   Nelumbo nucifera [Indian lotus]
ref|XP_007224916.1|  hypothetical protein PRUPE_ppa021934mg           60.1    1e-07   
ref|XP_006579047.1|  PREDICTED: uncharacterized protein LOC100775282  58.9    2e-07   
gb|KJB55057.1|  hypothetical protein B456_009G060700                  59.3    2e-07   Gossypium raimondii
ref|XP_008377675.1|  PREDICTED: uncharacterized protein LOC103440754  58.2    4e-07   
ref|XP_009363946.1|  PREDICTED: uncharacterized protein LOC103953867  58.2    5e-07   Pyrus x bretschneideri [bai li]
ref|XP_010245551.1|  PREDICTED: uncharacterized protein LOC104589062  58.2    5e-07   Nelumbo nucifera [Indian lotus]
ref|XP_010665861.1|  PREDICTED: uncharacterized protein LOC104883105  58.2    5e-07   Beta vulgaris subsp. vulgaris [field beet]
emb|CDP18790.1|  unnamed protein product                              57.0    1e-06   Coffea canephora [robusta coffee]
ref|XP_003603315.1|  hypothetical protein MTR_3g106250                56.6    2e-06   Medicago truncatula
ref|XP_003527779.1|  PREDICTED: uncharacterized protein LOC100783731  55.5    3e-06   Glycine max [soybeans]
ref|XP_008378697.1|  PREDICTED: uncharacterized protein LOC103441769  55.5    4e-06   Malus domestica [apple tree]
ref|NP_850061.1|  uncharacterized protein                             54.3    9e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002880661.1|  hypothetical protein ARALYDRAFT_481378           52.4    4e-05   Arabidopsis lyrata subsp. lyrata
ref|XP_004501367.1|  PREDICTED: uncharacterized protein LOC101507611  51.6    7e-05   Cicer arietinum [garbanzo]
ref|XP_011039597.1|  PREDICTED: uncharacterized protein LOC105136101  50.8    2e-04   Populus euphratica
emb|CDX76763.1|  BnaC08g33490D                                        50.4    2e-04   
ref|XP_010429511.1|  PREDICTED: uncharacterized protein LOC104713...  50.1    2e-04   Camelina sativa [gold-of-pleasure]
emb|CBI21089.3|  unnamed protein product                              50.1    2e-04   Vitis vinifera
ref|XP_010429513.1|  PREDICTED: uncharacterized protein LOC104713...  50.1    2e-04   Camelina sativa [gold-of-pleasure]
ref|XP_006405118.1|  hypothetical protein EUTSA_v10000227mg           50.1    3e-04   Eutrema salsugineum [saltwater cress]
ref|XP_006294490.1|  hypothetical protein CARUB_v10023518mg           50.1    3e-04   Capsella rubella
ref|XP_002515453.1|  conserved hypothetical protein                   49.7    3e-04   
ref|XP_010417285.1|  PREDICTED: uncharacterized protein LOC104703050  49.7    3e-04   Camelina sativa [gold-of-pleasure]
ref|XP_009117076.1|  PREDICTED: uncharacterized protein LOC103842203  48.9    6e-04   Brassica rapa



>ref|XP_009776174.1| PREDICTED: uncharacterized protein LOC104225989 [Nicotiana sylvestris]
Length=386

 Score = 88.6 bits (218),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 51/95 (54%), Positives = 62/95 (65%), Gaps = 4/95 (4%)
 Frame = +3

Query  237  YRTGLGLFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKP  416
            Y+T LGLFA+TWSR+L GRSFH+HFLL+DS    A  ++       S +  PSFH  IKP
Sbjct  56   YQTHLGLFALTWSRNLFGRSFHIHFLLNDSDGVGADYNNTISSPHLSSTSTPSFHLNIKP  115

Query  417  LMFSKKQGSKKLQISSSGGLKNANXFWDLSRAKFG  521
             +F KK GSKKL     G  K  + FWDLS+AKFG
Sbjct  116  FIFWKKHGSKKLD----GDNKVVHIFWDLSKAKFG  146



>ref|XP_006366515.1| PREDICTED: uncharacterized protein LOC102585370 [Solanum tuberosum]
Length=349

 Score = 84.3 bits (207),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 48/95 (51%), Positives = 56/95 (59%), Gaps = 22/95 (23%)
 Frame = +3

Query  237  YRTGLGLFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKP  416
            Y T LGLFA+TWSR+L GRSFH+HFLL+                 SS   +PSFH  IKP
Sbjct  55   YNTHLGLFALTWSRNLFGRSFHIHFLLNG---------------LSSPHVSPSFHLHIKP  99

