BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001O16

Length=809
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|ABI84246.1|  polyubiquitin 10                                        363   1e-123   Arachis hypogaea [goober]
gb|AFW66442.1|  putative ubiquitin family protein                       363   1e-123   
gb|AEW46688.1|  polyubiquitin                                           363   1e-123   Ulva linza
ref|XP_010235843.1|  PREDICTED: polyubiquitin 11 isoform X1             365   2e-123   Brachypodium distachyon [annual false brome]
gb|EYU33610.1|  hypothetical protein MIMGU_mgv1a004315mg                363   2e-123   Erythranthe guttata [common monkey flower]
ref|XP_008358804.1|  PREDICTED: LOW QUALITY PROTEIN: polyubiquiti...    365   2e-123   
gb|AEZ49160.1|  polyubiquitin                                           365   2e-123   Wolffia australiana
ref|XP_010931017.1|  PREDICTED: polyubiquitin 11 isoform X1             363   2e-123   Elaeis guineensis
ref|XP_004968120.1|  PREDICTED: polyubiquitin-like                      363   2e-123   Setaria italica
ref|XP_003626479.1|  Ubiquitin-like protein                             365   2e-123   
gb|KJB36627.1|  hypothetical protein B456_006G167800                    363   2e-123   Gossypium raimondii
dbj|BAC57955.1|  polyubiquitin                                          363   2e-123   Tripolium pannonicum [sea starwort]
ref|XP_010490793.1|  PREDICTED: polyubiquitin 11-like                   363   2e-123   Camelina sativa [gold-of-pleasure]
ref|XP_002317213.1|  polyubiquitin family protein                       363   2e-123   Populus trichocarpa [western balsam poplar]
gb|KDO51109.1|  hypothetical protein CISIN_1g026973mg                   363   2e-123   Citrus sinensis [apfelsine]
gb|AET06143.1|  ubiquitin                                               363   2e-123   Papaver somniferum
ref|XP_010062974.1|  PREDICTED: polyubiquitin                           370   3e-123   Eucalyptus grandis [rose gum]
ref|XP_002438839.1|  hypothetical protein SORBIDRAFT_10g027030          363   3e-123   Sorghum bicolor [broomcorn]
ref|XP_007154494.1|  hypothetical protein PHAVU_003G1236001g            362   3e-123   Phaseolus vulgaris [French bean]
ref|XP_006288299.1|  hypothetical protein CARUB_v10001544mg             363   3e-123   
ref|XP_006428822.1|  hypothetical protein CICLE_v10012652mg             363   3e-123   Citrus clementina [clementine]
gb|ACJ85618.1|  unknown                                                 363   3e-123   Medicago truncatula
ref|NP_567286.1|  ubiquitin 11                                          363   3e-123   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006428779.1|  hypothetical protein CICLE_v10012654mg             363   3e-123   Citrus clementina [clementine]
ref|XP_007205619.1|  hypothetical protein PRUPE_ppa009116mg             363   3e-123   
ref|XP_006370634.1|  hypothetical protein POPTR_0001s44440g             364   3e-123   
ref|XP_003570150.1|  PREDICTED: polyubiquitin 11 isoform X2             363   4e-123   Brachypodium distachyon [annual false brome]
gb|AAP31578.1|  ubiquitin                                               363   4e-123   Hevea brasiliensis [jebe]
emb|CAH59739.1|  polyubiquitin                                          363   4e-123   Plantago major [cart-track plant]
ref|XP_003590494.1|  Ubiquitin                                          366   4e-123   
gb|KDO51955.1|  hypothetical protein CISIN_1g026932mg                   362   4e-123   Citrus sinensis [apfelsine]
gb|AAO43307.1|  putative polyubiquitin                                  363   4e-123   Arabidopsis thaliana [mouse-ear cress]
emb|CBI22349.3|  unnamed protein product                                365   4e-123   Vitis vinifera
ref|XP_006287868.1|  hypothetical protein CARUB_v10001095mg             369   5e-123   
emb|CDP08567.1|  unnamed protein product                                367   5e-123   Coffea canephora [robusta coffee]
gb|AFK41706.1|  unknown                                                 362   6e-123   Medicago truncatula
ref|XP_002872805.1|  hypothetical protein ARALYDRAFT_490270             365   6e-123   
ref|XP_003627152.1|  Ubiquitin                                          363   6e-123   
gb|KJB62484.1|  hypothetical protein B456_009G418900                    362   8e-123   Gossypium raimondii
gb|AGV54749.1|  ubiquitin 11                                            363   9e-123   Phaseolus vulgaris [French bean]
gb|ACJ85643.1|  unknown                                                 362   1e-122   Medicago truncatula
ref|NP_001147027.1|  polyubiquitin containing 7 ubiquitin monomers      364   1e-122   
ref|XP_007512209.1|  polyubiquitin                                      366   1e-122   Bathycoccus prasinos
gb|ABY60454.1|  putative polyubiquitin                                  363   1e-122   Adonis aestivalis var. palaestina
ref|XP_008784557.1|  PREDICTED: LOW QUALITY PROTEIN: polyubiquiti...    361   1e-122   
gb|AFK43392.1|  unknown                                                 361   2e-122   Medicago truncatula
ref|XP_003619702.1|  Ubiquitin-like protein                             362   2e-122   
ref|XP_003574865.1|  PREDICTED: polyubiquitin-like                      365   2e-122   Brachypodium distachyon [annual false brome]
ref|XP_009114489.1|  PREDICTED: polyubiquitin-like                      363   2e-122   Brassica rapa
gb|ACJ85658.1|  unknown                                                 360   2e-122   Medicago truncatula
emb|CAA40323.1|  polyubiquitin protein                                  364   2e-122   Helianthus annuus
gb|AES89865.2|  polyubiquitin 3                                         362   3e-122   Medicago truncatula
ref|XP_006377830.1|  hypothetical protein POPTR_0011s13770g             363   3e-122   
prf||1604470A  poly-ubiquitin                                           362   3e-122
gb|AAQ84316.1|  fiber polyubiquitin                                     360   3e-122   Gossypium barbadense [Egyptian cotton]
ref|XP_007014924.1|  Polyubiquitin 3                                    363   3e-122   Theobroma cacao [chocolate]
gb|EYU33609.1|  hypothetical protein MIMGU_mgv1a004315mg                363   3e-122   Erythranthe guttata [common monkey flower]
emb|CAH59740.1|  polyubiquitin                                          363   3e-122   Plantago major [cart-track plant]
ref|XP_007154495.1|  hypothetical protein PHAVU_003G1236001g            362   3e-122   Phaseolus vulgaris [French bean]
gb|AAO43308.1|  putative polyubiquitin                                  361   3e-122   Arabidopsis thaliana [mouse-ear cress]
gb|KIM78989.1|  hypothetical protein PILCRDRAFT_573034                  360   3e-122   Piloderma croceum F 1598
ref|XP_011468094.1|  PREDICTED: polyubiquitin                           363   3e-122   Fragaria vesca subsp. vesca
ref|XP_006428820.1|  hypothetical protein CICLE_v10012290mg             363   3e-122   Citrus clementina [clementine]
gb|KIM78981.1|  hypothetical protein PILCRDRAFT_10644                   360   3e-122   Piloderma croceum F 1598
gb|AIS71924.1|  polyubiquitin                                           360   3e-122   Mangifera indica
gb|EJU04700.1|  polyubiquitin UbiD/Ubi4                                 360   3e-122   Dacryopinax primogenitus
gb|KJB81823.1|  hypothetical protein B456_013G163500                    363   3e-122   Gossypium raimondii
gb|KJA26171.1|  hypothetical protein HYPSUDRAFT_354705                  360   3e-122   Hypholoma sublateritium FD-334 SS-4
ref|XP_006396611.1|  hypothetical protein EUTSA_v10028730mg             363   3e-122   
gb|AAM64530.1|  ubiquitin homolog                                       360   3e-122   Arabidopsis thaliana [mouse-ear cress]
gb|AAK68824.1|  Unknown protein                                         360   3e-122   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011110054.1|  hypothetical protein H072_4094                     360   3e-122   
ref|XP_007211606.1|  hypothetical protein PRUPE_ppa005503mg             363   3e-122   
ref|XP_002456845.1|  hypothetical protein SORBIDRAFT_03g043940          363   4e-122   Sorghum bicolor [broomcorn]
ref|NP_849292.1|  polyubiquitin 14                                      363   4e-122   Arabidopsis thaliana [mouse-ear cress]
dbj|BAJ85978.1|  predicted protein                                      363   4e-122   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AES89866.2|  polyubiquitin 3                                         363   4e-122   Medicago truncatula
gb|ABK94002.1|  unknown                                                 363   4e-122   Populus trichocarpa [western balsam poplar]
ref|XP_006428821.1|  hypothetical protein CICLE_v10012292mg             363   4e-122   Citrus clementina [clementine]
gb|ACA58351.1|  ubiquitin-like protein                                  358   4e-122   Sandersonia aurantiaca [Chinese-lantern lily]
ref|XP_002873083.1|  hypothetical protein ARALYDRAFT_487095             363   4e-122   
gb|KDP39203.1|  hypothetical protein JCGZ_00960                         363   4e-122   Jatropha curcas
emb|CDR41572.1|  RHTO0S06e03070g1_1                                     360   4e-122   Rhodotorula toruloides
ref|XP_006654612.1|  PREDICTED: polyubiquitin-like                      363   4e-122   Oryza brachyantha
ref|NP_851029.1|  polyubiquitin 3                                       363   4e-122   Arabidopsis thaliana [mouse-ear cress]
gb|EPS72031.1|  polyubiquitin                                           362   4e-122   Genlisea aurea
ref|XP_006480631.1|  PREDICTED: polyubiquitin-like                      363   4e-122   Citrus sinensis [apfelsine]
ref|XP_006302387.1|  hypothetical protein CARUB_v10020456mg             363   4e-122   
gb|AHC00631.1|  polyubiquitin                                           363   4e-122   Ganoderma lucidum
ref|XP_011077812.1|  PREDICTED: polyubiquitin 3                         364   4e-122   
ref|XP_009112898.1|  PREDICTED: polyubiquitin                           363   4e-122   Brassica rapa
ref|XP_003537278.1|  PREDICTED: polyubiquitin-like                      363   4e-122   Glycine max [soybeans]
ref|XP_010258950.1|  PREDICTED: polyubiquitin                           363   4e-122   Nelumbo nucifera [Indian lotus]
ref|XP_006428925.1|  hypothetical protein CICLE_v10012291mg             363   4e-122   Citrus clementina [clementine]
gb|KIK28767.1|  hypothetical protein PISMIDRAFT_672939                  360   4e-122   Pisolithus microcarpus 441
gb|AFW66439.1|  putative ubiquitin family protein                       362   5e-122   
gb|ABD96088.1|  polyubiquitin                                           361   5e-122   Malus domestica [apple tree]
gb|AFY06654.1|  polyubiquitin                                           361   5e-122   Carica papaya [mamon]
ref|XP_007205620.1|  hypothetical protein PRUPE_ppa009116mg             363   5e-122   
emb|CAA48140.1|  ubiquitin                                              362   5e-122   Antirrhinum majus [garden snapdragon]
emb|CDP08569.1|  unnamed protein product                                363   5e-122   Coffea canephora [robusta coffee]
emb|CBY46745.1|  polyubiquitin 10 protein                               363   5e-122   Lepidium appelianum [hairy whitetop]
gb|AAC35858.1|  polyubiquitin                                           361   6e-122   Capsicum chinense [bonnet pepper]
ref|XP_002872746.1|  hypothetical protein ARALYDRAFT_911794             360   6e-122   
gb|KDP38838.1|  hypothetical protein JCGZ_04995                         362   6e-122   Jatropha curcas
gb|ACD31680.1|  ubiquitin                                               362   7e-122   Gossypium hirsutum [American cotton]
gb|KJB14874.1|  hypothetical protein B456_002G147600                    363   7e-122   Gossypium raimondii
gb|AAB95250.1|  ubiquitin                                               362   7e-122   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010227188.1|  PREDICTED: polyubiquitin isoform X1                363   7e-122   
ref|XP_010493589.1|  PREDICTED: polyubiquitin-like                      367   8e-122   Camelina sativa [gold-of-pleasure]
emb|CAA54603.1|  pentameric polyubiquitin                               363   9e-122   Nicotiana tabacum [American tobacco]
ref|XP_010453358.1|  PREDICTED: polyubiquitin-like                      362   9e-122   Camelina sativa [gold-of-pleasure]
ref|XP_007154493.1|  hypothetical protein PHAVU_003G123500g             366   1e-121   Phaseolus vulgaris [French bean]
gb|KIK92093.1|  hypothetical protein PAXRUDRAFT_830299                  359   1e-121   Paxillus rubicundulus Ve08.2h10
ref|XP_003082269.1|  polyubiquitin (ISS)                                361   1e-121   
ref|XP_010938693.1|  PREDICTED: polyubiquitin                           362   1e-121   Elaeis guineensis
ref|XP_007154496.1|  hypothetical protein PHAVU_003G1236001g            362   1e-121   Phaseolus vulgaris [French bean]
ref|XP_006685644.1|  ubiquitin                                          359   1e-121   Yamadazyma tenuis ATCC 10573
ref|XP_010240636.1|  PREDICTED: polyubiquitin isoform X1                365   1e-121   
gb|KJB62487.1|  hypothetical protein B456_009G418900                    362   1e-121   Gossypium raimondii
gb|AGZ15412.1|  fiber polyubiquitin                                     359   1e-121   Phaseolus vulgaris [French bean]
gb|KIL68862.1|  hypothetical protein M378DRAFT_157997                   362   1e-121   Amanita muscaria Koide BX008
gb|EGO00904.1|  hypothetical protein SERLA73DRAFT_178893                362   1e-121   Serpula lacrymans var. lacrymans S7.3
gb|AIY27743.1|  polyubiquitin Ubi10                                     362   1e-121   Betula luminifera [liang ye hua]
gb|AAO43309.1|  putative polyubiquitin                                  359   2e-121   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006288300.1|  hypothetical protein CARUB_v10001544mg             361   2e-121   Capsella rubella
sp|P69315.2|UBIQP_LINUS  RecName: Full=Polyubiquitin; Contains: R...    361   2e-121   Linum usitatissimum
ref|XP_011048569.1|  PREDICTED: polyubiquitin 3-like                    361   2e-121   Populus euphratica
ref|XP_008796945.1|  PREDICTED: LOW QUALITY PROTEIN: polyubiquiti...    361   2e-121   Phoenix dactylifera
gb|ADD52202.1|  ubiquitin                                               364   2e-121   Catharanthus roseus [chatas]
gb|AFK47245.1|  unknown                                                 358   2e-121   Medicago truncatula
ref|XP_002872109.1|  predicted protein                                  364   2e-121   
ref|XP_010492041.1|  PREDICTED: polyubiquitin-like                      361   2e-121   Camelina sativa [gold-of-pleasure]
ref|XP_006381473.1|  polyubiquitin family protein                       361   2e-121   
emb|CCL99875.1|  predicted protein                                      361   2e-121   Fibroporia radiculosa
gb|KIM67150.1|  hypothetical protein SCLCIDRAFT_1210637                 361   3e-121   Scleroderma citrinum Foug A
gb|AIS40894.1|  polyubiquitin                                           367   3e-121   Kalanchoe fedtschenkoi [lavender-scallops]
gb|EWZ40370.1|  ubiquitin C                                             358   3e-121   Fusarium oxysporum Fo47
gb|KIR29996.1|  polyubiquitin                                           361   3e-121   Cryptococcus gattii VGII LA55
gb|KIJ45725.1|  hypothetical protein M422DRAFT_106821                   360   3e-121   Sphaerobolus stellatus SS14
gb|KIY45417.1|  ubiquitin                                               360   3e-121   Fistulina hepatica ATCC 64428
emb|CEF99839.1|  Ubiquitin conserved site                               362   3e-121   Ostreococcus tauri
ref|XP_001555417.1|  polyubiquitin                                      360   4e-121   Botrytis cinerea B05.10
ref|XP_010911599.1|  PREDICTED: polyubiquitin 4                         363   4e-121   Elaeis guineensis
ref|NP_001105376.1|  polyubiquitin                                      363   4e-121   
gb|AGV54228.1|  polyubiquitin-like protein                              363   4e-121   Phaseolus vulgaris [French bean]
gb|KIR63773.1|  polyubiquitin                                           360   4e-121   Cryptococcus gattii CA1873
gb|ABU40645.1|  polyubiquitin                                           363   4e-121   Triticum aestivum [Canadian hard winter wheat]
gb|KJB13592.1|  hypothetical protein B456_002G083000                    363   4e-121   Gossypium raimondii
ref|XP_002508175.1|  ubiquitin                                          363   4e-121   Micromonas commoda
gb|AAB95252.1|  ubiquitin                                               363   4e-121   Arabidopsis thaliana [mouse-ear cress]
gb|KIY53974.1|  polyubiquitin                                           360   4e-121   Fistulina hepatica ATCC 64428
ref|XP_007339454.1|  ubiquitin                                          360   4e-121   
ref|XP_010558157.1|  PREDICTED: polyubiquitin-like                      363   4e-121   Tarenaya hassleriana [spider flower]
gb|KJB62485.1|  hypothetical protein B456_009G418900                    360   4e-121   Gossypium raimondii
gb|KDQ20365.1|  hypothetical protein BOTBODRAFT_123907                  360   4e-121   Botryobasidium botryosum FD-172 SS1
gb|KDB11907.1|  ubiquitin                                               360   4e-121   Ustilaginoidea virens
ref|XP_001828882.1|  ubiquitin C                                        360   4e-121   Coprinopsis cinerea okayama7#130
ref|XP_003030030.1|  polyubiquitin                                      360   4e-121   Schizophyllum commune H4-8
gb|KJB81825.1|  hypothetical protein B456_013G163500                    363   4e-121   Gossypium raimondii
ref|XP_009763135.1|  PREDICTED: polyubiquitin-like                      363   4e-121   Nicotiana sylvestris
sp|P0CG84.1|UBI4P_NICSY  RecName: Full=Polyubiquitin; Contains: R...    363   4e-121   Nicotiana sylvestris
ref|NP_001148453.1|  LOC100282068                                       363   4e-121   Zea mays [maize]
ref|XP_009358096.1|  PREDICTED: polyubiquitin isoform X1                364   4e-121   Pyrus x bretschneideri [bai li]
ref|NP_001174480.1|  Os05g0504766                                       363   4e-121   
gb|EYU33608.1|  hypothetical protein MIMGU_mgv1a004315mg                363   4e-121   Erythranthe guttata [common monkey flower]
ref|XP_009108753.1|  PREDICTED: polyubiquitin 11-like                   357   4e-121   Brassica rapa
gb|KEH31155.1|  polyubiquitin 3                                         363   4e-121   Medicago truncatula
gb|AAB68045.1|  polyubiquitin                                           363   4e-121   Fragaria x ananassa
ref|NP_849300.4|  polyubiquitin 10                                      363   4e-121   Arabidopsis thaliana [mouse-ear cress]
gb|AAL09741.1|  AT4g05320/C17L7_240                                     363   4e-121   Arabidopsis thaliana [mouse-ear cress]
ref|XP_001598085.1|  polyubiquitin                                      360   4e-121   Sclerotinia sclerotiorum 1980 UF-70
ref|XP_002992988.1|  hypothetical protein SELMODRAFT_187148             357   4e-121   Selaginella moellendorffii
ref|XP_010270791.1|  PREDICTED: polyubiquitin-like                      363   4e-121   Nelumbo nucifera [Indian lotus]
ref|XP_001420612.1|  predicted protein                                  363   5e-121   Ostreococcus lucimarinus CCE9901
gb|AAQ07453.1|  ubiquitin                                               363   5e-121   Musa acuminata AAA Group [Cavendish banana]
gb|KJB81824.1|  hypothetical protein B456_013G163500                    363   5e-121   Gossypium raimondii
ref|XP_010454368.1|  PREDICTED: polyubiquitin 4-like                    363   5e-121   Camelina sativa [gold-of-pleasure]
ref|XP_002874006.1|  hypothetical protein ARALYDRAFT_488966             363   5e-121   
gb|ACS68205.1|  ubiquitin 10.2                                          363   5e-121   Brassica napus [oilseed rape]
ref|XP_010240921.1|  PREDICTED: polyubiquitin-like                      363   5e-121   Nelumbo nucifera [Indian lotus]
emb|CDP05795.1|  unnamed protein product                                363   5e-121   Coffea canephora [robusta coffee]
ref|XP_006593989.1|  PREDICTED: polyubiquitin 10-like isoform X1        363   5e-121   
emb|CBY46746.1|  polyubiquitin 10 protein                               363   5e-121   Lepidium campestre [bastard cress]
ref|XP_006396612.1|  hypothetical protein EUTSA_v10028730mg             363   5e-121   Eutrema salsugineum [saltwater cress]
ref|XP_010421267.1|  PREDICTED: polyubiquitin 4-like                    363   5e-121   Camelina sativa [gold-of-pleasure]
gb|AAB36545.1|  ubiquitin-like protein                                  364   5e-121   Phaseolus vulgaris [French bean]
ref|NP_568397.1|  ubiquitin 4                                           363   5e-121   Arabidopsis thaliana [mouse-ear cress]
gb|AAY86773.1|  polyubiquitin                                           363   5e-121   Noccaea caerulescens
sp|Q58G87.2|UBQ3_ORYSJ  RecName: Full=Polyubiquitin 3; Contains: ...    363   5e-121   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009596689.1|  PREDICTED: polyubiquitin-like                      363   5e-121   Nicotiana tomentosiformis
ref|XP_006428816.1|  hypothetical protein CICLE_v10011684mg             363   5e-121   
ref|XP_007763327.1|  polyubiquitin                                      360   5e-121   Coniophora puteana RWD-64-598 SS2
gb|EYU18102.1|  hypothetical protein MIMGU_mgv1a008166mg                363   5e-121   Erythranthe guttata [common monkey flower]
ref|XP_009591312.1|  PREDICTED: polyubiquitin 4                         363   5e-121   Nicotiana tomentosiformis
ref|XP_010696408.1|  PREDICTED: polyubiquitin 4                         363   5e-121   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_001783045.1|  predicted protein                                  357   5e-121   
gb|AAX40652.1|  polyubiquitin                                           363   5e-121   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010452435.1|  PREDICTED: polyubiquitin-like                      360   5e-121   Camelina sativa [gold-of-pleasure]
ref|XP_002266370.1|  PREDICTED: polyubiquitin 4-like                    363   6e-121   Vitis vinifera
ref|XP_006302388.1|  hypothetical protein CARUB_v10020456mg             363   6e-121   Capsella rubella
gb|EMS65864.1|  Polyubiquitin                                           363   6e-121   Triticum urartu
gb|ADO60140.1|  ubiquitin                                               356   6e-121   Beauveria bassiana
ref|XP_007366816.1|  polyubiquitin                                      360   6e-121   Dichomitus squalens LYAD-421 SS1
ref|XP_009605659.1|  PREDICTED: polyubiquitin                           360   7e-121   Nicotiana tomentosiformis
ref|XP_001755431.1|  predicted protein                                  357   7e-121   
ref|XP_010275241.1|  PREDICTED: polyubiquitin-like                      362   7e-121   Nelumbo nucifera [Indian lotus]
dbj|BAL61087.1|  polyubiquitin                                          357   7e-121   Dianthus caryophyllus [carnation]
emb|CCT70325.1|  UBI4-Ubiquitin                                         358   7e-121   Fusarium fujikuroi IMI 58289
dbj|GAK65396.1|  ubiquitin                                              360   8e-121   Moesziomyces antarcticus
ref|NP_001053957.1|  Os04g0628100                                       363   9e-121   
ref|XP_003670049.1|  hypothetical protein NDAI_0D04930                  357   9e-121   Naumovozyma dairenensis CBS 421
ref|XP_001931824.1|  ubiquitin                                          357   1e-120   Pyrenophora tritici-repentis Pt-1C-BFP
ref|XP_007924320.1|  hypothetical protein MYCFIDRAFT_60610              357   1e-120   Pseudocercospora fijiensis CIRAD86
ref|XP_719867.1|  hypothetical protein CaO19.6771                       356   1e-120   Candida albicans SC5314
ref|XP_001764949.1|  predicted protein                                  360   1e-120   
emb|CEP60563.1|  LALA0S01e13784g1_1                                     356   1e-120   Lachancea lanzarotensis
ref|XP_009631616.1|  PREDICTED: polyubiquitin-like                      362   1e-120   Nicotiana tomentosiformis
ref|XP_008020911.1|  hypothetical protein SETTUDRAFT_162442             359   1e-120   Exserohilum turcica Et28A
gb|KJB62483.1|  hypothetical protein B456_009G418900                    362   1e-120   Gossypium raimondii
gb|EPX74297.1|  ubiquitin                                               356   1e-120   Schizosaccharomyces octosporus yFS286
emb|CAB81074.1|  polyubiquitin (ubq10)                                  365   2e-120   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003607669.1|  Multidrug resistance protein ABC transporter...    364   2e-120   
ref|XP_002953480.1|  polyubiquitin                                      359   2e-120   Volvox carteri f. nagariensis
ref|XP_001797032.1|  hypothetical protein SNOG_06667                    356   2e-120   Parastagonospora nodorum SN15
gb|KII93501.1|  hypothetical protein PLICRDRAFT_694663                  360   2e-120   Plicaturopsis crispa FD-325 SS-3
gb|AAF04147.1|  ubiquitin precursor                                     362   2e-120   Hevea brasiliensis [jebe]
gb|EMS60894.1|  Polyubiquitin                                           364   2e-120   Triticum urartu
gb|ACB87916.1|  polyubiquitin 1                                         355   2e-120   Malus domestica [apple tree]
gb|AAC67552.1|  polyubiquitin                                           361   2e-120   Saccharum hybrid cultivar H32-8560
ref|XP_001830230.1|  ubiquitin                                          358   2e-120   Coprinopsis cinerea okayama7#130
ref|XP_007154492.1|  hypothetical protein PHAVU_003G123400g             360   2e-120   Phaseolus vulgaris [French bean]
ref|XP_004956019.1|  PREDICTED: polyubiquitin 4-like                    361   3e-120   Setaria italica
ref|XP_010436682.1|  PREDICTED: polyubiquitin 4-like                    364   3e-120   
ref|XP_009784908.1|  PREDICTED: polyubiquitin-like isoform X2           363   3e-120   Nicotiana sylvestris
gb|EGO00841.1|  hypothetical protein SERLA73DRAFT_121253                360   3e-120   Serpula lacrymans var. lacrymans S7.3
ref|XP_003052575.1|  predicted protein                                  358   3e-120   [Nectria] haematococca mpVI 77-13-4
ref|XP_010324326.1|  PREDICTED: polyubiquitin isoform X1                363   3e-120   
gb|AAO43310.1|  putative polyubiquitin                                  356   3e-120   Arabidopsis thaliana [mouse-ear cress]
gb|AFR98116.1|  polyubiquitin                                           361   4e-120   Cryptococcus neoformans var. grubii H99
gb|KIK17147.1|  hypothetical protein PISMIDRAFT_685607                  361   4e-120   Pisolithus microcarpus 441
ref|XP_001880135.1|  ubiquitin                                          361   4e-120   Laccaria bicolor S238N-H82
gb|AAN31845.1|  putative polyubiquitin (UBQ10)                          363   4e-120   Arabidopsis thaliana [mouse-ear cress]
gb|KII92029.1|  hypothetical protein PLICRDRAFT_172184                  361   4e-120   Plicaturopsis crispa FD-325 SS-3
ref|XP_007211609.1|  hypothetical protein PRUPE_ppa005507mg             363   4e-120   Prunus persica
emb|CAA40324.1|  hexaubiquitin protein                                  363   4e-120   Helianthus annuus
gb|ACX46987.1|  ubiquitin                                               363   4e-120   Guzmania wittmackii x Guzmania lingulata
gb|KDP42860.1|  hypothetical protein JCGZ_23802                         363   4e-120   Jatropha curcas
ref|NP_001045980.1|  Os02g0161900                                       363   4e-120   
ref|XP_002452705.1|  hypothetical protein SORBIDRAFT_04g031060          363   4e-120   Sorghum bicolor [broomcorn]
gb|EUC59758.1|  polyubiquitin                                           360   4e-120   Rhizoctonia solani AG-3 Rhs1AP
gb|AAA82978.1|  polyubiquitin                                           360   4e-120   Cryptococcus neoformans var. grubii
ref|XP_004953565.1|  PREDICTED: polyubiquitin-like                      363   4e-120   Setaria italica
ref|XP_010423744.1|  PREDICTED: polyubiquitin                           363   4e-120   Camelina sativa [gold-of-pleasure]
gb|EYU33607.1|  hypothetical protein MIMGU_mgv1a004315mg                363   4e-120   Erythranthe guttata [common monkey flower]
gb|AAB95251.1|  ubiquitin                                               363   4e-120   Arabidopsis thaliana [mouse-ear cress]
dbj|BAK03691.1|  predicted protein                                      363   4e-120   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KIM40192.1|  hypothetical protein M413DRAFT_73842                    360   5e-120   Hebeloma cylindrosporum h7
gb|KJB13590.1|  hypothetical protein B456_002G083000                    363   5e-120   Gossypium raimondii
ref|XP_002891806.1|  predicted protein                                  360   5e-120   
gb|AAD03343.1|  ubiquitin                                               363   5e-120   Pisum sativum [garden pea]
ref|XP_002888365.1|  polyubiquitin                                      363   5e-120   Arabidopsis lyrata subsp. lyrata
dbj|BAK02501.1|  predicted protein                                      363   5e-120   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ91912.1|  predicted protein                                      363   5e-120   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007049060.1|  Polyubiquitin 10                                   363   5e-120   
gb|KJB81827.1|  hypothetical protein B456_013G163500                    363   5e-120   Gossypium raimondii
ref|XP_009784905.1|  PREDICTED: polyubiquitin-like isoform X1           363   5e-120   Nicotiana sylvestris
gb|EJU00136.1|  ubiquitin                                               360   5e-120   Dacryopinax primogenitus
ref|XP_007316637.1|  hypothetical protein SERLADRAFT_368035             360   5e-120   Serpula lacrymans var. lacrymans S7.9
ref|XP_010262389.1|  PREDICTED: polyubiquitin                           363   5e-120   Nelumbo nucifera [Indian lotus]
gb|KDQ30621.1|  hypothetical protein PLEOSDRAFT_1088454                 360   5e-120   Pleurotus ostreatus PC15
ref|XP_003196661.1|  ATP-dependent protein binding protein              360   5e-120   Cryptococcus gattii WM276
ref|NP_849299.4|  polyubiquitin 10                                      363   5e-120   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010324327.1|  PREDICTED: polyubiquitin isoform X2                360   5e-120   
ref|XP_010431529.1|  PREDICTED: LOW QUALITY PROTEIN: polyubiquiti...    363   5e-120   Camelina sativa [gold-of-pleasure]
gb|EGA57707.1|  Ubi4p                                                   355   5e-120   Saccharomyces cerevisiae FostersB
ref|XP_008345409.1|  PREDICTED: polyubiquitin-like                      363   5e-120   
gb|KIM22018.1|  hypothetical protein M408DRAFT_333137                   355   6e-120   Serendipita vermifera MAFF 305830
ref|XP_011094250.1|  PREDICTED: polyubiquitin-like                      363   6e-120   Sesamum indicum [beniseed]
gb|KDR85168.1|  hypothetical protein GALMADRAFT_131895                  360   6e-120   
gb|ACN40936.1|  unknown                                                 363   6e-120   
gb|KIM48035.1|  hypothetical protein M413DRAFT_16078                    360   6e-120   
gb|KIJ68260.1|  hypothetical protein HYDPIDRAFT_173033                  360   6e-120   
ref|XP_003542730.1|  PREDICTED: polyubiquitin 10-like                   363   6e-120   
ref|XP_006428817.1|  hypothetical protein CICLE_v10011684mg             363   6e-120   
gb|AFW70219.1|  polyubiquitin-like protein                              364   6e-120   
ref|XP_011094650.1|  PREDICTED: polyubiquitin                           363   6e-120   
ref|XP_008350368.1|  PREDICTED: polyubiquitin                           363   6e-120   
ref|XP_008441422.1|  PREDICTED: LOW QUALITY PROTEIN: polyubiquiti...    363   6e-120   
ref|XP_007864655.1|  ubiquitin                                          360   7e-120   
gb|AFD53810.1|  ubiquitin                                               355   7e-120   
ref|XP_008244357.1|  PREDICTED: polyubiquitin isoform X1                363   7e-120   
emb|CAD27944.1|  polyubiquitin-like                                     354   7e-120   
gb|AAC16012.1|  polyubiquitin                                           363   7e-120   
ref|XP_003010029.1|  polyubiquitin UbiD/Ubi4, putative                  354   7e-120   
gb|AGT38457.1|  polyubiquitin                                           363   7e-120   
ref|XP_003607668.1|  Multidrug resistance protein ABC transporter...    364   8e-120   
ref|XP_001755307.1|  predicted protein                                  357   8e-120   
ref|XP_006372519.1|  polyubiquitin family protein                       357   8e-120   
ref|XP_002551324.1|  ubiquitin                                          357   8e-120   
ref|XP_011037020.1|  PREDICTED: polyubiquitin-like                      360   8e-120   
ref|XP_002980153.1|  hypothetical protein SELMODRAFT_271419             357   9e-120   
emb|CCG34086.1|  Polyubiquitin                                          357   9e-120   
dbj|BAP70433.1|  Ubiquitin                                              357   9e-120   
ref|XP_002839703.1|  hypothetical protein                               357   9e-120   
gb|KIW56414.1|  polyubiquitin                                           357   9e-120   
ref|XP_001210780.1|  ubiquitin                                          357   1e-119   
gb|EPS29015.1|  hypothetical protein PDE_03961                          356   1e-119   
sp|P0CG73.1|UBI1P_CANAX  RecName: Full=Polyubiquitin; Contains: R...    354   1e-119   
dbj|GAA27344.2|  polyubiquitin-A                                        356   1e-119   
ref|XP_002888394.1|  hexaubiquitin protein                              363   1e-119   
emb|CCO30833.1|  Polyubiquitin                                          360   1e-119   
gb|KEZ40313.1|  Polyubiquitin                                           357   1e-119   
gb|EEH07231.1|  ubiquitin                                               357   1e-119   
gb|EEH20847.2|  polyubiquitin                                           357   1e-119   
ref|XP_001227036.1|  polyubiquitin                                      357   1e-119   
gb|AGM32540.1|  polyubiquitin-B-like isoform                            355   1e-119   
ref|XP_002494205.1|  Ubiquitin                                          357   1e-119   
ref|XP_010756991.1|  polyubiquitin                                      357   1e-119   
gb|EMS24129.1|  ubiquitin C                                             354   1e-119   
gb|EEQ88150.1|  ubiquitin                                               356   1e-119   
gb|AAV65292.1|  polyubiquitin                                           356   2e-119   
gb|EKV13151.1|  hypothetical protein PDIG_39650                         357   2e-119   
gb|AAP80689.1|  polyubiquitin                                           354   2e-119   
ref|XP_003350608.1|  hypothetical protein SMAC_07925                    353   2e-119   
gb|AFW66445.1|  ubiquitin2                                              364   2e-119   
ref|XP_002419618.1|  ubiquitin, putative                                356   2e-119   
gb|KHJ83418.1|  ubiquitin family protein                                353   2e-119   
gb|AEH41483.1|  ubiquitin                                               356   2e-119   
ref|XP_010046742.1|  PREDICTED: polyubiquitin-like                      362   2e-119   
emb|CAA52290.1|  polyubiquitin                                          359   2e-119   
gb|KJB62482.1|  hypothetical protein B456_009G418900                    359   2e-119   
ref|XP_001266981.1|  polyubiquitin (UbiD), putative                     356   2e-119   
gb|AGM32487.1|  polyubiquitin-B-like isoform 1                          353   2e-119   
gb|KDR10312.1|  Ubiquitin                                               353   2e-119   
dbj|GAA55031.1|  ubiquitin C                                            353   2e-119   
ref|XP_659604.1|  hypothetical protein AN2000.2                         357   2e-119   
gb|EZF98642.1|  polyubiquitin                                           353   2e-119   
ref|XP_006694532.1|  hypothetical protein CTHT_0041260                  356   2e-119   
gb|ETN78467.1|  ubiquitin family protein                                353   3e-119   
ref|XP_010451655.1|  PREDICTED: polyubiquitin 4-like                    363   3e-119   
gb|EYC42800.1|  hypothetical protein Y032_0517g2809                     353   3e-119   
ref|XP_009618235.1|  PREDICTED: polyubiquitin-like isoform X1           364   3e-119   
ref|XP_003402310.1|  PREDICTED: polyubiquitin-B-like isoform 1          353   3e-119   
ref|XP_002791169.1|  ubiquitin                                          355   3e-119   
gb|KIM30634.1|  hypothetical protein M408DRAFT_328170                   353   3e-119   
gb|AAL91103.1|  ubiquitin                                               353   3e-119   
emb|CCA16073.1|  polyubiquitin putative                                 363   3e-119   
ref|XP_007808982.1|  ubiquitin                                          357   3e-119   
ref|XP_008034069.1|  ubiquitin 10.1                                     361   4e-119   
ref|XP_011038259.1|  PREDICTED: polyubiquitin-like                      355   4e-119   
ref|XP_004249885.1|  PREDICTED: polyubiquitin-like                      363   4e-119   
gb|AAY33920.2|  polyubiquitin                                           358   4e-119   
tpd|FAA00317.1|  TPA: polyubiquitin                                     355   4e-119   
tpe|CBF85986.1|  TPA: Polyubiquitin Fragment [Source:UniProtKB/Tr...    355   4e-119   
dbj|BAH71115.1|  ACYPI006410                                            352   4e-119   
emb|CDH08450.1|  ubiquitin and ubiquitin-like proteins                  355   4e-119   
ref|XP_004505453.1|  PREDICTED: polyubiquitin-A-like                    363   4e-119   
ref|XP_001538486.1|  polyubiquitin                                      355   4e-119   
emb|CAA51679.1|  ubiquitin                                              363   4e-119   
ref|XP_007307433.1|  polyubiquitin                                      360   4e-119   
ref|XP_007410937.1|  hypothetical protein MELLADRAFT_87680              363   4e-119   
gb|EYU33611.1|  hypothetical protein MIMGU_mgv1a004315mg                363   5e-119   
ref|XP_006350990.1|  PREDICTED: polyubiquitin-A-like                    363   5e-119   
gb|EYU18101.1|  hypothetical protein MIMGU_mgv1a004289mg                363   5e-119   
gb|AAC49013.1|  polyubiquitin containing 7 ubiquitin monomers           363   5e-119   
ref|XP_010553005.1|  PREDICTED: polyubiquitin-like                      363   5e-119   
ref|XP_003608276.1|  Ubiquitin                                          363   5e-119   
ref|XP_008645269.1|  PREDICTED: polyubiquitin                           363   5e-119   
ref|XP_003843815.1|  hypothetical protein LEMA_P014660.1                358   5e-119   
ref|XP_567862.1|  ATP-dependent protein binding protein                 360   5e-119   
tpd|FAA00319.1|  TPA: polyubiquitin                                     360   5e-119   
ref|XP_011388891.1|  putative ubiquitin                                 360   5e-119   
ref|XP_009150698.1|  PREDICTED: polyubiquitin                           363   5e-119   
ref|XP_003607670.1|  Ubiquitin                                          363   5e-119   
ref|XP_002842034.1|  hypothetical protein                               355   5e-119   
ref|XP_003542728.1|  PREDICTED: polyubiquitin-A-like isoform 1          363   5e-119   
ref|XP_003627151.1|  Ubiquitin                                          363   5e-119   
gb|ABD32351.2|  Ubiquitin                                               363   5e-119   
ref|XP_007861169.1|  polyubiquitin                                      360   6e-119   
gb|KDQ63803.1|  hypothetical protein JAAARDRAFT_29850                   360   6e-119   
dbj|BAK61744.1|  ubiquitin                                              352   6e-119   
ref|XP_006480550.1|  PREDICTED: polyubiquitin-A-like                    363   6e-119   
gb|AAO43306.1|  putative polyubiquitin                                  355   7e-119   
gb|EYU38681.1|  hypothetical protein MIMGU_mgv1a004304mg                363   7e-119   
gb|KJB62486.1|  hypothetical protein B456_009G418900                    357   7e-119   
emb|CAN71997.1|  hypothetical protein VITISV_004025                     363   7e-119   
ref|XP_002267017.1|  PREDICTED: polyubiquitin-like                      363   8e-119   
dbj|GAA87419.1|  polyubiquitin                                          354   8e-119   
gb|AAO43305.1|  putative polyubiquitin                                  355   8e-119   
ref|XP_002976481.1|  hypothetical protein SELMODRAFT_271198             357   8e-119   
ref|XP_001246797.1|  polyubiquitin                                      354   8e-119   
gb|KIY97628.1|  ubiquitin C                                             354   8e-119   
ref|XP_010537590.1|  PREDICTED: polyubiquitin 11                        352   9e-119   
ref|XP_002992907.1|  hypothetical protein SELMODRAFT_162680             357   9e-119   
ref|XP_004341200.1|  polyubiquitin, putative                            351   9e-119   
ref|XP_005644220.1|  polyubiquitin                                      354   1e-118   
dbj|BAO38900.1|  ubiquitin                                              357   1e-118   
ref|XP_011275993.1|  ubiquitin C                                        357   1e-118   
gb|KFY10578.1|  hypothetical protein V492_04946                         358   1e-118   
ref|XP_001777816.1|  predicted protein                                  357   1e-118   
ref|XP_008243902.1|  PREDICTED: polyubiquitin-like isoform X1           362   1e-118   
emb|CDI53149.1|  probable Polyubiquitin protein                         354   1e-118   
ref|NP_983342.1|  ACL062Cp                                              357   1e-118   
ref|XP_003675939.1|  hypothetical protein NCAS_0C05850                  357   1e-118   
emb|CCA40372.1|  Ubiquitin cross-reactive protein                       357   1e-118   
dbj|BAL61084.1|  polyubiqutin                                           357   1e-118   
emb|CDP91931.1|  Protein Bm3564, isoform e                              356   1e-118   
gb|ELR08709.1|  polyubiquitin                                           357   1e-118   
ref|NP_595409.1|  ubiquitin                                             357   2e-118   
ref|XP_453980.1|  hypothetical protein                                  357   2e-118   
tpd|FAA00316.1|  TPA: polyubiquitin                                     356   2e-118   
sp|P0CH27.1|RL402_TRYCR  RecName: Full=Ubiquitin-60S ribosomal pr...    355   2e-118   
ref|XP_004365491.1|  polyubiquitin 5                                    350   2e-118   
ref|NP_013061.1|  ubiquitin                                             356   2e-118   
gb|ADD24466.1|  Ubiquitin                                               350   2e-118   
gb|KFY77115.1|  hypothetical protein V499_03430                         356   2e-118   
ref|XP_958803.1|  ubiquitin                                             353   2e-118   
gb|AEZ66647.1|  putative beta-1,6-glucanase                             356   2e-118   
ref|XP_002627625.1|  ubiquitin                                          356   2e-118   
gb|EJD76734.1|  polyubiquitin, variant 2                                354   2e-118   
dbj|BAK61751.1|  ubiquitin                                              350   2e-118   
ref|XP_002171731.1|  ubiquitin                                          356   2e-118   
emb|CAJ41447.1|  polyubiquitin                                          353   2e-118   
pir||T02358  ubiquitin homolog T8F5.13 - Arabidopsis thaliana           354   3e-118
ref|XP_001766873.1|  predicted protein                                  355   3e-118   
gb|EFN76024.1|  Ubiquitin                                               350   3e-118   
ref|NP_176714.4|  ubiquitin 13                                          353   3e-118   
gb|ABV22331.1|  ubiquitin                                               353   3e-118   
gb|AAL91109.1|  ubiquitin                                               353   3e-118   
emb|CEL52635.1|  Polyubiquitin OS=Petroselinum crispum GN=PCUBI4-...    361   3e-118   
ref|XP_003290908.1|  ubiquitin                                          350   4e-118   
gb|AGH70140.1|  ubiquitin family protein                                349   4e-118   
ref|XP_003331105.1|  polyubiquitin-A                                    363   4e-118   
ref|XP_011302492.1|  PREDICTED: polyubiquitin-B                         353   4e-118   
ref|XP_001897032.1|  polyubiquitin precursor                            356   4e-118   
gb|AFP44113.1|  ubiquitin                                               348   4e-118   
ref|XP_011094688.1|  PREDICTED: polyubiquitin-like                      363   4e-118   
gb|AAC13691.1|  poly-ubiquitin                                          355   4e-118   
ref|XP_008796191.1|  PREDICTED: polyubiquitin-like                      353   4e-118   
gb|KHN45015.1|  Polyubiquitin-A                                         363   4e-118   
ref|XP_002553736.1|  KLTH0E05852p                                       356   4e-118   
ref|XP_009620669.1|  PREDICTED: polyubiquitin-like                      363   5e-118   
ref|XP_007545871.1|  PREDICTED: polyubiquitin-B isoform X2              351   5e-118   
ref|XP_010480024.1|  PREDICTED: polyubiquitin-like                      353   5e-118   
gb|KIJ26545.1|  hypothetical protein M422DRAFT_216245                   361   5e-118   
gb|KIK81924.1|  hypothetical protein PAXRUDRAFT_736824                  350   6e-118   
ref|XP_006352490.1|  PREDICTED: polyubiquitin-A-like isoform X1         363   6e-118   
ref|XP_626192.1|  polyubiquitin with 3 Ub domains                       350   7e-118   
ref|XP_008816966.1|  polyubiquitin                                      352   7e-118   
gb|AAO43303.1|  putative polyubiquitin                                  353   8e-118   
ref|XP_011203306.1|  PREDICTED: polyubiquitin-B                         348   8e-118   
gb|ACB87918.1|  polyubiquitin 3                                         347   8e-118   
ref|XP_005831810.1|  ubiquitin                                          349   8e-118   
ref|XP_002973843.1|  hypothetical protein SELMODRAFT_173723             357   8e-118   
gb|AAO43304.1|  putative polyubiquitin                                  353   8e-118   
gb|KIZ01427.1|  ubiquitin C                                             354   1e-117   
ref|XP_002083532.1|  GD13313                                            347   1e-117   
tpg|DAA34473.1|  TPA: ubiquitin                                         349   1e-117   
ref|XP_008632241.1|  PREDICTED: polyubiquitin-C isoform X10             348   1e-117   
ref|XP_001774326.1|  predicted protein                                  357   1e-117   
ref|XP_005620146.1|  PREDICTED: polyubiquitin-B isoform X1              349   1e-117   
ref|XP_002498336.1|  ZYRO0G07854p                                       357   1e-117   
ref|XP_007443096.1|  PREDICTED: polyubiquitin-C                         348   1e-117   
ref|XP_006306291.1|  hypothetical protein CARUB_v10012156mg             357   1e-117   
gb|KHN87823.1|  Polyubiquitin-A                                         348   2e-117   
emb|CDP08561.1|  unnamed protein product                                362   2e-117   
gb|ABO84843.1|  ubiquitin B                                             347   2e-117   
ref|XP_002674746.1|  polyubiquitin                                      348   2e-117   
emb|CAA30815.1|  unnamed protein product                                348   2e-117   
ref|XP_460488.1|  DEHA2F02816p                                          356   2e-117   
gb|ELU42015.1|  polyubiquitin                                           363   2e-117   
gb|ABI53721.1|  polyubiquitin                                           356   2e-117   
gb|EXX74854.1|  ubiquitin                                               347   2e-117   
gb|EMS54972.1|  Polyubiquitin-A                                         363   2e-117   
ref|XP_001486573.1|  ubiquitin                                          356   2e-117   
emb|CDP08564.1|  unnamed protein product                                353   2e-117   
ref|XP_008161896.1|  PREDICTED: polyubiquitin-C                         348   2e-117   
ref|XP_008426285.1|  PREDICTED: polyubiquitin-B isoform X1              349   2e-117   
ref|XP_008330590.1|  PREDICTED: polyubiquitin-B isoform X2              348   2e-117   
ref|XP_003142560.1|  ubiquitin C II                                     354   2e-117   
ref|XP_008003373.1|  PREDICTED: polyubiquitin-C                         348   2e-117   
gb|AFC36452.1|  ubiquitin                                               347   3e-117   
ref|XP_001610925.1|  polyubiquitin                                      348   3e-117   
ref|NP_001133175.1|  polyubiquitin                                      348   3e-117   
gb|ACH45547.1|  putative ubiquitin C variant 1                          347   3e-117   
ref|XP_001018501.1|  Ubiquitin family protein                           348   3e-117   
gb|KIH55346.1|  ubiquitin family protein                                353   3e-117   
ref|XP_009901570.1|  PREDICTED: polyubiquitin-B isoform X1              348   3e-117   
ref|XP_008300055.1|  PREDICTED: polyubiquitin-B                         348   3e-117   
gb|AAA28997.1|  ubiquitin                                               348   3e-117   
ref|XP_010177726.1|  PREDICTED: polyubiquitin-B isoform X5              348   3e-117   
ref|XP_008369745.1|  PREDICTED: polyubiquitin-like                      356   3e-117   
ref|XP_002771956.1|  polyubiquitin, putative                            348   3e-117   
ref|XP_010602597.1|  PREDICTED: polyubiquitin-C                         348   3e-117   
ref|XP_010669246.1|  PREDICTED: polyubiquitin-like                      356   3e-117   
ref|XP_007057723.1|  PREDICTED: polyubiquitin-C isoform X1              348   3e-117   
ref|XP_005023176.1|  PREDICTED: polyubiquitin-C isoform X2              348   3e-117   
ref|XP_011298607.1|  PREDICTED: polyubiquitin isoform X1                353   3e-117   
emb|CAX72428.1|  ubiquitin C                                            347   3e-117   



