BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001O14

Length=598
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KDO77195.1|  hypothetical protein CISIN_1g033622mg                 68.2    2e-11   Citrus sinensis [apfelsine]
ref|XP_006468587.1|  PREDICTED: uncharacterized protein LOC102611829  68.2    2e-11   Citrus sinensis [apfelsine]
ref|XP_006448587.1|  hypothetical protein CICLE_v10017227mg           66.2    1e-10   Citrus clementina [clementine]
ref|XP_002272698.1|  PREDICTED: uncharacterized protein LOC100242357  60.1    2e-08   Vitis vinifera
ref|XP_011076427.1|  PREDICTED: uncharacterized protein LOC105160648  59.3    3e-08   Sesamum indicum [beniseed]
ref|XP_002530128.1|  conserved hypothetical protein                   59.3    3e-08   
emb|CDP04089.1|  unnamed protein product                              58.2    7e-08   Coffea canephora [robusta coffee]
ref|XP_009786185.1|  PREDICTED: uncharacterized protein LOC104234327  57.8    8e-08   Nicotiana sylvestris
ref|XP_010100615.1|  hypothetical protein L484_011546                 55.8    5e-07   Morus notabilis
ref|XP_004293872.1|  PREDICTED: uncharacterized protein LOC101296935  55.5    6e-07   Fragaria vesca subsp. vesca
ref|XP_006363158.1|  PREDICTED: uncharacterized protein LOC102589628  55.1    9e-07   Solanum tuberosum [potatoes]
gb|EYU20186.1|  hypothetical protein MIMGU_mgv1a016532mg              54.7    1e-06   Erythranthe guttata [common monkey flower]
ref|XP_009614340.1|  PREDICTED: uncharacterized protein LOC104107286  54.3    1e-06   Nicotiana tomentosiformis
ref|XP_004134518.1|  PREDICTED: uncharacterized protein LOC101221511  54.3    2e-06   Cucumis sativus [cucumbers]
gb|KDO77197.1|  hypothetical protein CISIN_1g033622mg                 53.1    2e-06   Citrus sinensis [apfelsine]
ref|XP_006303442.1|  hypothetical protein CARUB_v10010686mg           53.9    2e-06   Capsella rubella
gb|KDP43127.1|  hypothetical protein JCGZ_26660                       52.8    5e-06   Jatropha curcas
ref|XP_008439430.1|  PREDICTED: uncharacterized protein LOC103484241  52.8    5e-06   Cucumis melo [Oriental melon]
ref|XP_004232614.1|  PREDICTED: uncharacterized protein LOC101249230  52.4    7e-06   Solanum lycopersicum
ref|XP_010478530.1|  PREDICTED: uncharacterized protein LOC104757481  52.4    9e-06   Camelina sativa [gold-of-pleasure]
gb|KEH31434.1|  hypothetical protein MTR_4g094782                     51.6    2e-05   Medicago truncatula
ref|XP_007040991.1|  Uncharacterized protein TCM_005979               51.6    2e-05   Theobroma cacao [chocolate]
ref|XP_006415397.1|  hypothetical protein EUTSA_v10009126mg           50.8    3e-05   Eutrema salsugineum [saltwater cress]
ref|XP_002893653.1|  hypothetical protein ARALYDRAFT_473330           50.4    4e-05   
gb|ACJ84077.1|  unknown                                               50.4    4e-05   Medicago truncatula
ref|XP_009115027.1|  PREDICTED: uncharacterized protein LOC103840281  49.7    7e-05   Brassica rapa
ref|XP_009107755.1|  PREDICTED: uncharacterized protein LOC103833...  49.3    1e-04   Brassica rapa
emb|CDY12451.1|  BnaC08g09400D                                        48.9    1e-04   Brassica napus [oilseed rape]
emb|CDY52185.1|  BnaAnng11260D                                        48.9    2e-04   Brassica napus [oilseed rape]
ref|XP_007158856.1|  hypothetical protein PHAVU_002G187600g           48.5    2e-04   Phaseolus vulgaris [French bean]
ref|XP_003524827.1|  PREDICTED: uncharacterized protein LOC100807...  48.5    2e-04   Glycine max [soybeans]
ref|XP_008371930.1|  PREDICTED: uncharacterized protein LOC103435323  48.1    3e-04   
ref|XP_003531115.1|  PREDICTED: uncharacterized protein LOC100777859  47.8    3e-04   Glycine max [soybeans]
ref|XP_008383255.1|  PREDICTED: uncharacterized protein LOC103445977  47.8    4e-04   Malus domestica [apple tree]
ref|XP_010499642.1|  PREDICTED: uncharacterized protein LOC104777131  47.8    4e-04   Camelina sativa [gold-of-pleasure]
ref|XP_009340257.1|  PREDICTED: uncharacterized protein LOC103932397  47.8    5e-04   Pyrus x bretschneideri [bai li]
ref|XP_009363271.1|  PREDICTED: uncharacterized protein LOC103953260  47.4    5e-04   Pyrus x bretschneideri [bai li]
gb|EPS68746.1|  hypothetical protein M569_06027                       46.6    0.001   Genlisea aurea