Query  417  LMFSKKQGSKKLQISSSGGLKNANXFWDLSRAKFG  521
             +F KK GSKKL         N + FWDLS+AKFG
Sbjct  100  FVFWKKHGSKKLD-------NNVHIFWDLSKAKFG  127



>ref|XP_009619129.1| PREDICTED: uncharacterized protein LOC104111192 [Nicotiana tomentosiformis]
Length=383

 Score = 84.3 bits (207),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 52/97 (54%), Positives = 64/97 (66%), Gaps = 7/97 (7%)
 Frame = +3

Query  237  YRTGLGLFAVTWSRDLLGRSFHLHFLLDDs--saaaagessPRDFYFSSLSGAPSFHFRI  410
            Y+T LGLFA+TWSR+L GRSFH+HFLL+DS    A    ++    + SS S  PSFH  I
Sbjct  56   YQTHLGLFALTWSRNLFGRSFHIHFLLNDSDGVGADYNNNTISSPHLSSTS-TPSFHLNI  114

Query  411  KPLMFSKKQGSKKLQISSSGGLKNANXFWDLSRAKFG  521
            KP +F KK GSKKL     G  K  + FWDLS++KFG
Sbjct  115  KPFIFWKKHGSKKLD----GDNKVVHIFWDLSKSKFG  147



>ref|XP_004244888.1| PREDICTED: uncharacterized protein LOC101262938 [Solanum lycopersicum]
Length=339

 Score = 77.8 bits (190),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 45/95 (47%), Positives = 53/95 (56%), Gaps = 22/95 (23%)
 Frame = +3

Query  237  YRTGLGLFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKP  416
            Y T LGLFA+TWSR+L GRSFH+HFLL+                 SS   +PSF   IKP
Sbjct  45   YNTHLGLFALTWSRNLFGRSFHIHFLLNG---------------LSSPHLSPSFQLHIKP  89

Query  417  LMFSKKQGSKKLQISSSGGLKNANXFWDLSRAKFG  521
             +F KK GS KL         N + FWD S+AKFG
Sbjct  90   FVFWKKHGSNKLH-------NNVHIFWDFSKAKFG  117



>emb|CAN69699.1| hypothetical protein VITISV_001515 [Vitis vinifera]
Length=372

 Score = 72.4 bits (176),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 42/95 (44%), Positives = 54/95 (57%), Gaps = 5/95 (5%)
 Frame = +3

Query  237  YRTGLGLFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKP  416
            Y T LG+F +TWSR+  GRS HL         +AA   SP           P+FH  IKP
Sbjct  49   YHTDLGIFTLTWSRNFFGRSLHLQL-----HPSAAANLSPLSLSNPLSLSTPAFHLHIKP  103

Query  417  LMFSKKQGSKKLQISSSGGLKNANXFWDLSRAKFG  521
             +F KK GSKKL ++ + G ++   FWDL+RAKFG
Sbjct  104  FVFWKKYGSKKLHVAGAPGGRDIRVFWDLTRAKFG  138



>ref|XP_002285361.1| PREDICTED: uncharacterized protein LOC100262872 [Vitis vinifera]
Length=371

 Score = 72.4 bits (176),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 42/95 (44%), Positives = 54/95 (57%), Gaps = 5/95 (5%)
 Frame = +3

Query  237  YRTGLGLFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKP  416
            Y T LG+F +TWSR+  GRS HL         +AA   SP           P+FH  IKP
Sbjct  49   YHTDLGIFTLTWSRNFFGRSLHLQL-----HPSAAANLSPLSLSNPLSLSTPAFHLHIKP  103

Query  417  LMFSKKQGSKKLQISSSGGLKNANXFWDLSRAKFG  521
             +F KK GSKKL ++ + G ++   FWDL+RAKFG
Sbjct  104  FVFWKKYGSKKLHVAGAPGGRDIRVFWDLTRAKFG  138



>ref|XP_006450316.1| hypothetical protein CICLE_v10008624mg [Citrus clementina]
 ref|XP_006483448.1| PREDICTED: uncharacterized protein LOC102620001 [Citrus sinensis]
 gb|ESR63556.1| hypothetical protein CICLE_v10008624mg [Citrus clementina]
 gb|KDO67512.1| hypothetical protein CISIN_1g016824mg [Citrus sinensis]
Length=382

 Score = 70.1 bits (170),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 51/98 (52%), Positives = 59/98 (60%), Gaps = 8/98 (8%)
 Frame = +3

Query  237  YRTGLGLFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYF-SSLSGAP-SFHFRI  410
            Y T LGLF++TWS  L G S HL     D      G SSP  F   SS S A  SFH  I
Sbjct  51   YNTHLGLFSLTWSMTLFGHSLHL-----DHHPFDYGNSSPISFCSNSSFSHAAFSFHLHI  105