>gb|ABI84246.1| polyubiquitin 10 [Arachis hypogaea]
Length=192

 Score =   363 bits (931),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 184/191 (96%), Positives = 184/191 (96%), Gaps = 0/191 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPD  645
             IQDK GIPPD
Sbjct  181  KIQDKEGIPPD  191


 Score =   228 bits (581),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 115/116 (99%), Positives = 115/116 (99%), Gaps = 0/116 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQ  420
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQ
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ  192



>gb|AFW66442.1| putative ubiquitin family protein, partial [Zea mays]
Length=216

 Score =   363 bits (932),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   277 bits (708),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 139/140 (99%), Positives = 139/140 (99%), Gaps = 0/140 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKE  492
            FAGKQLEDGRTLADYNIQKE
Sbjct  197  FAGKQLEDGRTLADYNIQKE  216



>gb|AEW46688.1| polyubiquitin, partial [Ulva linza]
Length=226

 Score =   363 bits (933),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   295 bits (754),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 148/150 (99%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLR  522
            FAGKQLEDGRTLADYNIQKESTLHL LRLR
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLR  226



>ref|XP_010235843.1| PREDICTED: polyubiquitin 11 isoform X1 [Brachypodium distachyon]
Length=265

 Score =   365 bits (937),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 187/206 (91%), Positives = 188/206 (91%), Gaps = 0/206 (0%)
 Frame = +1

Query  37   CDYFRFSILFLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  216
            CD   F      MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  13   CDLEDFLECRKMMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  72

Query  217  QLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXD  396
            QLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI D
Sbjct  73   QLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQD  132

Query  397  KEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLE  576
            KEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE
Sbjct  133  KEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE  192

Query  577  GESSDTIDNVKAXIQDKXGIPPDXXK  654
             ESSDTIDNVKA IQDK GIPPD  +
Sbjct  193  VESSDTIDNVKAKIQDKEGIPPDQQR  218


 Score =   299 bits (766),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  101  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  160

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  161  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  220

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG
Sbjct  221  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  252



>gb|EYU33610.1| hypothetical protein MIMGU_mgv1a004315mg [Erythranthe guttata]
Length=229

 Score =   363 bits (933),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   300 bits (767),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGM  531
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG+
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGV  229



>ref|XP_008358804.1| PREDICTED: LOW QUALITY PROTEIN: polyubiquitin 11-like, partial 
[Malus domestica]
Length=260

 Score =   365 bits (936),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   344 bits (882),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 174/180 (97%), Positives = 174/180 (97%), Gaps = 0/180 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK   GKTITLE ESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTXTGKTITLEXESSDTIDNVKA  256


 Score =   204 bits (518),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 103/105 (98%), Positives = 103/105 (98%), Gaps = 0/105 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAK  387
            IQKESTLHLVLRLRGGMQIFVKT TGKTITLE ESSDTIDNVKAK
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTXTGKTITLEXESSDTIDNVKAK  257



>gb|AEZ49160.1| polyubiquitin, partial [Wolffia australiana]
Length=281

 Score =   365 bits (938),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 185/195 (95%), Positives = 186/195 (95%), Gaps = 0/195 (0%)
 Frame = +1

Query  70   KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  249
            KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  20   KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  79

Query  250  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRL  429
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRL
Sbjct  80   NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  139

Query  430  IFAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVK  609
            IFAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVK
Sbjct  140  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  199

Query  610  AXIQDKXGIPPDXXK  654
            A IQDK GIPPD  +
Sbjct  200  AKIQDKEGIPPDQQR  214


 Score =   349 bits (896),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 178/185 (96%), Positives = 178/185 (96%), Gaps = 0/185 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  97   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  156

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  157  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  216

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE  SSDTIDNVKA
Sbjct  217  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVASSDTIDNVKA  276

Query  613  XIQDK  627
             IQDK
Sbjct  277  KIQDK  281


 Score =   217 bits (553),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 110/123 (89%), Positives = 112/123 (91%), Gaps = 0/123 (0%)
 Frame = +1

Query  286  RLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLIFAGKQLEDGRT  465
            RL+  MQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLIFAGKQLEDGRT
Sbjct  16   RLQSKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRT  75

Query  466  LADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKAXIQDKXGIPPD  645
            LADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA IQDK GIPPD
Sbjct  76   LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPD  135

Query  646  XXK  654
              +
Sbjct  136  QQR  138



>ref|XP_010931017.1| PREDICTED: polyubiquitin 11 isoform X1 [Elaeis guineensis]
 ref|XP_010931026.1| PREDICTED: polyubiquitin 11 isoform X2 [Elaeis guineensis]
 ref|XP_010923942.1| PREDICTED: polyubiquitin 11 [Elaeis guineensis]
Length=229

 Score =   363 bits (933),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   301 bits (772),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGM  531
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGM
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229



>ref|XP_004968120.1| PREDICTED: polyubiquitin-like [Setaria italica]
 ref|XP_009404996.1| PREDICTED: polyubiquitin 11 [Musa acuminata subsp. malaccensis]
 gb|ABS18744.1| ubiqutin ligase-like protein [Oryza sativa Japonica Group]
 dbj|BAJ88219.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=229

 Score =   363 bits (932),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   299 bits (766),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>ref|XP_003626479.1| Ubiquitin-like protein [Medicago truncatula]
 gb|AES82697.1| polyubiquitin 3 [Medicago truncatula]
Length=277

 Score =   365 bits (937),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 185/196 (94%), Positives = 187/196 (95%), Gaps = 0/196 (0%)
 Frame = +1

Query  67   LKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  246
            +KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  47   IKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  106

Query  247  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQR  426
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQR
Sbjct  107  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  166

Query  427  LIFAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNV  606
            LIFAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNV
Sbjct  167  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV  226

Query  607  KAXIQDKXGIPPDXXK  654
            KA IQDK GIPPD  +
Sbjct  227  KAKIQDKEGIPPDQQR  242


 Score =   299 bits (765),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 150/153 (98%), Gaps = 0/153 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  125  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  185  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  244

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGM  531
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG 
Sbjct  245  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  277



>gb|KJB36627.1| hypothetical protein B456_006G167800 [Gossypium raimondii]
Length=229

 Score =   363 bits (932),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   299 bits (766),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>dbj|BAC57955.1| polyubiquitin [Aster tripolium]
Length=229

 Score =   363 bits (932),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   300 bits (768),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGM  531
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG+
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGL  229



>ref|XP_010490793.1| PREDICTED: polyubiquitin 11-like [Camelina sativa]
Length=230

 Score =   363 bits (932),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   299 bits (766),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>ref|XP_002317213.1| polyubiquitin family protein [Populus trichocarpa]
 gb|ABK95814.1| unknown [Populus trichocarpa]
 gb|EEE97825.1| polyubiquitin family protein [Populus trichocarpa]
Length=229

 Score =   363 bits (932),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   300 bits (767),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGM  531
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG+
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGI  229



>gb|KDO51109.1| hypothetical protein CISIN_1g026973mg [Citrus sinensis]
Length=230

 Score =   363 bits (932),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   299 bits (766),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>gb|AET06143.1| ubiquitin [Papaver somniferum]
Length=229

 Score =   363 bits (932),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   299 bits (765),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>ref|XP_010062974.1| PREDICTED: polyubiquitin [Eucalyptus grandis]
Length=425

 Score =   370 bits (950),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 188/205 (92%), Positives = 192/205 (94%), Gaps = 0/205 (0%)
 Frame = +1

Query  40   DYFRFSILFLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQ  219
            D  +FS L +KMQIFVKTLTGKTITLEVESSDT+DNVKAKIQDKEGIPPDQQRLIFAGKQ
Sbjct  34   DLSKFSSLRVKMQIFVKTLTGKTITLEVESSDTVDNVKAKIQDKEGIPPDQQRLIFAGKQ  93

Query  220  LEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDK  399
            LEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DK
Sbjct  94   LEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  153

Query  400  EGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEG  579
            EGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE 
Sbjct  154  EGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEV  213

Query  580  ESSDTIDNVKAXIQDKXGIPPDXXK  654
            ESSDTIDNVKA IQDK GIPPD  +
Sbjct  214  ESSDTIDNVKAKIQDKEGIPPDQQR  238


 Score =   362 bits (930),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 183/194 (94%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  121  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  180

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  181  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  240

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDT+DNVKA
Sbjct  241  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTVDNVKA  300

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  301  KIQDKEGIPPDQQR  314


 Score =   362 bits (930),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 183/194 (94%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  197  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  256

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDT+DNVKAKI DKEGIPPDQQRLI
Sbjct  257  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTVDNVKAKIQDKEGIPPDQQRLI  316

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  317  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  376