>gb|KDO77195.1| hypothetical protein CISIN_1g033622mg [Citrus sinensis]
Length=105

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 57/86 (66%), Positives = 65/86 (76%), Gaps = 7/86 (8%)
 Frame = +1

Query  118  MAKSMRSKREKRLRAIRREIVSADPITqkkedaklaaqeaalaaPKVPVRSQSTTNRTTA  297
            MAKSMRSKREKRLRAIRREIV  +P  +KK++AK AAQEAALAAPK+PVRS     +T +
Sbjct  1    MAKSMRSKREKRLRAIRREIV--EPFYEKKDEAKFAAQEAALAAPKLPVRSP----KTNS  54

Query  298  MSIEPAPTTSIDKDNNMDVEMDDDTQ  375
            M I   PT +   DNNMDVEM D TQ
Sbjct  55   MEI-ATPTATSTADNNMDVEMADGTQ  79



>ref|XP_006468587.1| PREDICTED: uncharacterized protein LOC102611829 [Citrus sinensis]
 gb|KDO77196.1| hypothetical protein CISIN_1g033622mg [Citrus sinensis]
Length=115

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 57/86 (66%), Positives = 65/86 (76%), Gaps = 7/86 (8%)
 Frame = +1

Query  118  MAKSMRSKREKRLRAIRREIVSADPITqkkedaklaaqeaalaaPKVPVRSQSTTNRTTA  297
            MAKSMRSKREKRLRAIRREIV  +P  +KK++AK AAQEAALAAPK+PVRS     +T +
Sbjct  1    MAKSMRSKREKRLRAIRREIV--EPFYEKKDEAKFAAQEAALAAPKLPVRSP----KTNS  54

Query  298  MSIEPAPTTSIDKDNNMDVEMDDDTQ  375
            M I   PT +   DNNMDVEM D TQ
Sbjct  55   MEIA-TPTATSTADNNMDVEMADGTQ  79



>ref|XP_006448587.1| hypothetical protein CICLE_v10017227mg [Citrus clementina]
 gb|ESR61827.1| hypothetical protein CICLE_v10017227mg [Citrus clementina]
Length=115

 Score = 66.2 bits (160),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 56/86 (65%), Positives = 64/86 (74%), Gaps = 7/86 (8%)
 Frame = +1

Query  118  MAKSMRSKREKRLRAIRREIVSADPITqkkedaklaaqeaalaaPKVPVRSQSTTNRTTA  297
            MAKSMRSKREKRLRAIRREIV  +P  +KK++AK AAQEAALAAPK+PVRS     +T +
Sbjct  1    MAKSMRSKREKRLRAIRREIV--EPFYEKKDEAKFAAQEAALAAPKLPVRSP----KTNS  54

Query  298  MSIEPAPTTSIDKDNNMDVEMDDDTQ  375
            M I   PT +   DNNMDVEM D  Q
Sbjct  55   MEIA-TPTATSTADNNMDVEMADGNQ  79



>ref|XP_002272698.1| PREDICTED: uncharacterized protein LOC100242357 [Vitis vinifera]
 emb|CBI27245.3| unnamed protein product [Vitis vinifera]
Length=124

 Score = 60.1 bits (144),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 52/87 (60%), Positives = 64/87 (74%), Gaps = 3/87 (3%)
 Frame = +1

Query  118  MAKSMRSKREKRLRAIRREIVSADPITqkkedaklaaqeaalaaPKVPVRSQSTTNRTTA  297
            MAKSMRSKREKRLRAIRRE+V  +P+   K+ AKLAAQEAALAAPK+PVR   +T+ + A
Sbjct  1    MAKSMRSKREKRLRAIRRELV--EPLYDAKDAAKLAAQEAALAAPKLPVRPTPSTSTSIA  58

Query  298  MSIEPAPTTSID-KDNNMDVEMDDDTQ  375
                 A T+++D    +MDVEMDD  Q
Sbjct  59   ADATTAITSAMDLTATSMDVEMDDGNQ  85



>ref|XP_011076427.1| PREDICTED: uncharacterized protein LOC105160648 [Sesamum indicum]
Length=114

 Score = 59.3 bits (142),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 55/86 (64%), Positives = 63/86 (73%), Gaps = 7/86 (8%)
 Frame = +1

Query  118  MAKSMRSKREKRLRAIRREIVSADPITqkkedaklaaqeaalaaPKVPVRSQSTTNRTTA  297
            MAKSMRSKREKRLRAIRRE+V  +PI +KKE AKLAAQEAALAA K+PV+S      + A
Sbjct  1    MAKSMRSKREKRLRAIRRELV--EPIYEKKEAAKLAAQEAALAASKLPVKSAP----SAA  54

Query  298  MSIEPAPTTSIDKDNNMDVEMDDDTQ  375
            M    A TTS + D+ MDVEM D  Q
Sbjct  55   MDFVAAATTSAN-DDGMDVEMADGNQ  79



>ref|XP_002530128.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF32272.1| conserved hypothetical protein [Ricinus communis]
Length=141

 Score = 59.3 bits (142),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 50/87 (57%), Positives = 62/87 (71%), Gaps = 6/87 (7%)
 Frame = +1

