BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001O12

Length=489
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006360895.1|  PREDICTED: probable protein phosphatase 2C 6...    114   8e-27   Solanum tuberosum [potatoes]
ref|XP_011092959.1|  PREDICTED: probable protein phosphatase 2C 60      113   1e-26   Sesamum indicum [beniseed]
ref|XP_004248644.1|  PREDICTED: probable protein phosphatase 2C 6...    112   3e-26   Solanum lycopersicum
ref|XP_011088628.1|  PREDICTED: probable protein phosphatase 2C 60      110   1e-25   Sesamum indicum [beniseed]
ref|XP_007041771.1|  Phosphatase 2C family protein isoform 1            109   3e-25   
ref|XP_010266043.1|  PREDICTED: probable protein phosphatase 2C 60      106   9e-25   Nelumbo nucifera [Indian lotus]
ref|XP_009628267.1|  PREDICTED: probable protein phosphatase 2C 60      107   2e-24   Nicotiana tomentosiformis
gb|KJB15851.1|  hypothetical protein B456_002G199700                    107   2e-24   Gossypium raimondii
gb|KJB15850.1|  hypothetical protein B456_002G199700                    107   2e-24   Gossypium raimondii
ref|XP_009783505.1|  PREDICTED: probable protein phosphatase 2C 60      107   2e-24   Nicotiana sylvestris
ref|XP_010266045.1|  PREDICTED: probable protein phosphatase 2C 60      106   3e-24   Nelumbo nucifera [Indian lotus]
gb|KHG25255.1|  hypothetical protein F383_08950                         106   3e-24   Gossypium arboreum [tree cotton]
gb|EYU37974.1|  hypothetical protein MIMGU_mgv1a007884mg                106   4e-24   Erythranthe guttata [common monkey flower]
ref|XP_002521272.1|  protein phosphatase 2c, putative                   105   5e-24   Ricinus communis
ref|XP_009791771.1|  PREDICTED: probable protein phosphatase 2C 46      105   6e-24   Nicotiana sylvestris
ref|XP_009590077.1|  PREDICTED: probable protein phosphatase 2C 4...    105   6e-24   Nicotiana tomentosiformis
gb|KHG27171.1|  hypothetical protein F383_05187                         105   1e-23   Gossypium arboreum [tree cotton]
ref|XP_009590079.1|  PREDICTED: probable protein phosphatase 2C 6...    104   1e-23   Nicotiana tomentosiformis
ref|XP_002279993.1|  PREDICTED: probable protein phosphatase 2C 60      104   2e-23   Vitis vinifera
emb|CAN64313.1|  hypothetical protein VITISV_023164                     104   2e-23   Vitis vinifera
ref|XP_007041776.1|  Phosphatase 2C family protein                      104   2e-23   
ref|XP_009595549.1|  PREDICTED: probable protein phosphatase 2C 46      104   2e-23   Nicotiana tomentosiformis
ref|XP_007041772.1|  Phosphatase 2C family protein isoform 2            104   2e-23   
gb|KJB32673.1|  hypothetical protein B456_005G255000                    104   2e-23   Gossypium raimondii
ref|XP_004169425.1|  PREDICTED: LOW QUALITY PROTEIN: probable pro...    103   4e-23   
ref|XP_004147052.1|  PREDICTED: probable protein phosphatase 2C 6...    103   4e-23   Cucumis sativus [cucumbers]
ref|XP_008457720.1|  PREDICTED: probable protein phosphatase 2C 60      103   4e-23   Cucumis melo [Oriental melon]
gb|KDP33299.1|  hypothetical protein JCGZ_13086                         103   5e-23   Jatropha curcas
ref|XP_006422534.1|  hypothetical protein CICLE_v10028600mg             102   1e-22   Citrus clementina [clementine]
ref|XP_002530628.1|  protein phosphatase 2c, putative                   102   1e-22   
ref|XP_006486691.1|  PREDICTED: probable protein phosphatase 2C 6...    101   2e-22   Citrus sinensis [apfelsine]
ref|XP_009781837.1|  PREDICTED: probable protein phosphatase 2C 46      101   2e-22   Nicotiana sylvestris
ref|XP_002313699.1|  phosphatase 2C family protein                      101   3e-22   Populus trichocarpa [western balsam poplar]
ref|XP_011046655.1|  PREDICTED: probable protein phosphatase 2C 64      101   3e-22   Populus euphratica
ref|XP_011045811.1|  PREDICTED: probable protein phosphatase 2C 64      101   3e-22   Populus euphratica
ref|XP_010239682.1|  PREDICTED: probable protein phosphatase 2C 60      100   4e-22   Brachypodium distachyon [annual false brome]
ref|XP_011022262.1|  PREDICTED: probable protein phosphatase 2C 46      100   4e-22   Populus euphratica
ref|XP_006383046.1|  phosphatase 2C family protein                      100   4e-22   Populus trichocarpa [western balsam poplar]
ref|XP_002305529.1|  hypothetical protein POPTR_0004s18340g             100   5e-22   Populus trichocarpa [western balsam poplar]
ref|XP_007201072.1|  hypothetical protein PRUPE_ppa006747mg           99.8    8e-22   Prunus persica