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  377  KIQDKEGIPPDQQR  390


 Score =   298 bits (763),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 149/153 (97%), Positives = 150/153 (98%), Gaps = 0/153 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDT+DNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  273  MQIFVKTLTGKTITLEVESSDTVDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  332

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  333  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  392

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGM  531
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG 
Sbjct  393  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  425



>ref|XP_002438839.1| hypothetical protein SORBIDRAFT_10g027030 [Sorghum bicolor]
 gb|EER90206.1| hypothetical protein SORBIDRAFT_10g027030 [Sorghum bicolor]
Length=229

 Score =   363 bits (932),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   298 bits (762),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 149/152 (98%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGG  528
            FAGKQLEDGRTLADYNIQK+STLHL LRLRGG
Sbjct  197  FAGKQLEDGRTLADYNIQKDSTLHLVLRLRGG  228



>ref|XP_007154494.1| hypothetical protein PHAVU_003G1236001g, partial [Phaseolus vulgaris]
 gb|ESW26488.1| hypothetical protein PHAVU_003G1236001g, partial [Phaseolus vulgaris]
Length=193

 Score =   362 bits (928),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 183/191 (96%), Positives = 184/191 (96%), Gaps = 0/191 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE E+SDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVENSDTIDNVKA  180

Query  613  XIQDKXGIPPD  645
             IQDK GIPPD
Sbjct  181  KIQDKEGIPPD  191


 Score =   229 bits (583),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 115/117 (98%), Positives = 116/117 (99%), Gaps = 0/117 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQ  423
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE+SDTIDNVKAKI DKEGIPPDQQ
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVENSDTIDNVKAKIQDKEGIPPDQQ  193



>ref|XP_006288299.1| hypothetical protein CARUB_v10001544mg [Capsella rubella]
 gb|EOA21197.1| hypothetical protein CARUB_v10001544mg [Capsella rubella]
Length=230

 Score =   363 bits (932),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   299 bits (765),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>ref|XP_006428822.1| hypothetical protein CICLE_v10012652mg [Citrus clementina]
 ref|XP_006480632.1| PREDICTED: polyubiquitin 4-like [Citrus sinensis]
 ref|XP_006480634.1| PREDICTED: polyubiquitin 4-like [Citrus sinensis]
 gb|ESR42062.1| hypothetical protein CICLE_v10012652mg [Citrus clementina]
Length=230

 Score =   363 bits (931),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   297 bits (761),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 149/152 (98%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGG  528
            FAGKQLEDGR LADYNIQKESTLHL LRLRGG
Sbjct  197  FAGKQLEDGRNLADYNIQKESTLHLVLRLRGG  228



>gb|ACJ85618.1| unknown [Medicago truncatula]
Length=229

 Score =   363 bits (931),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   299 bits (765),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>ref|NP_567286.1| ubiquitin 11 [Arabidopsis thaliana]
 ref|NP_849291.1| polyubiquitin 14 [Arabidopsis thaliana]
 ref|NP_001031585.1| ubiquitin 11 [Arabidopsis thaliana]
 ref|NP_567247.2| polyubiquitin 14 [Arabidopsis thaliana]
 ref|NP_001118936.1| ubiquitin 11 [Arabidopsis thaliana]
 ref|XP_002305607.1| hypothetical protein POPTR_0004s02080g [Populus trichocarpa]
 ref|XP_006370636.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 ref|XP_007157173.1| hypothetical protein PHAVU_002G048800g [Phaseolus vulgaris]
 ref|XP_007211604.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 ref|XP_007211605.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 ref|XP_007211608.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 ref|XP_008349294.1| PREDICTED: polyubiquitin 11 [Malus domestica]
 ref|XP_010437606.1| PREDICTED: polyubiquitin 11 isoform X1 [Camelina sativa]
 ref|XP_010437607.1| PREDICTED: polyubiquitin 11 isoform X2 [Camelina sativa]
 ref|XP_010491428.1| PREDICTED: polyubiquitin 11 [Camelina sativa]
 sp|P0CH33.1|UBQ11_ARATH RecName: Full=Polyubiquitin 11; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAD48980.1|AF162444_12 contains similarity to Pfam family PF00240 - Ubiquitin family; 
score=526.5, E=1.9e-154, N=3 [Arabidopsis thaliana]
 emb|CAA10056.1| polyubiquitin [Vicia faba]
 emb|CAB81047.1| AT4g05050 [Arabidopsis thaliana]
 emb|CAC27335.1| putative polyubiquitin [Picea abies]
 gb|AAK96565.1| AT4g05050/T32N4_13 [Arabidopsis thaliana]
 gb|AAL06940.1| AT4g05050/T32N4_13 [Arabidopsis thaliana]
 gb|AAL09770.1| AT4g05050/T32N4_13 [Arabidopsis thaliana]
 gb|AAM19968.1| AT4g05050/T32N4_13 [Arabidopsis thaliana]
 gb|AAN65052.1| Unknown protein [Arabidopsis thaliana]
 gb|AAV92464.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92465.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92466.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92467.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92468.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92469.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92470.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92471.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92472.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92473.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92474.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92475.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92476.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92477.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92478.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92479.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92480.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92481.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92482.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92483.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92484.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92485.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92486.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92487.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92488.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92489.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92490.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 dbj|BAE98552.1| hypothetical protein [Arabidopsis thaliana]
 gb|EEE86118.1| hypothetical protein POPTR_0004s02080g [Populus trichocarpa]
 gb|AEE82244.1| polyubiquitin 14 [Arabidopsis thaliana]
 gb|AEE82245.1| polyubiquitin 14 [Arabidopsis thaliana]
 gb|AEE82468.1| ubiquitin 11 [Arabidopsis thaliana]
 gb|AEE82469.1| ubiquitin 11 [Arabidopsis thaliana]
 gb|AEE82470.1| ubiquitin 11 [Arabidopsis thaliana]
 gb|AFP43343.1| polyubiquitin [Arabidopsis thaliana]
 gb|EMJ12803.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 gb|EMJ12804.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 gb|EMJ12807.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 gb|AGV54265.1| ubiquitin 11 [Phaseolus vulgaris]
 gb|ERP67205.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 gb|ESW29167.1| hypothetical protein PHAVU_002G048800g [Phaseolus vulgaris]
 gb|AES82698.2| polyubiquitin 3 [Medicago truncatula]
 gb|AJA29686.1| polyubiquitin Ubi4 [Betula luminifera]
 gb|KJB67136.1| hypothetical protein B456_010G177000 [Gossypium raimondii]
 gb|KJB69250.1| hypothetical protein B456_011G016600 [Gossypium raimondii]
 gb|KJB69251.1| hypothetical protein B456_011G016600 [Gossypium raimondii]
 gb|KJB69252.1| hypothetical protein B456_011G016600 [Gossypium raimondii]
Length=229

 Score =   363 bits (931),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   299 bits (765),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 150/153 (98%), Gaps = 0/153 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGM  531
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG 
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  229



>ref|XP_006428779.1| hypothetical protein CICLE_v10012654mg [Citrus clementina]
 ref|XP_006594132.1| PREDICTED: polyubiquitin-like [Glycine max]
 gb|ESR42019.1| hypothetical protein CICLE_v10012654mg [Citrus clementina]
 gb|KDO45140.1| hypothetical protein CISIN_1g0269401mg [Citrus sinensis]
 gb|KDO45141.1| hypothetical protein CISIN_1g0269401mg [Citrus sinensis]
 gb|KHN48309.1| Polyubiquitin [Glycine soja]
Length=230

 Score =   363 bits (931),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   299 bits (765),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>ref|XP_007205619.1| hypothetical protein PRUPE_ppa009116mg [Prunus persica]
 gb|EMJ06818.1| hypothetical protein PRUPE_ppa009116mg [Prunus persica]
Length=232

 Score =   363 bits (931),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 183/194 (94%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQ+FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQVFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   291 bits (744),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 146/149 (98%), Positives = 146/149 (98%), Gaps = 0/149 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRL  519
            FAGKQLEDGRTLADYNIQKESTLHL LR 
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRF  225



>ref|XP_006370634.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 gb|ERP67203.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
Length=261

 Score =   364 bits (934),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   340 bits (871),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 172/177 (97%), Positives = 172/177 (97%), Gaps = 0/177 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDN  603
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDN
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDN  253



>ref|XP_003570150.1| PREDICTED: polyubiquitin 11 isoform X2 [Brachypodium distachyon]
Length=241

 Score =   363 bits (932),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   299 bits (765),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>gb|AAP31578.1| ubiquitin [Hevea brasiliensis]
Length=230

 Score =   363 bits (931),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   299 bits (765),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>emb|CAH59739.1| polyubiquitin [Plantago major]
Length=232

 Score =   363 bits (931),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   300 bits (769),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 151/156 (97%), Positives = 152/156 (97%), Gaps = 0/156 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIF  540
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG+  F
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGLTGF  232



>ref|XP_003590494.1| Ubiquitin [Medicago truncatula]
Length=312

 Score =   366 bits (939),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   289 bits (739),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 144/145 (99%), Positives = 144/145 (99%), Gaps = 0/145 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHL  507
            FAGKQLEDGRTLADYNIQKESTLHL
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHL  221



>gb|KDO51955.1| hypothetical protein CISIN_1g026932mg [Citrus sinensis]
 gb|KDO51956.1| hypothetical protein CISIN_1g026932mg [Citrus sinensis]
Length=230

 Score =   362 bits (930),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   298 bits (764),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>gb|AAO43307.1| putative polyubiquitin [Arabidopsis thaliana]
Length=250

 Score =   363 bits (932),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  21   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  80

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  81   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  140

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  141  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  200

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  201  KIQDKEGIPPDQQR  214


 Score =   299 bits (766),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  97   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  156

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  157  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  216

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG
Sbjct  217  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  248


 Score =   254 bits (650),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 128/138 (93%), Positives = 129/138 (93%), Gaps = 0/138 (0%)
 Frame = +1

Query  241  ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQ  420
            ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQ
Sbjct  1    ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ  60

Query  421  QRLIFAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTID  600
            QRLIFAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTID
Sbjct  61   QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTID  120

Query  601  NVKAXIQDKXGIPPDXXK  654
            NVKA IQDK GIPPD  +
Sbjct  121  NVKAKIQDKEGIPPDQQR  138



>emb|CBI22349.3| unnamed protein product [Vitis vinifera]
Length=298

 Score =   365 bits (937),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 185/196 (94%), Positives = 186/196 (95%), Gaps = 0/196 (0%)
 Frame = +1

Query  67   LKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  246
             KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  26   FKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  85

Query  247  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQR  426
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQR
Sbjct  86   YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  145

Query  427  LIFAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNV  606
            LIFAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNV
Sbjct  146  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV  205

Query  607  KAXIQDKXGIPPDXXK  654
            KA IQDK GIPPD  +
Sbjct  206  KAKIQDKEGIPPDQQR  221


 Score =   353 bits (907),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 180/188 (96%), Positives = 181/188 (96%), Gaps = 0/188 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  104  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  163

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  164  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  223

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  224  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  283

Query  613  XIQDKXGI  636
             IQDK G+
Sbjct  284  KIQDKEGM  291



>ref|XP_006287868.1| hypothetical protein CARUB_v10001095mg, partial [Capsella rubella]
 gb|EOA20766.1| hypothetical protein CARUB_v10001095mg, partial [Capsella rubella]
Length=407

 Score =   369 bits (947),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 189/206 (92%), Positives = 192/206 (93%), Gaps = 1/206 (0%)
 Frame = +1

Query  37   CDYFRFSILFLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  216
             + FR +IL  KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  15   SNLFR-TILSFKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  73

Query  217  QLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXD  396
            QLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI D
Sbjct  74   QLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQD  133

Query  397  KEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLE  576
            KEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE
Sbjct  134  KEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE  193

Query  577  GESSDTIDNVKAXIQDKXGIPPDXXK  654
             ESSDTIDNVKA IQDK GIPPD  +
Sbjct  194  VESSDTIDNVKAKIQDKEGIPPDQQR  219


 Score =   363 bits (932),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  102  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  161

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  162  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  221

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  222  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  281

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  282  KIQDKEGIPPDQQR  295


 Score =   363 bits (932),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  178  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  237

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  238  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  297

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  298  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  357

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  358  KIQDKEGIPPDQQR  371


 Score =   299 bits (766),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  254  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  313

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  314  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  373

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG
Sbjct  374  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  405



>emb|CDP08567.1| unnamed protein product [Coffea canephora]
Length=364

 Score =   367 bits (943),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 187/204 (92%), Positives = 188/204 (92%), Gaps = 0/204 (0%)
 Frame = +1

Query  43   YFRFSILFLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQL  222
            Y  F     KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQL
Sbjct  44   YLVFCFSSHKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQL  103

Query  223  EDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKE  402
            EDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKE
Sbjct  104  EDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE  163

Query  403  GIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGE  582
            GIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE E
Sbjct  164  GIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE  223

Query  583  SSDTIDNVKAXIQDKXGIPPDXXK  654
            SSDTIDNVKA IQDK GIPPD  +
Sbjct  224  SSDTIDNVKAKIQDKEGIPPDQQR  247


 Score =   363 bits (933),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  130  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  189

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  190  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  249

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  250  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  309

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  310  KIQDKEGIPPDQQR  323


 Score =   271 bits (694),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 136/137 (99%), Positives = 136/137 (99%), Gaps = 0/137 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  206  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  265

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  266  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  325

Query  433  FAGKQLEDGRTLADYNI  483
            FAGKQLEDGRTLADYNI
Sbjct  326  FAGKQLEDGRTLADYNI  342



>gb|AFK41706.1| unknown [Medicago truncatula]
 gb|AES60745.2| pentameric polyubiquitin [Medicago truncatula]
Length=233

 Score =   362 bits (930),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   298 bits (764),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>ref|XP_002872805.1| hypothetical protein ARALYDRAFT_490270 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49064.1| hypothetical protein ARALYDRAFT_490270 [Arabidopsis lyrata subsp. 
lyrata]
Length=309

 Score =   365 bits (937),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   353 bits (905),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 179/185 (97%), Positives = 179/185 (97%), Gaps = 0/185 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  XIQDK  627
             IQDK
Sbjct  257  KIQDK  261



>ref|XP_003627152.1| Ubiquitin [Medicago truncatula]
 gb|KEH18411.1| polyubiquitin 3 [Medicago truncatula]
Length=270

 Score =   363 bits (933),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   325 bits (833),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 164/168 (98%), Positives = 164/168 (98%), Gaps = 0/168 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLE  576
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE  244


 Score =   134 bits (337),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 76/118 (64%), Positives = 76/118 (64%), Gaps = 41/118 (35%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQK-----------------------------------------ESTLHLVLRLRGGM  303
            IQK                                         ESTLHLVLRLRGG 
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEDGRTLADYNIQKESTLHLVLRLRGGF  270



>gb|KJB62484.1| hypothetical protein B456_009G418900 [Gossypium raimondii]
Length=229

 Score =   362 bits (928),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 183/194 (94%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   299 bits (765),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>gb|AGV54749.1| ubiquitin 11 [Phaseolus vulgaris]
Length=269

 Score =   363 bits (932),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 185/196 (94%), Positives = 186/196 (95%), Gaps = 0/196 (0%)
 Frame = +1

Query  67   LKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  246
             KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  39   FKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  98

Query  247  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQR  426
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQR
Sbjct  99   YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  158

Query  427  LIFAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNV  606
            LIFAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNV
Sbjct  159  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV  218

Query  607  KAXIQDKXGIPPDXXK  654
            KA IQDK GIPPD  +
Sbjct  219  KAKIQDKEGIPPDQQR  234


 Score =   298 bits (762),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 150/153 (98%), Gaps = 0/153 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  117  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  176

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  177  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  236

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGM  531
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG 
Sbjct  237  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  269



>gb|ACJ85643.1| unknown [Medicago truncatula]
Length=229

 Score =   362 bits (928),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 183/194 (94%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQ+KEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQNKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   299 bits (766),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 150/153 (98%), Gaps = 0/153 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGM  531
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG 
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  229



>ref|NP_001147027.1| polyubiquitin containing 7 ubiquitin monomers [Zea mays]
 gb|ACG25128.1| polyubiquitin containing 7 ubiquitin monomers [Zea mays]
Length=311

 Score =   364 bits (935),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 185/195 (95%), Positives = 186/195 (95%), Gaps = 0/195 (0%)
 Frame = +1

Query  70   KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  249
            KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  82   KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  141

Query  250  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRL  429
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRL
Sbjct  142  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  201

Query  430  IFAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVK  609
            IFAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVK
Sbjct  202  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  261

Query  610  AXIQDKXGIPPDXXK  654
            A IQDK GIPPD  +
Sbjct  262  AKIQDKEGIPPDQQR  276


 Score =   307 bits (787),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 165/202 (82%), Positives = 168/202 (83%), Gaps = 10/202 (5%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR L    
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRNLIFSP  60

Query  253  IQKESTLHLVLR--------LRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGI  408
              + +  H             R  MQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGI
Sbjct  61   FARNA--HTARSPISDPRSPRRSKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  118

Query  409  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESS  588
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESS
Sbjct  119  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESS  178

Query  589  DTIDNVKAXIQDKXGIPPDXXK  654
            DTIDNVKA IQDK GIPPD  +
Sbjct  179  DTIDNVKAKIQDKEGIPPDQQR  200


 Score =   299 bits (765),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  159  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  218

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  219  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  278

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG
Sbjct  279  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  310



>ref|XP_007512209.1| polyubiquitin [Bathycoccus prasinos]
 emb|CCO66297.1| polyubiquitin [Bathycoccus prasinos]
Length=359

 Score =   366 bits (939),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  128  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  187

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  188  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  247

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  248  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  307

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  308  KIQDKEGIPPDQQR  321


 Score =   342 bits (877),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 184/245 (75%), Positives = 185/245 (76%), Gaps = 51/245 (21%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEG-------------------------  177
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEG                         
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGTFRVKSRRLKFCLLALLDSATTIES  60

Query  178  --------------------------IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  279
                                      IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  61   SLALRSKKSSERREREKESALSRARGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  120

Query  280  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLIFAGKQLEDG  459
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLIFAGKQLEDG
Sbjct  121  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  180

Query  460  RTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKAXIQDKXGIP  639
            RTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA IQDK GIP
Sbjct  181  RTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  240

Query  640  PDXXK  654
            PD  +
Sbjct  241  PDQQR  245


 Score =   301 bits (771),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  204  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  263

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  264  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  323

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG
Sbjct  324  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  355



>gb|ABY60454.1| putative polyubiquitin [Adonis aestivalis var. palaestina]
Length=281

 Score =   363 bits (932),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  12   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  71

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  72   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  131

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  132  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  191

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  192  KIQDKEGIPPDQQR  205


 Score =   363 bits (932),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  88   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  147

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  148  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  207

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  208  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  267

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  268  KIQDKEGIPPDQQR  281


 Score =   236 bits (602),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 119/129 (92%), Positives = 120/129 (93%), Gaps = 0/129 (0%)
 Frame = +1

Query  268  TLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLIFAGKQ  447
            TLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLIFAGKQ
Sbjct  1    TLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQ  60

Query  448  LEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKAXIQDK  627
            LEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA IQDK
Sbjct  61   LEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  120

Query  628  XGIPPDXXK  654
             GIPPD  +
Sbjct  121  EGIPPDQQR  129



>ref|XP_008784557.1| PREDICTED: LOW QUALITY PROTEIN: polyubiquitin 11-like [Phoenix 
dactylifera]
Length=229

 Score =   361 bits (927),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 183/194 (94%), Positives = 184/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLV RLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVXRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   299 bits (766),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>gb|AFK43392.1| unknown [Medicago truncatula]
Length=233

 Score =   361 bits (927),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 183/194 (94%), Positives = 184/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDN KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNAKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   299 bits (765),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>ref|XP_003619702.1| Ubiquitin-like protein [Medicago truncatula]
Length=245

 Score =   362 bits (928),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 183/191 (96%), Positives = 183/191 (96%), Gaps = 0/191 (0%)
 Frame = +1

Query  67   LKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  246
             KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  50   FKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  109

Query  247  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQR  426
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQR
Sbjct  110  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  169

Query  427  LIFAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNV  606
            LIFAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNV
Sbjct  170  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV  229

Query  607  KAXIQDKXGIP  639
            KA IQDK GIP
Sbjct  230  KAKIQDKEGIP  240


 Score =   215 bits (547),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 108/118 (92%), Positives = 109/118 (92%), Gaps = 0/118 (0%)
 Frame = +1

Query  301  MQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLIFAGKQLEDGRTLADYN  480
            MQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  52   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  111

Query  481  IQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKAXIQDKXGIPPDXXK  654
            IQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA IQDK GIPPD  +
Sbjct  112  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  169



>ref|XP_003574865.1| PREDICTED: polyubiquitin-like [Brachypodium distachyon]
Length=341

 Score =   365 bits (936),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 185/195 (95%), Positives = 186/195 (95%), Gaps = 0/195 (0%)
 Frame = +1

Query  70   KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  249
            KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  36   KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  95

Query  250  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRL  429
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRL
Sbjct  96   NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  155

Query  430  IFAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVK  609
            IFAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVK
Sbjct  156  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  215

Query  610  AXIQDKXGIPPDXXK  654
            A IQDK GIPPD  +
Sbjct  216  AKIQDKEGIPPDQQR  230


 Score =   363 bits (932),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  113  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  172

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  173  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  232

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  233  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  292

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  293  KIQDKEGIPPDQQR  306


 Score =   299 bits (766),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  189  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  248

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  249  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  308

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG
Sbjct  309  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  340



>ref|XP_009114489.1| PREDICTED: polyubiquitin-like [Brassica rapa]
Length=305

 Score =   363 bits (933),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  257  KIQDKEGIPPDQQR  270


 Score =   360 bits (924),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 183/194 (94%), Positives = 184/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP DQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPQDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   299 bits (766),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 150/153 (98%), Gaps = 0/153 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGM  531
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG 
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  305



>gb|ACJ85658.1| unknown [Medicago truncatula]
Length=228

 Score =   360 bits (925),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 181/194 (93%), Positives = 183/194 (94%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTI LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTIILEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KI DKEGIPPDQQRL+
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLV  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKALTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   254 bits (648),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 131/145 (90%), Positives = 133/145 (92%), Gaps = 1/145 (1%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRL+FAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLVFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVK LTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKALTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHL  507
            FAG  L  G  L+   IQKESTLHL
Sbjct  197  FAGNNLRMG-GLSLIYIQKESTLHL  220


 Score =   110 bits (274),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 59/70 (84%), Positives = 60/70 (86%), Gaps = 1/70 (1%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVK LTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  L  G  L+   
Sbjct  153  MQIFVKALTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGNNLRMG-GLSLIY  211

Query  253  IQKESTLHLV  282
            IQKESTLHLV
Sbjct  212  IQKESTLHLV  221



>emb|CAA40323.1| polyubiquitin protein [Helianthus annuus]
Length=334

 Score =   364 bits (935),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   364 bits (935),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  257  KIQDKEGIPPDQQR  270


 Score =   347 bits (889),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 176/182 (97%), Positives = 176/182 (97%), Gaps = 0/182 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  613  XI  618
             I
Sbjct  333  KI  334



>gb|AES89865.2| polyubiquitin 3 [Medicago truncatula]
Length=278

 Score =   362 bits (930),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   327 bits (837),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 165/171 (96%), Positives = 166/171 (97%), Gaps = 0/171 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGES  585
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLEG +
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGNN  247



>ref|XP_006377830.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 gb|ERP55627.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
Length=297

 Score =   363 bits (932),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   363 bits (932),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  257  KIQDKEGIPPDQQR  270


 Score =   277 bits (709),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 139/142 (98%), Positives = 140/142 (99%), Gaps = 0/142 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKEST  498
            FAGKQLEDGRTLADYNIQKE+ 
Sbjct  273  FAGKQLEDGRTLADYNIQKENA  294



>prf||1604470A poly-ubiquitin
Length=272

 Score =   362 bits (929),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  44   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  103

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  104  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  163

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  164  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  223

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  224  KIQDKEGIPPDQQR  237


 Score =   299 bits (766),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 150/160 (94%), Positives = 151/160 (94%), Gaps = 0/160 (0%)
 Frame = +1

Query  175  GIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE  354
            GIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE
Sbjct  2    GIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE  61

Query  355  SSDTIDNVKAKIXDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQ  534
            SSDTIDNVKAKI DKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQ
Sbjct  62   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQ  121

Query  535  IFVKXLXGKTITLEGESSDTIDNVKAXIQDKXGIPPDXXK  654
            IFVK L GKTITLE ESSDTIDNVKA IQDK GIPPD  +
Sbjct  122  IFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  161


 Score =   298 bits (763),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  120  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  179

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  180  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  239

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG
Sbjct  240  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  271



>gb|AAQ84316.1| fiber polyubiquitin [Gossypium barbadense]
Length=229

 Score =   360 bits (925),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 183/194 (94%), Positives = 184/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   294 bits (752),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 149/153 (97%), Positives = 149/153 (97%), Gaps = 0/153 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGM  531
            FAGKQLEDGRTLADYNIQKESTL L LRLRGG 
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLPLVLRLRGGF  229



>ref|XP_007014924.1| Polyubiquitin 3 [Theobroma cacao]
 gb|EOY32543.1| Polyubiquitin 3 [Theobroma cacao]
Length=305

 Score =   363 bits (932),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   363 bits (932),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  257  KIQDKEGIPPDQQR  270


 Score =   299 bits (766),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>gb|EYU33609.1| hypothetical protein MIMGU_mgv1a004315mg [Erythranthe guttata]
 gb|EYU33612.1| hypothetical protein MIMGU_mgv1a004315mg [Erythranthe guttata]
Length=305

 Score =   363 bits (932),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   363 bits (932),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  257  KIQDKEGIPPDQQR  270


 Score =   300 bits (767),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGM  531
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG+
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGV  305



>emb|CAH59740.1| polyubiquitin [Plantago major]
Length=305

 Score =   363 bits (932),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   363 bits (932),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  257  KIQDKEGIPPDQQR  270


 Score =   299 bits (766),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>ref|XP_007154495.1| hypothetical protein PHAVU_003G1236001g, partial [Phaseolus vulgaris]
 gb|ESW26489.1| hypothetical protein PHAVU_003G1236001g, partial [Phaseolus vulgaris]
Length=269

 Score =   362 bits (928),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 183/194 (94%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE E+SDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVENSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   362 bits (928),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 183/191 (96%), Positives = 184/191 (96%), Gaps = 0/191 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE+SDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVENSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  XIQDKXGIPPD  645
             IQDK GIPPD
Sbjct  257  KIQDKEGIPPD  267


 Score =   229 bits (583),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 115/117 (98%), Positives = 116/117 (99%), Gaps = 0/117 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVE+SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVENSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQ  423
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQ
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ  269



>gb|AAO43308.1| putative polyubiquitin [Arabidopsis thaliana]
Length=250

 Score =   361 bits (926),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 183/194 (94%), Positives = 184/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  21   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  80

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKE IPPDQQRLI
Sbjct  81   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEWIPPDQQRLI  140

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  141  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  200

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  201  KIQDKEGIPPDQQR  214


 Score =   293 bits (750),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 148/152 (97%), Positives = 148/152 (97%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  97   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEWIPPDQQRLIFAGKQLEDGRTLADYN  156

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  157  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  216

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGG  528
            FAGKQLEDGRTLA YNIQKESTLHL LRLRGG
Sbjct  217  FAGKQLEDGRTLAVYNIQKESTLHLVLRLRGG  248


 Score =   252 bits (644),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 127/138 (92%), Positives = 128/138 (93%), Gaps = 0/138 (0%)
 Frame = +1

Query  241  ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQ  420
            ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQ
Sbjct  1    ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ  60

Query  421  QRLIFAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTID  600
            QRLIFAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTID
Sbjct  61   QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTID  120

Query  601  NVKAXIQDKXGIPPDXXK  654
            NVKA IQDK  IPPD  +
Sbjct  121  NVKAKIQDKEWIPPDQQR  138



>gb|KIM78989.1| hypothetical protein PILCRDRAFT_573034 [Piloderma croceum F 1598]
Length=229

 Score =   360 bits (924),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 182/194 (94%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTL+DYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   296 bits (758),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 148/152 (97%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGG  528
            FAGKQLEDGRTL+DYNIQKESTLHL LRLRGG
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  228



>ref|XP_011468094.1| PREDICTED: polyubiquitin [Fragaria vesca subsp. vesca]
Length=306

 Score =   363 bits (932),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  257  KIQDKEGIPPDQQR  270


 Score =   363 bits (931),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 183/194 (94%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDT+DNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTVDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   299 bits (766),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>ref|XP_006428820.1| hypothetical protein CICLE_v10012290mg [Citrus clementina]
 gb|ESR42060.1| hypothetical protein CICLE_v10012290mg [Citrus clementina]
Length=306

 Score =   363 bits (932),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  257  KIQDKEGIPPDQQR  270


 Score =   360 bits (925),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 183/194 (94%), Positives = 184/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQ KEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQHKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   299 bits (765),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>gb|KIM78981.1| hypothetical protein PILCRDRAFT_10644 [Piloderma croceum F 1598]
Length=229

 Score =   360 bits (924),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 182/194 (94%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTL+DYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   296 bits (759),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 148/153 (97%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGM  531
            FAGKQLEDGRTL+DYNIQKESTLHL LRLRGG+
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGV  229