Query  411  KPLMFSKKQGSKKLQ-ISSSGGLKNANXFWDLSRAKFG  521
            KPL+F KK+GSKKL  I+++   KN   FWDLS+AKFG
Sbjct  106  KPLIFWKKRGSKKLSVITTNKASKNIQLFWDLSKAKFG  143



>ref|XP_007011756.1| Uncharacterized protein TCM_036932 [Theobroma cacao]
 gb|EOY29375.1| Uncharacterized protein TCM_036932 [Theobroma cacao]
Length=384

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 47/95 (49%), Positives = 56/95 (59%), Gaps = 7/95 (7%)
 Frame = +3

Query  237  YRTGLGLFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKP  416
            Y+T LGLF++TWSR  LG S HLH       + ++  S P    FS+L     FH  IKP
Sbjct  52   YQTNLGLFSLTWSRTFLGHSLHLHLHPSSHYSFSSPLSLPNSLSFSTL----HFHLHIKP  107

Query  417  LMFSKKQGSKKLQISSSGGLKNANXFWDLSRAKFG  521
             +F KKQG KKL   SS  + N   FWDLSRAKFG
Sbjct  108  FIFWKKQGYKKL---SSATVPNVQVFWDLSRAKFG  139



>gb|ABK92441.1| unknown [Populus trichocarpa]
Length=207

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 41/99 (41%), Positives = 55/99 (56%), Gaps = 8/99 (8%)
 Frame = +3

Query  237  YRTGLGLFAVTWSRDLLGRSFHLHF-LLDDssaaaagessPRDFYFSSLSGAPSFHFRIK  413
            Y+T LGLF++TWS  LLG S HL    +DD+++  +  S       S++    SFH  IK
Sbjct  44   YQTDLGLFSLTWSSSLLGHSLHLRLHPIDDNASYCSPVSLSNPLSLSTI----SFHLNIK  99

Query  414  PLMFSKKQGSKKLQI---SSSGGLKNANXFWDLSRAKFG  521
            P +F K+ GSKKL +              FWDLSRA+FG
Sbjct  100  PFLFWKRHGSKKLHVINQEPDTPTPRIQIFWDLSRARFG  138



>ref|XP_002324318.2| hypothetical protein POPTR_0018s02290g [Populus trichocarpa]
 gb|EEF02883.2| hypothetical protein POPTR_0018s02290g [Populus trichocarpa]
Length=401

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 41/99 (41%), Positives = 55/99 (56%), Gaps = 8/99 (8%)
 Frame = +3

Query  237  YRTGLGLFAVTWSRDLLGRSFHLHF-LLDDssaaaagessPRDFYFSSLSGAPSFHFRIK  413
            Y+T LGLF++TWS  LLG S HL    +DD+++  +  S       S++    SFH  IK
Sbjct  44   YQTDLGLFSLTWSSSLLGHSLHLRLHPIDDNASYCSPVSLSNPLSLSTI----SFHLNIK  99

Query  414  PLMFSKKQGSKKLQI---SSSGGLKNANXFWDLSRAKFG  521
            P +F K+ GSKKL +              FWDLSRA+FG
Sbjct  100  PFLFWKRHGSKKLHVINQEPDTPTPRIQIFWDLSRARFG  138



>ref|XP_011036648.1| PREDICTED: uncharacterized protein LOC105134078 [Populus euphratica]
Length=407

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 40/99 (40%), Positives = 55/99 (56%), Gaps = 8/99 (8%)
 Frame = +3

Query  237  YRTGLGLFAVTWSRDLLGRSFHLHF-LLDDssaaaagessPRDFYFSSLSGAPSFHFRIK  413
            Y+T LGLF++TWS  LLG S HL    +DD+++  +  S       S++    SFH  IK
Sbjct  50   YQTDLGLFSLTWSSSLLGHSLHLRLHPIDDNASYCSPVSLCNPLCLSTI----SFHLNIK  105

Query  414  PLMFSKKQGSKKLQI---SSSGGLKNANXFWDLSRAKFG  521
            P +F K+ GSK+L +              FWDLSRA+FG
Sbjct  106  PFLFWKRHGSKRLHVINQEPDTPTPRIQIFWDLSRARFG  144



>gb|KDP33539.1| hypothetical protein JCGZ_07110 [Jatropha curcas]
Length=384

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 43/98 (44%), Positives = 54/98 (55%), Gaps = 8/98 (8%)
 Frame = +3