Query  118  MAKSMRSKREKRLRAIRREIVSADPITqkkedaklaaqeaalaaPKVPVRSQSTTNRTTA  297
            MAKS+RSKREKRLRAIRR++V  +P  +KK+ AKLAA E AL+APK+PV   +++    A
Sbjct  1    MAKSLRSKREKRLRAIRRDMV--EPYYEKKDAAKLAAMETALSAPKLPVFKPTSSASANA  58

Query  298  MSIEPAPTTSIDKDN-NMDVEMDDDTQ  375
            M +    T SI   N NMDVEMDDD Q
Sbjct  59   MDLT---TPSIPTSNANMDVEMDDDNQ  82



>emb|CDP04089.1| unnamed protein product [Coffea canephora]
Length=114

 Score = 58.2 bits (139),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 50/81 (62%), Positives = 64/81 (79%), Gaps = 6/81 (7%)
 Frame = +1

Query  118  MAKSMRSKREKRLRAIRREIVSADPITqkkedaklaaqeaalaaPKVPVRSQSTTNRTTA  297
            MAKSMRSKREKRLRAIRRE+V  +P+ QKKE+AKLAAQEAAL APK+PVRS ++   +  
Sbjct  1    MAKSMRSKREKRLRAIRREMV--EPLYQKKEEAKLAAQEAALNAPKLPVRSHNSDASSMD  58

Query  298  MSIEPAPTTSIDKDNNMDVEM  360
            ++  P+ T++    N+MDVEM
Sbjct  59   LTTIPSSTST----NDMDVEM  75



>ref|XP_009786185.1| PREDICTED: uncharacterized protein LOC104234327 [Nicotiana sylvestris]
Length=114

 Score = 57.8 bits (138),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 53/86 (62%), Positives = 63/86 (73%), Gaps = 6/86 (7%)
 Frame = +1

Query  118  MAKSMRSKREKRLRAIRREIVSADPITqkkedaklaaqeaalaaPKVPVRSQSTTNRTTA  297
            MAKSMR KREKRLRAI+REIV+++P   KKE AKLAAQEAALAAPK+ V+S ST   +TA
Sbjct  1    MAKSMRCKREKRLRAIKREIVASEPSVLKKEAAKLAAQEAALAAPKLVVKSPST---STA  57

Query  298  MSIEPAPTTSIDKDNNMDVEMDDDTQ  375
            M       ++ + DN MDVEM D  Q
Sbjct  58   MDTS---ASTPNNDNAMDVEMADGNQ  80



>ref|XP_010100615.1| hypothetical protein L484_011546 [Morus notabilis]
 gb|EXB83252.1| hypothetical protein L484_011546 [Morus notabilis]
Length=121

 Score = 55.8 bits (133),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 49/84 (58%), Positives = 61/84 (73%), Gaps = 7/84 (8%)
 Frame = +1

Query  118  MAKSMRSKREKRLRAIRREIVSADPITqkkedaklaaqeaalaaPKVPVRSQSTTNRTTA  297
            MAKSMR KREKRLRAIRR++V  +P  + K+ AKLAA EAA+ APK+PV+ Q+TT  ++A
Sbjct  1    MAKSMRCKREKRLRAIRRDMV--EPFYENKDAAKLAALEAAMNAPKLPVK-QTTTTSSSA  57

Query  298  MSIEPAPTTSIDKDNNMDVEMDDD  369
            M  E A  TS    N MD+EM DD
Sbjct  58   M--EAAEPTSA--ANGMDIEMADD  77



>ref|XP_004293872.1| PREDICTED: uncharacterized protein LOC101296935 [Fragaria vesca 
subsp. vesca]
Length=118

 Score = 55.5 bits (132),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 64/86 (74%), Gaps = 8/86 (9%)
 Frame = +1

Query  118  MAKSMRSKREKRLRAIRREIVSADPITqkkedaklaaqeaalaaPKVPVRSQSTTNRTTA  297
            MAKSMR KREKRLRAIRRE+V  +P  +KK++AKLAAQEAALAAPK+PV+  S    +++
Sbjct  1    MAKSMRCKREKRLRAIRREMV--EPYYEKKDEAKLAAQEAALAAPKLPVKPSSKA--SSS  56

Query  298  MSIEPAPTTSIDKDNNMDVEMDDDTQ  375
            M I P  T+    +N M+VEM D +Q
Sbjct  57   MEITPVSTS----ENAMEVEMADGSQ  78



>ref|XP_006363158.1| PREDICTED: uncharacterized protein LOC102589628 [Solanum tuberosum]
Length=114

 Score = 55.1 bits (131),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 52/86 (60%), Positives = 63/86 (73%), Gaps = 6/86 (7%)
 Frame = +1

Query  118  MAKSMRSKREKRLRAIRREIVSADPITqkkedaklaaqeaalaaPKVPVRSQSTTNRTTA  297
            MAKSMRSKREKRLRAIRR+IV+ +P   KKE AKL AQEAALAAPK+ V+S  +  RTT 
Sbjct  1    MAKSMRSKREKRLRAIRRDIVATEPTVLKKEAAKLVAQEAALAAPKLIVKSPFS--RTT-  57