>gb|AIS71924.1| polyubiquitin [Mangifera indica]
Length=229

 Score =   360 bits (924),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 183/194 (94%), Positives = 184/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLH VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHRVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   258 bits (659),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 130/131 (99%), Positives = 130/131 (99%), Gaps = 0/131 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRT  465
            FAGKQLEDGRT
Sbjct  197  FAGKQLEDGRT  207



>gb|EJU04700.1| polyubiquitin UbiD/Ubi4 [Dacryopinax sp. DJM-731 SS1]
Length=229

 Score =   360 bits (924),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 182/194 (94%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTL+DYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   296 bits (758),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 148/152 (97%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGG  528
            FAGKQLEDGRTL+DYNIQKESTLHL LRLRGG
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  228



>gb|KJB81823.1| hypothetical protein B456_013G163500 [Gossypium raimondii]
Length=305

 Score =   363 bits (932),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  257  KIQDKEGIPPDQQR  270


 Score =   361 bits (927),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 183/194 (94%), Positives = 184/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   299 bits (766),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 150/153 (98%), Gaps = 0/153 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGM  531
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG 
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  305



>gb|KJA26171.1| hypothetical protein HYPSUDRAFT_354705 [Hypholoma sublateritium 
FD-334 SS-4]
Length=229

 Score =   360 bits (924),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 182/194 (94%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTL+DYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   296 bits (758),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 148/152 (97%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGG  528
            FAGKQLEDGRTL+DYNIQKESTLHL LRLRGG
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  228



>ref|XP_006396611.1| hypothetical protein EUTSA_v10028730mg [Eutrema salsugineum]
 gb|AAL27563.1|AF429429_1 polyubiquitin OUB1 [Olea europaea]
 gb|ESQ38064.1| hypothetical protein EUTSA_v10028730mg [Eutrema salsugineum]
Length=305

 Score =   363 bits (932),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   363 bits (932),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  257  KIQDKEGIPPDQQR  270


 Score =   300 bits (768),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGM  531
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG+
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGL  305



>gb|AAM64530.1| ubiquitin homolog [Arabidopsis thaliana]
Length=229

 Score =   360 bits (924),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 183/194 (94%), Positives = 184/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVL LRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLXLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   299 bits (765),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 150/153 (98%), Gaps = 0/153 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGM  531
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG 
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  229



>gb|AAK68824.1| Unknown protein [Arabidopsis thaliana]
Length=229

 Score =   360 bits (924),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKPLPGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   293 bits (749),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 148/153 (97%), Positives = 148/153 (97%), Gaps = 0/153 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVK L GKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKPLPGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGM  531
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG 
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  229



>ref|XP_011110054.1| hypothetical protein H072_4094 [Dactylellina haptotyla CBS 200.50]
 gb|EPS41950.1| hypothetical protein H072_4094 [Dactylellina haptotyla CBS 200.50]
Length=229

 Score =   360 bits (924),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 182/194 (94%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTL+DYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   296 bits (758),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 148/152 (97%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGG  528
            FAGKQLEDGRTL+DYNIQKESTLHL LRLRGG
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  228



>ref|XP_007211606.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 gb|EMJ12805.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
Length=309

 Score =   363 bits (932),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   363 bits (932),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  257  KIQDKEGIPPDQQR  270


 Score =   296 bits (759),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 149/151 (99%), Positives = 149/151 (99%), Gaps = 0/151 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRG  525
            FAGKQLEDGRTLADYNIQKESTLHL LRLRG
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRG  303



>ref|XP_002456845.1| hypothetical protein SORBIDRAFT_03g043940 [Sorghum bicolor]
 ref|XP_002453347.1| hypothetical protein SORBIDRAFT_04g004280 [Sorghum bicolor]
 ref|XP_003574869.1| PREDICTED: polyubiquitin [Brachypodium distachyon]
 ref|XP_007695807.1| hypothetical protein COCSADRAFT_108224 [Bipolaris sorokiniana 
ND90Pr]
 ref|XP_009412665.1| PREDICTED: polyubiquitin isoform X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009412666.1| PREDICTED: polyubiquitin isoform X2 [Musa acuminata subsp. malaccensis]
 ref|XP_010227192.1| PREDICTED: polyubiquitin isoform X2 [Brachypodium distachyon]
 sp|P69309.2|UBIQP_AVEFA RecName: Full=Polyubiquitin; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor [Avena fatua]
 pir||S28426 polyubiquitin 4 - wild oat
 emb|CAA49200.1| tetraubiquitin [Avena fatua]
 gb|AAC37466.1| polyubiquitin [Saccharum hybrid cultivar H65-7052]
 gb|AAM28291.1| tetrameric ubiquitin [Ananas comosus]
 gb|EES01965.1| hypothetical protein SORBIDRAFT_03g043940 [Sorghum bicolor]
 gb|EES06323.1| hypothetical protein SORBIDRAFT_04g004280 [Sorghum bicolor]
 gb|AEE65379.1| ubiquitin 1 [Panicum virgatum]
 gb|EMD68114.1| hypothetical protein COCSADRAFT_108224 [Bipolaris sorokiniana 
ND90Pr]
 gb|EMD93446.1| hypothetical protein COCHEDRAFT_1202381 [Bipolaris maydis C5]
 gb|EMS58836.1| Polyubiquitin [Triticum urartu]
 gb|ENI07106.1| hypothetical protein COCC4DRAFT_70576 [Bipolaris maydis ATCC 
48331]
 gb|AGT16802.1| polyubiquitin-like protein [Saccharum hybrid cultivar R570]
 gb|EUN28034.1| hypothetical protein COCVIDRAFT_96666 [Bipolaris victoriae FI3]
Length=305

 Score =   363 bits (932),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   363 bits (932),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  257  KIQDKEGIPPDQQR  270


 Score =   299 bits (765),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>ref|NP_849292.1| polyubiquitin 14 [Arabidopsis thaliana]
 ref|NP_001118922.1| polyubiquitin 14 [Arabidopsis thaliana]
 ref|NP_974516.4| polyubiquitin 10 [Arabidopsis thaliana]
 ref|XP_002316978.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 ref|XP_002874829.1| hypothetical protein ARALYDRAFT_490155 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_004146845.1| PREDICTED: polyubiquitin-like [Cucumis sativus]
 ref|XP_004165599.1| PREDICTED: polyubiquitin-like [Cucumis sativus]
 ref|XP_004293260.1| PREDICTED: polyubiquitin [Fragaria vesca subsp. vesca]
 ref|XP_006383941.1| hypothetical protein POPTR_0004s02080g [Populus trichocarpa]
 ref|XP_006377831.1| polyubiquitin family protein [Populus trichocarpa]
 ref|XP_006377832.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 ref|XP_006377833.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 ref|XP_006372945.1| hypothetical protein POPTR_0017s06450g [Populus trichocarpa]
 ref|XP_006396614.1| hypothetical protein EUTSA_v10028728mg [Eutrema salsugineum]
 ref|XP_006396615.1| hypothetical protein EUTSA_v10028728mg [Eutrema salsugineum]
 ref|XP_006589609.1| PREDICTED: polyubiquitin [Glycine max]
 ref|XP_006593990.1| PREDICTED: polyubiquitin 10-like isoform X2 [Glycine max]
 ref|XP_006606032.1| PREDICTED: polyubiquitin [Glycine max]
 ref|XP_007211603.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 ref|XP_008454542.1| PREDICTED: polyubiquitin [Cucumis melo]
 ref|XP_009134330.1| PREDICTED: polyubiquitin [Brassica rapa]
 ref|XP_010422419.1| PREDICTED: polyubiquitin [Camelina sativa]
 ref|XP_011007895.1| PREDICTED: polyubiquitin [Populus euphratica]
 ref|XP_011010177.1| PREDICTED: polyubiquitin [Populus euphratica]
 sp|P69325.2|UBIQP_SOYBN RecName: Full=Polyubiquitin; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor [Glycine max]
 sp|Q3E7T8.2|UBQ14_ARATH RecName: Full=Polyubiquitin 14; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor [Arabidopsis thaliana]
 pir||S49332 polyubiquitin 4 - common sunflower
 pir||G85036 polyubiquitin [imported] - Arabidopsis thaliana
 dbj|BAA03764.1| ubiquitin [Glycine max]
 dbj|BAA05670.1| ubiquitin [Glycine max]
 emb|CAA84440.1| seed tetraubiquitin [Helianthus annuus]
 dbj|BAA05085.1| Ubiquitin [Glycine max]
 gb|AAD15340.1| putative polyubiquitin [Arabidopsis thaliana]
 emb|CAB77774.1| polyubiquitin [Arabidopsis thaliana]
 gb|AAM65295.1| polyubiquitin (UBQ14) [Arabidopsis thaliana]
 emb|CAH59738.1| polyubiquitin [Plantago major]
 dbj|BAH19554.1| AT4G02890 [Arabidopsis thaliana]
 gb|EEE97590.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 gb|EFH51088.1| hypothetical protein ARALYDRAFT_490155 [Arabidopsis lyrata subsp. 
lyrata]
 gb|AEE82246.1| polyubiquitin 14 [Arabidopsis thaliana]
 gb|AEE82247.1| polyubiquitin 14 [Arabidopsis thaliana]
 gb|AEE82503.1| polyubiquitin 10 [Arabidopsis thaliana]
 gb|AFP43341.1| polyubiquitin [Arabidopsis thaliana]
 gb|EMJ12802.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 gb|ERP50742.1| hypothetical protein POPTR_0017s06450g [Populus trichocarpa]
 gb|ERP55628.1| polyubiquitin family protein [Populus trichocarpa]
 gb|ERP55629.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 gb|ERP55630.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 gb|ERP61738.1| hypothetical protein POPTR_0004s02080g [Populus trichocarpa]
 gb|ESQ38067.1| hypothetical protein EUTSA_v10028728mg [Eutrema salsugineum]
 gb|ESQ38068.1| hypothetical protein EUTSA_v10028728mg [Eutrema salsugineum]
 dbj|BAO57270.1| ubiquitin 10 [Ipomoea nil]
 gb|KHN02680.1| Polyubiquitin [Glycine soja]
 gb|KHN15806.1| Polyubiquitin [Glycine soja]
 gb|KJB13594.1| hypothetical protein B456_002G083100 [Gossypium raimondii]
 gb|KJB69249.1| hypothetical protein B456_011G016600 [Gossypium raimondii]
 prf||2111434A tetraubiquitin
Length=305

 Score =   363 bits (932),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   363 bits (932),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  257  KIQDKEGIPPDQQR  270


 Score =   299 bits (765),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 150/153 (98%), Gaps = 0/153 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGM  531
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG 
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  305



>dbj|BAJ85978.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ91581.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=305

 Score =   363 bits (932),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  257  KIQDKEGIPPDQQR  270


 Score =   362 bits (928),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 183/194 (94%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   299 bits (765),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>gb|AES89866.2| polyubiquitin 3 [Medicago truncatula]
Length=305

 Score =   363 bits (931),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   363 bits (931),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  257  KIQDKEGIPPDQQR  270


 Score =   299 bits (765),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>gb|ABK94002.1| unknown [Populus trichocarpa]
Length=305

 Score =   363 bits (931),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  257  KIQDKEGIPPDQQR  270


 Score =   359 bits (922),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 183/194 (94%), Positives = 184/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD N
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADNN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   299 bits (765),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 150/153 (98%), Gaps = 0/153 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGM  531
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG 
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  305



>ref|XP_006428821.1| hypothetical protein CICLE_v10012292mg [Citrus clementina]
 ref|XP_006480633.1| PREDICTED: polyubiquitin-like [Citrus sinensis]
 gb|ESR42061.1| hypothetical protein CICLE_v10012292mg [Citrus clementina]
Length=306

 Score =   363 bits (932),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   363 bits (932),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  257  KIQDKEGIPPDQQR  270


 Score =   299 bits (765),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>gb|ACA58351.1| ubiquitin-like protein [Sandersonia aurantiaca]
Length=189

 Score =   358 bits (920),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 182/189 (96%), Positives = 182/189 (96%), Gaps = 0/189 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIP  639
             IQDK GIP
Sbjct  181  KIQDKEGIP  189


 Score =   214 bits (544),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 108/118 (92%), Positives = 109/118 (92%), Gaps = 0/118 (0%)
 Frame = +1

Query  301  MQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLIFAGKQLEDGRTLADYN  480
            MQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  481  IQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKAXIQDKXGIPPDXXK  654
            IQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA IQDK GIPPD  +
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  118



>ref|XP_002873083.1| hypothetical protein ARALYDRAFT_487095 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49342.1| hypothetical protein ARALYDRAFT_487095 [Arabidopsis lyrata subsp. 
lyrata]
Length=306

 Score =   363 bits (931),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  257  KIQDKEGIPPDQQR  270


 Score =   361 bits (926),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 183/194 (94%), Positives = 184/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLTDYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   299 bits (765),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>gb|KDP39203.1| hypothetical protein JCGZ_00960 [Jatropha curcas]
Length=317

 Score =   363 bits (933),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   363 bits (933),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  257  KIQDKEGIPPDQQR  270


 Score =   306 bits (783),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 153/156 (98%), Positives = 153/156 (98%), Gaps = 0/156 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIF  540
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQI 
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIL  308



>emb|CDR41572.1| RHTO0S06e03070g1_1 [Rhodosporidium toruloides]
Length=230

 Score =   360 bits (924),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 181/194 (93%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTL+DYN+QKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLSDYNVQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   295 bits (755),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 147/152 (97%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            +QKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  VQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGG  528
            FAGKQLEDGRTL DYNIQKESTLHL LRLRGG
Sbjct  197  FAGKQLEDGRTLQDYNIQKESTLHLVLRLRGG  228



>ref|XP_006654612.1| PREDICTED: polyubiquitin-like [Oryza brachyantha]
Length=305

 Score =   363 bits (931),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   363 bits (931),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  257  KIQDKEGIPPDQQR  270


 Score =   297 bits (761),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 149/152 (98%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGG  528
            FAGKQL+DGRTLADYNIQKESTLHL LRLRGG
Sbjct  273  FAGKQLDDGRTLADYNIQKESTLHLVLRLRGG  304



>ref|NP_851029.1| polyubiquitin 3 [Arabidopsis thaliana]
 ref|NP_568112.2| polyubiquitin 3 [Arabidopsis thaliana]
 ref|NP_001031824.1| polyubiquitin 3 [Arabidopsis thaliana]
 ref|XP_006288303.1| hypothetical protein CARUB_v10001548mg [Capsella rubella]
 ref|XP_009122723.1| PREDICTED: polyubiquitin 3 [Brassica rapa]
 sp|Q1EC66.1|UBQ3_ARATH RecName: Full=Polyubiquitin 3; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor [Arabidopsis thaliana]
 emb|CAB86091.1| polyubiquitin (ubq3) [Arabidopsis thaliana]
 dbj|BAB08384.1| polyubiquitin [Arabidopsis thaliana]
 gb|AAO00780.1| polyubiquitin (UBQ3) [Arabidopsis thaliana]
 gb|ABF85770.1| At5g03240 [Arabidopsis thaliana]
 dbj|BAH19791.1| AT5G03240 [Arabidopsis thaliana]
 gb|AED90574.1| polyubiquitin 3 [Arabidopsis thaliana]
 gb|AED90575.1| polyubiquitin 3 [Arabidopsis thaliana]
 gb|AED90576.1| polyubiquitin 3 [Arabidopsis thaliana]
 gb|EOA21201.1| hypothetical protein CARUB_v10001548mg [Capsella rubella]
Length=306

 Score =   363 bits (931),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   363 bits (931),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  257  KIQDKEGIPPDQQR  270


 Score =   299 bits (765),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>gb|EPS72031.1| polyubiquitin, partial [Genlisea aurea]
Length=274

 Score =   362 bits (928),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  46   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  105

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  106  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  165

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  166  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  225

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  226  KIQDKEGIPPDQQR  239


 Score =   305 bits (780),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 153/163 (94%), Positives = 154/163 (94%), Gaps = 0/163 (0%)
 Frame = +1

Query  166  DKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITL  345
            DKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITL
Sbjct  1    DKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITL  60

Query  346  EVESSDTIDNVKAKIXDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLXLRLRG  525
            EVESSDTIDNVKAKI DKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL LRLRG
Sbjct  61   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  120

Query  526  GMQIFVKXLXGKTITLEGESSDTIDNVKAXIQDKXGIPPDXXK  654
            GMQIFVK L GKTITLE ESSDTIDNVKA IQDK GIPPD  +
Sbjct  121  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  163


 Score =   298 bits (762),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 150/153 (98%), Gaps = 0/153 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  122  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  181

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  182  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  241

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGM  531
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG 
Sbjct  242  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  274



>ref|XP_006480631.1| PREDICTED: polyubiquitin-like [Citrus sinensis]
Length=306

 Score =   363 bits (931),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   363 bits (931),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  257  KIQDKEGIPPDQQR  270


 Score =   299 bits (765),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>ref|XP_006302387.1| hypothetical protein CARUB_v10020456mg [Capsella rubella]
 gb|EOA35285.1| hypothetical protein CARUB_v10020456mg [Capsella rubella]
Length=307

 Score =   363 bits (931),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   363 bits (931),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  257  KIQDKEGIPPDQQR  270


 Score =   299 bits (765),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>gb|AHC00631.1| polyubiquitin [Ganoderma lucidum]
Length=319

 Score =   363 bits (932),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 184/200 (92%), Positives = 188/200 (94%), Gaps = 0/200 (0%)
 Frame = +1

Query  55   SILFLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  234
            S+L   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  9    SLLAYSMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  68

Query  235  TLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPP  414
            TL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPP
Sbjct  69   TLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  128

Query  415  DQQRLIFAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDT  594
            DQQRLIFAGKQLEDGRTL+DYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDT
Sbjct  129  DQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDT  188

Query  595  IDNVKAXIQDKXGIPPDXXK  654
            IDNVKA IQDK GIPPD  +
Sbjct  189  IDNVKAKIQDKEGIPPDQQR  208


 Score =   361 bits (926),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 182/194 (94%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  91   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  150

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  151  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  210

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTL+DYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  211  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  270

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  271  KIQDKEGIPPDQQR  284


 Score =   297 bits (761),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 148/153 (97%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  167  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  226

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  227  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  286

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGM  531
            FAGKQLEDGRTL+DYNIQKESTLHL LRLRGG+
Sbjct  287  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGL  319



>ref|XP_011077812.1| PREDICTED: polyubiquitin 3 [Sesamum indicum]
 ref|XP_011077813.1| PREDICTED: polyubiquitin 3 [Sesamum indicum]
Length=334

 Score =   364 bits (934),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  29   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  88

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  89   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  148

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  149  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  208

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  209  KIQDKEGIPPDQQR  222


 Score =   364 bits (934),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  105  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  164

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  165  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  224

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  225  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  284

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  285  KIQDKEGIPPDQQR  298


 Score =   300 bits (767),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  181  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  240

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  241  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  300

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG
Sbjct  301  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  332


 Score =   243 bits (621),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 123/133 (92%), Positives = 124/133 (93%), Gaps = 0/133 (0%)
 Frame = +1

Query  256  QKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLIF  435
            QKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLIF
Sbjct  14   QKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF  73

Query  436  AGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKAX  615
            AGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA 
Sbjct  74   AGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAK  133

Query  616  IQDKXGIPPDXXK  654
            IQDK GIPPD  +
Sbjct  134  IQDKEGIPPDQQR  146



>ref|XP_009112898.1| PREDICTED: polyubiquitin [Brassica rapa]
Length=305

 Score =   363 bits (931),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   363 bits (931),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  257  KIQDKEGIPPDQQR  270


 Score =   299 bits (766),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGM  531
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG+
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGI  305



>ref|XP_003537278.1| PREDICTED: polyubiquitin-like [Glycine max]
 ref|XP_010454744.1| PREDICTED: polyubiquitin 3 [Camelina sativa]
 gb|KHN39094.1| Polyubiquitin [Glycine soja]
Length=306

 Score =   363 bits (931),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   363 bits (931),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  257  KIQDKEGIPPDQQR  270


 Score =   299 bits (765),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>ref|XP_010258950.1| PREDICTED: polyubiquitin [Nelumbo nucifera]
Length=306

 Score =   363 bits (931),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   363 bits (931),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  257  KIQDKEGIPPDQQR  270


 Score =   299 bits (766),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGM  531
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG+
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGI  305



>ref|XP_006428925.1| hypothetical protein CICLE_v10012291mg [Citrus clementina]
 gb|ESR42165.1| hypothetical protein CICLE_v10012291mg [Citrus clementina]
Length=306

 Score =   363 bits (931),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   363 bits (931),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  257  KIQDKEGIPPDQQR  270


 Score =   299 bits (765),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>gb|KIK28767.1| hypothetical protein PISMIDRAFT_672939, partial [Pisolithus microcarpus 
441]
Length=247

 Score =   360 bits (925),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 182/194 (94%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  19   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  78

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  79   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  138

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTL+DYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  139  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  198

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  199  KIQDKEGIPPDQQR  212


 Score =   297 bits (761),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 148/153 (97%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  95   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  154

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  155  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  214

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGM  531
            FAGKQLEDGRTL+DYNIQKESTLHL LRLRGG+
Sbjct  215  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGL  247


 Score =   249 bits (636),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 125/136 (92%), Positives = 127/136 (93%), Gaps = 0/136 (0%)
 Frame = +1

Query  247  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQR  426
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQR
Sbjct  1    YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  60

Query  427  LIFAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNV  606
            LIFAGKQLEDGRTL+DYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNV
Sbjct  61   LIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV  120

Query  607  KAXIQDKXGIPPDXXK  654
            KA IQDK GIPPD  +
Sbjct  121  KAKIQDKEGIPPDQQR  136



>gb|AFW66439.1| putative ubiquitin family protein [Zea mays]
Length=297

 Score =   362 bits (930),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   342 bits (877),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 177/194 (91%), Positives = 178/194 (92%), Gaps = 8/194 (4%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSD       
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD-------  249

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  250  -IQDKEGIPPDQQR  262


 Score =   276 bits (706),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 142/152 (93%), Positives = 142/152 (93%), Gaps = 8/152 (5%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD        I DKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD--------IQDKEGIPPDQQRLI  264

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG
Sbjct  265  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  296



>gb|ABD96088.1| polyubiquitin [Malus domestica]
Length=270

 Score =   361 bits (927),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  42   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  101

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  102  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  161

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  162  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  221

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  222  KIQDKEGIPPDQQR  235


 Score =   298 bits (762),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 150/153 (98%), Gaps = 0/153 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  118  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  177

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  178  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  237

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGM  531
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG 
Sbjct  238  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  270


 Score =   296 bits (759),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 149/159 (94%), Positives = 150/159 (94%), Gaps = 0/159 (0%)
 Frame = +1

Query  178  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  357
            IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES
Sbjct  1    IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  60

Query  358  SDTIDNVKAKIXDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQI  537
            SDTIDNVKAKI DKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQI
Sbjct  61   SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  120

Query  538  FVKXLXGKTITLEGESSDTIDNVKAXIQDKXGIPPDXXK  654
            FVK L GKTITLE ESSDTIDNVKA IQDK GIPPD  +
Sbjct  121  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  159



>gb|AFY06654.1| polyubiquitin, partial [Carica papaya]
Length=264

 Score =   361 bits (927),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 183/194 (94%), Positives = 184/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  36   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  95

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KI DKEGIPPDQQRLI
Sbjct  96   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  155

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  156  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  215

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  216  KIQDKEGIPPDQQR  229


 Score =   297 bits (761),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 149/153 (97%), Positives = 149/153 (97%), Gaps = 0/153 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  112  MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  171

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  172  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  231

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGM  531
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG 
Sbjct  232  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  264


 Score =   231 bits (589),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 129/142 (91%), Positives = 130/142 (92%), Gaps = 0/142 (0%)
 Frame = +1

Query  229  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGI  408
            G TLADYNIQKESTL LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGI
Sbjct  12   GGTLADYNIQKESTLLLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  71

Query  409  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESS  588
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESS
Sbjct  72   PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESS  131

Query  589  DTIDNVKAXIQDKXGIPPDXXK  654
            DTIDNVK  IQDK GIPPD  +
Sbjct  132  DTIDNVKTKIQDKEGIPPDQQR  153



>ref|XP_007205620.1| hypothetical protein PRUPE_ppa009116mg [Prunus persica]
 ref|XP_007205621.1| hypothetical protein PRUPE_ppa009116mg [Prunus persica]
 gb|EMJ06819.1| hypothetical protein PRUPE_ppa009116mg [Prunus persica]
 gb|EMJ06820.1| hypothetical protein PRUPE_ppa009116mg [Prunus persica]
Length=306

 Score =   363 bits (931),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  257  KIQDKEGIPPDQQR  270


 Score =   362 bits (929),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 183/194 (94%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQ+FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQVFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   299 bits (765),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>emb|CAA48140.1| ubiquitin [Antirrhinum majus]
Length=296

 Score =   362 bits (930),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  68   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  127

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  128  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  187

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  188  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  247

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  248  KIQDKEGIPPDQQR  261


 Score =   345 bits (886),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 175/185 (95%), Positives = 176/185 (95%), Gaps = 0/185 (0%)
 Frame = +1

Query  100  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  279
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  1    GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  60

Query  280  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLIFAGKQLEDG  459
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLIFAGKQLEDG
Sbjct  61   VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  120

Query  460  RTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKAXIQDKXGIP  639
            RTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA IQDK GIP
Sbjct  121  RTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  180

Query  640  PDXXK  654
            PD  +
Sbjct  181  PDQQR  185


 Score =   298 bits (764),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 150/153 (98%), Gaps = 0/153 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  144  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  203

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  204  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  263

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGM  531
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG 
Sbjct  264  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  296



>emb|CDP08569.1| unnamed protein product [Coffea canephora]
Length=306

 Score =   363 bits (931),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  257  KIQDKEGIPPDQQR  270


 Score =   361 bits (927),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 183/194 (94%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   299 bits (766),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGM  531
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG+
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGI  305



>emb|CBY46745.1| polyubiquitin 10 protein, partial [Lepidium appelianum]
Length=308

 Score =   363 bits (931),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  4    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  63

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  64   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  123

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  124  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  183

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  184  KIQDKEGIPPDQQR  197


 Score =   363 bits (931),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  80   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  139

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  140  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  199

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  200  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  259

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  260  KIQDKEGIPPDQQR  273


 Score =   299 bits (765),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 150/153 (98%), Gaps = 0/153 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  156  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  215

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  216  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  275

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGM  531
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG 
Sbjct  276  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  308


 Score =   220 bits (561),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 111/121 (92%), Positives = 112/121 (93%), Gaps = 0/121 (0%)
 Frame = +1

Query  292  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLIFAGKQLEDGRTLA  471
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  1    RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  60

Query  472  DYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKAXIQDKXGIPPDXX  651
            DYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA IQDK GIPPD  
Sbjct  61   DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ  120

Query  652  K  654
            +
Sbjct  121  R  121



>gb|AAC35858.1| polyubiquitin [Capsicum chinense]
Length=265

 Score =   361 bits (926),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 183/194 (94%), Positives = 184/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  37   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  96

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  97   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  156

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVK 
Sbjct  157  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKT  216

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  217  KIQDKEGIPPDQQR  230


 Score =   297 bits (760),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 149/153 (97%), Positives = 149/153 (97%), Gaps = 0/153 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  113  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  172

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KI DKEGIPPDQQRLI
Sbjct  173  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  232

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGM  531
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG 
Sbjct  233  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  265


 Score =   286 bits (731),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 144/154 (94%), Positives = 145/154 (94%), Gaps = 0/154 (0%)
 Frame = +1

Query  193  QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTID  372
            QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTID
Sbjct  1    QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTID  60

Query  373  NVKAKIXDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXL  552
            NVKAKI DKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L
Sbjct  61   NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTL  120

Query  553  XGKTITLEGESSDTIDNVKAXIQDKXGIPPDXXK  654
             GKTITLE ESSDTIDNVKA IQDK GIPPD  +
Sbjct  121  TGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  154



>ref|XP_002872746.1| hypothetical protein ARALYDRAFT_911794 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_002872769.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49005.1| hypothetical protein ARALYDRAFT_911794 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49028.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=229

 Score =   360 bits (923),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 183/194 (94%), Positives = 184/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIP D  +
Sbjct  181  KIQDKEGIPLDQQR  194


 Score =   295 bits (756),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 149/153 (97%), Positives = 149/153 (97%), Gaps = 0/153 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIP DQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPLDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGM  531
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG 
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  229



>gb|KDP38838.1| hypothetical protein JCGZ_04995 [Jatropha curcas]
Length=308

 Score =   362 bits (930),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   362 bits (930),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  257  KIQDKEGIPPDQQR  270


 Score =   298 bits (764),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>gb|ACD31680.1| ubiquitin [Gossypium hirsutum]
Length=305

 Score =   362 bits (930),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  257  KIQDKEGIPPDQQR  270


 Score =   360 bits (925),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 183/194 (94%), Positives = 184/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   296 bits (758),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 149/153 (97%), Positives = 149/153 (97%), Gaps = 0/153 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGM  531
            FAGKQLEDGRTL DYNIQKESTLHL LRLRGG 
Sbjct  273  FAGKQLEDGRTLPDYNIQKESTLHLVLRLRGGF  305