ref|XP_009363444.1|  PREDICTED: probable protein phosphatase 2C 46    99.8    9e-22   Pyrus x bretschneideri [bai li]
ref|XP_008377721.1|  PREDICTED: probable protein phosphatase 2C 60    99.8    9e-22   
ref|XP_010066286.1|  PREDICTED: probable protein phosphatase 2C 60    99.4    1e-21   Eucalyptus grandis [rose gum]
ref|XP_010086827.1|  putative protein phosphatase 2C 60               99.4    1e-21   Morus notabilis
ref|XP_007202114.1|  hypothetical protein PRUPE_ppa006861mg           99.4    1e-21   Prunus persica
ref|XP_008337969.1|  PREDICTED: probable protein phosphatase 2C 46    99.4    1e-21   Malus domestica [apple tree]
ref|XP_003536720.1|  PREDICTED: probable protein phosphatase 2C 6...  99.4    1e-21   Glycine max [soybeans]
gb|EYU40449.1|  hypothetical protein MIMGU_mgv1a0103672mg             97.4    1e-21   Erythranthe guttata [common monkey flower]
gb|KCW64133.1|  hypothetical protein EUGRSUZ_G01786                   99.0    2e-21   Eucalyptus grandis [rose gum]
gb|KDP23958.1|  hypothetical protein JCGZ_25346                       99.0    2e-21   Jatropha curcas
emb|CDP14549.1|  unnamed protein product                              98.6    2e-21   Coffea canephora [robusta coffee]
ref|NP_001147802.1|  LOC100281412                                     98.6    2e-21   
ref|XP_004966475.1|  PREDICTED: probable protein phosphatase 2C 6...  98.6    2e-21   Setaria italica
gb|AFW69526.1|  hypothetical protein ZEAMMB73_815291                  98.2    2e-21   
ref|XP_009589840.1|  PREDICTED: probable protein phosphatase 2C 60    98.6    3e-21   
gb|ACG29902.1|  protein phosphatase 2C                                98.2    3e-21   Zea mays [maize]
ref|NP_001146390.1|  protein phosphatase 2C isoform 1                 98.2    3e-21   Zea mays [maize]
gb|KHG28703.1|  hypothetical protein F383_13791                       98.2    3e-21   Gossypium arboreum [tree cotton]
ref|XP_003635344.1|  PREDICTED: LOW QUALITY PROTEIN: probable pro...  98.2    3e-21   
ref|XP_008643604.1|  PREDICTED: LOC100281412 isoform X1               98.2    3e-21   
ref|XP_009355640.1|  PREDICTED: probable protein phosphatase 2C 60    97.8    5e-21   Pyrus x bretschneideri [bai li]
dbj|BAK01278.1|  predicted protein                                    97.4    5e-21   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMS54114.1|  putative protein phosphatase 2C 60                    97.4    5e-21   Triticum urartu
ref|XP_008382096.1|  PREDICTED: probable protein phosphatase 2C 60    97.1    6e-21   
gb|KJB47696.1|  hypothetical protein B456_008G037200                  97.4    7e-21   Gossypium raimondii
gb|KJB47691.1|  hypothetical protein B456_008G037200                  97.4    7e-21   Gossypium raimondii
gb|KJB47694.1|  hypothetical protein B456_008G037200                  96.7    7e-21   Gossypium raimondii
ref|XP_007142806.1|  hypothetical protein PHAVU_007G018300g           97.1    9e-21   Phaseolus vulgaris [French bean]
ref|XP_008242016.1|  PREDICTED: probable protein phosphatase 2C 46    97.1    9e-21   
ref|XP_010029636.1|  PREDICTED: probable protein phosphatase 2C 60    96.7    1e-20   Eucalyptus grandis [rose gum]
ref|XP_008811724.1|  PREDICTED: probable protein phosphatase 2C 60    96.7    1e-20   Phoenix dactylifera
ref|XP_004497192.1|  PREDICTED: probable protein phosphatase 2C 6...  96.7    1e-20   Cicer arietinum [garbanzo]
ref|XP_004290738.1|  PREDICTED: probable protein phosphatase 2C 46    96.7    1e-20   Fragaria vesca subsp. vesca
ref|XP_006656500.1|  PREDICTED: probable protein phosphatase 2C 6...  96.3    2e-20   Oryza brachyantha
gb|ACG45008.1|  protein phosphatase 2C                                96.3    2e-20   Zea mays [maize]
gb|KHN11497.1|  Hypothetical protein glysoja_015392                   96.3    2e-20   Glycine soja [wild soybean]
ref|XP_003555860.1|  PREDICTED: probable protein phosphatase 2C 6...  96.3    2e-20   
ref|XP_008393780.1|  PREDICTED: probable protein phosphatase 2C 60    95.9    2e-20   
ref|XP_009340482.1|  PREDICTED: probable protein phosphatase 2C 60    95.9    2e-20   Pyrus x bretschneideri [bai li]
ref|XP_009801750.1|  PREDICTED: probable protein phosphatase 2C 60    95.9    2e-20   Nicotiana sylvestris
ref|XP_007046602.1|  Phosphatase 2C family protein isoform 1          95.9    3e-20   Theobroma cacao [chocolate]
ref|XP_010935169.1|  PREDICTED: probable protein phosphatase 2C 60    95.5    3e-20   Elaeis guineensis
ref|NP_001058597.1|  Os06g0717800                                     95.5    3e-20   