Query  298  MSIEPAPTTSIDKDNNMDVEMDDDTQ  375
              ++ + +TS D D  MDVE+ D  Q
Sbjct  58   --MDTSASTSND-DTKMDVEIADGNQ  80



>gb|EYU20186.1| hypothetical protein MIMGU_mgv1a016532mg [Erythranthe guttata]
Length=117

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 61/86 (71%), Gaps = 3/86 (3%)
 Frame = +1

Query  118  MAKSMRSKREKRLRAIRREIVSADPITqkkedaklaaqeaalaaPKVPVRSQSTTNRTTA  297
            MAKSMRSKREKRLRAIRRE+V  +PI  KK+ AKLAAQ+AALAAPK+PV+   T + + A
Sbjct  1    MAKSMRSKREKRLRAIRRELV--EPIYDKKDAAKLAAQDAALAAPKLPVKHIPTVD-SAA  57

Query  298  MSIEPAPTTSIDKDNNMDVEMDDDTQ  375
              +  A  TS    N +DVEM D  Q
Sbjct  58   NELIAAAATSFANHNGIDVEMADGNQ  83



>ref|XP_009614340.1| PREDICTED: uncharacterized protein LOC104107286 [Nicotiana tomentosiformis]
Length=114

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 60/86 (70%), Gaps = 6/86 (7%)
 Frame = +1

Query  118  MAKSMRSKREKRLRAIRREIVSADPITqkkedaklaaqeaalaaPKVPVRSQSTTNRTTA  297
            MAKSMR KREKRLRAI+REIV+++P   KKE AKLAAQEAALAAPK+ V+S  T+     
Sbjct  1    MAKSMRCKREKRLRAIKREIVASEPSVLKKEAAKLAAQEAALAAPKLVVKSPFTSTTMDT  60

Query  298  MSIEPAPTTSIDKDNNMDVEMDDDTQ  375
             +  P      + DN+MDVEM D  Q
Sbjct  61   STSTP------NNDNSMDVEMADGNQ  80



>ref|XP_004134518.1| PREDICTED: uncharacterized protein LOC101221511 [Cucumis sativus]
 ref|XP_004158680.1| PREDICTED: uncharacterized protein LOC101230485 [Cucumis sativus]
 gb|KGN49538.1| hypothetical protein Csa_6G538670 [Cucumis sativus]
Length=120

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 48/70 (69%), Positives = 54/70 (77%), Gaps = 2/70 (3%)
 Frame = +1

Query  118  MAKSMRSKREKRLRAIRREIVSADPITqkkedaklaaqeaalaaPKVPVRSQSTTNRTTA  297
            MAKSMRSKREKRLRAIRRE+V  DP   KKE AKLAAQEAALAAPK+PVRS   T+  + 
Sbjct  1    MAKSMRSKREKRLRAIRREMV--DPFYDKKEAAKLAAQEAALAAPKLPVRSSPLTSNVST  58

Query  298  MSIEPAPTTS  327
            M + P  T+S
Sbjct  59   MDVAPPSTSS  68



>gb|KDO77197.1| hypothetical protein CISIN_1g033622mg [Citrus sinensis]
 gb|KDO77198.1| hypothetical protein CISIN_1g033622mg [Citrus sinensis]
Length=74

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 49/79 (62%), Positives = 57/79 (72%), Gaps = 7/79 (9%)
 Frame = +1

Query  118  MAKSMRSKREKRLRAIRREIVSADPITqkkedaklaaqeaalaaPKVPVRSQSTTNRTTA  297
            MAKSMRSKREKRLRAIRREIV  +P  +KK++AK AAQEAALAAPK+PVRS  T +   A
Sbjct  1    MAKSMRSKREKRLRAIRREIV--EPFYEKKDEAKFAAQEAALAAPKLPVRSPKTNSMEIA  58

Query  298  MSIEPAPTTSIDKDNNMDV  354
                  PT +   DNNM +
Sbjct  59   -----TPTATSTADNNMVI  72



>ref|XP_006303442.1| hypothetical protein CARUB_v10010686mg [Capsella rubella]
 gb|EOA36340.1| hypothetical protein CARUB_v10010686mg [Capsella rubella]
Length=118

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 51/88 (58%), Positives = 57/88 (65%), Gaps = 5/88 (6%)
 Frame = +1

Query  118  MAKSMRSKREKRLRAIRREIVSADPITqkkedaklaaqeaalaaPKVPVRSQ--STTNRT  291
            MAKSMR KR KRLRAIRREIV  +  T  +EDAK AA EAALAAPK+PVR    S     
Sbjct  1    MAKSMRCKRVKRLRAIRREIVEKESFTLTREDAKSAAIEAALAAPKLPVRQPPVSPFMEI  60

Query  292  TAMSIEPAPTTSIDKDNNMDVEMDDDTQ  375
               S E AP T    DN+ DVEMDD+ +
Sbjct  61   ATPSSESAPATV---DNDSDVEMDDEKK  85