>gb|KJB14874.1| hypothetical protein B456_002G147600, partial [Gossypium raimondii]
Length=344

 Score =   363 bits (933),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  42   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  101

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  102  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  161

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  162  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  221

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  222  KIQDKEGIPPDQQR  235


 Score =   363 bits (933),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  118  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  177

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  178  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  237

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  238  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  297

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  298  KIQDKEGIPPDQQR  311


 Score =   297 bits (760),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 149/151 (99%), Positives = 149/151 (99%), Gaps = 0/151 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  194  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  253

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  254  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  313

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRG  525
            FAGKQLEDGRTLADYNIQKESTLHL LRLRG
Sbjct  314  FAGKQLEDGRTLADYNIQKESTLHLVLRLRG  344


 Score =   276 bits (707),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 149/194 (77%), Positives = 150/194 (77%), Gaps = 35/194 (18%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLE                                   DGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLE-----------------------------------DGRTLADYN  25

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  26   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  85

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  86   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  145

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  146  KIQDKEGIPPDQQR  159



>gb|AAB95250.1| ubiquitin [Arabidopsis thaliana]
Length=304

 Score =   362 bits (929),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 183/194 (94%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQ+ESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQRESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   362 bits (929),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 183/194 (94%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQ+ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQRESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  257  KIQDKEGIPPDQQR  270


 Score =   299 bits (765),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>ref|XP_010227188.1| PREDICTED: polyubiquitin isoform X1 [Brachypodium distachyon]
Length=339

 Score =   363 bits (933),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  35   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  94

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  95   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  154

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  155  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  214

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  215  KIQDKEGIPPDQQR  228


 Score =   363 bits (933),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  111  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  170

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  171  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  230

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  231  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  290

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  291  KIQDKEGIPPDQQR  304


 Score =   299 bits (766),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  187  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  246

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  247  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  306

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG
Sbjct  307  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  338


 Score =   221 bits (562),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 111/121 (92%), Positives = 112/121 (93%), Gaps = 0/121 (0%)
 Frame = +1

Query  292  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLIFAGKQLEDGRTLA  471
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  32   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  91

Query  472  DYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKAXIQDKXGIPPDXX  651
            DYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA IQDK GIPPD  
Sbjct  92   DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ  151

Query  652  K  654
            +
Sbjct  152  R  152



>ref|XP_010493589.1| PREDICTED: polyubiquitin-like [Camelina sativa]
Length=430

 Score =   367 bits (941),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 186/201 (93%), Positives = 188/201 (94%), Gaps = 0/201 (0%)
 Frame = +1

Query  52   FSILFLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  231
             +IL  KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  41   LAILSFKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  100

Query  232  RTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIP  411
            RTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIP
Sbjct  101  RTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  160

Query  412  PDQQRLIFAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSD  591
            PDQQRLIFAGKQLEDG TLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSD
Sbjct  161  PDQQRLIFAGKQLEDGHTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  220

Query  592  TIDNVKAXIQDKXGIPPDXXK  654
            TIDNVKA IQDK GIPPD  +
Sbjct  221  TIDNVKAKIQDKEGIPPDQQR  241


 Score =   363 bits (933),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  200  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  259

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  260  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  319

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  320  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  379

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  380  KIQDKEGIPPDQQR  393


 Score =   362 bits (928),  Expect = 9e-120, Method: Compositional matrix adjust.
 Identities = 183/194 (94%), Positives = 184/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG TLADYN
Sbjct  124  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGHTLADYN  183

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  184  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  243

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  244  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  303

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  304  KIQDKEGIPPDQQR  317


 Score =   300 bits (767),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  276  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  335

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  336  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  395

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG
Sbjct  396  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  427



>emb|CAA54603.1| pentameric polyubiquitin [Nicotiana tabacum]
Length=346

 Score =   363 bits (933),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   363 bits (933),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  257  KIQDKEGIPPDQQR  270


 Score =   358 bits (919),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 182/189 (96%), Positives = 182/189 (96%), Gaps = 0/189 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  613  XIQDKXGIP  639
             IQDK GIP
Sbjct  333  KIQDKEGIP  341



>ref|XP_010453358.1| PREDICTED: polyubiquitin-like [Camelina sativa]
Length=305

 Score =   362 bits (929),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 183/194 (94%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES+DTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESTDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   362 bits (929),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 183/194 (94%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVES+DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESTDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  257  KIQDKEGIPPDQQR  270


 Score =   299 bits (766),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 150/153 (98%), Gaps = 0/153 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGM  531
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG 
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  305



>ref|XP_007154493.1| hypothetical protein PHAVU_003G123500g [Phaseolus vulgaris]
 gb|ESW26487.1| hypothetical protein PHAVU_003G123500g [Phaseolus vulgaris]
Length=429

 Score =   366 bits (940),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 189/204 (93%), Positives = 191/204 (94%), Gaps = 1/204 (0%)
 Frame = +1

Query  43   YFRFSILFLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQL  222
            + RF I  LKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQL
Sbjct  40   FHRF-ISPLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQL  98

Query  223  EDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKE  402
            EDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKE
Sbjct  99   EDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE  158

Query  403  GIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGE  582
            GIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE E
Sbjct  159  GIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE  218

Query  583  SSDTIDNVKAXIQDKXGIPPDXXK  654
            SSDTIDNVKA IQDK GIPPD  +
Sbjct  219  SSDTIDNVKAKIQDKEGIPPDQQR  242


 Score =   363 bits (931),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  125  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  185  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  244

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  245  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  304

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  305  KIQDKEGIPPDQQR  318


 Score =   363 bits (931),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  201  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  260

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  261  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  320

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  321  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  380

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  381  KIQDKEGIPPDQQR  394


 Score =   299 bits (765),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 150/153 (98%), Gaps = 0/153 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  277  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  336

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  337  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  396

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGM  531
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG 
Sbjct  397  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  429



>gb|KIK92093.1| hypothetical protein PAXRUDRAFT_830299, partial [Paxillus rubicundulus 
Ve08.2h10]
Length=229

 Score =   359 bits (921),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 182/194 (94%), Positives = 184/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLLDYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTL+DYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   296 bits (758),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 148/152 (97%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGG  528
            FAGKQLEDGRTL+DYNIQKESTLHL LRLRGG
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  228



>ref|XP_003082269.1| polyubiquitin (ISS) [Ostreococcus tauri]
Length=288

 Score =   361 bits (927),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  53   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  112

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  113  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  173  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  232

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  233  KIQDKEGIPPDQQR  246


 Score =   299 bits (765),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 150/161 (93%), Positives = 152/161 (94%), Gaps = 0/161 (0%)
 Frame = +1

Query  172  EGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEV  351
            +GIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEV
Sbjct  10   DGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEV  69

Query  352  ESSDTIDNVKAKIXDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLXLRLRGGM  531
            ESSDTIDNVKAKI DKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL LRLRGGM
Sbjct  70   ESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  129

Query  532  QIFVKXLXGKTITLEGESSDTIDNVKAXIQDKXGIPPDXXK  654
            QIFVK L GKTITLE ESSDTIDNVKA IQDK GIPPD  +
Sbjct  130  QIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  170


 Score =   253 bits (647),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 128/129 (99%), Positives = 128/129 (99%), Gaps = 0/129 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  129  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  188

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  189  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  248

Query  433  FAGKQLEDG  459
            FAGKQLEDG
Sbjct  249  FAGKQLEDG  257



>ref|XP_010938693.1| PREDICTED: polyubiquitin [Elaeis guineensis]
Length=307

 Score =   362 bits (929),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 183/194 (94%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIF+KTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFIKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   360 bits (924),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 182/194 (94%), Positives = 184/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIF+KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFIKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVK 
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKT  256

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  257  KIQDKEGIPPDQQR  270


 Score =   296 bits (759),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 149/152 (98%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KI DKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>ref|XP_007154496.1| hypothetical protein PHAVU_003G1236001g [Phaseolus vulgaris]
 gb|ESW26490.1| hypothetical protein PHAVU_003G1236001g [Phaseolus vulgaris]
Length=305

 Score =   362 bits (928),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 183/194 (94%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE E+SDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVENSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   362 bits (928),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 183/194 (94%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE+SDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVENSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  257  KIQDKEGIPPDQQR  270


 Score =   298 bits (764),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 149/153 (97%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVE+SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVENSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGM  531
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG+
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGL  305



>ref|XP_006685644.1| ubiquitin [Candida tenuis ATCC 10573]
 gb|EGV64838.1| ubiquitin [Candida tenuis ATCC 10573]
Length=229

 Score =   359 bits (921),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 181/194 (93%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVK+
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   296 bits (758),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 148/152 (97%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>ref|XP_010240636.1| PREDICTED: polyubiquitin isoform X1 [Brachypodium distachyon]
 ref|XP_010240784.1| PREDICTED: polyubiquitin isoform X1 [Brachypodium distachyon]
Length=383

 Score =   365 bits (936),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 184/196 (94%), Positives = 187/196 (95%), Gaps = 0/196 (0%)
 Frame = +1

Query  67   LKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  246
            ++MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  1    MQMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  60

Query  247  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQR  426
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQR
Sbjct  61   YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  120

Query  427  LIFAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNV  606
            LIFAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNV
Sbjct  121  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV  180

Query  607  KAXIQDKXGIPPDXXK  654
            KA IQDK GIPPD  +
Sbjct  181  KAKIQDKEGIPPDQQR  196


 Score =   363 bits (933),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  79   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  138

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  139  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  198

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  199  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  258

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  259  KIQDKEGIPPDQQR  272


 Score =   363 bits (933),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  155  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  214

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  215  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  274

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  275  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  334

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  335  KIQDKEGIPPDQQR  348


 Score =   299 bits (766),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  231  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  290

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  291  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  350

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG
Sbjct  351  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  382



>gb|KJB62487.1| hypothetical protein B456_009G418900 [Gossypium raimondii]
Length=305

 Score =   362 bits (928),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 183/194 (94%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  257  KIQDKEGIPPDQQR  270


 Score =   360 bits (925),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 182/194 (94%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   299 bits (765),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>gb|AGZ15412.1| fiber polyubiquitin [Phaseolus vulgaris]
Length=229

 Score =   359 bits (921),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 183/194 (94%), Positives = 184/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ES DTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESFDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   281 bits (718),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 144/153 (94%), Positives = 144/153 (94%), Gaps = 0/153 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES DTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESFDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGM  531
            FAGKQLEDG TLADYNIQKE TL L L  RGG 
Sbjct  197  FAGKQLEDGCTLADYNIQKEFTLPLVLCFRGGF  229



>gb|KIL68862.1| hypothetical protein M378DRAFT_157997 [Amanita muscaria Koide 
BX008]
Length=305

 Score =   362 bits (928),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 183/194 (94%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   362 bits (928),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 183/194 (94%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTL+DYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  257  KIQDKEGIPPDQQR  270


 Score =   297 bits (761),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 148/153 (97%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGM  531
            FAGKQLEDGRTL+DYNIQKESTLHL LRLRGG+
Sbjct  273  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGL  305



>gb|EGO00904.1| hypothetical protein SERLA73DRAFT_178893 [Serpula lacrymans var. 
lacrymans S7.3]
Length=312

 Score =   362 bits (928),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 182/194 (94%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTL+DYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   362 bits (928),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 182/194 (94%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTL+DYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  257  KIQDKEGIPPDQQR  270


 Score =   285 bits (730),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 142/145 (98%), Positives = 144/145 (99%), Gaps = 0/145 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHL  507
            FAGKQLEDGRTL+DYNIQKESTLHL
Sbjct  273  FAGKQLEDGRTLSDYNIQKESTLHL  297


 Score =   140 bits (354),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 69/71 (97%), Positives = 70/71 (99%), Gaps = 0/71 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  288

Query  253  IQKESTLHLVL  285
            IQKESTLHLV 
Sbjct  289  IQKESTLHLVF  299



>gb|AIY27743.1| polyubiquitin Ubi10, partial [Betula luminifera]
Length=330

 Score =   362 bits (930),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 182/194 (94%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  75   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  134

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFV+TLTGKTITLEVESSDT+DNVKAKI DKEGIPPDQQRLI
Sbjct  135  IQKESTLHLVLRLRGGMQIFVRTLTGKTITLEVESSDTVDNVKAKIQDKEGIPPDQQRLI  194

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  195  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  254

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  255  KIQDKEGIPPDQQR  268


 Score =   343 bits (880),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 173/180 (96%), Positives = 175/180 (97%), Gaps = 0/180 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFV+TLTGKTITLEVESSDT+DNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  151  MQIFVRTLTGKTITLEVESSDTVDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  210

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  211  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  270

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  271  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  330


 Score =   334 bits (857),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 173/194 (89%), Positives = 177/194 (91%), Gaps = 2/194 (1%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVK L  KTITLEV+    IDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVK-LYSKTITLEVKLRH-IDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  58

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLV RLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  59   IQKESTLHLVFRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  118

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFV+ L GKTITLE ESSDT+DNVKA
Sbjct  119  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVRTLTGKTITLEVESSDTVDNVKA  178

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  179  KIQDKEGIPPDQQR  192



>gb|AAO43309.1| putative polyubiquitin [Arabidopsis thaliana]
Length=250

 Score =   359 bits (922),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 182/194 (94%), Positives = 184/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEV+SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  21   MQIFVKTLTGKTITLEVQSSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  80

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKE IPPDQQRLI
Sbjct  81   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEWIPPDQQRLI  140

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  141  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  200

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  201  KIQDKEGIPPDQKR  214


 Score =   291 bits (746),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 147/153 (96%), Positives = 149/153 (97%), Gaps = 0/153 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  97   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEWIPPDQQRLIFAGKQLEDGRTLADYN  156

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQ+RLI
Sbjct  157  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQKRLI  216

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGM  531
            FAGKQLEDGRTLA YNIQKESTLHL LRLRGG+
Sbjct  217  FAGKQLEDGRTLAVYNIQKESTLHLVLRLRGGI  249


 Score =   251 bits (640),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 126/138 (91%), Positives = 128/138 (93%), Gaps = 0/138 (0%)
 Frame = +1

Query  241  ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQ  420
            ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEV+SSDTIDNVKAKI DKEGIPPDQ
Sbjct  1    ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVQSSDTIDNVKAKIQDKEGIPPDQ  60

Query  421  QRLIFAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTID  600
            QRLIFAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTID
Sbjct  61   QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTID  120

Query  601  NVKAXIQDKXGIPPDXXK  654
            NVKA IQDK  IPPD  +
Sbjct  121  NVKAKIQDKEWIPPDQQR  138



>ref|XP_006288300.1| hypothetical protein CARUB_v10001544mg [Capsella rubella]
 gb|EOA21198.1| hypothetical protein CARUB_v10001544mg [Capsella rubella]
Length=306

 Score =   361 bits (927),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 183/194 (94%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQ+K GIPPD  +
Sbjct  181  KIQEKEGIPPDQQR  194


 Score =   361 bits (927),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 183/194 (94%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI +KEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQEKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  257  KIQDKEGIPPDQQR  270


 Score =   297 bits (761),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 149/152 (98%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQ+KEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQEKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>sp|P69315.2|UBIQP_LINUS RecName: Full=Polyubiquitin; Contains: RecName: Full=Ubiquitin; 
Contains: RecName: Full=Ubiquitin-related; Flags: Precursor, 
partial [Linum usitatissimum]
 gb|AAA33401.1| ubiquitin, partial [Linum usitatissimum]
Length=305

 Score =   361 bits (927),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 183/194 (94%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIF+KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  42   MQIFLKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  101

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  102  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  161

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  162  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  221

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  222  KIQDKEGIPPDQQR  235


 Score =   354 bits (909),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 181/188 (96%), Positives = 181/188 (96%), Gaps = 0/188 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  118  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  177

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  178  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  237

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  238  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  297

Query  613  XIQDKXGI  636
             IQDK GI
Sbjct  298  KIQDKEGI  305


 Score =   296 bits (758),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 148/159 (93%), Positives = 150/159 (94%), Gaps = 0/159 (0%)
 Frame = +1

Query  178  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  357
            IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF+KTLTGKTITLEVES
Sbjct  1    IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFLKTLTGKTITLEVES  60

Query  358  SDTIDNVKAKIXDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQI  537
            SDTIDNVKAKI DKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQI
Sbjct  61   SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  120

Query  538  FVKXLXGKTITLEGESSDTIDNVKAXIQDKXGIPPDXXK  654
            FVK L GKTITLE ESSDTIDNVKA IQDK GIPPD  +
Sbjct  121  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  159



>ref|XP_011048569.1| PREDICTED: polyubiquitin 3-like [Populus euphratica]
Length=306

 Score =   361 bits (927),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 183/194 (94%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQK+STLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKDSTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   360 bits (923),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 182/194 (94%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQK+STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKDSTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLE+GRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  197  FAGKQLEEGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  257  KIQDKEGIPPDQQR  270


 Score =   297 bits (760),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 149/152 (98%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLE+GRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEEGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>ref|XP_008796945.1| PREDICTED: LOW QUALITY PROTEIN: polyubiquitin-like [Phoenix dactylifera]
Length=309

 Score =   361 bits (927),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 183/194 (94%), Positives = 184/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES DTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESXDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   361 bits (927),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 183/194 (94%), Positives = 184/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVES DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESXDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  257  KIQDKEGIPPDQQR  270


 Score =   299 bits (766),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>gb|ADD52202.1| ubiquitin [Catharanthus roseus]
 gb|AEK98798.1| ubiquitin [Carthamus tinctorius]
Length=381

 Score =   364 bits (934),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 188/212 (89%), Positives = 191/212 (90%), Gaps = 6/212 (3%)
 Frame = +1

Query  37   CDYFRFSILFL------KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  198
            C+  + S L L       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  135  CNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  194

Query  199  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV  378
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV
Sbjct  195  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV  254

Query  379  KAKIXDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXG  558
            KAKI DKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L G
Sbjct  255  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  314

Query  559  KTITLEGESSDTIDNVKAXIQDKXGIPPDXXK  654
            KTITLE ESSDTIDNVKA IQDK GIPPD  +
Sbjct  315  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  346


 Score =   358 bits (918),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 182/194 (94%), Positives = 183/194 (94%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDT DNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD N
Sbjct  77   MQIFVKTLTGKTITLEVESSDTTDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADCN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  257  KIQDKEGIPPDQQR  270


 Score =   356 bits (913),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 181/194 (93%), Positives = 182/194 (94%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAK QDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKTQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDT DNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTTDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLAD NIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADCNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   297 bits (760),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 149/153 (97%), Positives = 149/153 (97%), Gaps = 0/153 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGM  531
             AGKQLEDGRTLADYNIQKESTLHL LRLRGG 
Sbjct  349  LAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  381



>gb|AFK47245.1| unknown [Medicago truncatula]
Length=233

 Score =   358 bits (919),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 181/194 (93%), Positives = 183/194 (94%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTI LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTIILEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KI DKEGIPPDQQRL+
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLV  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKALTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   291 bits (745),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 146/152 (96%), Positives = 147/152 (97%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRL+FAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLVFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVK LTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKALTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGG  528
            FAGKQLEDGRTLAD NIQKESTLHL LRLRGG
Sbjct  197  FAGKQLEDGRTLADNNIQKESTLHLVLRLRGG  228



>ref|XP_002872109.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48368.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=383

 Score =   364 bits (934),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  78   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  137

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  138  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  197

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  198  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  257

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  258  KIQDKEGIPPDQQR  271


 Score =   363 bits (932),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 183/194 (94%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  154  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  213

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  214  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  273

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  274  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  333

Query  613  XIQDKXGIPPDXXK  654
             IQDK G+PPD  +
Sbjct  334  KIQDKEGVPPDQQR  347


 Score =   360 bits (923),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 183/194 (94%), Positives = 184/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP DQQRLIFAGKQLEDGRTLADYN
Sbjct  2    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPLDQQRLIFAGKQLEDGRTLADYN  61

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  62   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  121

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  122  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  181

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  182  KIQDKEGIPPDQQR  195


 Score =   299 bits (766),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 149/152 (98%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  230  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  289

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEG+PPDQQRLI
Sbjct  290  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGVPPDQQRLI  349

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG
Sbjct  350  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  381



>ref|XP_010492041.1| PREDICTED: polyubiquitin-like [Camelina sativa]
Length=305

 Score =   361 bits (926),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 183/194 (94%), Positives = 184/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAG QLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGTQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   361 bits (926),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 183/194 (94%), Positives = 184/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG QLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGTQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  257  KIQDKEGIPPDQQR  270


 Score =   299 bits (766),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 150/153 (98%), Gaps = 0/153 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGM  531
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG 
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  305



>ref|XP_006381473.1| polyubiquitin family protein [Populus trichocarpa]
 gb|ERP59270.1| polyubiquitin family protein [Populus trichocarpa]
Length=306

 Score =   361 bits (926),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 183/194 (94%), Positives = 184/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGNTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  257  KIQDKEGIPPDQQR  270


 Score =   358 bits (918),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 181/194 (93%), Positives = 183/194 (94%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVE+SDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVENSDTIDNVKVKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L G TITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGNTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   297 bits (760),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 149/152 (98%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTG TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGNTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>emb|CCL99875.1| predicted protein [Fibroporia radiculosa]
Length=312

 Score =   361 bits (927),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 182/194 (94%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  8    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  67

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  68   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  127

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTL+DYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  128  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  187

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  188  KIQDKEGIPPDQQR  201


 Score =   361 bits (927),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 182/194 (94%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  84   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  143

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  144  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  203

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTL+DYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  204  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  263

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  264  KIQDKEGIPPDQQR  277


 Score =   298 bits (762),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 148/153 (97%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  160  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  219

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  220  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  279

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGM  531
            FAGKQLEDGRTL+DYNIQKESTLHL LRLRGG+
Sbjct  280  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGL  312



>gb|KIM67150.1| hypothetical protein SCLCIDRAFT_1210637 [Scleroderma citrinum 
Foug A]
Length=305

 Score =   361 bits (926),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 182/194 (94%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTL+DYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  257  KIQDKEGIPPDQQR  270


 Score =   357 bits (916),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 181/194 (93%), Positives = 184/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQ KEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQVKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTL+DYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   296 bits (759),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 148/152 (97%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGG  528
            FAGKQLEDGRTL+DYNIQKESTLHL LRLRGG
Sbjct  273  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  304



>gb|AIS40894.1| polyubiquitin [Kalanchoe fedtschenkoi]
Length=470

 Score =   367 bits (941),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 189/205 (92%), Positives = 191/205 (93%), Gaps = 2/205 (1%)
 Frame = +1

Query  46   FRFSI--LFLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQ  219
            FR +I  L  KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQ
Sbjct  3    FRKAINSLLPKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQ  62

Query  220  LEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDK  399
            LEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DK
Sbjct  63   LEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  122

Query  400  EGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEG  579
            EGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE 
Sbjct  123  EGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEV  182

Query  580  ESSDTIDNVKAXIQDKXGIPPDXXK  654
            ESSDTIDNVKA IQDK GIPPD  +
Sbjct  183  ESSDTIDNVKAKIQDKEGIPPDQQR  207


 Score =   363 bits (932),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  90   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  149

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  150  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  209

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  210  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  269

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  270  KIQDKEGIPPDQQR  283


 Score =   363 bits (932),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  166  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  225

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  226  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  285

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  286  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  345

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  346  KIQDKEGIPPDQQR  359


 Score =   363 bits (932),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  242  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  301

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  302  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  361

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  362  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  421

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  422  KIQDKEGIPPDQQR  435


 Score =   299 bits (766),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  318  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  377

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  378  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  437

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG
Sbjct  438  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  469



>gb|EWZ40370.1| ubiquitin C [Fusarium oxysporum Fo47]
Length=229

 Score =   358 bits (918),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 180/194 (93%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVK+
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   295 bits (755),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 147/152 (97%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGG  528
            FAGKQLEDGRTL+DYNIQKESTLHL LRLRGG
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  228



>gb|KIR29996.1| polyubiquitin [Cryptococcus gattii LA55]
 gb|KIR37417.1| polyubiquitin [Cryptococcus gattii MMRL2647]
 gb|KIR43885.1| polyubiquitin [Cryptococcus gattii Ram5]
 gb|KIR92886.1| polyubiquitin [Cryptococcus gattii CBS 10090]
 gb|KIY60273.1| polyubiquitin [Cryptococcus gattii 99/473]
Length=315

 Score =   361 bits (926),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 182/194 (94%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTL+DYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  257  KIQDKEGIPPDQQR  270


 Score =   360 bits (923),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 181/194 (93%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTL+DYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   309 bits (791),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 154/158 (97%), Positives = 156/158 (99%), Gaps = 0/158 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVK  546
            FAGKQLEDGRTL+DYNIQKESTLHL LRLRGGMQIFVK
Sbjct  273  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVK  310


 Score =   166 bits (421),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 82/83 (99%), Positives = 83/83 (100%), Gaps = 0/83 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  288

Query  253  IQKESTLHLVLRLRGGMQIFVKT  321
            IQKESTLHLVLRLRGGMQIFVKT
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKT  311



>gb|KIJ45725.1| hypothetical protein M422DRAFT_106821, partial [Sphaerobolus 
stellatus SS14]
Length=305

 Score =   360 bits (925),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 182/194 (94%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTL+DYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   360 bits (925),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 182/194 (94%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTL+DYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  257  KIQDKEGIPPDQQR  270


 Score =   299 bits (765),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 149/153 (97%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGM  531
            FAGKQLEDGRTL+DYNIQKESTLHL LRLRGGM
Sbjct  273  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  305



>gb|KIY45417.1| ubiquitin [Fistulina hepatica ATCC 64428]
Length=305

 Score =   360 bits (925),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 182/194 (94%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTL+DYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   360 bits (925),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 182/194 (94%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTL+DYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  257  KIQDKEGIPPDQQR  270


 Score =   296 bits (759),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 148/152 (97%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGG  528
            FAGKQLEDGRTL+DYNIQKESTLHL LRLRGG
Sbjct  273  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  304



>emb|CEF99839.1| Ubiquitin conserved site [Ostreococcus tauri]
Length=339

 Score =   362 bits (928),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  35   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  94

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  95   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  154

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  155  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  214

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  215  KIQDKEGIPPDQQR  228


 Score =   362 bits (928),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  111  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  170

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  171  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  230

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  231  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  290

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  291  KIQDKEGIPPDQQR  304


 Score =   298 bits (762),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  187  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  246

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  247  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  306

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG
Sbjct  307  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  338



>ref|XP_001555417.1| polyubiquitin [Botrytis cinerea B05.10]
 ref|XP_001906054.1| hypothetical protein [Podospora anserina S mat+]
 ref|XP_007336907.1| ubiquitin [Auricularia delicata TFB-10046 SS5]
 ref|XP_007390409.1| hypothetical protein PHACADRAFT_247222 [Phanerochaete carnosa 
HHB-10118-sp]
 ref|XP_011121602.1| hypothetical protein AOL_s00078g37 [Arthrobotrys oligospora ATCC 
24927]
 gb|AAC15225.1| polyubiquitin [Botrytis cinerea]
 emb|CAP66720.1| unnamed protein product [Podospora anserina S mat+]
 gb|EGX49548.1| hypothetical protein AOL_s00078g37 [Arthrobotrys oligospora ATCC 
24927]
 emb|CCD51422.1| similar to polyubiquitin protein [Botrytis cinerea T4]
 gb|EJD55630.1| ubiquitin [Auricularia delicata TFB-10046 SS5]
 gb|EKM60970.1| hypothetical protein PHACADRAFT_247222 [Phanerochaete carnosa 
HHB-10118-sp]
 gb|EMR84820.1| putative polyubiquitin protein [Botrytis cinerea BcDW1]
 emb|CDP28455.1| Putative Ubiquitin [Podospora anserina S mat+]
 gb|KIP12035.1| hypothetical protein PHLGIDRAFT_17814 [Phlebiopsis gigantea 11061_1 
CR5-6]
Length=305

 Score =   360 bits (925),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 182/194 (94%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTL+DYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   360 bits (925),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 182/194 (94%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTL+DYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  257  KIQDKEGIPPDQQR  270


 Score =   296 bits (759),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 148/152 (97%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGG  528
            FAGKQLEDGRTL+DYNIQKESTLHL LRLRGG
Sbjct  273  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  304



>ref|XP_010911599.1| PREDICTED: polyubiquitin 4 [Elaeis guineensis]
Length=384

 Score =   363 bits (932),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   363 bits (932),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  257  KIQDKEGIPPDQQR  270


 Score =   363 bits (932),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  333  KIQDKEGIPPDQQR  346


 Score =   299 bits (766),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>ref|NP_001105376.1| polyubiquitin [Zea mays]
 gb|AAC49025.1| polyubiquitin [Zea mays]
Length=381

 Score =   363 bits (932),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   363 bits (932),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  257  KIQDKEGIPPDQQR  270


 Score =   362 bits (929),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 183/194 (94%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL +RLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVVRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  333  KIQDKEGIPPDQQR  346


 Score =   298 bits (763),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 149/152 (98%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLV+RLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVVRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>gb|AGV54228.1| polyubiquitin-like protein [Phaseolus vulgaris]
Length=381

 Score =   363 bits (932),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  333  KIQDKEGIPPDQQR  346


 Score =   358 bits (918),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 182/194 (94%), Positives = 183/194 (94%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL   LRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVSWLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   358 bits (918),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 182/194 (94%), Positives = 183/194 (94%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLV  LRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVSWLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  257  KIQDKEGIPPDQQR  270