ref|XP_006828820.1|  hypothetical protein AMTR_s00001p00136050        95.5    3e-20   Amborella trichopoda
gb|EEC81321.1|  hypothetical protein OsI_24486                        95.5    3e-20   Oryza sativa Indica Group [Indian rice]
ref|XP_010266882.1|  PREDICTED: probable protein phosphatase 2C 60    95.5    3e-20   Nelumbo nucifera [Indian lotus]
gb|KDO71338.1|  hypothetical protein CISIN_1g015989mg                 94.0    3e-20   Citrus sinensis [apfelsine]
gb|KJB77608.1|  hypothetical protein B456_012G156600                  94.0    4e-20   Gossypium raimondii
gb|KDO71337.1|  hypothetical protein CISIN_1g015989mg                 94.4    5e-20   Citrus sinensis [apfelsine]
ref|XP_010941352.1|  PREDICTED: probable protein phosphatase 2C 7...  94.4    5e-20   Elaeis guineensis
ref|XP_009418617.1|  PREDICTED: probable protein phosphatase 2C 6...  94.4    5e-20   
gb|KJB77607.1|  hypothetical protein B456_012G156600                  94.7    6e-20   Gossypium raimondii
ref|XP_006425370.1|  hypothetical protein CICLE_v10025781mg           94.7    6e-20   
gb|KHG19895.1|  hypothetical protein F383_10069                       94.7    6e-20   Gossypium arboreum [tree cotton]
ref|XP_009391019.1|  PREDICTED: probable protein phosphatase 2C 60    94.7    6e-20   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009344827.1|  PREDICTED: probable protein phosphatase 2C 46    94.7    6e-20   Pyrus x bretschneideri [bai li]
ref|XP_006467020.1|  PREDICTED: probable protein phosphatase 2C 6...  94.7    6e-20   Citrus sinensis [apfelsine]
gb|KJB77609.1|  hypothetical protein B456_012G156600                  94.0    7e-20   Gossypium raimondii
ref|XP_010941349.1|  PREDICTED: probable protein phosphatase 2C 6...  94.4    7e-20   Elaeis guineensis
gb|EMT20424.1|  Putative protein phosphatase 2C 60                    94.4    7e-20   
ref|XP_009418584.1|  PREDICTED: probable protein phosphatase 2C 6...  94.4    8e-20   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009602153.1|  PREDICTED: probable protein phosphatase 2C 60    94.4    8e-20   Nicotiana tomentosiformis
ref|XP_008440869.1|  PREDICTED: probable protein phosphatase 2C 6...  94.4    8e-20   Cucumis melo [Oriental melon]
ref|XP_009408204.1|  PREDICTED: probable protein phosphatase 2C 60    94.0    1e-19   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB43265.1|  hypothetical protein B456_007G190900                  94.0    1e-19   Gossypium raimondii
ref|XP_002439035.1|  hypothetical protein SORBIDRAFT_10g030320        94.0    1e-19   Sorghum bicolor [broomcorn]
ref|XP_006367872.1|  PREDICTED: probable protein phosphatase 2C 6...  93.6    1e-19   Solanum tuberosum [potatoes]
gb|AAD11430.1|  protein phosphatase 2C homolog                        93.6    1e-19   Mesembryanthemum crystallinum
emb|CAB90634.1|  protein phosphatase 2C (PP2C)                        93.6    2e-19   Fagus sylvatica
ref|XP_004492898.1|  PREDICTED: probable protein phosphatase 2C 6...  93.2    2e-19   Cicer arietinum [garbanzo]
ref|XP_008791943.1|  PREDICTED: probable protein phosphatase 2C 60    93.2    2e-19   Phoenix dactylifera
ref|XP_004231056.1|  PREDICTED: probable protein phosphatase 2C 46    92.4    4e-19   Solanum lycopersicum
ref|XP_006343345.1|  PREDICTED: probable protein phosphatase 2C 6...  92.4    4e-19   Solanum tuberosum [potatoes]
ref|XP_004234522.1|  PREDICTED: probable protein phosphatase 2C 60    92.4    5e-19   Solanum lycopersicum
ref|XP_010918123.1|  PREDICTED: probable protein phosphatase 2C 60    92.0    5e-19   Elaeis guineensis
ref|XP_010683039.1|  PREDICTED: probable protein phosphatase 2C 60    92.0    6e-19   
ref|XP_006411644.1|  hypothetical protein EUTSA_v10025386mg           91.7    7e-19   Eutrema salsugineum [saltwater cress]
emb|CDP01847.1|  unnamed protein product                              90.9    1e-18   Coffea canephora [robusta coffee]
ref|XP_009803770.1|  PREDICTED: probable protein phosphatase 2C 4...  89.7    1e-18   Nicotiana sylvestris
ref|XP_010526813.1|  PREDICTED: probable protein phosphatase 2C 46    90.9    1e-18   Tarenaya hassleriana [spider flower]
ref|XP_010531120.1|  PREDICTED: probable protein phosphatase 2C 46    90.9    1e-18   Tarenaya hassleriana [spider flower]
ref|XP_010690331.1|  PREDICTED: probable protein phosphatase 2C 60    90.5    2e-18   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009803756.1|  PREDICTED: probable protein phosphatase 2C 6...  90.5    2e-18   Nicotiana sylvestris
ref|XP_004287772.1|  PREDICTED: probable protein phosphatase 2C 46    90.5    2e-18   Fragaria vesca subsp. vesca