Query  237  YRTGLGLFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKP  416
            Y+T LGLF++TWSR  +G S HL     D++ A+    S      S L    SFH  IKP
Sbjct  48   YQTELGLFSLTWSRSFIGHSLHLQLHSGDTATASPFSFS-NPSSLSIL----SFHVHIKP  102

Query  417  LMFSKKQGSKKLQI---SSSGGLKNANXFWDLSRAKFG  521
             +F KK GSKKL +     +  +     FWDLSRAKFG
Sbjct  103  FIFWKKHGSKKLHVINQEPNASVPGVQIFWDLSRAKFG  140



>gb|KJB07669.1| hypothetical protein B456_001G036600 [Gossypium raimondii]
Length=362

 Score = 64.3 bits (155),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 43/95 (45%), Positives = 52/95 (55%), Gaps = 11/95 (12%)
 Frame = +3

Query  237  YRTGLGLFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKP  416
            Y T LGLF++TWS   LG S  LH        +    SSP    FS+L     FH  IKP
Sbjct  53   YHTNLGLFSLTWSCTFLGHSLLLHL----YPCSHFSPSSPTSLSFSTL----LFHLHIKP  104

Query  417  LMFSKKQGSKKLQISSSGGLKNANXFWDLSRAKFG  521
             +F KK G+KKL   ++    N + FWDLSRAKFG
Sbjct  105  FIFWKKYGNKKLSCDTTS---NVHVFWDLSRAKFG  136



>ref|XP_010048907.1| PREDICTED: uncharacterized protein LOC104437620 [Eucalyptus grandis]
 gb|KCW81330.1| hypothetical protein EUGRSUZ_C02717 [Eucalyptus grandis]
Length=382

 Score = 60.5 bits (145),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 45/95 (47%), Positives = 53/95 (56%), Gaps = 4/95 (4%)
 Frame = +3

Query  237  YRTGLGLFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKP  416
            Y T LGLF++TWS+ L GRS HL       S+     SSP     S  S   SF   IKP
Sbjct  50   YHTHLGLFSLTWSKTLFGRSLHLSLHSHHGSSFLDYNSSP----LSPSSCTFSFQLHIKP  105

Query  417  LMFSKKQGSKKLQISSSGGLKNANXFWDLSRAKFG  521
            L+F KKQGSKKL    +    +   FWDL+RAKFG
Sbjct  106  LVFWKKQGSKKLDADKTRTGASIRIFWDLARAKFG  140



>ref|XP_010265675.1| PREDICTED: uncharacterized protein LOC104603360 [Nelumbo nucifera]
Length=376

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 48/94 (51%), Gaps = 16/94 (17%)
 Frame = +3

Query  237  YRTGLGLFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKP  416
            Y T LG+FA+TW R ++GR+  +    DD            D +       P+F   IKP
Sbjct  48   YYTNLGVFALTWCRYVIGRALQIDLRFDDQEE--------EDLF-------PTFRLHIKP  92

Query  417  LMFSKKQGSKKLQISSSGGLKNANXFWDLSRAKF  518
              F +K GSKKL +++    K    +WDL+RAKF
Sbjct  93   FFFWRKYGSKKLHLNNPAK-KKVEIYWDLTRAKF  125



>ref|XP_007224916.1| hypothetical protein PRUPE_ppa021934mg [Prunus persica]
 gb|EMJ26115.1| hypothetical protein PRUPE_ppa021934mg [Prunus persica]
Length=431

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 41/95 (43%), Positives = 49/95 (52%), Gaps = 15/95 (16%)
 Frame = +3

Query  237  YRTGLGLFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKP  416
            Y T L LF++TWSR  LGRS HL+ L     +              S +  PSFH  IKP
Sbjct  147  YHTDLALFSLTWSRSFLGRSLHLNLLHHSFDSPLP--------PSLSSASPPSFHLHIKP  198

Query  417  LMFSKKQGSKKLQISSSGGLKNANXFWDLSRAKFG  521
             +F KK GSK+L         N   FWDLSRA+FG
Sbjct  199  FIFWKKHGSKRLS-------PNTRIFWDLSRARFG  226



>ref|XP_006579047.1| PREDICTED: uncharacterized protein LOC100775282 [Glycine max]
Length=299

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/95 (38%), Positives = 50/95 (53%), Gaps = 11/95 (12%)
 Frame = +3

Query  237  YRTGLGLFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKP  416
            Y T  G  ++TWSR ++GRS H+    +   +      +P     ++LS    FH  I+P
Sbjct  36   YHTDTGPVSLTWSRSIVGRSLHIQLHQNPLDSPPYPNPNPNPSPSTTLS----FHLHIRP  91

Query  417  LMFSKKQGSKKLQISSSGGLKNANXFWDLSRAKFG  521
             +F KK GSKKL         N + FW+LSRAKFG
Sbjct  92   FLFWKKHGSKKLA-------PNTHLFWNLSRAKFG  119