 Score =   300 bits (768),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGM  531
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG+
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGL  381



>gb|KIR63773.1| polyubiquitin [Cryptococcus gattii CA1873]
 gb|KIR98208.1| polyubiquitin [Cryptococcus gattii 2001/935-1]
Length=305

 Score =   360 bits (925),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 182/194 (94%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTL+DYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  257  KIQDKEGIPPDQQR  270


 Score =   359 bits (921),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 181/194 (93%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTL+DYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   296 bits (759),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 148/152 (97%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGG  528
            FAGKQLEDGRTL+DYNIQKESTLHL LRLRGG
Sbjct  273  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  304



>gb|ABU40645.1| polyubiquitin [Triticum aestivum]
Length=380

 Score =   363 bits (932),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   363 bits (932),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  257  KIQDKEGIPPDQQR  270


 Score =   363 bits (932),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  333  KIQDKEGIPPDQQR  346


 Score =   299 bits (766),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>gb|KJB13592.1| hypothetical protein B456_002G083000 [Gossypium raimondii]
Length=385

 Score =   363 bits (932),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   363 bits (932),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  257  KIQDKEGIPPDQQR  270


 Score =   363 bits (932),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  333  KIQDKEGIPPDQQR  346


 Score =   300 bits (768),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 150/155 (97%), Positives = 152/155 (98%), Gaps = 0/155 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQI  537
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG ++
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGFRM  383



>ref|XP_002508175.1| ubiquitin [Micromonas sp. RCC299]
 ref|XP_003061956.1| ubiquitin [Micromonas pusilla CCMP1545]
 gb|EEH53668.1| ubiquitin [Micromonas pusilla CCMP1545]
 gb|ACO69433.1| ubiquitin [Micromonas sp. RCC299]
 gb|KEH20642.1| polyubiquitin 3 [Medicago truncatula]
Length=381

 Score =   363 bits (932),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   363 bits (932),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  257  KIQDKEGIPPDQQR  270


 Score =   363 bits (932),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  333  KIQDKEGIPPDQQR  346


 Score =   299 bits (766),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>gb|AAB95252.1| ubiquitin [Arabidopsis thaliana]
Length=380

 Score =   363 bits (932),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  333  KIQDKEGIPPDQQR  346


 Score =   360 bits (925),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 183/194 (94%), Positives = 184/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQ LI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQWLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   360 bits (925),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 183/194 (94%), Positives = 184/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQWLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  257  KIQDKEGIPPDQQR  270


 Score =   297 bits (760),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 149/152 (98%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGG  528
            FAGKQLEDGRTLADY+IQKESTLHL LRLRGG
Sbjct  349  FAGKQLEDGRTLADYDIQKESTLHLVLRLRGG  380



>gb|KIY53974.1| polyubiquitin [Fistulina hepatica ATCC 64428]
Length=305

 Score =   360 bits (925),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 182/194 (94%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTL+DYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   360 bits (925),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 182/194 (94%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTL+DYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  257  KIQDKEGIPPDQQR  270


 Score =   295 bits (755),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 147/153 (96%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGM  531
            FAGKQLEDGRTL+DY+IQKESTLHL LRLRGG+
Sbjct  273  FAGKQLEDGRTLSDYSIQKESTLHLVLRLRGGL  305



>ref|XP_007339454.1| ubiquitin [Auricularia delicata TFB-10046 SS5]
 gb|EJD52725.1| ubiquitin [Auricularia delicata TFB-10046 SS5]
 gb|KIM81538.1| hypothetical protein PILCRDRAFT_821319 [Piloderma croceum F 1598]
Length=305

 Score =   360 bits (925),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 182/194 (94%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTL+DYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   360 bits (925),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 182/194 (94%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTL+DYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  257  KIQDKEGIPPDQQR  270


 Score =   296 bits (759),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 148/153 (97%), Positives = 150/153 (98%), Gaps = 0/153 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGM  531
            FAGKQLEDGRTL+DYNIQKESTLHL LRLRGG 
Sbjct  273  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGF  305



>ref|XP_010558157.1| PREDICTED: polyubiquitin-like [Tarenaya hassleriana]
Length=382

 Score =   363 bits (932),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   363 bits (932),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  257  KIQDKEGIPPDQQR  270


 Score =   363 bits (932),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  333  KIQDKEGIPPDQQR  346


 Score =   299 bits (766),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>gb|KJB62485.1| hypothetical protein B456_009G418900 [Gossypium raimondii]
Length=305

 Score =   360 bits (925),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 182/194 (94%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  257  KIQDKEGIPPDQQR  270


 Score =   359 bits (921),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 181/194 (93%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVK+
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   298 bits (762),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 149/152 (98%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>gb|KDQ20365.1| hypothetical protein BOTBODRAFT_123907 [Botryobasidium botryosum 
FD-172 SS1]
Length=305

 Score =   360 bits (925),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 182/194 (94%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTL+DYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   360 bits (925),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 182/194 (94%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTL+DYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  257  KIQDKEGIPPDQQR  270


 Score =   296 bits (758),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 148/152 (97%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGG  528
            FAGKQLEDGRTL+DYNIQKESTLHL LRLRGG
Sbjct  273  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  304



>gb|KDB11907.1| ubiquitin [Ustilaginoidea virens]
Length=305

 Score =   360 bits (925),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 182/194 (94%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVK+
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   360 bits (925),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 182/194 (94%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVK+
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS  256

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  257  KIQDKEGIPPDQQR  270


 Score =   296 bits (758),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 148/152 (97%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KI DKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>ref|XP_001828882.1| ubiquitin C [Coprinopsis cinerea okayama7#130]
 ref|XP_001873268.1| ubiquitin [Laccaria bicolor S238N-H82]
 ref|XP_003037536.1| hypothetical protein SCHCODRAFT_64979 [Schizophyllum commune 
H4-8]
 ref|XP_006454479.1| ubiquitin [Agaricus bisporus var. bisporus H97]
 ref|XP_007316692.1| hypothetical protein SERLADRAFT_385284 [Serpula lacrymans var. 
lacrymans S7.9]
 ref|XP_007325267.1| hypothetical protein AGABI1DRAFT_81473 [Agaricus bisporus var. 
burnettii JB137-S8]
 ref|XP_007378433.1| ubiquitin [Punctularia strigosozonata HHB-11173 SS5]
 ref|XP_007842308.1| polyubiquitin [Moniliophthora roreri MCA 2997]
 ref|XP_007879465.1| hypothetical protein PFL1_06871 [Pseudozyma flocculosa PF-1]
 gb|EAU92889.1| ubiquitin C [Coprinopsis cinerea okayama7#130]
 gb|EDR15060.1| ubiquitin [Laccaria bicolor S238N-H82]
 gb|EFJ02634.1| hypothetical protein SCHCODRAFT_64979 [Schizophyllum commune 
H4-8]
 gb|EGO26519.1| hypothetical protein SERLADRAFT_385284 [Serpula lacrymans var. 
lacrymans S7.9]
 gb|EIN13516.1| ubiquitin [Punctularia strigosozonata HHB-11173 SS5]
 gb|EKM83733.1| hypothetical protein AGABI1DRAFT_81473 [Agaricus bisporus var. 
burnettii JB137-S8]
 gb|EKV51498.1| ubiquitin [Agaricus bisporus var. bisporus H97]
 dbj|GAC72194.1| ubiquitin and ubiquitin-like proteins [Pseudozyma antarctica 
T-34]
 dbj|GAC93128.1| ubiquitin [Pseudozyma hubeiensis SY62]
 gb|EPQ28867.1| hypothetical protein PFL1_06871 [Pseudozyma flocculosa PF-1]
 gb|ESK98373.1| polyubiquitin [Moniliophthora roreri MCA 2997]
 gb|AHA61591.1| ubiquitin [Volvariella volvacea]
 gb|KIK04252.1| hypothetical protein K443DRAFT_4723 [Laccaria amethystina LaAM-08-1]
 gb|KIO31281.1| hypothetical protein M407DRAFT_241831 [Tulasnella calospora MUT 
4182]
Length=305

 Score =   360 bits (925),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 182/194 (94%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTL+DYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   360 bits (925),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 182/194 (94%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTL+DYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  257  KIQDKEGIPPDQQR  270


 Score =   296 bits (758),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 148/152 (97%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGG  528
            FAGKQLEDGRTL+DYNIQKESTLHL LRLRGG
Sbjct  273  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  304



>ref|XP_003030030.1| polyubiquitin [Schizophyllum commune H4-8]
 ref|XP_006678580.1| polyubiquitin [Batrachochytrium dendrobatidis JAM81]
 ref|XP_007396817.1| hypothetical protein PHACADRAFT_257732 [Phanerochaete carnosa 
HHB-10118-sp]
 gb|AAB94630.1| polyubiquitin [Schizophyllum commune]
 gb|EFI95127.1| polyubiquitin [Schizophyllum commune H4-8]
 gb|EGF80702.1| polyubiquitin [Batrachochytrium dendrobatidis JAM81]
 gb|EKM54116.1| hypothetical protein PHACADRAFT_257732 [Phanerochaete carnosa 
HHB-10118-sp]
 gb|EPT04446.1| hypothetical protein FOMPIDRAFT_1021745 [Fomitopsis pinicola 
FP-58527 SS1]
 gb|KDQ24213.1| hypothetical protein PLEOSDRAFT_1058300 [Pleurotus ostreatus 
PC15]
 gb|KDQ28506.1| hypothetical protein PLEOSDRAFT_1089714 [Pleurotus ostreatus 
PC15]
 gb|KDQ53556.1| hypothetical protein JAAARDRAFT_72512 [Jaapia argillacea MUCL 
33604]
 gb|KIK09182.1| hypothetical protein K443DRAFT_671672 [Laccaria amethystina LaAM-08-1]
 gb|KIK44225.1| hypothetical protein CY34DRAFT_648259 [Suillus luteus UH-Slu-Lm8-n1]
 gb|KIM51102.1| hypothetical protein SCLCIDRAFT_144015 [Scleroderma citrinum 
Foug A]
 gb|KIN98337.1| hypothetical protein M404DRAFT_856969 [Pisolithus tinctorius 
Marx 270]
 gb|KIN98894.1| hypothetical protein M404DRAFT_966612 [Pisolithus tinctorius 
Marx 270]
Length=305

 Score =   360 bits (925),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 182/194 (94%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTL+DYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   360 bits (925),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 182/194 (94%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTL+DYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  257  KIQDKEGIPPDQQR  270


 Score =   297 bits (761),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 148/153 (97%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGM  531
            FAGKQLEDGRTL+DYNIQKESTLHL LRLRGG+
Sbjct  273  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGL  305



>gb|KJB81825.1| hypothetical protein B456_013G163500 [Gossypium raimondii]
 gb|KJB81826.1| hypothetical protein B456_013G163500 [Gossypium raimondii]
Length=381

 Score =   363 bits (932),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  257  KIQDKEGIPPDQQR  270


 Score =   363 bits (932),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  333  KIQDKEGIPPDQQR  346


 Score =   361 bits (927),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 183/194 (94%), Positives = 184/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   299 bits (766),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 150/153 (98%), Gaps = 0/153 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGM  531
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG 
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  381



>ref|XP_009763135.1| PREDICTED: polyubiquitin-like [Nicotiana sylvestris]
Length=381

 Score =   363 bits (932),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  333  KIQDKEGIPPDQQR  346


 Score =   362 bits (929),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 183/194 (94%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVES+DTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESTDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  257  KIQDKEGIPPDQQR  270


 Score =   360 bits (925),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 182/194 (94%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES+DTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESTDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   299 bits (766),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 150/153 (98%), Gaps = 0/153 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGM  531
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG 
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  381



>sp|P0CG84.1|UBI4P_NICSY RecName: Full=Polyubiquitin; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor, partial [Nicotiana sylvestris]
 gb|AAA34124.1| pentameric polyubiquitin, partial [Nicotiana sylvestris]
Length=377

 Score =   363 bits (931),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  132

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  133  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  192

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  193  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  252

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  253  KIQDKEGIPPDQQR  266


 Score =   363 bits (931),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  149  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  208

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  209  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  268

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  269  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  328

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  329  KIQDKEGIPPDQQR  342


 Score =   354 bits (909),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 180/190 (95%), Positives = 181/190 (95%), Gaps = 0/190 (0%)
 Frame = +1

Query  85   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  264
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  1    VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  60

Query  265  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLIFAGK  444
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLIFAGK
Sbjct  61   STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  120

Query  445  QLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKAXIQD  624
            QLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA IQD
Sbjct  121  QLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQD  180

Query  625  KXGIPPDXXK  654
            K GIPPD  +
Sbjct  181  KEGIPPDQQR  190


 Score =   299 bits (765),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 150/153 (98%), Gaps = 0/153 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  225  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  284

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  285  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  344

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGM  531
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG 
Sbjct  345  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  377



>ref|NP_001148453.1| LOC100282068 [Zea mays]
 ref|XP_002299930.1| UBIQUITIN 11 family protein [Populus trichocarpa]
 ref|XP_003607671.1| Ubiquitin [Medicago truncatula]
 gb|AAC49014.1| ubiquitin [Zea mays]
 gb|ACG31521.1| polyubiquitin containing 7 ubiquitin monomers [Zea mays]
 gb|EEE84735.1| UBIQUITIN 11 family protein [Populus trichocarpa]
 gb|ACR37911.1| unknown [Zea mays]
 gb|AES89868.1| polyubiquitin 3 [Medicago truncatula]
 gb|AFW66440.1| putative ubiquitin family protein isoform 1 [Zea mays]
 gb|AFW66441.1| putative ubiquitin family protein isoform 2 [Zea mays]
Length=381

 Score =   363 bits (932),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   363 bits (932),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  257  KIQDKEGIPPDQQR  270


 Score =   363 bits (932),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  333  KIQDKEGIPPDQQR  346


 Score =   299 bits (765),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>ref|XP_009358096.1| PREDICTED: polyubiquitin isoform X1 [Pyrus x bretschneideri]
 ref|XP_009343084.1| PREDICTED: polyubiquitin isoform X1 [Pyrus x bretschneideri]
Length=401

 Score =   364 bits (934),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  21   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  80

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  81   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  140

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  141  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  200

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  201  KIQDKEGIPPDQQR  214


 Score =   364 bits (934),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  97   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  156

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  157  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  216

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  217  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  276

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  277  KIQDKEGIPPDQQR  290


 Score =   364 bits (934),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  173  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  232

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  233  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  292

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  293  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  352

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  353  KIQDKEGIPPDQQR  366


 Score =   300 bits (767),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 150/153 (98%), Gaps = 0/153 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  249  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  308

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  309  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  368

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGM  531
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG 
Sbjct  369  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  401



>ref|NP_001174480.1| Os05g0504766 [Oryza sativa Japonica Group]
 ref|XP_002438904.1| hypothetical protein SORBIDRAFT_10g028020 [Sorghum bicolor]
 ref|XP_006656385.1| PREDICTED: polyubiquitin-like [Oryza brachyantha]
 ref|XP_007027294.1| Ubiquitin 4 [Theobroma cacao]
 ref|XP_010240640.1| PREDICTED: polyubiquitin isoform X2 [Brachypodium distachyon]
 ref|XP_010240789.1| PREDICTED: polyubiquitin isoform X2 [Brachypodium distachyon]
 gb|AAD30173.1|AF148448_1 polyubiquitin [Sporobolus stapfianus]
 gb|AAW56906.1| polyubiquitin [Oryza sativa Japonica Group]
 gb|EAY98614.1| hypothetical protein OsI_20535 [Oryza sativa Indica Group]
 gb|EEE64284.1| hypothetical protein OsJ_19121 [Oryza sativa Japonica Group]
 gb|EER90271.1| hypothetical protein SORBIDRAFT_10g028020 [Sorghum bicolor]
 dbj|BAH93208.1| Os05g0504766 [Oryza sativa Japonica Group]
 dbj|BAJ91806.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK04112.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gb|AFH53939.1| polyubiquitin 4 [Brachypodium distachyon]
 gb|AFH53940.1| polyubiquitin 10 [Brachypodium distachyon]
 gb|EOY07796.1| Ubiquitin 4 [Theobroma cacao]
 gb|AGT16803.1| polyubiquitin [Saccharum hybrid cultivar R570]
Length=381

 Score =   363 bits (932),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   363 bits (932),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  257  KIQDKEGIPPDQQR  270


 Score =   363 bits (932),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  333  KIQDKEGIPPDQQR  346


 Score =   299 bits (765),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>gb|EYU33608.1| hypothetical protein MIMGU_mgv1a004315mg [Erythranthe guttata]
Length=381

 Score =   363 bits (932),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   363 bits (932),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  257  KIQDKEGIPPDQQR  270


 Score =   363 bits (932),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  333  KIQDKEGIPPDQQR  346


 Score =   299 bits (766),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGM  531
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG+
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGV  381



>ref|XP_009108753.1| PREDICTED: polyubiquitin 11-like [Brassica rapa]
Length=229

 Score =   357 bits (917),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 181/194 (93%), Positives = 183/194 (94%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKE+ LHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKETNLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKNLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK  IPPD  +
Sbjct  181  KIQDKEDIPPDQQR  194


 Score =   295 bits (754),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 148/153 (97%), Positives = 148/153 (97%), Gaps = 0/153 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVK LTGKTITLEVESSDTIDNVKAKI DKE IPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKNLTGKTITLEVESSDTIDNVKAKIQDKEDIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGM  531
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG 
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  229



>gb|KEH31155.1| polyubiquitin 3 [Medicago truncatula]
Length=381

 Score =   363 bits (932),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   363 bits (932),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  257  KIQDKEGIPPDQQR  270


 Score =   362 bits (928),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 183/194 (94%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTL+DYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  333  KIQDKEGIPPDQQR  346


 Score =   298 bits (762),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 149/153 (97%), Positives = 150/153 (98%), Gaps = 0/153 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  288

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGM  531
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG 
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  381



>gb|AAB68045.1| polyubiquitin [Fragaria x ananassa]
Length=381

 Score =   363 bits (932),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  333  KIQDKEGIPPDQQR  346


 Score =   363 bits (931),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 185/194 (95%), Positives = 186/194 (96%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   361 bits (926),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 183/194 (94%), Positives = 184/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  257  KIQDKEGIPPDQQR  270


 Score =   299 bits (765),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 150/153 (98%), Gaps = 0/153 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGM  531
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG 
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  381



>ref|NP_849300.4| polyubiquitin 10 [Arabidopsis thaliana]
 ref|NP_567291.4| polyubiquitin 10 [Arabidopsis thaliana]
 ref|NP_001078353.4| polyubiquitin 10 [Arabidopsis thaliana]
 ref|XP_004134747.1| PREDICTED: polyubiquitin-like isoform 1 [Cucumis sativus]
 ref|XP_004134748.1| PREDICTED: polyubiquitin-like isoform 2 [Cucumis sativus]
 ref|XP_004496773.1| PREDICTED: polyubiquitin-like [Cicer arietinum]
 ref|XP_006360087.1| PREDICTED: polyubiquitin-like isoform X2 [Solanum tuberosum]
 ref|XP_006287939.1| hypothetical protein CARUB_v10001174mg [Capsella rubella]
 ref|XP_006370633.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 ref|XP_006370635.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 ref|XP_006370637.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 ref|XP_006380307.1| hypothetical protein POPTR_0007s02460g [Populus trichocarpa]
 ref|XP_006377834.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 ref|XP_006377835.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 ref|XP_006372946.1| UBIQUITIN 11 family protein [Populus trichocarpa]
 ref|XP_006396616.1| hypothetical protein EUTSA_v10028728mg [Eutrema salsugineum]
 ref|XP_006396617.1| hypothetical protein EUTSA_v10028728mg [Eutrema salsugineum]
 ref|XP_006452184.1| hypothetical protein CICLE_v10008642mg [Citrus clementina]
 ref|XP_007021032.1| Polyubiquitin 10 isoform 1 [Theobroma cacao]
 ref|XP_007021033.1| Polyubiquitin 10 isoform 1 [Theobroma cacao]
 ref|XP_007021035.1| Polyubiquitin 10 [Theobroma cacao]
 ref|XP_007025987.1| Polyubiquitin 10 [Theobroma cacao]
 ref|XP_007143204.1| hypothetical protein PHAVU_007G052600g [Phaseolus vulgaris]
 ref|XP_007211430.1| hypothetical protein PRUPE_ppa007117mg [Prunus persica]
 ref|XP_007211607.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 ref|XP_008244360.1| PREDICTED: polyubiquitin isoform X2 [Prunus mume]
 ref|XP_009365167.1| PREDICTED: polyubiquitin [Pyrus x bretschneideri]
 ref|XP_009358097.1| PREDICTED: polyubiquitin isoform X2 [Pyrus x bretschneideri]
 ref|XP_009358098.1| PREDICTED: polyubiquitin isoform X2 [Pyrus x bretschneideri]
 ref|XP_009343085.1| PREDICTED: polyubiquitin isoform X2 [Pyrus x bretschneideri]
 ref|XP_009343086.1| PREDICTED: polyubiquitin isoform X2 [Pyrus x bretschneideri]
 ref|XP_009611794.1| PREDICTED: polyubiquitin [Nicotiana tomentosiformis]
 ref|XP_009792849.1| PREDICTED: polyubiquitin [Nicotiana sylvestris]
 ref|XP_009793738.1| PREDICTED: polyubiquitin [Nicotiana sylvestris]
 ref|XP_010267760.1| PREDICTED: polyubiquitin [Nelumbo nucifera]
 ref|XP_010423137.1| PREDICTED: polyubiquitin [Camelina sativa]
 ref|XP_010447068.1| PREDICTED: polyubiquitin [Camelina sativa]
 ref|XP_010455857.1| PREDICTED: polyubiquitin [Camelina sativa]
 ref|XP_010644407.1| PREDICTED: polyubiquitin [Vitis vinifera]
 ref|XP_011026350.1| PREDICTED: polyubiquitin [Populus euphratica]
 ref|XP_011030849.1| PREDICTED: polyubiquitin [Populus euphratica]
 ref|XP_011048300.1| PREDICTED: polyubiquitin [Populus euphratica]
 ref|XP_011460984.1| PREDICTED: polyubiquitin [Fragaria vesca subsp. vesca]
 ref|XP_011460993.1| PREDICTED: polyubiquitin [Fragaria vesca subsp. vesca]
 sp|P69322.2|UBIQP_PEA RecName: Full=Polyubiquitin; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor [Pisum sativum]
 emb|CAA34886.1| unnamed protein product [Pisum sativum]
 gb|AAD03344.1| ubiquitin [Pisum sativum]
 gb|AAK96602.1| AT4g05320/C17L7_240 [Arabidopsis thaliana]
 dbj|BAD26592.1| polyubiquitin [Populus nigra]
 gb|ABB73307.1| ubiquitin [Lotus japonicus]
 gb|ABK92512.1| unknown [Populus trichocarpa]
 gb|ABK93264.1| unknown [Populus trichocarpa]
 gb|ABK95903.1| unknown [Populus trichocarpa]
 gb|ABK96012.1| unknown [Populus trichocarpa]
 gb|ABK96127.1| unknown [Populus trichocarpa]
 gb|ACK56276.1| ubiquitin [Populus trichocarpa]
 gb|AEE82501.1| polyubiquitin 10 [Arabidopsis thaliana]
 gb|AEE82504.1| polyubiquitin 10 [Arabidopsis thaliana]
 gb|AEE82505.1| polyubiquitin 10 [Arabidopsis thaliana]
 gb|EMJ12629.1| hypothetical protein PRUPE_ppa007117mg [Prunus persica]
 gb|EMJ12806.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 gb|EOA20837.1| hypothetical protein CARUB_v10001174mg [Capsella rubella]
 gb|EOY12557.1| Polyubiquitin 10 isoform 1 [Theobroma cacao]
 gb|EOY12558.1| Polyubiquitin 10 isoform 1 [Theobroma cacao]
 gb|EOY12560.1| Polyubiquitin 10 [Theobroma cacao]
 gb|EOY28609.1| Polyubiquitin 10 [Theobroma cacao]
 gb|ERP50743.1| UBIQUITIN 11 family protein [Populus trichocarpa]
 gb|ERP55631.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 gb|ERP55632.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 gb|ERP58104.1| hypothetical protein POPTR_0007s02460g [Populus trichocarpa]
 gb|ERP67202.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 gb|ERP67204.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 gb|ERP67206.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 gb|ESQ38069.1| hypothetical protein EUTSA_v10028728mg [Eutrema salsugineum]
 gb|ESQ38070.1| hypothetical protein EUTSA_v10028728mg [Eutrema salsugineum]
 gb|ESR65424.1| hypothetical protein CICLE_v10008642mg [Citrus clementina]
 gb|ESW15198.1| hypothetical protein PHAVU_007G052600g [Phaseolus vulgaris]
 gb|KDO52961.1| hypothetical protein CISIN_1g009518mg [Citrus sinensis]
 gb|KDP20793.1| hypothetical protein JCGZ_21264 [Jatropha curcas]
 gb|AET01628.2| polyubiquitin 3 [Medicago truncatula]
 gb|KEH30745.1| polyubiquitin 3 [Medicago truncatula]
 gb|KJB13593.1| hypothetical protein B456_002G083100 [Gossypium raimondii]
 gb|KJB62633.1| hypothetical protein B456_009G427000 [Gossypium raimondii]
 prf||1603402A poly-ubiquitin
Length=381

 Score =   363 bits (932),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   363 bits (932),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  257  KIQDKEGIPPDQQR  270


 Score =   363 bits (932),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  333  KIQDKEGIPPDQQR  346


 Score =   299 bits (765),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 150/153 (98%), Gaps = 0/153 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGM  531
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG 
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  381



>gb|AAL09741.1| AT4g05320/C17L7_240 [Arabidopsis thaliana]
Length=381

 Score =   363 bits (932),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  333  KIQDKEGIPPDQQR  346


 Score =   360 bits (925),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 183/194 (94%), Positives = 184/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL L LRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLSLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   360 bits (925),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 183/194 (94%), Positives = 184/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVL LRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLSLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  257  KIQDKEGIPPDQQR  270


 Score =   299 bits (765),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 150/153 (98%), Gaps = 0/153 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGM  531
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG 
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  381



>ref|XP_001598085.1| polyubiquitin [Sclerotinia sclerotiorum 1980]
 gb|EDN90771.1| polyubiquitin [Sclerotinia sclerotiorum 1980 UF-70]
Length=305

 Score =   360 bits (924),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 182/194 (94%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTL+DYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   360 bits (924),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 182/194 (94%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTL+DYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  257  KIQDKEGIPPDQQR  270


 Score =   295 bits (755),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 148/152 (97%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGG  528
            FAGKQLEDGRTL DYNIQKESTLHL LRLRGG
Sbjct  273  FAGKQLEDGRTLLDYNIQKESTLHLVLRLRGG  304



>ref|XP_002992988.1| hypothetical protein SELMODRAFT_187148 [Selaginella moellendorffii]
 ref|XP_002994514.1| hypothetical protein SELMODRAFT_138728 [Selaginella moellendorffii]
 gb|EFJ04422.1| hypothetical protein SELMODRAFT_138728 [Selaginella moellendorffii]
 gb|EFJ05934.1| hypothetical protein SELMODRAFT_187148 [Selaginella moellendorffii]
Length=229

 Score =   357 bits (917),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 181/194 (93%), Positives = 182/194 (94%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKT  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   298 bits (762),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 149/153 (97%), Positives = 149/153 (97%), Gaps = 0/153 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGM  531
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGM
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229



>ref|XP_010270791.1| PREDICTED: polyubiquitin-like [Nelumbo nucifera]
Length=382

 Score =   363 bits (932),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   362 bits (930),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 183/194 (94%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKT+TLE ESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTVTLEVESSDTIDNVKA  256

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  257  KIQDKEGIPPDQQR  270


 Score =   362 bits (930),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 183/194 (94%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKT+TLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTVTLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  333  KIQDKEGIPPDQQR  346


 Score =   299 bits (765),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 149/153 (97%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKT+TLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTVTLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGM  531
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG+
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGI  381



>ref|XP_001420612.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO98905.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|KHN17791.1| Polyubiquitin 4 [Glycine soja]
Length=381

 Score =   363 bits (931),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   363 bits (931),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  257  KIQDKEGIPPDQQR  270


 Score =   363 bits (931),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  333  KIQDKEGIPPDQQR  346


 Score =   299 bits (765),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>gb|AAQ07453.1| ubiquitin [Musa acuminata AAA Group]
Length=381

 Score =   363 bits (931),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   361 bits (927),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 183/194 (94%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITL+ ESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLKVESSDTIDNVKA  256

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  257  KIQDKEGIPPDQQR  270


 Score =   361 bits (927),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 183/194 (94%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITL+VESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLKVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  333  KIQDKEGIPPDQQR  346


 Score =   297 bits (760),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 149/152 (98%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITL+VESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLKVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>gb|KJB81824.1| hypothetical protein B456_013G163500 [Gossypium raimondii]
Length=393

 Score =   363 bits (933),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  257  KIQDKEGIPPDQQR  270


 Score =   363 bits (933),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  333  KIQDKEGIPPDQQR  346