>gb|KDP43127.1| hypothetical protein JCGZ_26660 [Jatropha curcas]
Length=116

 Score = 52.8 bits (125),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 53/87 (61%), Positives = 65/87 (75%), Gaps = 6/87 (7%)
 Frame = +1

Query  118  MAKSMRSKREKRLRAIRREIVSADPITqkkedaklaaqeaalaaPKVPVR-SQSTTNRTT  294
            MAKSMRSKREKRLRAIRR++V  +P   KK++AKLAAQEAALAAPK+PV+ S      ++
Sbjct  1    MAKSMRSKREKRLRAIRRDLV--EPFYDKKDEAKLAAQEAALAAPKLPVKPSPFAAASSS  58

Query  295  AMSIEPAPTTSIDKDNNMDVEMDDDTQ  375
            AM +    T S   + NMDVEMDDD+Q
Sbjct  59   AMDMTTTTTAS---NTNMDVEMDDDSQ  82



>ref|XP_008439430.1| PREDICTED: uncharacterized protein LOC103484241 [Cucumis melo]
Length=120

 Score = 52.8 bits (125),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 48/70 (69%), Positives = 54/70 (77%), Gaps = 2/70 (3%)
 Frame = +1

Query  118  MAKSMRSKREKRLRAIRREIVSADPITqkkedaklaaqeaalaaPKVPVRSQSTTNRTTA  297
            MAKSMRSKREKRLRAIRRE+V  DP   KKE AKLAAQEAALAAPK+PVRS   T+  + 
Sbjct  1    MAKSMRSKREKRLRAIRREMV--DPFYDKKEAAKLAAQEAALAAPKLPVRSSPFTSNVST  58

Query  298  MSIEPAPTTS  327
            M +  A T+S
Sbjct  59   MDVALASTSS  68



>ref|XP_004232614.1| PREDICTED: uncharacterized protein LOC101249230 [Solanum lycopersicum]
Length=114

 Score = 52.4 bits (124),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 53/86 (62%), Positives = 65/86 (76%), Gaps = 6/86 (7%)
 Frame = +1

Query  118  MAKSMRSKREKRLRAIRREIVSADPITqkkedaklaaqeaalaaPKVPVRSQSTTNRTTA  297
            MAKSMRSKREKRLRAIRR+IV+ +P   KKE AKLAAQEAALAAPK+ V+S  +  RTT 
Sbjct  1    MAKSMRSKREKRLRAIRRDIVATEPSVLKKEAAKLAAQEAALAAPKLIVKSPFS--RTT-  57

Query  298  MSIEPAPTTSIDKDNNMDVEMDDDTQ  375
              ++ + +TS D ++ MDVEM D  Q
Sbjct  58   --MDTSASTSND-ESKMDVEMADGNQ  80



>ref|XP_010478530.1| PREDICTED: uncharacterized protein LOC104757481 [Camelina sativa]
Length=120

 Score = 52.4 bits (124),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 50/88 (57%), Positives = 59/88 (67%), Gaps = 3/88 (3%)
 Frame = +1

Query  118  MAKSMRSKREKRLRAIRREIVSADPITqkkedaklaaqeaalaaPKVPVR--SQSTTNRT  291
            MAKSMR KR KRLRAIRR+IV  +  T  +EDAK AA EAALAAPK+PVR    S     
Sbjct  1    MAKSMRCKRVKRLRAIRRDIVEKESFTLTREDAKNAAIEAALAAPKLPVRLPPVSPFMEV  60

Query  292  TAMSIEPAPTTSIDKDNNMDVEMDDDTQ  375
               S E AP +S+   N+MDVEMDD+ +
Sbjct  61   ATPSSESAP-SSVTIANDMDVEMDDEKK  87



>gb|KEH31434.1| hypothetical protein MTR_4g094782 [Medicago truncatula]
Length=115

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 55/86 (64%), Positives = 61/86 (71%), Gaps = 10/86 (12%)
 Frame = +1

Query  118  MAKSMRSKREKRLRAIRREIVSADPITqkkedaklaaqeaalaaPKVPVRSQSTTNRTTA  297
            MAKSMRSKREKRLRAIRREIV  +P   KKE AKLAAQEAALAAPK+ V   S    TT 
Sbjct  1    MAKSMRSKREKRLRAIRREIV--EPYYDKKEAAKLAAQEAALAAPKLQVSVPS----TTT  54

Query  298  MSIEPAPTTSIDKDNNMDVEMDDDTQ  375
            M +    T+SI+ +N MDVEM D  Q
Sbjct  55   MEVS---TSSIN-NNPMDVEMSDGNQ  76



>ref|XP_007040991.1| Uncharacterized protein TCM_005979 [Theobroma cacao]
 gb|EOX96822.1| Uncharacterized protein TCM_005979 [Theobroma cacao]
Length=128

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 65/90 (72%), Gaps = 6/90 (7%)
 Frame = +1

Query  118  MAKSMRSKREKRLRAIRREIVSADPITqkkedaklaaqeaalaaPKVPVRSQS-TTNRTT  294
            MAKSMRSKREKRLRAIRREIV  +P  QKK+DAKLAAQEAALAAPK+P  + +  +  +T
Sbjct  1    MAKSMRSKREKRLRAIRREIV--EPFYQKKDDAKLAAQEAALAAPKMPALAPTPASASST  58