ref|XP_009418691.1|  PREDICTED: probable protein phosphatase 2C 6...  90.1    3e-18   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006380555.1|  hypothetical protein POPTR_0007s09220g           90.1    3e-18   Populus trichocarpa [western balsam poplar]
ref|XP_009418690.1|  PREDICTED: probable protein phosphatase 2C 6...  90.1    5e-18   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009392876.1|  PREDICTED: probable protein phosphatase 2C 60    88.6    9e-18   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008806142.1|  PREDICTED: probable protein phosphatase 2C 60    88.6    1e-17   Phoenix dactylifera
ref|XP_004232521.1|  PREDICTED: probable protein phosphatase 2C 60    88.2    1e-17   Solanum lycopersicum
ref|XP_009395356.1|  PREDICTED: probable protein phosphatase 2C 60    88.2    1e-17   Musa acuminata subsp. malaccensis [pisang utan]
gb|KGN48956.1|  hypothetical protein Csa_6G507290                     87.4    2e-17   Cucumis sativus [cucumbers]
ref|XP_008440874.1|  PREDICTED: probable protein phosphatase 2C 6...  87.4    3e-17   Cucumis melo [Oriental melon]
ref|XP_006282643.1|  hypothetical protein CARUB_v10004984mg           86.7    3e-17   
ref|XP_010548248.1|  PREDICTED: probable protein phosphatase 2C 46    87.0    4e-17   Tarenaya hassleriana [spider flower]
gb|KJB40119.1|  hypothetical protein B456_007G047600                  86.7    5e-17   Gossypium raimondii
ref|XP_006282642.1|  hypothetical protein CARUB_v10004984mg           86.7    5e-17   Capsella rubella
gb|KHG27051.1|  hypothetical protein F383_06469                       86.3    6e-17   Gossypium arboreum [tree cotton]
gb|ACJ84882.1|  unknown                                               85.9    8e-17   Medicago truncatula
gb|KEH44379.1|  serine/threonine phosphatase family, 2C domain pr...  86.3    8e-17   Medicago truncatula
gb|KEH23415.1|  protein phosphatase 2C family protein                 85.1    9e-17   Medicago truncatula
ref|XP_002868847.1|  phosphatase 2C family protein                    85.9    1e-16   
ref|XP_006340779.1|  PREDICTED: probable protein phosphatase 2C 6...  85.5    1e-16   
ref|XP_003624259.1|  Protein phosphatase 2C (PP2C)                    85.5    1e-16   Medicago truncatula
ref|NP_195564.2|  putative protein phosphatase 2C 64                  85.1    2e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010555215.1|  PREDICTED: probable protein phosphatase 2C 64    84.0    4e-16   Tarenaya hassleriana [spider flower]
gb|ACR37869.1|  unknown                                               80.9    4e-16   Zea mays [maize]
gb|AAL32532.1|  putative protein phosphatase-2c                       84.0    4e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008447931.1|  PREDICTED: probable protein phosphatase 2C 6...  82.8    6e-16   
ref|XP_006662022.1|  PREDICTED: probable protein phosphatase 2C 7...  83.6    7e-16   
gb|EPS71472.1|  hypothetical protein M569_03278                       83.2    7e-16   Genlisea aurea
ref|XP_004135015.1|  PREDICTED: probable protein phosphatase 2C 6...  83.6    7e-16   
ref|XP_010503831.1|  PREDICTED: probable protein phosphatase 2C 46    83.2    7e-16   Camelina sativa [gold-of-pleasure]
ref|XP_009115817.1|  PREDICTED: probable protein phosphatase 2C 46    83.2    8e-16   Brassica rapa
ref|XP_004144860.1|  PREDICTED: probable protein phosphatase 2C 6...  83.2    9e-16   Cucumis sativus [cucumbers]
ref|XP_008447929.1|  PREDICTED: probable protein phosphatase 2C 6...  83.2    9e-16   Cucumis melo [Oriental melon]
ref|XP_009413031.1|  PREDICTED: probable protein phosphatase 2C 60    83.2    9e-16   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDX73725.1|  BnaC08g22780D                                        82.8    9e-16   
ref|XP_010028765.1|  PREDICTED: probable protein phosphatase 2C 60    82.8    1e-15   Eucalyptus grandis [rose gum]
ref|XP_008447930.1|  PREDICTED: probable protein phosphatase 2C 6...  82.0    1e-15   
ref|XP_009400339.1|  PREDICTED: probable protein phosphatase 2C 60    82.4    2e-15   
ref|XP_004146159.1|  PREDICTED: probable protein phosphatase 2C 6...  82.0    2e-15   Cucumis sativus [cucumbers]
emb|CDX78002.1|  BnaA09g31970D                                        82.8    2e-15   
gb|ABF93865.1|  protein phosphatase 2C, putative, expressed           80.9    3e-15   Oryza sativa Japonica Group [Japonica rice]
gb|ACN25494.1|  unknown                                               81.3    4e-15   Zea mays [maize]