 Score =   362 bits (928),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 183/194 (94%), Positives = 184/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   278 bits (711),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 140/143 (98%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  433  FAGKQLEDGRTLADYNIQKESTL  501
            FAGKQLEDGRTLADYNIQKE+ L
Sbjct  349  FAGKQLEDGRTLADYNIQKENPL  371



>ref|XP_010454368.1| PREDICTED: polyubiquitin 4-like [Camelina sativa]
Length=382

 Score =   363 bits (931),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  333  KIQDKEGIPPDQQR  346


 Score =   362 bits (930),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 183/194 (94%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDT+DNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTVDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   362 bits (930),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 183/194 (94%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDT+DNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTVDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  257  KIQDKEGIPPDQQR  270


 Score =   299 bits (765),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>ref|XP_002874006.1| hypothetical protein ARALYDRAFT_488966 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50265.1| hypothetical protein ARALYDRAFT_488966 [Arabidopsis lyrata subsp. 
lyrata]
Length=382

 Score =   363 bits (931),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  257  KIQDKEGIPPDQQR  270


 Score =   363 bits (931),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  333  KIQDKEGIPPDQQR  346


 Score =   362 bits (930),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 183/194 (94%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQ+FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQVFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   299 bits (765),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>gb|ACS68205.1| ubiquitin 10.2 [Brassica napus]
Length=381

 Score =   363 bits (931),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   363 bits (931),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  257  KIQDKEGIPPDQQR  270


 Score =   363 bits (931),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  333  KIQDKEGIPPDQQR  346


 Score =   299 bits (766),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGM  531
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG+
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGI  381



>ref|XP_010240921.1| PREDICTED: polyubiquitin-like [Nelumbo nucifera]
Length=381

 Score =   363 bits (931),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  257  KIQDKEGIPPDQQR  270


 Score =   363 bits (931),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  333  KIQDKEGIPPDQQR  346


 Score =   362 bits (930),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 183/194 (94%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            +QKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   VQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   299 bits (765),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 150/153 (98%), Gaps = 0/153 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGM  531
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG 
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  381



>emb|CDP05795.1| unnamed protein product [Coffea canephora]
Length=381

 Score =   363 bits (931),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  333  KIQDKEGIPPDQQR  346


 Score =   361 bits (927),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 183/194 (94%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI +KEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQEKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   361 bits (927),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 183/194 (94%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQ+KEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQEKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  257  KIQDKEGIPPDQQR  270


 Score =   299 bits (765),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 150/153 (98%), Gaps = 0/153 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGM  531
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG 
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  381



>ref|XP_006593989.1| PREDICTED: polyubiquitin 10-like isoform X1 [Glycine max]
Length=381

 Score =   363 bits (931),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   363 bits (931),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  257  KIQDKEGIPPDQQR  270


 Score =   362 bits (930),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 183/194 (94%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKT+TLE ESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTVTLEVESSDTIDNVKA  332

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  333  KIQDKEGIPPDQQR  346


 Score =   298 bits (764),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 149/153 (97%), Positives = 150/153 (98%), Gaps = 0/153 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKT+TLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTVTLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGM  531
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG 
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  381



>emb|CBY46746.1| polyubiquitin 10 protein, partial [Lepidium campestre]
Length=381

 Score =   363 bits (931),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  257  KIQDKEGIPPDQQR  270


 Score =   363 bits (931),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  333  KIQDKEGIPPDQQR  346


 Score =   362 bits (930),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 183/194 (94%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDT+DNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTVDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   299 bits (765),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 150/153 (98%), Gaps = 0/153 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGM  531
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG 
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  381



>ref|XP_006396612.1| hypothetical protein EUTSA_v10028730mg [Eutrema salsugineum]
 ref|XP_010537979.1| PREDICTED: polyubiquitin [Tarenaya hassleriana]
 emb|CAJ86369.1| OSIGBa0117N13.13 [Oryza sativa Indica Group]
 emb|CAJ86419.1| H0303G06.8 [Oryza sativa Indica Group]
 gb|EAY95663.1| hypothetical protein OsI_17529 [Oryza sativa Indica Group]
 gb|ESQ38065.1| hypothetical protein EUTSA_v10028730mg [Eutrema salsugineum]
Length=381

 Score =   363 bits (931),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   363 bits (931),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  257  KIQDKEGIPPDQQR  270


 Score =   363 bits (931),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  333  KIQDKEGIPPDQQR  346


 Score =   300 bits (767),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGM  531
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG+
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGL  381



>ref|XP_010421267.1| PREDICTED: polyubiquitin 4-like [Camelina sativa]
Length=382

 Score =   363 bits (931),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   363 bits (931),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  257  KIQDKEGIPPDQQR  270


 Score =   362 bits (928),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 183/194 (94%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKE+TLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKETTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  333  KIQDKEGIPPDQQR  346


 Score =   298 bits (762),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 149/152 (98%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKE+TLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  289  IQKETTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>gb|AAB36545.1| ubiquitin-like protein [Phaseolus vulgaris]
Length=407

 Score =   364 bits (934),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  103  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  162

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  163  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  222

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  223  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  282

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  283  KIQDKEGIPPDQQR  296


 Score =   364 bits (934),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  179  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  238

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  239  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  298

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  299  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  358

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  359  KIQDKEGIPPDQQR  372


 Score =   300 bits (767),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  255  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  314

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  315  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  374

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG
Sbjct  375  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  406


 Score =   273 bits (698),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 145/179 (81%), Positives = 152/179 (85%), Gaps = 3/179 (2%)
 Frame = +1

Query  118  EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  297
            +V  S  ++ V A++ D +      Q   FA KQLEDGRTLADYNIQKESTLHLVLRLRG
Sbjct  45   QVFVSHMVEGVDARLLDVQKGHKGAQ--CFA-KQLEDGRTLADYNIQKESTLHLVLRLRG  101

Query  298  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLIFAGKQLEDGRTLADY  477
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  102  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  161

Query  478  NIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKAXIQDKXGIPPDXXK  654
            NIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA IQDK GIPPD  +
Sbjct  162  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  220



>ref|NP_568397.1| ubiquitin 4 [Arabidopsis thaliana]
 ref|XP_002881273.1| hypothetical protein ARALYDRAFT_482268 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_010420904.1| PREDICTED: polyubiquitin 4 [Camelina sativa]
 ref|XP_010493166.1| PREDICTED: polyubiquitin 4 [Camelina sativa]
 sp|P0CH32.1|UBQ4_ARATH RecName: Full=Polyubiquitin 4; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor [Arabidopsis thaliana]
 emb|CAA31331.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAB53929.1| polyubiquitin [Arabidopsis thaliana]
 gb|EFH57532.1| hypothetical protein ARALYDRAFT_482268 [Arabidopsis lyrata subsp. 
lyrata]
 gb|AED92867.1| ubiquitin 4 [Arabidopsis thaliana]
 prf||1515347A poly-ubiquitin
Length=382

 Score =   363 bits (931),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   363 bits (931),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  257  KIQDKEGIPPDQQR  270


 Score =   363 bits (931),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  333  KIQDKEGIPPDQQR  346


 Score =   299 bits (765),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>gb|AAY86773.1| polyubiquitin [Noccaea caerulescens]
Length=382

 Score =   363 bits (931),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   363 bits (931),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  257  KIQDKEGIPPDQQR  270


 Score =   363 bits (931),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  333  KIQDKEGIPPDQQR  346


 Score =   299 bits (765),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>sp|Q58G87.2|UBQ3_ORYSJ RecName: Full=Polyubiquitin 3; Contains: RecName: Full=Ubiquitin-related; 
Contains: RecName: Full=Ubiquitin; Flags: Precursor 
[Oryza sativa Japonica Group]
 emb|CAE04243.3| OSJNBa0089N06.4 [Oryza sativa Japonica Group]
 gb|EAZ32071.1| hypothetical protein OsJ_16259 [Oryza sativa Japonica Group]
Length=381

 Score =   363 bits (931),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  257  KIQDKEGIPPDQQR  270


 Score =   363 bits (931),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  333  KIQDKEGIPPDQQR  346


 Score =   360 bits (924),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 183/194 (94%), Positives = 184/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVE SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVEFSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   300 bits (767),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGM  531
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG+
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGL  381



>ref|XP_009596689.1| PREDICTED: polyubiquitin-like [Nicotiana tomentosiformis]
Length=382

 Score =   363 bits (931),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   363 bits (931),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  257  KIQDKEGIPPDQQR  270


 Score =   363 bits (931),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  333  KIQDKEGIPPDQQR  346


 Score =   299 bits (765),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>ref|XP_006428816.1| hypothetical protein CICLE_v10011684mg [Citrus clementina]
 gb|ESR42056.1| hypothetical protein CICLE_v10011684mg [Citrus clementina]
Length=382

 Score =   363 bits (931),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   363 bits (931),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  257  KIQDKEGIPPDQQR  270


 Score =   363 bits (931),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  333  KIQDKEGIPPDQQR  346


 Score =   299 bits (765),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>ref|XP_007763327.1| polyubiquitin [Coniophora puteana RWD-64-598 SS2]
 gb|EIW86558.1| polyubiquitin [Coniophora puteana RWD-64-598 SS2]
 gb|EUC62408.1| polyubiquitin [Rhizoctonia solani AG-3 Rhs1AP]
 gb|KDQ12738.1| hypothetical protein BOTBODRAFT_34195 [Botryobasidium botryosum 
FD-172 SS1]
 gb|KEP53373.1| polyubiquitin [Rhizoctonia solani 123E]
 gb|KIJ12827.1| hypothetical protein PAXINDRAFT_82237 [Paxillus involutus ATCC 
200175]
 gb|KIK47355.1| hypothetical protein CY34DRAFT_799527 [Suillus luteus UH-Slu-Lm8-n1]
Length=305

 Score =   360 bits (924),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 182/194 (94%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTL+DYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   360 bits (924),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 182/194 (94%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTL+DYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  257  KIQDKEGIPPDQQR  270


 Score =   296 bits (758),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 148/152 (97%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGG  528
            FAGKQLEDGRTL+DYNIQKESTLHL LRLRGG
Sbjct  273  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  304



>gb|EYU18102.1| hypothetical protein MIMGU_mgv1a008166mg [Erythranthe guttata]
Length=383

 Score =   363 bits (931),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  257  KIQDKEGIPPDQQR  270


 Score =   363 bits (931),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  333  KIQDKEGIPPDQQR  346


 Score =   361 bits (926),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 182/194 (94%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDT+DNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTVDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   299 bits (765),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>ref|XP_009591312.1| PREDICTED: polyubiquitin 4 [Nicotiana tomentosiformis]
 ref|XP_011468093.1| PREDICTED: LOW QUALITY PROTEIN: polyubiquitin 4-like [Fragaria 
vesca subsp. vesca]
Length=382

 Score =   363 bits (931),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   363 bits (931),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  257  KIQDKEGIPPDQQR  270


 Score =   363 bits (931),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  333  KIQDKEGIPPDQQR  346


 Score =   299 bits (765),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>ref|XP_010696408.1| PREDICTED: polyubiquitin 4 [Beta vulgaris subsp. vulgaris]
Length=382

 Score =   363 bits (931),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   363 bits (931),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  257  KIQDKEGIPPDQQR  270


 Score =   361 bits (926),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 183/194 (94%), Positives = 184/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVK 
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKT  332

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  333  KIQDKEGIPPDQQR  346


 Score =   297 bits (760),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 149/152 (98%), Positives = 149/152 (98%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KI DKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  348

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>ref|XP_001783045.1| predicted protein [Physcomitrella patens]
 gb|EDQ52114.1| predicted protein [Physcomitrella patens]
Length=229

 Score =   357 bits (916),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 181/194 (93%), Positives = 182/194 (94%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKT  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   295 bits (755),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 148/152 (97%), Positives = 148/152 (97%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>gb|AAX40652.1| polyubiquitin [Oryza sativa Japonica Group]
Length=381

 Score =   363 bits (931),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  257  KIQDKEGIPPDQQR  270


 Score =   362 bits (930),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 183/194 (94%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRL+
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLV  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  333  KIQDKEGIPPDQQR  346


 Score =   360 bits (924),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 183/194 (94%), Positives = 184/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVE SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVEFSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   299 bits (766),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 149/153 (97%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL+FAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLVFAGKQLEDGRTLADYN  288

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGM  531
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG+
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGL  381



>ref|XP_010452435.1| PREDICTED: polyubiquitin-like [Camelina sativa]
Length=305

 Score =   360 bits (924),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 182/194 (94%), Positives = 184/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI D+EGIPPDQQR I
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDQEGIPPDQQRFI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   360 bits (924),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 182/194 (94%), Positives = 184/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQD+EGIPPDQQR IFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDQEGIPPDQQRFIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  257  KIQDKEGIPPDQQR  270


 Score =   299 bits (765),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 150/153 (98%), Gaps = 0/153 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGM  531
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG 
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  305



>ref|XP_002266370.1| PREDICTED: polyubiquitin 4-like [Vitis vinifera]
Length=383

 Score =   363 bits (931),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   363 bits (931),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  257  KIQDKEGIPPDQQR  270


 Score =   363 bits (931),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  333  KIQDKEGIPPDQQR  346


 Score =   299 bits (765),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>ref|XP_006302388.1| hypothetical protein CARUB_v10020456mg [Capsella rubella]
 gb|EOA35286.1| hypothetical protein CARUB_v10020456mg [Capsella rubella]
Length=383

 Score =   363 bits (931),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   363 bits (931),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  257  KIQDKEGIPPDQQR  270


 Score =   363 bits (931),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  333  KIQDKEGIPPDQQR  346


 Score =   299 bits (765),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>gb|EMS65864.1| Polyubiquitin [Triticum urartu]
Length=405

 Score =   363 bits (933),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   363 bits (933),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  257  KIQDKEGIPPDQQR  270


 Score =   363 bits (933),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  333  KIQDKEGIPPDQQR  346


 Score =   300 bits (767),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 152/160 (95%), Positives = 154/160 (96%), Gaps = 2/160 (1%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGG--MQIFVK  546
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG  M  +V+
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGHVMHRYVR  388



>gb|ADO60140.1| ubiquitin [Beauveria bassiana]
Length=215

 Score =   356 bits (914),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 179/194 (92%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTL+DYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVK+
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   270 bits (689),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 134/139 (96%), Positives = 138/139 (99%), Gaps = 0/139 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQK  489
            FAGKQLEDGRTL+DYNIQK
Sbjct  197  FAGKQLEDGRTLSDYNIQK  215



>ref|XP_007366816.1| polyubiquitin [Dichomitus squalens LYAD-421 SS1]
 gb|EJF60398.1| polyubiquitin [Dichomitus squalens LYAD-421 SS1]
Length=305

 Score =   360 bits (923),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 182/194 (94%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTL+DYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  257  KIQDKEGIPPDQQR  270


 Score =   357 bits (917),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 181/194 (93%), Positives = 184/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR L+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRPLSDYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTL+DYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   297 bits (760),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 148/153 (97%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGM  531
            FAGKQLEDGRTL+DYNIQKESTLHL LRLRGG+
Sbjct  273  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGL  305



>ref|XP_009605659.1| PREDICTED: polyubiquitin [Nicotiana tomentosiformis]
Length=305

 Score =   360 bits (923),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 183/194 (94%), Positives = 184/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLED RTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDERTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   360 bits (923),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 183/194 (94%), Positives = 184/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED RTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDERTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  257  KIQDKEGIPPDQQR  270


 Score =   299 bits (765),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 150/153 (98%), Gaps = 0/153 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGM  531
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG 
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  305



>ref|XP_001755431.1| predicted protein [Physcomitrella patens]
 gb|EDQ79911.1| predicted protein [Physcomitrella patens]
Length=231

 Score =   357 bits (916),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 181/194 (93%), Positives = 182/194 (94%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKT  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   292 bits (748),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 147/151 (97%), Positives = 147/151 (97%), Gaps = 0/151 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRG  525
            FAGKQLEDGRTLADYNIQKESTLHL LRLRG
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRG  227



>ref|XP_010275241.1| PREDICTED: polyubiquitin-like [Nelumbo nucifera]
Length=383

 Score =   362 bits (930),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKILDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  257  KIQDKEGIPPDQQR  270


 Score =   360 bits (923),  Expect = 9e-120, Method: Compositional matrix adjust.
 Identities = 183/194 (94%), Positives = 184/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             I DK GIPPD  +
Sbjct  181  KILDKEGIPPDQQR  194


 Score =   360 bits (923),  Expect = 9e-120, Method: Compositional matrix adjust.
 Identities = 183/194 (94%), Positives = 184/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKILDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  333  KIQDKEGIPPDQQR  346


 Score =   299 bits (765),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>dbj|BAL61087.1| polyubiquitin [Dianthus caryophyllus]
Length=229

 Score =   357 bits (915),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 181/194 (93%), Positives = 182/194 (94%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKT  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   295 bits (754),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 148/152 (97%), Positives = 148/152 (97%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>emb|CCT70325.1| UBI4-Ubiquitin [Fusarium fujikuroi IMI 58289]
Length=281

 Score =   358 bits (920),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 180/194 (93%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  53   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  112

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KI DKEGIPPDQQRLI
Sbjct  113  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  172

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTL+DYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVK+
Sbjct  173  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS  232

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  233  KIQDKEGIPPDQQR  246


 Score =   298 bits (762),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 157/194 (81%), Positives = 161/194 (83%), Gaps = 24/194 (12%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDN                        LEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDN------------------------LEDGRTLSDYN  36

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KI DKEGIPPDQQRLI
Sbjct  37   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  96

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVK+
Sbjct  97   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS  156

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  157  KIQDKEGIPPDQQR  170


 Score =   295 bits (754),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 146/152 (96%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  129  MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  188

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KI DKEGIPPDQQRLI
Sbjct  189  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  248

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGG  528
            FAGKQLEDGRTL+DYNIQKESTLHL LRLRGG
Sbjct  249  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  280



>dbj|GAK65396.1| ubiquitin [Pseudozyma antarctica]
Length=334

 Score =   360 bits (925),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 185/206 (90%), Positives = 189/206 (92%), Gaps = 1/206 (0%)
 Frame = +1

Query  37   CDYFRFSILFLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  216
            C    F +L   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  19   CSSALFPLL-QAMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  77

Query  217  QLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXD  396
            QLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI D
Sbjct  78   QLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQD  137

Query  397  KEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLE  576
            KEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHL LRLRGGMQIFVK L GKTITLE
Sbjct  138  KEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE  197

Query  577  GESSDTIDNVKAXIQDKXGIPPDXXK  654
             ESSDTIDNVKA IQDK GIPPD  +
Sbjct  198  VESSDTIDNVKAKIQDKEGIPPDQQR  223


 Score =   360 bits (923),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 182/194 (94%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  106  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  165

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  166  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  225

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTL+DYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  226  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  285

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  286  KIQDKEGIPPDQQR  299


 Score =   296 bits (757),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 148/152 (97%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  182  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  241

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  242  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  301

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGG  528
            FAGKQLEDGRTL+DYNIQKESTLHL LRLRGG
Sbjct  302  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  333



>ref|NP_001053957.1| Os04g0628100 [Oryza sativa Japonica Group]
 dbj|BAF15871.1| Os04g0628100 [Oryza sativa Japonica Group]
Length=392

 Score =   363 bits (931),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  88   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  147

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  148  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  207

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  208  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  267

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  268  KIQDKEGIPPDQQR  281


 Score =   363 bits (931),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  164  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  223

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  224  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  283

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  284  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  343

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  344  KIQDKEGIPPDQQR  357


 Score =   362 bits (929),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 186/201 (93%), Positives = 188/201 (94%), Gaps = 1/201 (0%)
 Frame = +1

Query  52   FSILFLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  231
             S LF +MQIFVKTLTGKTITLEVE SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  6    LSCLF-QMQIFVKTLTGKTITLEVEFSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  64

Query  232  RTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIP  411
            RTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIP
Sbjct  65   RTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  124

Query  412  PDQQRLIFAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSD  591
            PDQQRLIFAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSD
Sbjct  125  PDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  184

Query  592  TIDNVKAXIQDKXGIPPDXXK  654
            TIDNVKA IQDK GIPPD  +
Sbjct  185  TIDNVKAKIQDKEGIPPDQQR  205


 Score =   300 bits (767),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  240  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  299

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  300  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  359

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGM  531
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG+
Sbjct  360  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGL  392



>ref|XP_003670049.1| hypothetical protein NDAI_0D04930 [Naumovozyma dairenensis CBS 
421]
 ref|XP_003959063.1| hypothetical protein KAFR_0I01470 [Kazachstania africana CBS 
2517]
 ref|XP_004181533.1| hypothetical protein TBLA_0G00670 [Tetrapisispora blattae CBS 
6284]
 emb|CCD24806.1| hypothetical protein NDAI_0D04930 [Naumovozyma dairenensis CBS 
421]
 emb|CCF59928.1| hypothetical protein KAFR_0I01470 [Kazachstania africana CBS 
2517]
 emb|CCH62014.1| hypothetical protein TBLA_0G00670 [Tetrapisispora blattae CBS 
6284]
Length=229

 Score =   357 bits (915),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 179/194 (92%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTL+DYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVK+
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   296 bits (758),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 147/153 (96%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGM  531
            FAGKQLEDGRTL+DYNIQKESTLHL LRLRGGM
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  229



>ref|XP_001931824.1| ubiquitin [Pyrenophora tritici-repentis Pt-1C-BFP]
 ref|XP_003305664.1| hypothetical protein PTT_18575 [Pyrenophora teres f. teres 0-1]
 ref|XP_003854274.1| hypothetical protein MYCGRDRAFT_57170 [Zymoseptoria tritici IPO323]
 ref|XP_007275950.1| ubiquitin [Colletotrichum gloeosporioides Nara gc5]
 ref|XP_007376605.1| polyubiquitin [Spathaspora passalidarum NRRL Y-27907]
 ref|XP_007674454.1| hypothetical protein BAUCODRAFT_32336 [Baudoinia compniacensis 
UAMH 10762]
 ref|XP_007741026.1| ubiquitin C [Cladophialophora psammophila CBS 110553]
 ref|XP_009261437.1| hypothetical protein FPSE_10045 [Fusarium pseudograminearum CS3096]
 ref|XP_009650785.1| ubiquitin [Verticillium dahliae VdLs.17]
 ref|XP_011319955.1| ubiquitin [Fusarium graminearum PH-1]
 gb|EDU40929.1| ubiquitin [Pyrenophora tritici-repentis Pt-1C-BFP]
 gb|EFQ86204.1| hypothetical protein PTT_18575 [Pyrenophora teres f. teres 0-1]
 gb|EGP89250.1| hypothetical protein MYCGRDRAFT_57170 [Zymoseptoria tritici IPO323]
 gb|EGW31827.1| polyubiquitin [Spathaspora passalidarum NRRL Y-27907]
 gb|EGY14431.1| ubiquitin [Verticillium dahliae VdLs.17]
 gb|EHK44351.1| hypothetical protein TRIATDRAFT_300588 [Trichoderma atroviride 
IMI 206040]
 gb|EJT46666.1| hypothetical protein A1Q1_04737 [Trichosporon asahii var. asahii 
CBS 2479]
 gb|EKJ69797.1| hypothetical protein FPSE_10045 [Fusarium pseudograminearum CS3096]
 gb|ELA35078.1| ubiquitin [Colletotrichum gloeosporioides Nara gc5]
 gb|EMC98317.1| hypothetical protein BAUCODRAFT_32336 [Baudoinia compniacensis 
UAMH 10762]
 gb|EME45125.1| hypothetical protein DOTSEDRAFT_70987 [Dothistroma septosporum 
NZE10]
 gb|ENH81500.1| ubiquitin [Colletotrichum orbiculare MAFF 240422]
 gb|ESU14530.1| ubiquitin [Fusarium graminearum PH-1]
 emb|CDK27817.1| unnamed protein product [Kuraishia capsulata CBS 1993]
 gb|EXJ73926.1| ubiquitin C [Cladophialophora psammophila CBS 110553]
 gb|EYB28525.1| hypothetical protein FG05_08768 [Fusarium graminearum]
 gb|KEQ58801.1| ubiquitin [Aureobasidium melanogenum CBS 110374]
 gb|KEQ70291.1| ubiquitin [Aureobasidium pullulans var. namibiae CBS 147.97]
 gb|KEQ87814.1| ubiquitin [Aureobasidium pullulans EXF-150]
 gb|KER00813.1| hypothetical protein AUEXF2481DRAFT_25097 [Aureobasidium subglaciale 
EXF-2481]
 emb|CEF77191.1| unnamed protein product [Fusarium graminearum]
 gb|KIV95571.1| polyubiquitin [Exophiala mesophila]
 gb|KIW22916.1| polyubiquitin [Cladophialophora immunda]
 gb|KIW83318.1| polyubiquitin [Fonsecaea pedrosoi CBS 271.37]
 gb|KIW87781.1| polyubiquitin [Cladophialophora bantiana CBS 173.52]
 gb|KIX98997.1| polyubiquitin [Fonsecaea multimorphosa CBS 102226]
Length=229

 Score =   357 bits (915),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 179/194 (92%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTL+DYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVK+
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   294 bits (752),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 146/152 (96%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGG  528
            FAGKQLEDGRTL+DYNIQKESTLHL LRLRGG
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  228



>ref|XP_007924320.1| hypothetical protein MYCFIDRAFT_60610 [Pseudocercospora fijiensis 
CIRAD86]
 gb|EHN05782.1| Ubi4p [Saccharomyces cerevisiae x Saccharomyces kudriavzevii 
VIN7]
 gb|EME83800.1| hypothetical protein MYCFIDRAFT_60610 [Pseudocercospora fijiensis 
CIRAD86]
 gb|EWH17145.1| Ubi4p [Saccharomyces cerevisiae P283]
Length=229

 Score =   357 bits (915),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 179/194 (92%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTL+DYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVK+
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   294 bits (752),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 146/152 (96%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGG  528
            FAGKQLEDGRTL+DYNIQKESTLHL LRLRGG
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  228



>ref|XP_719867.1| hypothetical protein CaO19.6771 [Candida albicans SC5314]
 ref|XP_719750.1| hypothetical protein CaO19.14063 [Candida albicans SC5314]
 emb|CAA76783.1| polyubiquitin [Candida albicans]
 gb|EAL00878.1| hypothetical protein CaO19.14063 [Candida albicans SC5314]
 gb|EAL01003.1| hypothetical protein CaO19.6771 [Candida albicans SC5314]
 gb|EEQ44747.1| hypothetical protein CAWG_03035 [Candida albicans WO-1]
 emb|CCE42351.1| hypothetical protein CPAR2_809000 [Candida parapsilosis]
 gb|EMG49099.1| hypothetical protein G210_0209 [Candida maltosa Xu316]
 gb|KHC79264.1| polyubiquitin [Candida albicans SC5314]
Length=229

 Score =   356 bits (914),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 179/194 (92%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTL+DYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVK+
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   294 bits (752),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 146/153 (95%), Positives = 150/153 (98%), Gaps = 0/153 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGM  531
            FAGKQLEDGRTL+DYNIQKESTLHL LRLRGG 
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGF  229



>ref|XP_001764949.1| predicted protein [Physcomitrella patens]
 gb|EDQ70165.1| predicted protein [Physcomitrella patens]
Length=318

 Score =   360 bits (923),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 182/194 (94%), Positives = 183/194 (94%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKT  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   358 bits (918),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 181/194 (93%), Positives = 182/194 (94%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVK 
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKT  256

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  257  KIQDKEGIPPDQQR  270


 Score =   304 bits (779),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 154/166 (93%), Positives = 155/166 (93%), Gaps = 0/166 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KI DKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTIT  570
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGM+I    L  K IT
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMEIIEDTLASKIIT  318



>emb|CEP60563.1| LALA0S01e13784g1_1 [Lachancea lanzarotensis]
Length=229

 Score =   356 bits (914),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 179/194 (92%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTL+DYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVK+
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   294 bits (753),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 146/153 (95%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGM  531
            FAGKQLEDGRTL+DYNIQKESTLHL LRLRGG+
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGI  229



>ref|XP_009631616.1| PREDICTED: polyubiquitin-like [Nicotiana tomentosiformis]
Length=381

 Score =   362 bits (929),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 183/194 (94%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDN+KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNIKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  333  KIQDKEGIPPDQQR  346


 Score =   357 bits (917),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 181/194 (93%), Positives = 184/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE+SDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVENSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDG TLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDN+KA
Sbjct  121  FAGKQLEDGCTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNIKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   357 bits (917),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 181/194 (93%), Positives = 184/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVE+SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG TLADYN
Sbjct  77   MQIFVKTLTGKTITLEVENSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGCTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDN+KAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNIKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  257  KIQDKEGIPPDQQR  270


 Score =   299 bits (765),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 150/153 (98%), Gaps = 0/153 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGM  531
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG 
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  381



>ref|XP_008020911.1| hypothetical protein SETTUDRAFT_162442 [Setosphaeria turcica 
Et28A]
 gb|EOA91885.1| hypothetical protein SETTUDRAFT_162442 [Setosphaeria turcica 
Et28A]
Length=305

 Score =   359 bits (921),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 181/194 (93%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVK+
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   359 bits (921),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 181/194 (93%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVK+
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS  256

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  257  KIQDKEGIPPDQQR  270


 Score =   296 bits (759),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 148/152 (97%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KI DKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>gb|KJB62483.1| hypothetical protein B456_009G418900 [Gossypium raimondii]
Length=381