Query  295  AMSIE---PAPTTSIDKDNNMDVEMDDDTQ  375
             M +E    AP ++    N M+VEM D+ Q
Sbjct  59   RMQVEEQVAAPNSTTTNLNLMEVEMADNDQ  88



>ref|XP_006415397.1| hypothetical protein EUTSA_v10009126mg [Eutrema salsugineum]
 gb|ESQ33750.1| hypothetical protein EUTSA_v10009126mg [Eutrema salsugineum]
Length=120

 Score = 50.8 bits (120),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 49/91 (54%), Positives = 58/91 (64%), Gaps = 9/91 (10%)
 Frame = +1

Query  118  MAKSMRSKREKRLRAIRREIVSADPITqkkedaklaaqeaalaaPKVPVRSQSTTNRT--  291
            MAKSMR KR KRLRAIRREIV  +  TQ +EDAK AA  AALAAPK+PVR    +     
Sbjct  1    MAKSMRCKRVKRLRAIRREIVEKESFTQTREDAKSAAIAAALAAPKLPVRLPPPSPFMEV  60

Query  292  ---TAMSIEPAPTTSIDKDNNMDVEMDDDTQ  375
               T+ S+  + T +    N MDVEMDD+ Q
Sbjct  61   ATPTSESVSASATIA----NEMDVEMDDEKQ  87



>ref|XP_002893653.1| hypothetical protein ARALYDRAFT_473330 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69912.1| hypothetical protein ARALYDRAFT_473330 [Arabidopsis lyrata subsp. 
lyrata]
Length=120

 Score = 50.4 bits (119),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 48/89 (54%), Positives = 59/89 (66%), Gaps = 5/89 (6%)
 Frame = +1

Query  118  MAKSMRSKREKRLRAIRREIVSADPITqkkedaklaaqeaalaaPKVPVRSQSTT---NR  288
            MAKSMR K+ KRLRA+RREIV  +  T  +EDAK AA EAALAAPK+PVR    +     
Sbjct  1    MAKSMRCKKVKRLRALRREIVEKESFTLTREDAKSAAIEAALAAPKLPVRQPPVSPFMEV  60

Query  289  TTAMSIEPAPTTSIDKDNNMDVEMDDDTQ  375
             T  S   + TT+I   N+MDVEMDD+ +
Sbjct  61   ATPSSESASATTTI--ANDMDVEMDDEKK  87



>gb|ACJ84077.1| unknown [Medicago truncatula]
 gb|AFK39798.1| unknown [Medicago truncatula]
Length=115

 Score = 50.4 bits (119),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 54/86 (63%), Positives = 61/86 (71%), Gaps = 10/86 (12%)
 Frame = +1

Query  118  MAKSMRSKREKRLRAIRREIVSADPITqkkedaklaaqeaalaaPKVPVRSQSTTNRTTA  297
            MAKSMRSKREKRLRAIRREIV  +P   KKE AKLAAQEAALAAPK+ V   S    TT 
Sbjct  1    MAKSMRSKREKRLRAIRREIV--EPYYDKKEAAKLAAQEAALAAPKLQVSVPS----TTT  54

Query  298  MSIEPAPTTSIDKDNNMDVEMDDDTQ  375
            M +    T+SI+ +N MD+EM D  Q
Sbjct  55   MEVS---TSSIN-NNPMDLEMSDGNQ  76



>ref|XP_009115027.1| PREDICTED: uncharacterized protein LOC103840281 [Brassica rapa]
Length=120

 Score = 49.7 bits (117),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 45/85 (53%), Positives = 56/85 (66%), Gaps = 1/85 (1%)
 Frame = +1

Query  118  MAKSMRSKREKRLRAIRREIVSADPITqkkedaklaaqeaalaaPKVPVRSQSTTNRTTA  297
            MAKSMR KR KRLRAIRREIV  +  T  ++DAK AA EAALAAPK+PVR    +     
Sbjct  1    MAKSMRCKRVKRLRAIRREIVEKEAFTLTRDDAKSAAIEAALAAPKLPVRQPPPSPFMEV  60

Query  298  MSIEPAPTTSIDK-DNNMDVEMDDD  369
             +  P  T++     N+MD+EMDD+
Sbjct  61   ATSTPESTSASGTIANDMDMEMDDE  85



>ref|XP_009107755.1| PREDICTED: uncharacterized protein LOC103833421 isoform X1 [Brassica 
rapa]
Length=120

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 54/87 (62%), Gaps = 1/87 (1%)
 Frame = +1

Query  118  MAKSMRSKREKRLRAIRREIVSADPITqkkedaklaaqeaalaaPKVPVR-SQSTTNRTT  294
            MAKSMR KR KRLRAIRREIV  +  T  +EDAK AA EAALAAPK+PVR    +     
Sbjct  1    MAKSMRCKRVKRLRAIRREIVEKESFTLTREDAKSAAIEAALAAPKLPVRLPPPSPFMEV  60