>gb|KJB55057.1| hypothetical protein B456_009G060700 [Gossypium raimondii]
Length=386

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 45/94 (48%), Positives = 53/94 (56%), Gaps = 7/94 (7%)
 Frame = +3

Query  237  YRTGLGLFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKP  416
            YRT LGLF++TWSR  LG S HLH       + ++  S P    FS+L     FH  IKP
Sbjct  53   YRTNLGLFSLTWSRSFLGHSLHLHLHPASHYSPSSPLSLPASLSFSTL----HFHLHIKP  108

Query  417  LMFSKKQGSKKLQISSSGGLKNANXFWDLSRAKF  518
             +F KK G KKL   SS  + N   FWD SRAKF
Sbjct  109  FIFWKKHGHKKL---SSATVPNVQVFWDFSRAKF  139



>ref|XP_008377675.1| PREDICTED: uncharacterized protein LOC103440754 [Malus domestica]
Length=346

 Score = 58.2 bits (139),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 40/95 (42%), Positives = 47/95 (49%), Gaps = 18/95 (19%)
 Frame = +3

Query  237  YRTGLGLFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKP  416
            Y T L LF++TWSR  LGRS HL+ L               D        +PSFH  IKP
Sbjct  47   YHTDLALFSLTWSRSFLGRSLHLNLLRHSF-----------DSPLPPSLSSPSFHLHIKP  95

Query  417  LMFSKKQGSKKLQISSSGGLKNANXFWDLSRAKFG  521
             +F KK GSKKL         N   +W LSRA+FG
Sbjct  96   FLFWKKHGSKKLS-------PNILLYWXLSRARFG  123



>ref|XP_009363946.1| PREDICTED: uncharacterized protein LOC103953867 [Pyrus x bretschneideri]
Length=343

 Score = 58.2 bits (139),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 40/95 (42%), Positives = 47/95 (49%), Gaps = 18/95 (19%)
 Frame = +3

Query  237  YRTGLGLFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKP  416
            Y T   LF++TWSR  LGRS HL+ L               D        +PSFH  IKP
Sbjct  42   YHTDHALFSLTWSRSFLGRSLHLNLLRHSF-----------DSPLPPSLSSPSFHLHIKP  90

Query  417  LMFSKKQGSKKLQISSSGGLKNANXFWDLSRAKFG  521
             +F KK GSKKL         N   FWDLS+A+FG
Sbjct  91   FLFWKKHGSKKLS-------PNILLFWDLSKARFG  118



>ref|XP_010245551.1| PREDICTED: uncharacterized protein LOC104589062 [Nelumbo nucifera]
Length=369

 Score = 58.2 bits (139),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 47/94 (50%), Gaps = 16/94 (17%)
 Frame = +3

Query  237  YRTGLGLFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKP  416
            Y T LG+FA+TW R+++GR   +    DD            D +       PS+   +KP
Sbjct  45   YYTNLGVFALTWCRNVIGRDLQIDIRFDDQED--------EDLF-------PSYRLHMKP  89

Query  417  LMFSKKQGSKKLQISSSGGLKNANXFWDLSRAKF  518
              F +K GSK+L ++     K    +WDL+RAKF
Sbjct  90   FFFWRKYGSKRLHVNGPTK-KKVEIYWDLTRAKF  122



>ref|XP_010665861.1| PREDICTED: uncharacterized protein LOC104883105 [Beta vulgaris 
subsp. vulgaris]
Length=384

 Score = 58.2 bits (139),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 36/95 (38%), Positives = 45/95 (47%), Gaps = 22/95 (23%)
 Frame = +3

Query  237  YRTGLGLFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKP  416
            Y+T +G+F++TWSR L  RSFHLH                        S + SFH  +KP
Sbjct  71   YQTNIGIFSITWSRSLFSRSFHLHL---------------------HPSPSLSFHLTLKP  109

Query  417  LMFSKKQGSKKLQISSSGGLKNANXFWDLSRAKFG  521
             +F  K G KKL       L +   FWD S AKFG
Sbjct  110  FLFWNKSGIKKLP-PPPHSLSSIYLFWDFSSAKFG  143



>emb|CDP18790.1| unnamed protein product [Coffea canephora]
Length=377

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 49/97 (51%), Gaps = 16/97 (16%)
 Frame = +3

Query  237  YRTGLGLFAVTWSRDLLG-RSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIK  413
            Y+T  GLF +TWS    G RS H++ LLD+              +  S   +PSFH +  
Sbjct  38   YQTQQGLFGLTWSIGPFGTRSLHIYLLLDN--------------HHLSFPPSPSFHLQFN  83