ref|NP_001151373.1|  LOC100285006                                     81.3    4e-15   Zea mays [maize]
ref|NP_001048899.1|  Os03g0137200                                     81.3    4e-15   
ref|NP_001065203.1|  Os10g0544900                                     80.9    7e-15   
ref|XP_006291301.1|  hypothetical protein CARUB_v10017436mg           79.7    9e-15   
ref|XP_006649361.1|  PREDICTED: probable protein phosphatase 2C 2...  80.5    1e-14   Oryza brachyantha
ref|XP_003520132.1|  PREDICTED: probable protein phosphatase 2C 6...  80.1    1e-14   Glycine max [soybeans]
gb|KHN00444.1|  Hypothetical protein glysoja_000112                   80.1    1e-14   Glycine soja [wild soybean]
ref|XP_006291300.1|  hypothetical protein CARUB_v10017436mg           79.7    1e-14   Capsella rubella
ref|XP_010234959.1|  PREDICTED: probable protein phosphatase 2C 72    79.7    2e-14   Brachypodium distachyon [annual false brome]
ref|XP_010515547.1|  PREDICTED: probable protein phosphatase 2C 46    79.3    2e-14   Camelina sativa [gold-of-pleasure]
ref|XP_010426694.1|  PREDICTED: probable protein phosphatase 2C 46    79.3    2e-14   Camelina sativa [gold-of-pleasure]
ref|XP_006403924.1|  hypothetical protein EUTSA_v10010452mg           79.3    2e-14   Eutrema salsugineum [saltwater cress]
ref|XP_009149079.1|  PREDICTED: probable protein phosphatase 2C 46    79.3    2e-14   Brassica rapa
ref|NP_001168381.1|  uncharacterized protein LOC100382150             79.0    2e-14   Zea mays [maize]
gb|AIB05855.1|  orphans transcription factor                          79.0    2e-14   Zea mays [maize]
ref|XP_010436947.1|  PREDICTED: probable protein phosphatase 2C 64    79.0    3e-14   Camelina sativa [gold-of-pleasure]
ref|XP_010431790.1|  PREDICTED: probable protein phosphatase 2C 6...  79.0    3e-14   Camelina sativa [gold-of-pleasure]
ref|XP_004983777.1|  PREDICTED: probable protein phosphatase 2C 7...  79.0    3e-14   Setaria italica
gb|ACR38514.1|  unknown                                               77.4    4e-14   Zea mays [maize]
ref|XP_004951589.1|  PREDICTED: probable protein phosphatase 2C 7...  78.6    5e-14   Setaria italica
ref|NP_566949.2|  putative protein phosphatase 2C                     78.2    5e-14   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001288424.1|  uncharacterized protein LOC103631685             78.2    5e-14   Zea mays [maize]
ref|XP_007009637.1|  Phosphatase 2C family protein isoform 1          78.2    5e-14   Theobroma cacao [chocolate]
gb|ACG32321.1|  protein phosphatase 2C                                78.2    5e-14   Zea mays [maize]
ref|XP_007009638.1|  Phosphatase 2C family protein isoform 2          78.2    5e-14   Theobroma cacao [chocolate]
dbj|BAK02779.1|  predicted protein                                    78.6    6e-14   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDY16313.1|  BnaC01g23480D                                        77.8    7e-14   Brassica napus [oilseed rape]
ref|NP_001152449.1|  protein phosphatase 2C                           77.8    9e-14   Zea mays [maize]
ref|XP_008680928.1|  PREDICTED: protein phosphatase 2C isoform X1     77.8    9e-14   Zea mays [maize]
ref|XP_006378750.1|  hypothetical protein POPTR_0010s22180g           77.4    9e-14   
gb|KHN35550.1|  Hypothetical protein glysoja_033039                   77.4    9e-14   Glycine soja [wild soybean]
ref|XP_010446360.1|  PREDICTED: probable protein phosphatase 2C 64    77.4    9e-14   Camelina sativa [gold-of-pleasure]
ref|XP_011027064.1|  PREDICTED: probable protein phosphatase 2C 3...  77.4    1e-13   Populus euphratica
ref|XP_011027061.1|  PREDICTED: probable protein phosphatase 2C 3...  77.4    1e-13   Populus euphratica
ref|XP_009101943.1|  PREDICTED: probable protein phosphatase 2C 6...  77.4    1e-13   Brassica rapa
ref|XP_009101942.1|  PREDICTED: probable protein phosphatase 2C 6...  77.0    1e-13   Brassica rapa
ref|XP_010253439.1|  PREDICTED: probable protein phosphatase 2C 38    77.0    1e-13   
emb|CDY54807.1|  BnaA06g40990D                                        77.0    1e-13   Brassica napus [oilseed rape]
ref|XP_002468552.1|  hypothetical protein SORBIDRAFT_01g047830        77.0    1e-13   Sorghum bicolor [broomcorn]
gb|EAY88457.1|  hypothetical protein OsI_09922                        76.3    3e-13   Oryza sativa Indica Group [Indian rice]
ref|XP_003547908.1|  PREDICTED: probable protein phosphatase 2C 6...  76.3    3e-13   Glycine max [soybeans]
emb|CAB37508.1|  putative protein phosphatase-2c                      76.3    3e-13   Arabidopsis thaliana [mouse-ear cress]