Query  295  AMSIEPAPTTSIDKDNNMDVEMDDDTQ  375
            A     + + S    N MDVEMDD+  
Sbjct  61   ATPTSESASVSGTVANAMDVEMDDEKH  87



>emb|CDY12451.1| BnaC08g09400D [Brassica napus]
Length=117

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 46/86 (53%), Positives = 54/86 (63%), Gaps = 2/86 (2%)
 Frame = +1

Query  118  MAKSMRSKREKRLRAIRREIVSADPITqkkedaklaaqeaalaaPKVPVRSQSTTNRTTA  297
            MAKSMR KR KRLRAIRREIV  +  T  +EDAK AA EAALAAPK+PVR    +     
Sbjct  1    MAKSMRCKRVKRLRAIRREIVQKESFTLTREDAKSAAIEAALAAPKLPVRLPPPSPFMEV  60

Query  298  MSIEPAPTTSIDKDNNMDVEMDDDTQ  375
             +  P   ++    N MDVEMDD+  
Sbjct  61   AT--PTSESASVSANVMDVEMDDEKH  84



>emb|CDY52185.1| BnaAnng11260D [Brassica napus]
Length=117

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 46/86 (53%), Positives = 54/86 (63%), Gaps = 2/86 (2%)
 Frame = +1

Query  118  MAKSMRSKREKRLRAIRREIVSADPITqkkedaklaaqeaalaaPKVPVRSQSTTNRTTA  297
            MAKSMR KR KRLRAIRREIV  +  T  +EDAK AA EAALAAPK+PVR    +     
Sbjct  1    MAKSMRCKRVKRLRAIRREIVEKESFTLTREDAKSAAIEAALAAPKLPVRLPPPSPFMEV  60

Query  298  MSIEPAPTTSIDKDNNMDVEMDDDTQ  375
             +  P   ++    N MDVEMDD+  
Sbjct  61   AT--PTSESASVSANVMDVEMDDEKH  84



>ref|XP_007158856.1| hypothetical protein PHAVU_002G187600g [Phaseolus vulgaris]
 gb|ESW30850.1| hypothetical protein PHAVU_002G187600g [Phaseolus vulgaris]
Length=112

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 58/86 (67%), Gaps = 12/86 (14%)
 Frame = +1

Query  118  MAKSMRSKREKRLRAIRREIVSADPITqkkedaklaaqeaalaaPKVPVRSQSTTNRTTA  297
            MAKS+RSK+EKRLRAIRREIV  +P   KKE AKLA QEAALAAPK+ V S+S      A
Sbjct  1    MAKSLRSKKEKRLRAIRREIV--EPFYDKKEAAKLAVQEAALAAPKLEVPSKS----NNA  54

Query  298  MSIEPAPTTSIDKDNNMDVEMDDDTQ  375
            M +  A  TS    N MDVEM D  +
Sbjct  55   MDV--ATLTS----NTMDVEMADSNK  74



>ref|XP_003524827.1| PREDICTED: uncharacterized protein LOC100807379 isoform X1 [Glycine 
max]
 ref|XP_006580068.1| PREDICTED: uncharacterized protein LOC100807379 isoform X2 [Glycine 
max]
 ref|XP_006580069.1| PREDICTED: uncharacterized protein LOC100807379 isoform X3 [Glycine 
max]
Length=113

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 62/86 (72%), Gaps = 11/86 (13%)
 Frame = +1

Query  118  MAKSMRSKREKRLRAIRREIVSADPITqkkedaklaaqeaalaaPKVPVRSQSTTNRTTA  297
            MAKS+RSKREKRLRAIRREIV  +P   KKE AKLAAQEAALAAPK+ V S+  T     
Sbjct  1    MAKSLRSKREKRLRAIRREIV--EPFYDKKEAAKLAAQEAALAAPKLEVPSKPNT-----  53

Query  298  MSIEPAPTTSIDKDNNMDVEMDDDTQ  375
             ++E + +T+   + N+DVEM D +Q
Sbjct  54   -AMEASTSTN---NTNIDVEMADGSQ  75



>ref|XP_008371930.1| PREDICTED: uncharacterized protein LOC103435323 [Malus domestica]
Length=119

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 49/82 (60%), Positives = 59/82 (72%), Gaps = 5/82 (6%)
 Frame = +1

Query  118  MAKSMRSKREKRLRAIRREIVSADPITqkkedaklaaqeaalaaPKVPVRSQSTTNRTTA  297
            MAKSMR KREKRLRAIRRE+V  +P   KK++AKLAAQEAALAAPK+PVR    +  T+A
Sbjct  1    MAKSMRCKREKRLRAIRREMV--EPYYDKKDEAKLAAQEAALAAPKLPVRPPPKS--TSA  56

Query  298  MSIEPAPTTSIDKDNNMDVEMD  363
            M +      S    +NMDV+MD
Sbjct  57   MEVSTTNGASAS-TSNMDVDMD  77



>ref|XP_003531115.1| PREDICTED: uncharacterized protein LOC100777859 [Glycine max]
 gb|KHN28916.1| hypothetical protein glysoja_025710 [Glycine soja]
Length=113