Query  414  P-LMFSKKQGSKKLQISSSGGLKNANXFWDLSRAKFG  521
            P   F KK+GSK L    +     A  FWDLSRAKFG
Sbjct  84   PRFTFWKKRGSKTLVGLPNTSSTTARVFWDLSRAKFG  120



>ref|XP_003603315.1| hypothetical protein MTR_3g106250 [Medicago truncatula]
 gb|AES73566.1| DUF868 family protein [Medicago truncatula]
Length=346

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 37/96 (39%), Positives = 51/96 (53%), Gaps = 19/96 (20%)
 Frame = +3

Query  237  YRTGLGLFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRD-FYFSSLSGAPSFHFRIK  413
            Y++ +GL ++TWSR +LGRS H+                P D    +  S + SFH  IK
Sbjct  42   YQSNVGLVSLTWSRSILGRSLHVQL-----------HHHPFDSPPTNPSSSSSSFHLHIK  90

Query  414  PLMFSKKQGSKKLQISSSGGLKNANXFWDLSRAKFG  521
            P +F KK G+KKL         N + FW+LS+AKFG
Sbjct  91   PFIFWKKHGTKKLS-------SNTHLFWNLSKAKFG  119



>ref|XP_003527779.1| PREDICTED: uncharacterized protein LOC100783731 [Glycine max]
Length=333

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 34/95 (36%), Positives = 47/95 (49%), Gaps = 16/95 (17%)
 Frame = +3

Query  237  YRTGLGLFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKP  416
            Y T  G  ++TWSR ++GRS H+    + +   +    +P            SFH  I+P
Sbjct  38   YHTDTGPVSLTWSRSIVGRSLHIQLHQNQNPLDSPPYPNPTTL---------SFHHHIRP  88

Query  417  LMFSKKQGSKKLQISSSGGLKNANXFWDLSRAKFG  521
             +F KK GSKKL         +   FW+LSRAKFG
Sbjct  89   FLFWKKHGSKKLA-------PDTFLFWNLSRAKFG  116



>ref|XP_008378697.1| PREDICTED: uncharacterized protein LOC103441769 [Malus domestica]
Length=344

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 45/94 (48%), Gaps = 18/94 (19%)
 Frame = +3

Query  237  YRTGLGLFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKP  416
            Y T   LF++TWSR  LGRS HL+ L               D        +P FH  IKP
Sbjct  43   YHTDHALFSLTWSRSFLGRSLHLNLLHHSF-----------DSPLPPSLSSPYFHLHIKP  91

Query  417  LMFSKKQGSKKLQISSSGGLKNANXFWDLSRAKF  518
             +F KK GSKKL         N   FWDLS+A+F
Sbjct  92   FLFWKKHGSKKLS-------PNILLFWDLSKARF  118



>ref|NP_850061.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAD23671.1| hypothetical protein [Arabidopsis thaliana]
 gb|AAS49111.1| At2g25200 [Arabidopsis thaliana]
 dbj|BAD43081.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEC07670.1| uncharacterized protein AT2G25200 [Arabidopsis thaliana]
Length=354

 Score = 54.3 bits (129),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 48/95 (51%), Gaps = 10/95 (11%)
 Frame = +3

Query  237  YRTGLGLFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKP  416
            Y T +G+F ++WSR  L RS HLHF   +S+          D Y  S+  A  F   IKP
Sbjct  54   YHTNVGVFFLSWSRSFLRRSLHLHFYSCNSTNCYLHSL---DCYRHSIPFA--FRLEIKP  108

Query  417  LMFSKKQGSKKLQISSSGGLKNANXFWDLSRAKFG  521
            L F +K GSKKL         +    WDL+ AKFG
Sbjct  109  LTFWRKNGSKKLSRKP-----DIRVVWDLTHAKFG  138



>ref|XP_002880661.1| hypothetical protein ARALYDRAFT_481378 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56920.1| hypothetical protein ARALYDRAFT_481378 [Arabidopsis lyrata subsp. 
lyrata]
Length=354

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 51/95 (54%), Gaps = 10/95 (11%)
 Frame = +3

Query  237  YRTGLGLFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKP  416
            Y T +G+F ++WS+  L RS HLHF   +S+          D Y  S+  A  F   IKP
Sbjct  54   YLTNVGVFFLSWSQSFLRRSLHLHFYSCNSTNCYLHSP---DCYRHSIPFA--FRLEIKP  108

Query  417  LMFSKKQGSKKLQISSSGGLKNANXFWDLSRAKFG  521
            L F +KQGSKK  IS    ++     WDL+ A+FG
Sbjct  109  LTFWRKQGSKK--ISRKPDIR---VVWDLTHARFG  138