dbj|BAJ95758.1|  predicted protein                                    76.3    3e-13   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AIG52087.1|  2C-type protein phosphatase protein                   75.9    3e-13   Zea mays [maize]
gb|AAK20060.1|AC025783_20  putative protein phosphatase 2C            75.9    4e-13   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010558777.1|  PREDICTED: probable protein phosphatase 2C 38    75.9    4e-13   Tarenaya hassleriana [spider flower]
gb|KJB73662.1|  hypothetical protein B456_011G242300                  75.5    5e-13   Gossypium raimondii
ref|XP_008445826.1|  PREDICTED: probable protein phosphatase 2C 3...  75.5    5e-13   Cucumis melo [Oriental melon]
ref|XP_010101501.1|  putative protein phosphatase 2C 38               76.3    5e-13   
ref|XP_008445820.1|  PREDICTED: probable protein phosphatase 2C 3...  75.1    6e-13   Cucumis melo [Oriental melon]
ref|XP_008233398.1|  PREDICTED: probable protein phosphatase 2C 3...  74.7    8e-13   Prunus mume [ume]
ref|XP_010526549.1|  PREDICTED: probable protein phosphatase 2C 64    74.7    8e-13   Tarenaya hassleriana [spider flower]
ref|XP_002312054.1|  serine/threonine protein phosphatase 2C          74.7    8e-13   
ref|XP_011017023.1|  PREDICTED: probable protein phosphatase 2C 3...  74.7    8e-13   Populus euphratica
ref|XP_008233397.1|  PREDICTED: probable protein phosphatase 2C 3...  74.7    8e-13   Prunus mume [ume]
ref|XP_011016941.1|  PREDICTED: probable protein phosphatase 2C 3...  74.7    9e-13   Populus euphratica
ref|XP_004985788.1|  PREDICTED: probable protein phosphatase 2C 2...  74.7    1e-12   Setaria italica
ref|XP_011016344.1|  PREDICTED: probable protein phosphatase 2C 3...  74.7    1e-12   Populus euphratica
gb|KHG04682.1|  hypothetical protein F383_30115                       74.3    1e-12   Gossypium arboreum [tree cotton]
ref|XP_002525065.1|  protein phosphatase 2c, putative                 72.8    1e-12   
ref|XP_004307440.1|  PREDICTED: probable protein phosphatase 2C 38    74.3    1e-12   Fragaria vesca subsp. vesca
ref|XP_002467561.1|  hypothetical protein SORBIDRAFT_01g030180        74.3    1e-12   Sorghum bicolor [broomcorn]
ref|XP_007156202.1|  hypothetical protein PHAVU_003G266900g           73.9    2e-12   Phaseolus vulgaris [French bean]
ref|XP_002876083.1|  hypothetical protein ARALYDRAFT_485488           73.6    2e-12   
ref|NP_001130554.1|  protein phosphatase 2C isoform 1                 73.6    3e-12   Zea mays [maize]
ref|XP_008349400.1|  PREDICTED: probable protein phosphatase 2C 38    72.0    3e-12   
gb|EMT14261.1|  Putative protein phosphatase 2C 72                    73.2    3e-12   
gb|EMS63543.1|  putative protein phosphatase 2C 72                    73.2    3e-12   Triticum urartu
gb|KGN50486.1|  hypothetical protein Csa_5G177060                     72.8    4e-12   Cucumis sativus [cucumbers]
gb|KDP46132.1|  hypothetical protein JCGZ_06643                       72.8    4e-12   Jatropha curcas
ref|XP_007218123.1|  hypothetical protein PRUPE_ppa007029mg           72.8    4e-12   Prunus persica
ref|XP_004143597.1|  PREDICTED: probable protein phosphatase 2C 3...  72.8    4e-12   Cucumis sativus [cucumbers]
ref|XP_008384321.1|  PREDICTED: probable protein phosphatase 2C 3...  72.0    8e-12   
gb|ABE77197.1|  putative protein phosphatase 2C                       72.0    8e-12   Sorghum bicolor [broomcorn]
ref|XP_008384320.1|  PREDICTED: probable protein phosphatase 2C 3...  72.0    8e-12   
gb|KDO67861.1|  hypothetical protein CISIN_1g026383mg                 70.1    8e-12   Citrus sinensis [apfelsine]
gb|KDO67862.1|  hypothetical protein CISIN_1g026383mg                 70.1    9e-12   Citrus sinensis [apfelsine]
ref|XP_006436169.1|  hypothetical protein CICLE_v10031798mg           69.7    1e-11   
gb|EPS66771.1|  hypothetical protein M569_08005                       71.2    1e-11   Genlisea aurea
ref|XP_002276631.1|  PREDICTED: probable protein phosphatase 2C 38    71.2    1e-11   Vitis vinifera
emb|CBI32641.3|  unnamed protein product                              71.2    1e-11   Vitis vinifera
ref|XP_010658151.1|  PREDICTED: probable protein phosphatase 2C 3...  71.2    2e-11   Vitis vinifera
ref|XP_002281610.1|  PREDICTED: probable protein phosphatase 2C 3...  71.2    2e-11   Vitis vinifera
ref|XP_006292665.1|  hypothetical protein CARUB_v10018907mg           71.2    2e-11   Capsella rubella
ref|XP_010260120.1|  PREDICTED: probable protein phosphatase 2C 3...  71.2    2e-11   Nelumbo nucifera [Indian lotus]