 Score = 47.8 bits (112),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 61/86 (71%), Gaps = 11/86 (13%)
 Frame = +1

Query  118  MAKSMRSKREKRLRAIRREIVSADPITqkkedaklaaqeaalaaPKVPVRSQSTTNRTTA  297
            MAKS+RSKREKRLRAIRREIV  +P   KKE AKLAAQEAALAAPK+ V S+  T     
Sbjct  1    MAKSLRSKREKRLRAIRREIV--EPFYDKKEAAKLAAQEAALAAPKLEVPSKPNT-----  53

Query  298  MSIEPAPTTSIDKDNNMDVEMDDDTQ  375
             ++E + +T    + NMDVE+ D +Q
Sbjct  54   -AMEASASTD---NTNMDVEVADGSQ  75



>ref|XP_008383255.1| PREDICTED: uncharacterized protein LOC103445977 [Malus domestica]
Length=119

 Score = 47.8 bits (112),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 49/82 (60%), Positives = 59/82 (72%), Gaps = 5/82 (6%)
 Frame = +1

Query  118  MAKSMRSKREKRLRAIRREIVSADPITqkkedaklaaqeaalaaPKVPVRSQSTTNRTTA  297
            MAKSMR KREKRLRAIRRE+V  +P   KK++AKLAAQEAALAAPK+PVR    +  T+A
Sbjct  1    MAKSMRCKREKRLRAIRREMV--EPYYDKKDEAKLAAQEAALAAPKLPVRPPPKS--TSA  56

Query  298  MSIEPAPTTSIDKDNNMDVEMD  363
            M +      S    +NMDV+MD
Sbjct  57   MEVNTTDGASAS-TSNMDVDMD  77



>ref|XP_010499642.1| PREDICTED: uncharacterized protein LOC104777131 [Camelina sativa]
Length=120

 Score = 47.8 bits (112),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 48/88 (55%), Positives = 57/88 (65%), Gaps = 3/88 (3%)
 Frame = +1

Query  118  MAKSMRSKREKRLRAIRREIVSADPITqkkedaklaaqeaalaaPKVPVR--SQSTTNRT  291
            MAKSMR KR KRLRAIRR+IV  +  T  +EDAK AA EAALAAPK+PVR    S     
Sbjct  1    MAKSMRCKRVKRLRAIRRDIVEKESFTLTREDAKNAAIEAALAAPKLPVRLPPVSPFMEV  60

Query  292  TAMSIEPAPTTSIDKDNNMDVEMDDDTQ  375
               S E AP ++    N+M VEMDD+ +
Sbjct  61   ATPSSESAPVSATI-ANDMYVEMDDEKK  87



>ref|XP_009340257.1| PREDICTED: uncharacterized protein LOC103932397 [Pyrus x bretschneideri]
Length=119

 Score = 47.8 bits (112),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 49/82 (60%), Positives = 59/82 (72%), Gaps = 5/82 (6%)
 Frame = +1

Query  118  MAKSMRSKREKRLRAIRREIVSADPITqkkedaklaaqeaalaaPKVPVRSQSTTNRTTA  297
            MAKSMR KREKRLRAIRRE+V  +P   KK++AKLAAQEAALAAPK+PVR    +  T+A
Sbjct  1    MAKSMRCKREKRLRAIRREMV--EPYYDKKDEAKLAAQEAALAAPKLPVRPPPKS--TSA  56

Query  298  MSIEPAPTTSIDKDNNMDVEMD  363
            M +      S    +NMDV+MD
Sbjct  57   MEVTTTDGASAS-TSNMDVDMD  77



>ref|XP_009363271.1| PREDICTED: uncharacterized protein LOC103953260 [Pyrus x bretschneideri]
Length=119

 Score = 47.4 bits (111),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 49/82 (60%), Positives = 59/82 (72%), Gaps = 5/82 (6%)
 Frame = +1

Query  118  MAKSMRSKREKRLRAIRREIVSADPITqkkedaklaaqeaalaaPKVPVRSQSTTNRTTA  297
            MAKSMR KREKRLRAIRRE+V  +P   KK++AKLAAQEAALAAPK+PVR    +  T+A
Sbjct  1    MAKSMRCKREKRLRAIRREMV--EPYYDKKDEAKLAAQEAALAAPKLPVRPPPKS--TSA  56

Query  298  MSIEPAPTTSIDKDNNMDVEMD  363
            M +      S    +NMDV+MD
Sbjct  57   MEVTTTNGASAS-TSNMDVDMD  77



>gb|EPS68746.1| hypothetical protein M569_06027 [Genlisea aurea]
Length=109

 Score = 46.6 bits (109),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 48/56 (86%), Gaps = 2/56 (4%)
 Frame = +1

Query  118  MAKSMRSKREKRLRAIRREIVSADPITqkkedaklaaqeaalaaPKVPVRSQSTTN  285
            MAKS+RSKREKRLRAIRRE+V  +PI +KKE AKLA  EAA+AAPK+PVR+  +++
Sbjct  1    MAKSIRSKREKRLRAIRRELV--EPIYEKKEAAKLAVLEAAMAAPKLPVRTPKSSD  54



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 774982056510