 Score =   362 bits (929),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 183/194 (94%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  333  KIQDKEGIPPDQQR  346


 Score =   360 bits (925),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 182/194 (94%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  257  KIQDKEGIPPDQQR  270


 Score =   359 bits (922),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 181/194 (93%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVK+
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   299 bits (766),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>gb|EPX74297.1| ubiquitin [Schizosaccharomyces octosporus yFS286]
Length=230

 Score =   356 bits (914),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 179/194 (92%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTL+DYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVK+
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   293 bits (751),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 146/152 (96%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGG  528
            FAGKQLEDGRTL+DYNIQKESTLHL LRLRGG
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  228



>emb|CAB81074.1| polyubiquitin (ubq10) [Arabidopsis thaliana]
Length=464

 Score =   365 bits (936),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   365 bits (936),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  257  KIQDKEGIPPDQQR  270


 Score =   365 bits (936),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  333  KIQDKEGIPPDQQR  346


 Score =   352 bits (904),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 179/185 (97%), Positives = 179/185 (97%), Gaps = 0/185 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  408

Query  613  XIQDK  627
             IQDK
Sbjct  409  KIQDK  413



>ref|XP_003607669.1| Multidrug resistance protein ABC transporter family [Medicago 
truncatula]
Length=448

 Score =   364 bits (934),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 185/196 (94%), Positives = 186/196 (95%), Gaps = 0/196 (0%)
 Frame = +1

Query  67   LKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  246
             KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  218  FKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  277

Query  247  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQR  426
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQR
Sbjct  278  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  337

Query  427  LIFAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNV  606
            LIFAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNV
Sbjct  338  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV  397

Query  607  KAXIQDKXGIPPDXXK  654
            KA IQDK GIPPD  +
Sbjct  398  KAKIQDKEGIPPDQQR  413


 Score =   298 bits (763),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  296  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  355

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  356  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  415

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG
Sbjct  416  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  447



>ref|XP_002953480.1| polyubiquitin [Volvox carteri f. nagariensis]
 gb|EFJ45453.1| polyubiquitin [Volvox carteri f. nagariensis]
Length=305

 Score =   359 bits (921),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 181/194 (93%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTI+NVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIENVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTI+NVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIENVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   359 bits (921),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 181/194 (93%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTI+NVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIENVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTI+NVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIENVKA  256

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  257  KIQDKEGIPPDQQR  270


 Score =   297 bits (761),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 148/153 (97%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTI+NVKAKI DKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIENVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGM  531
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG+
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGL  305



>ref|XP_001797032.1| hypothetical protein SNOG_06667 [Phaeosphaeria nodorum SN15]
 gb|EAT86498.1| hypothetical protein SNOG_06667 [Phaeosphaeria nodorum SN15]
Length=234

 Score =   356 bits (914),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 179/194 (92%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTL+DYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVK+
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   293 bits (751),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 146/152 (96%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGG  528
            FAGKQLEDGRTL+DYNIQKESTLHL LRLRGG
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  228



>gb|KII93501.1| hypothetical protein PLICRDRAFT_694663 [Plicaturopsis crispa 
FD-325 SS-3]
Length=348

 Score =   360 bits (925),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 182/194 (94%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  44   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  103

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  104  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  163

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTL+DYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  164  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  223

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  224  KIQDKEGIPPDQQR  237


 Score =   360 bits (925),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 182/194 (94%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  120  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  179

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  180  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  239

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTL+DYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  240  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  299

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  300  KIQDKEGIPPDQQR  313


 Score =   296 bits (759),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 148/152 (97%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  196  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  255

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  256  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  315

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGG  528
            FAGKQLEDGRTL+DYNIQKESTLHL LRLRGG
Sbjct  316  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  347



>gb|AAF04147.1| ubiquitin precursor [Hevea brasiliensis]
Length=381

 Score =   362 bits (928),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 187/209 (89%), Positives = 190/209 (91%), Gaps = 1/209 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITL VESSDTIDNVKAKI DKEGIPPDQQR I
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLGVESSDTIDNVKAKIQDKEGIPPDQQRFI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXKXYXSPESSLKXGVPL  699
             IQDK GIPPD  +   +  SSL+   PL
Sbjct  181  KIQDKEGIPPDQQRLIFAG-SSLRMVAPL  208


 Score =   344 bits (883),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 177/194 (91%), Positives = 178/194 (92%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  L     LADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGSSLRMVAPLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  333  KIQDKEGIPPDQQR  346


 Score =   340 bits (872),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 175/194 (90%), Positives = 176/194 (91%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITL VESSDTIDNVKAKIQDKEGIPPDQQR IFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLGVESSDTIDNVKAKIQDKEGIPPDQQRFIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAG  L     LADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  197  FAGSSLRMVAPLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  257  KIQDKEGIPPDQQR  270


 Score =   299 bits (765),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 150/153 (98%), Gaps = 0/153 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGM  531
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG 
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  381



>gb|EMS60894.1| Polyubiquitin [Triticum urartu]
Length=458

 Score =   364 bits (934),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  230  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  289

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  290  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  349

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  350  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  409

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  410  KIQDKEGIPPDQQR  423


 Score =   300 bits (767),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  306  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  365

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  366  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  425

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG
Sbjct  426  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  457


 Score =   215 bits (547),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 110/123 (89%), Positives = 111/123 (90%), Gaps = 0/123 (0%)
 Frame = +1

Query  286  RLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLIFAGKQLEDGRT  465
            RL   MQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLIFAGKQLEDGRT
Sbjct  225  RLEKTMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRT  284

Query  466  LADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKAXIQDKXGIPPD  645
            LADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA IQDK GIPPD
Sbjct  285  LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPD  344

Query  646  XXK  654
              +
Sbjct  345  QQR  347



>gb|ACB87916.1| polyubiquitin 1 [Malus domestica]
Length=208

 Score =   355 bits (910),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 178/194 (92%), Positives = 184/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTG++ITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGESITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGR+LADYNIQKESTLHL LRLRGGM IFVK L GKTITLE ESS+TIDNV+A
Sbjct  121  FAGKQLEDGRSLADYNIQKESTLHLVLRLRGGMHIFVKSLTGKTITLEVESSETIDNVQA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   233 bits (595),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 115/123 (93%), Positives = 121/123 (98%), Gaps = 0/123 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTG++ITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR+LADYN
Sbjct  77   MQIFVKTLTGESITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRSLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGM IFVK+LTGKTITLEVESS+TIDNV+AKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMHIFVKSLTGKTITLEVESSETIDNVQAKIQDKEGIPPDQQRLI  196

Query  433  FAG  441
            FAG
Sbjct  197  FAG  199



>gb|AAC67552.1| polyubiquitin [Saccharum hybrid cultivar H32-8560]
Length=381

 Score =   361 bits (927),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 183/194 (94%), Positives = 184/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQR I
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRXI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   358 bits (920),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 182/194 (94%), Positives = 183/194 (94%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR IFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRXIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLA YNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLAXYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  257  KIQDKEGIPPDQQR  270


 Score =   355 bits (912),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 181/194 (93%), Positives = 182/194 (94%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA YN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAXYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQR I
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRXI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLA YNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLAXYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  333  KIQDKEGIPPDQQR  346


 Score =   294 bits (753),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 148/152 (97%), Positives = 148/152 (97%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR IFAGKQLEDGRTLA YN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRXIFAGKQLEDGRTLAXYN  288

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>ref|XP_001830230.1| ubiquitin [Coprinopsis cinerea okayama7#130]
 gb|EAU91601.1| ubiquitin [Coprinopsis cinerea okayama7#130]
Length=305

 Score =   358 bits (919),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 181/194 (93%), Positives = 184/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTL+DYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   358 bits (919),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 181/194 (93%), Positives = 184/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTL+DYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  257  KIQDKEGIPPDQQR  270


 Score =   296 bits (758),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 148/153 (97%), Positives = 150/153 (98%), Gaps = 0/153 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGM  531
            FAGKQLEDGRTL+DYNIQKESTLHL LRLRGG 
Sbjct  273  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGF  305



>ref|XP_007154492.1| hypothetical protein PHAVU_003G123400g [Phaseolus vulgaris]
 gb|ESW26486.1| hypothetical protein PHAVU_003G123400g [Phaseolus vulgaris]
Length=358

 Score =   360 bits (924),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 183/194 (94%), Positives = 184/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQ ESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQMESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   335 bits (860),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 183/247 (74%), Positives = 184/247 (74%), Gaps = 53/247 (21%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQ ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQMESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXL---------------------------------  513
            FAGKQLEDGRTLADYNIQKESTLHL L                                 
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFAKIQDKEGIPPDQQRLIFAGKQLE  256

Query  514  --------------------RLRGGMQIFVKXLXGKTITLEGESSDTIDNVKAXIQDKXG  633
                                RLRGGMQIFVK L GKTITLE ESSDTIDNVKA IQDK G
Sbjct  257  DGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEG  316

Query  634  IPPDXXK  654
            IPPD  +
Sbjct  317  IPPDQQR  323


 Score =   275 bits (702),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 150/206 (73%), Positives = 151/206 (73%), Gaps = 53/206 (26%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEG-------------------------  177
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEG                         
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  178  ----------------------------IPPDQQRLIFAGKQLEDGRTLADYNIQKESTL  273
                                        IPPDQQRLIFAGKQLEDGRTLADYNIQKESTL
Sbjct  213  IQKESTLHLVLRLRGGMQIFAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTL  272

Query  274  HLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLIFAGKQLE  453
            HLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLIFAGKQLE
Sbjct  273  HLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLE  332

Query  454  DGRTLADYNIQKESTLHLXLRLRGGM  531
            DGRTLADYNIQKESTLHL LRLRGG+
Sbjct  333  DGRTLADYNIQKESTLHLVLRLRGGL  358



>ref|XP_004956019.1| PREDICTED: polyubiquitin 4-like [Setaria italica]
Length=381

 Score =   361 bits (926),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 183/194 (94%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTID+VKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDHVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   361 bits (926),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 183/194 (94%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTID+VKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDHVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  257  KIQDKEGIPPDQQR  270


 Score =   361 bits (926),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 183/194 (94%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTID+VKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDHVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  333  KIQDKEGIPPDQQR  346


 Score =   299 bits (765),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>ref|XP_010436682.1| PREDICTED: polyubiquitin 4-like [Camelina sativa]
Length=462

 Score =   364 bits (934),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  157  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  216

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  217  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  276

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  277  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  336

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  337  KIQDKEGIPPDQQR  350


 Score =   364 bits (934),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  233  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  292

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  293  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  352

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  353  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  412

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  413  KIQDKEGIPPDQQR  426


 Score =   362 bits (929),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 187/206 (91%), Positives = 189/206 (92%), Gaps = 6/206 (3%)
 Frame = +1

Query  55   SILFLKM------QIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  216
            SIL L +      QIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  69   SILHLALRLRGGIQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  128

Query  217  QLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXD  396
            QLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI D
Sbjct  129  QLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQD  188

Query  397  KEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLE  576
            KEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE
Sbjct  189  KEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE  248

Query  577  GESSDTIDNVKAXIQDKXGIPPDXXK  654
             ESSDTIDNVKA IQDK GIPPD  +
Sbjct  249  VESSDTIDNVKAKIQDKEGIPPDQQR  274


 Score =   330 bits (847),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 168/194 (87%), Positives = 177/194 (91%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQI  KTLT KTITL+V+SSDTI+NVKA+IQD+EGIP DQQRLIF+GK L+DG TLADYN
Sbjct  5    MQIHAKTLTEKTITLDVKSSDTINNVKAQIQDREGIPLDQQRLIFSGKLLDDGLTLADYN  64

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKES LHL LRLRGG+QIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  65   IQKESILHLALRLRGGIQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  124

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  125  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  184

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  185  KIQDKEGIPPDQQR  198


 Score =   300 bits (767),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  309  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  368

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  369  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  428

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG
Sbjct  429  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  460


 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 27/46 (59%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = +1

Query  529  MQIFVKXLXGKTITLEGESSDTIDNVKAXIQDKXGIPPDXXKXYXS  666
            MQI  K L  KTITL+ +SSDTI+NVKA IQD+ GIP D  +   S
Sbjct  5    MQIHAKTLTEKTITLDVKSSDTINNVKAQIQDREGIPLDQQRLIFS  50



>ref|XP_009784908.1| PREDICTED: polyubiquitin-like isoform X2 [Nicotiana sylvestris]
Length=449

 Score =   363 bits (933),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  408

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  409  KIQDKEGIPPDQQR  422


 Score =   362 bits (928),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 183/194 (94%), Positives = 184/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKT  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   362 bits (928),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 183/194 (94%), Positives = 184/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  257  KIQDKEGIPPDQQR  270


 Score =   362 bits (928),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 183/194 (94%), Positives = 184/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  333  KIQDKEGIPPDQQR  346


 Score =   287 bits (735),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 144/145 (99%), Positives = 144/145 (99%), Gaps = 0/145 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  305  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  364

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  365  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  424

Query  433  FAGKQLEDGRTLADYNIQKESTLHL  507
            FAGKQLEDGRTLADYNIQKESTLHL
Sbjct  425  FAGKQLEDGRTLADYNIQKESTLHL  449



>gb|EGO00841.1| hypothetical protein SERLA73DRAFT_121253 [Serpula lacrymans var. 
lacrymans S7.3]
Length=371

 Score =   360 bits (925),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 182/194 (94%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  143  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  202

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  203  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  262

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTL+DYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  263  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  322

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  323  KIQDKEGIPPDQQR  336


 Score =   331 bits (848),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 171/194 (88%), Positives = 174/194 (90%), Gaps = 10/194 (5%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQ   
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQH--  118

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
                    GRTL+DYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  119  --------GRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  170

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  171  KIQDKEGIPPDQQR  184


 Score =   331 bits (848),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 171/194 (88%), Positives = 174/194 (90%), Gaps = 10/194 (5%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ           GRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQH----------GRTLSDYN  126

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  127  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  186

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTL+DYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  187  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  246

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  247  KIQDKEGIPPDQQR  260


 Score =   296 bits (759),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 148/152 (97%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  219  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  278

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  279  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  338

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGG  528
            FAGKQLEDGRTL+DYNIQKESTLHL LRLRGG
Sbjct  339  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  370



>ref|XP_003052575.1| predicted protein [Nectria haematococca mpVI 77-13-4]
 gb|EEU46862.1| predicted protein [Nectria haematococca mpVI 77-13-4]
 gb|ENH62031.1| Polyubiquitin [Fusarium oxysporum f. sp. cubense race 1]
 gb|EWG38736.1| polyubiquitin [Fusarium verticillioides 7600]
 gb|EWY88137.1| ubiquitin C [Fusarium oxysporum FOSC 3-a]
 gb|EWZ87537.1| ubiquitin C [Fusarium oxysporum f. sp. lycopersici MN25]
 gb|EXA41161.1| ubiquitin C [Fusarium oxysporum f. sp. pisi HDV247]
 gb|EXK33938.1| ubiquitin C [Fusarium oxysporum f. sp. melonis 26406]
 gb|EXK99281.1| ubiquitin C [Fusarium oxysporum f. sp. raphani 54005]
 gb|EXL44710.1| ubiquitin C [Fusarium oxysporum f. sp. radicis-lycopersici 26381]
 gb|EXL88175.1| ubiquitin C [Fusarium oxysporum f. sp. conglutinans race 2 54008]
 gb|EXM08998.1| ubiquitin C [Fusarium oxysporum f. sp. cubense tropical race 
4 54006]
 gb|EXM34538.1| ubiquitin C [Fusarium oxysporum f. sp. vasinfectum 25433]
 gb|KIL89583.1| polyubiquitin [Fusarium avenaceum]
Length=305

 Score =   358 bits (919),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 180/194 (93%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVK+
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   358 bits (919),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 180/194 (93%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTL+DYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVK+
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS  256

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  257  KIQDKEGIPPDQQR  270


 Score =   294 bits (752),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 146/152 (96%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KI DKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGG  528
            FAGKQLEDGRTL+DYNIQKESTLHL LRLRGG
Sbjct  273  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  304



>ref|XP_010324326.1| PREDICTED: polyubiquitin isoform X1 [Solanum lycopersicum]
Length=457

 Score =   363 bits (933),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   360 bits (925),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 183/194 (94%), Positives = 184/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIP D  +
Sbjct  257  KIQDKEGIPSDQQR  270


 Score =   360 bits (925),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 183/194 (94%), Positives = 184/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIP DQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPSDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  333  KIQDKEGIPPDQQR  346


 Score =   360 bits (925),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 183/194 (94%), Positives = 184/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP DQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPSDQQRLIFAGKQLEDGRTLADYN  288

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  408

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  409  KIQDKEGIPPDQQR  422


 Score =   299 bits (766),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 150/153 (98%), Gaps = 0/153 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  305  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  364

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  365  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  424

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGM  531
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG 
Sbjct  425  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  457



>gb|AAO43310.1| putative polyubiquitin [Arabidopsis thaliana]
Length=250

 Score =   356 bits (913),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 180/194 (93%), Positives = 183/194 (94%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEV+SSDTIDN+KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  21   MQIFVKTLTGKTITLEVKSSDTIDNIKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  80

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGK ITLEVESSDTIDNVKAKI DKE IPPDQQRLI
Sbjct  81   IQKESTLHLVLRLRGGMQIFVKTLTGKIITLEVESSDTIDNVKAKIQDKEWIPPDQQRLI  140

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  141  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  200

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  201  KIQDKEGIPPDQQR  214


 Score =   291 bits (744),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 147/152 (97%), Positives = 147/152 (97%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGK ITLEVESSDTIDNVKAKIQDKE IPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  97   MQIFVKTLTGKIITLEVESSDTIDNVKAKIQDKEWIPPDQQRLIFAGKQLEDGRTLADYN  156

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  157  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  216

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGG  528
            FAGKQLEDGRTLA YNIQKESTLHL LRLRGG
Sbjct  217  FAGKQLEDGRTLAVYNIQKESTLHLVLRLRGG  248


 Score =   245 bits (625),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 123/138 (89%), Positives = 126/138 (91%), Gaps = 0/138 (0%)
 Frame = +1

Query  241  ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQ  420
            ADYNIQKE TLHLVLRLRGGMQIFVKTLTGKTITLEV+SSDTIDN+KAKI DKEGIPPDQ
Sbjct  1    ADYNIQKEPTLHLVLRLRGGMQIFVKTLTGKTITLEVKSSDTIDNIKAKIQDKEGIPPDQ  60

Query  421  QRLIFAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTID  600
            QRLIFAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GK ITLE ESSDTID
Sbjct  61   QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKIITLEVESSDTID  120

Query  601  NVKAXIQDKXGIPPDXXK  654
            NVKA IQDK  IPPD  +
Sbjct  121  NVKAKIQDKEWIPPDQQR  138



>gb|AFR98116.1| polyubiquitin [Cryptococcus neoformans var. grubii H99]
Length=381

 Score =   361 bits (926),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 182/194 (94%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTL+DYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   361 bits (926),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 182/194 (94%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTL+DYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  257  KIQDKEGIPPDQQR  270


 Score =   361 bits (926),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 182/194 (94%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTL+DYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  333  KIQDKEGIPPDQQR  346


 Score =   299 bits (765),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 149/153 (97%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  288

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGM  531
            FAGKQLEDGRTL+DYNIQKESTLHL LRLRGGM
Sbjct  349  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  381



>gb|KIK17147.1| hypothetical protein PISMIDRAFT_685607 [Pisolithus microcarpus 
441]
Length=381

 Score =   361 bits (926),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 182/194 (94%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTL+DYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   361 bits (926),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 182/194 (94%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTL+DYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  257  KIQDKEGIPPDQQR  270


 Score =   361 bits (926),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 182/194 (94%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTL+DYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  333  KIQDKEGIPPDQQR  346


 Score =   297 bits (760),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 148/153 (97%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  288

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGM  531
            FAGKQLEDGRTL+DYNIQKESTLHL LRLRGG+
Sbjct  349  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGI  381



>ref|XP_001880135.1| ubiquitin [Laccaria bicolor S238N-H82]
 ref|XP_007307861.1| ubiquitin [Stereum hirsutum FP-91666 SS1]
 ref|XP_007843605.1| ubiquitin [Moniliophthora roreri MCA 2997]
 ref|XP_009541704.1| hypothetical protein HETIRDRAFT_469462 [Heterobasidion irregulare 
TC 32-1]
 ref|XP_009547126.1| hypothetical protein HETIRDRAFT_409860 [Heterobasidion irregulare 
TC 32-1]
 emb|CAA80851.1| ubiquitin [Phanerochaete chrysosporium]
 gb|EDR08822.1| ubiquitin [Laccaria bicolor S238N-H82]
 gb|EIM82624.1| ubiquitin [Stereum hirsutum FP-91666 SS1]
 gb|ESK97130.1| ubiquitin [Moniliophthora roreri MCA 2997]
 gb|ETW80366.1| hypothetical protein HETIRDRAFT_409860 [Heterobasidion irregulare 
TC 32-1]
 gb|ETW87847.1| hypothetical protein HETIRDRAFT_469462 [Heterobasidion irregulare 
TC 32-1]
 gb|KDR75791.1| hypothetical protein GALMADRAFT_248496 [Galerina marginata CBS 
339.88]
 gb|KIK67299.1| hypothetical protein GYMLUDRAFT_37383 [Gymnopus luxurians FD-317 
M1]
 gb|KIY66896.1| ubiquitin, partial [Cylindrobasidium torrendii FP15055 ss-10]
Length=381

 Score =   361 bits (926),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 182/194 (94%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTL+DYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   361 bits (926),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 182/194 (94%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTL+DYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  257  KIQDKEGIPPDQQR  270


 Score =   361 bits (926),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 182/194 (94%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTL+DYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  333  KIQDKEGIPPDQQR  346


 Score =   297 bits (761),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 148/153 (97%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  288

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGM  531
            FAGKQLEDGRTL+DYNIQKESTLHL LRLRGG+
Sbjct  349  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGL  381



>gb|AAN31845.1| putative polyubiquitin (UBQ10) [Arabidopsis thaliana]
Length=464

 Score =   363 bits (933),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   363 bits (933),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  257  KIQDKEGIPPDQQR  270


 Score =   363 bits (933),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  333  KIQDKEGIPPDQQR  346


 Score =   363 bits (933),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 184/191 (96%), Positives = 184/191 (96%), Gaps = 0/191 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  408

Query  613  XIQDKXGIPPD  645
             IQDK GIPPD
Sbjct  409  KIQDKEGIPPD  419



>gb|KII92029.1| hypothetical protein PLICRDRAFT_172184 [Plicaturopsis crispa 
FD-325 SS-3]
Length=389

 Score =   361 bits (926),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 182/194 (94%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  9    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  68

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  69   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  128

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTL+DYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  129  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  188

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  189  KIQDKEGIPPDQQR  202


 Score =   361 bits (926),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 182/194 (94%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  85   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  144

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  145  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  204

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTL+DYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  205  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  264

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  265  KIQDKEGIPPDQQR  278


 Score =   361 bits (926),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 182/194 (94%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  161  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  220

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  221  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  280

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTL+DYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  281  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  340

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  341  KIQDKEGIPPDQQR  354


 Score =   298 bits (762),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 148/153 (97%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  237  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  296

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  297  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  356

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGM  531
            FAGKQLEDGRTL+DYNIQKESTLHL LRLRGG+
Sbjct  357  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGL  389



>ref|XP_007211609.1| hypothetical protein PRUPE_ppa005507mg [Prunus persica]
 gb|AAL27564.1|AF429430_1 polyubiquitin OUB2 [Olea europaea]
 gb|EMJ12808.1| hypothetical protein PRUPE_ppa005507mg [Prunus persica]
Length=457

 Score =   363 bits (932),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   363 bits (932),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  257  KIQDKEGIPPDQQR  270


 Score =   363 bits (932),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  333  KIQDKEGIPPDQQR  346


 Score =   363 bits (932),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  408

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  409  KIQDKEGIPPDQQR  422


 Score =   300 bits (768),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 150/153 (98%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  305  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  364

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  365  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  424

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGM  531
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG+
Sbjct  425  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGL  457



>emb|CAA40324.1| hexaubiquitin protein [Helianthus annuus]
 emb|CAA40325.1| hexaubiquitin protein [Helianthus annuus]
Length=457

 Score =   363 bits (932),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   363 bits (932),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  257  KIQDKEGIPPDQQR  270


 Score =   363 bits (932),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  333  KIQDKEGIPPDQQR  346


 Score =   363 bits (932),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  408

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  409  KIQDKEGIPPDQQR  422


 Score =   299 bits (766),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  305  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  364

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  365  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  424

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG
Sbjct  425  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  456



>gb|ACX46987.1| ubiquitin [Guzmania wittmackii x Guzmania lingulata]
Length=441

 Score =   363 bits (931),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  408

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  409  KIQDKEGIPPDQQR  422


 Score =   361 bits (926),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 183/194 (94%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPP+  +
Sbjct  181  KIQDKEGIPPEQQR  194


 Score =   361 bits (926),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 183/194 (94%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPP+QQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPEQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  257  KIQDKEGIPPDQQR  270


 Score =   361 bits (926),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 183/194 (94%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPEQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  333  KIQDKEGIPPDQQR  346


 Score =   254 bits (649),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 128/129 (99%), Positives = 128/129 (99%), Gaps = 0/129 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  305  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  364

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  365  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  424

Query  433  FAGKQLEDG  459
            FAGKQLEDG
Sbjct  425  FAGKQLEDG  433



>gb|KDP42860.1| hypothetical protein JCGZ_23802 [Jatropha curcas]
Length=457

 Score =   363 bits (932),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   363 bits (932),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  257  KIQDKEGIPPDQQR  270


 Score =   363 bits (932),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  333  KIQDKEGIPPDQQR  346


 Score =   361 bits (926),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 183/190 (96%), Positives = 183/190 (96%), Gaps = 0/190 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  408

Query  613  XIQDKXGIPP  642
             IQDK GIPP
Sbjct  409  KIQDKEGIPP  418


 Score =   296 bits (757),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 149/153 (97%), Positives = 149/153 (97%), Gaps = 0/153 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  305  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  364

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPP QQRLI
Sbjct  365  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPVQQRLI  424

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGM  531
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG 
Sbjct  425  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  457



>ref|NP_001045980.1| Os02g0161900 [Oryza sativa Japonica Group]
 ref|NP_001058378.1| Os06g0681400 [Oryza sativa Japonica Group]
 ref|XP_006646911.1| PREDICTED: polyubiquitin-like [Oryza brachyantha]
 gb|AAF01315.1|AF184279_1 polyubiquitin [Oryza sativa Indica Group]
 gb|AAF01316.1|AF184280_1 polyubiquitin [Oryza sativa Indica Group]
 emb|CAA53665.1| polyubiquitin [Oryza sativa Indica Group]
 gb|AAC49806.1| polyubiquitin [Oryza sativa Indica Group]
 dbj|BAD25213.1| polyubiquitin 6 [Oryza sativa Japonica Group]
 dbj|BAF07894.1| Os02g0161900 [Oryza sativa Japonica Group]
 dbj|BAF20292.1| Os06g0681400 [Oryza sativa Japonica Group]
 dbj|BAG95117.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC72542.1| hypothetical protein OsI_05955 [Oryza sativa Indica Group]
 gb|EEE56356.1| hypothetical protein OsJ_05481 [Oryza sativa Japonica Group]
 gb|ADB84621.1| polyubiquitin [Oryza sativa Japonica Group]
 gb|ADM86852.1| polyubiquitin [Oryza sativa Japonica Group]
 dbj|BAK06683.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gb|AEE65380.1| ubiquitin 2 [Panicum virgatum]
 gb|AFW66449.1| ubiquitin2 [Zea mays]
Length=457

 Score =   363 bits (932),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   363 bits (932),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  257  KIQDKEGIPPDQQR  270


 Score =   363 bits (932),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  333  KIQDKEGIPPDQQR  346


 Score =   363 bits (932),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  408

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  409  KIQDKEGIPPDQQR  422


 Score =   299 bits (766),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  305  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  364

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  365  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  424

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG
Sbjct  425  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  456



>ref|XP_002452705.1| hypothetical protein SORBIDRAFT_04g031060 [Sorghum bicolor]
 gb|EES05681.1| hypothetical protein SORBIDRAFT_04g031060 [Sorghum bicolor]
Length=459

 Score =   363 bits (932),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   363 bits (932),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  257  KIQDKEGIPPDQQR  270


 Score =   363 bits (932),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  153  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  212

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  333  KIQDKEGIPPDQQR  346


 Score =   363 bits (932),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  229  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  288

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  348

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGGMQIFVKXLXGKTITLEGESSDTIDNVKA  612
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGGMQIFVK L GKTITLE ESSDTIDNVKA
Sbjct  349  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  408

Query  613  XIQDKXGIPPDXXK  654
             IQDK GIPPD  +
Sbjct  409  KIQDKEGIPPDQQR  422


 Score =   299 bits (766),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 150/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  73   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  252
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  305  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  364

Query  253  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  432
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  365  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  424

Query  433  FAGKQLEDGRTLADYNIQKESTLHLXLRLRGG  528
            FAGKQLEDGRTLADYNIQKESTLHL LRLRGG
Sbjct  425  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  456



Lambda      K        H        a         alpha
   0.316    0.137    0.379    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1620118203410