>ref|XP_004501367.1| PREDICTED: uncharacterized protein LOC101507611 [Cicer arietinum]
Length=347

 Score = 51.6 bits (122),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 35/95 (37%), Positives = 49/95 (52%), Gaps = 18/95 (19%)
 Frame = +3

Query  237  YRTGLGLFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKP  416
            Y+T +GL ++TWSR +LGRS H+        +                + + SFH  IKP
Sbjct  44   YQTDIGLVSLTWSRSILGRSLHVQLHHHPFDS-----------PPPPPNPSSSFHLHIKP  92

Query  417  LMFSKKQGSKKLQISSSGGLKNANXFWDLSRAKFG  521
             +F KK G+KKL         N + FW+LS+AKFG
Sbjct  93   FIFWKKHGTKKLS-------SNTHLFWNLSKAKFG  120



>ref|XP_011039597.1| PREDICTED: uncharacterized protein LOC105136101 [Populus euphratica]
Length=402

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 40/99 (40%), Positives = 55/99 (56%), Gaps = 8/99 (8%)
 Frame = +3

Query  237  YRTGLGLFAVTWSRDLLGRSFHLHFL-LDDssaaaagessPRDFYFSSLSGAPSFHFRIK  413
            Y+T LGLF++TWS   LG S HLH   +D +++  +    P     S++    SFH  IK
Sbjct  45   YQTDLGLFSLTWSSCFLGHSLHLHLHPIDCNNSYCSPVFYPNPLSLSTI----SFHLNIK  100

Query  414  PLMFSKKQGSKKLQI---SSSGGLKNANXFWDLSRAKFG  521
            P +F K+ GSKK  +    ++        FWDLSRAKFG
Sbjct  101  PSLFWKRHGSKKFHVINQEANTPTPRIQIFWDLSRAKFG  139



>emb|CDX76763.1| BnaC08g33490D [Brassica napus]
Length=349

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 37/95 (39%), Positives = 50/95 (53%), Gaps = 10/95 (11%)
 Frame = +3

Query  237  YRTGLGLFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKP  416
            Y T +G+F ++WS+  L RS HLHF      ++A       D Y  S S   +F   IKP
Sbjct  55   YHTNVGVFFLSWSQSFLRRSLHLHFY---HCSSANCYLHSPDCY--SRSAPFTFRLEIKP  109

Query  417  LMFSKKQGSKKLQISSSGGLKNANXFWDLSRAKFG  521
            L F +K GSKK  IS    ++     WDL+ A+FG
Sbjct  110  LTFWRKHGSKK--ISRKPDIRVT---WDLTHARFG  139



>ref|XP_010429511.1| PREDICTED: uncharacterized protein LOC104713983 isoform X1 [Camelina 
sativa]
Length=353

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 36/95 (38%), Positives = 49/95 (52%), Gaps = 10/95 (11%)
 Frame = +3

Query  237  YRTGLGLFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKP  416
            Y T +G+F +TWS+  L RS HLHF   +S           D Y  S+    +F   +KP
Sbjct  53   YHTNVGVFFLTWSQAFLRRSLHLHFYSCNSVNCYLHSP---DCYRHSVPF--TFRLEVKP  107

Query  417  LMFSKKQGSKKLQISSSGGLKNANXFWDLSRAKFG  521
            L F +K GSKK  IS    ++     WDL+ A+FG
Sbjct  108  LTFWRKHGSKK--ISRKPDIR---IVWDLTHARFG  137



>emb|CBI21089.3| unnamed protein product [Vitis vinifera]
Length=291

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 39/74 (53%), Gaps = 5/74 (7%)
 Frame = +3

Query  237  YRTGLGLFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKP  416
            Y T LG+F +TWSR+  GRS HL         +AA   SP           P+FH  IKP
Sbjct  49   YHTDLGIFTLTWSRNFFGRSLHLQL-----HPSAAANLSPLSLSNPLSLSTPAFHLHIKP  103

Query  417  LMFSKKQGSKKLQI  458
             +F KK GSKKL +
Sbjct  104  FVFWKKYGSKKLHM  117



>ref|XP_010429513.1| PREDICTED: uncharacterized protein LOC104713983 isoform X2 [Camelina 
sativa]
Length=353

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 36/95 (38%), Positives = 49/95 (52%), Gaps = 10/95 (11%)
 Frame = +3

Query  237  YRTGLGLFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKP  416
            Y T +G+F +TWS+  L RS HLHF   +S           D Y  S+    +F   +KP
Sbjct  53   YHTNVGVFFLTWSQAFLRRSLHLHFYSCNSVNCYLHSP---DCYRHSVPF--TFRLEVKP  107