ref|XP_010260119.1|  PREDICTED: probable protein phosphatase 2C 3...  71.2    2e-11   Nelumbo nucifera [Indian lotus]
gb|KHG11455.1|  hypothetical protein F383_16117                       70.5    3e-11   Gossypium arboreum [tree cotton]
gb|KJB76497.1|  hypothetical protein B456_012G092200                  70.5    3e-11   Gossypium raimondii
emb|CDY51441.1|  BnaA09g54860D                                        70.5    3e-11   Brassica napus [oilseed rape]
ref|XP_008792632.1|  PREDICTED: probable protein phosphatase 2C 3...  70.5    3e-11   Phoenix dactylifera
emb|CDX73413.1|  BnaC08g25900D                                        70.5    3e-11   
ref|XP_010229239.1|  PREDICTED: probable protein phosphatase 2C 28    70.5    3e-11   
ref|XP_009421366.1|  PREDICTED: probable protein phosphatase 2C 60    70.5    3e-11   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009116204.1|  PREDICTED: probable protein phosphatase 2C 48    70.5    3e-11   Brassica rapa
ref|XP_008369746.1|  PREDICTED: probable protein phosphatase 2C 3...  70.1    3e-11   
ref|XP_006436172.1|  hypothetical protein CICLE_v10031798mg           69.7    3e-11   
ref|XP_008792639.1|  PREDICTED: probable protein phosphatase 2C 3...  70.5    3e-11   
ref|XP_008369731.1|  PREDICTED: probable protein phosphatase 2C 3...  70.1    3e-11   
ref|XP_010534295.1|  PREDICTED: probable protein phosphatase 2C 38    70.1    4e-11   Tarenaya hassleriana [spider flower]
ref|XP_009404640.1|  PREDICTED: probable protein phosphatase 2C 38    70.1    4e-11   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004497368.1|  PREDICTED: probable protein phosphatase 2C 3...  70.1    4e-11   Cicer arietinum [garbanzo]
emb|CDY12086.1|  BnaC03g60020D                                        70.1    4e-11   Brassica napus [oilseed rape]
ref|XP_006436170.1|  hypothetical protein CICLE_v10031798mg           70.1    4e-11   
ref|XP_009357617.1|  PREDICTED: probable protein phosphatase 2C 3...  70.1    5e-11   Pyrus x bretschneideri [bai li]
ref|XP_009357616.1|  PREDICTED: probable protein phosphatase 2C 3...  70.1    6e-11   Pyrus x bretschneideri [bai li]
ref|NP_191065.2|  putative protein phosphatase 2C 48                  69.3    6e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010669739.1|  PREDICTED: probable protein phosphatase 2C 3...  69.3    6e-11   Beta vulgaris subsp. vulgaris [field beet]
gb|EAY77438.1|  hypothetical protein OsI_05432                        69.3    6e-11   Oryza sativa Indica Group [Indian rice]
ref|XP_010669737.1|  PREDICTED: probable protein phosphatase 2C 3...  69.3    6e-11   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002989193.1|  hypothetical protein SELMODRAFT_427794           69.3    8e-11   Selaginella moellendorffii
ref|XP_002987289.1|  hypothetical protein SELMODRAFT_183083           69.3    8e-11   Selaginella moellendorffii
ref|XP_008789013.1|  PREDICTED: probable protein phosphatase 2C 3...  69.3    8e-11   
ref|XP_008789012.1|  PREDICTED: probable protein phosphatase 2C 3...  69.3    8e-11   
gb|KHN27097.1|  Hypothetical protein glysoja_032865                   68.9    1e-10   Glycine soja [wild soybean]
ref|XP_003555636.1|  PREDICTED: probable protein phosphatase 2C 3...  68.9    1e-10   
ref|XP_009796582.1|  PREDICTED: probable protein phosphatase 2C 38    68.6    1e-10   
ref|XP_010484688.1|  PREDICTED: probable protein phosphatase 2C 79    68.6    1e-10   
ref|XP_003536795.1|  PREDICTED: probable protein phosphatase 2C 3...  68.6    1e-10   
ref|XP_010444839.1|  PREDICTED: LOW QUALITY PROTEIN: probable pro...  68.6    1e-10   
gb|KHN37290.1|  Hypothetical protein glysoja_013505                   68.6    1e-10   
ref|NP_187868.2|  putative protein phosphatase 2C 38                  68.2    2e-10   
gb|ADE76373.1|  unknown                                               68.2    2e-10   
gb|KDO68177.1|  hypothetical protein CISIN_1g015823mg                 66.6    2e-10   
gb|KCW65340.1|  hypothetical protein EUGRSUZ_G02783                   67.4    2e-10   
ref|XP_006407314.1|  hypothetical protein EUTSA_v10020905mg           68.2    2e-10   
ref|XP_002878013.1|  serine/threonine protein phosphatase 2C          68.2    2e-10   
ref|XP_010067239.1|  PREDICTED: probable protein phosphatase 2C 38    67.8    2e-10   
ref|XP_004509404.1|  PREDICTED: probable protein phosphatase 2C 4...  67.4    3e-10   
ref|XP_003592807.1|  hypothetical protein MTR_1g116260                67.4    3e-10   
emb|CDX90277.1|  BnaA08g17070D                                        67.4    3e-10   