Query  417  LMFSKKQGSKKLQISSSGGLKNANXFWDLSRAKFG  521
            L F +K GSKK  IS    ++     WDL+ A+FG
Sbjct  108  LTFWRKHGSKK--ISRKPDIR---IVWDLTHARFG  137



>ref|XP_006405118.1| hypothetical protein EUTSA_v10000227mg [Eutrema salsugineum]
 gb|ESQ46571.1| hypothetical protein EUTSA_v10000227mg [Eutrema salsugineum]
Length=343

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 35/95 (37%), Positives = 50/95 (53%), Gaps = 9/95 (9%)
 Frame = +3

Query  237  YRTGLGLFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKP  416
            Y T +G+F ++WS+  L RS HLH+      +A        D Y  S+    +F   IKP
Sbjct  53   YHTNIGVFFLSWSQSFLRRSLHLHYY--SCHSANCYLHHSPDCYRHSVPF--TFRLEIKP  108

Query  417  LMFSKKQGSKKLQISSSGGLKNANXFWDLSRAKFG  521
            L F +K GSKK  IS    ++     WDL++A+FG
Sbjct  109  LTFWRKHGSKK--ISRKPDIR---VVWDLTKARFG  138



>ref|XP_006294490.1| hypothetical protein CARUB_v10023518mg [Capsella rubella]
 gb|EOA27388.1| hypothetical protein CARUB_v10023518mg [Capsella rubella]
Length=353

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 35/95 (37%), Positives = 50/95 (53%), Gaps = 10/95 (11%)
 Frame = +3

Query  237  YRTGLGLFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKP  416
            Y T +G+F +TWS+  L RS H+HF    S  +        D Y +S+    +F   +KP
Sbjct  52   YHTNVGVFFLTWSQAFLRRSLHIHFY---SCHSVNCYLHSPDCYRNSVPF--TFRLEVKP  106

Query  417  LMFSKKQGSKKLQISSSGGLKNANXFWDLSRAKFG  521
            L F +K GSKK  IS    ++     WDL+ A+FG
Sbjct  107  LTFWRKHGSKK--ISRKPDIR---VVWDLTHARFG  136



>ref|XP_002515453.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF46902.1| conserved hypothetical protein [Ricinus communis]
Length=336

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 34/61 (56%), Gaps = 12/61 (20%)
 Frame = +3

Query  375  SLSGAPS-----FHFRIKPLMFSKKQGSKKLQI-------SSSGGLKNANXFWDLSRAKF  518
            SLS  PS     FH  IKP +F KK GSKKLQI       +S+        FWDLSRAKF
Sbjct  32   SLSHTPSLSTLSFHLDIKPYIFWKKHGSKKLQIINHQDYHTSTASTPAIQIFWDLSRAKF  91

Query  519  G  521
            G
Sbjct  92   G  92



>ref|XP_010417285.1| PREDICTED: uncharacterized protein LOC104703050 [Camelina sativa]
Length=373

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 36/95 (38%), Positives = 49/95 (52%), Gaps = 10/95 (11%)
 Frame = +3

Query  237  YRTGLGLFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKP  416
            Y T +G+F +TWS+  L RS HLHF    S  +        D Y  S+    +F   +KP
Sbjct  73   YHTNVGVFFLTWSQAFLRRSLHLHFY---SCHSVNCYLHSPDCYRHSVPF--TFRLEVKP  127

Query  417  LMFSKKQGSKKLQISSSGGLKNANXFWDLSRAKFG  521
            L F +K GSKK  IS    ++     WDL+ A+FG
Sbjct  128  LTFWRKHGSKK--ISRKPDIR---IVWDLTHARFG  157



>ref|XP_009117076.1| PREDICTED: uncharacterized protein LOC103842203 [Brassica rapa]
Length=350

 Score = 48.9 bits (115),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 36/95 (38%), Positives = 50/95 (53%), Gaps = 10/95 (11%)
 Frame = +3

Query  237  YRTGLGLFAVTWSRDLLGRSFHLHFLLDDssaaaagessPRDFYFSSLSGAPSFHFRIKP  416
            Y T +G+F ++WS+  L RS HLHF      ++A       D Y  S+    +F   IKP
Sbjct  56   YHTNVGVFFLSWSQSFLRRSLHLHFY---HCSSANCYLHSPDCYSHSVPF--TFRLEIKP  110

Query  417  LMFSKKQGSKKLQISSSGGLKNANXFWDLSRAKFG  521
            L F +K GSKK  IS    ++     WDL+ A+FG
Sbjct  111  LTFWRKHGSKK--ISRKPDIRVT---WDLTHARFG  140



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 566636427000