ref|NP_201409.1|  putative protein phosphatase 2C 79                  67.4    3e-10   
ref|XP_009109549.1|  PREDICTED: probable protein phosphatase 2C 64    67.4    3e-10   
gb|KDO68176.1|  hypothetical protein CISIN_1g015823mg                 66.6    3e-10   
ref|NP_001045569.1|  Os01g0976700                                     67.4    3e-10   
gb|KJB67681.1|  hypothetical protein B456_010G203500                  67.4    4e-10   
gb|KJB67682.1|  hypothetical protein B456_010G203500                  67.0    4e-10   
ref|XP_003565195.1|  PREDICTED: probable protein phosphatase 2C 60    67.4    4e-10   
gb|KDO68174.1|  hypothetical protein CISIN_1g015823mg                 67.4    4e-10   
gb|AAG51012.1|AC069474_11  protein phosphatase 2C, putative; 1682...  67.0    4e-10   
ref|XP_009769529.1|  PREDICTED: probable protein phosphatase 2C 38    66.6    5e-10   
ref|XP_006403497.1|  hypothetical protein EUTSA_v10010445mg           66.6    6e-10   
gb|KDP29048.1|  hypothetical protein JCGZ_16437                       66.6    6e-10   
ref|XP_006828247.1|  hypothetical protein AMTR_s00023p00195110        66.6    6e-10   
emb|CAB82700.1|  protein phosphatase 2C-like protein                  66.2    9e-10   
ref|XP_010465036.1|  PREDICTED: probable protein phosphatase 2C 38    65.9    1e-09   
ref|XP_010486985.1|  PREDICTED: probable protein phosphatase 2C 38    65.9    1e-09   
ref|XP_010499254.1|  PREDICTED: probable protein phosphatase 2C 38    65.9    1e-09   
ref|XP_002884915.1|  phosphatase 2C family protein                    65.9    1e-09   
ref|XP_011077014.1|  PREDICTED: probable protein phosphatase 2C 3...  65.9    1e-09   
ref|XP_011077015.1|  PREDICTED: probable protein phosphatase 2C 3...  65.9    1e-09   
ref|XP_009594017.1|  PREDICTED: probable protein phosphatase 2C 38    65.5    1e-09   
emb|CDY02904.1|  BnaC04g25820D                                        65.5    1e-09   
gb|EYU41653.1|  hypothetical protein MIMGU_mgv1a008235mg              65.5    2e-09   
emb|CDX76124.1|  BnaA04g03880D                                        65.1    2e-09   
ref|XP_009139203.1|  PREDICTED: probable protein phosphatase 2C 48    65.1    2e-09   
gb|KHG13638.1|  hypothetical protein F383_18928                       65.1    2e-09   
emb|CDY29015.1|  BnaC07g32210D                                        65.1    2e-09   
ref|XP_010556097.1|  PREDICTED: probable protein phosphatase 2C 48    65.1    2e-09   
ref|XP_010534443.1|  PREDICTED: probable protein phosphatase 2C 48    65.1    2e-09   
ref|XP_010937760.1|  PREDICTED: probable protein phosphatase 2C 38    65.1    2e-09   
emb|CDP06683.1|  unnamed protein product                              65.1    2e-09   
ref|XP_009146605.1|  PREDICTED: probable protein phosphatase 2C 38    65.1    2e-09   
emb|CDY08420.1|  BnaA05g26560D                                        65.1    2e-09   
ref|XP_010920974.1|  PREDICTED: probable protein phosphatase 2C 38    64.7    2e-09   
ref|XP_010504342.1|  PREDICTED: probable protein phosphatase 2C 48    64.7    3e-09   
ref|XP_003594721.1|  Pyruvate dehydrogenase phosphatase               64.3    3e-09   
ref|XP_006297878.1|  hypothetical protein CARUB_v10013921mg           64.3    3e-09   
ref|XP_002519242.1|  protein phosphatase 2c, putative                 64.7    4e-09   
ref|XP_009405829.1|  PREDICTED: probable protein phosphatase 2C 38    64.3    4e-09   
emb|CDY42159.1|  BnaC05g40600D                                        64.3    4e-09   
emb|CDY52665.1|  BnaC01g38550D                                        64.3    4e-09   
ref|XP_009801002.1|  PREDICTED: probable protein phosphatase 2C 38    64.3    4e-09   
ref|XP_009120474.1|  PREDICTED: probable protein phosphatase 2C 38    63.9    4e-09   
dbj|BAJ97329.1|  predicted protein                                    63.9    5e-09   
ref|XP_011019816.1|  PREDICTED: probable protein phosphatase 2C 42    63.9    5e-09   
ref|XP_009600192.1|  PREDICTED: probable protein phosphatase 2C 38    63.9    5e-09   
gb|AFK33394.1|  unknown                                               63.9    5e-09   
ref|XP_002525208.1|  protein phosphatase 2c, putative                 63.2    7e-09   
ref|XP_007207906.1|  hypothetical protein PRUPE_ppa020549mg           63.2    9e-09   
ref|XP_008241950.1|  PREDICTED: probable protein phosphatase 2C 48    63.2    9e-09   
ref|XP_007142657.1|  hypothetical protein PHAVU_007G0057000g          62.4    9e-09   
ref|XP_010312270.1|  PREDICTED: probable protein phosphatase 2C 3...  62.8    1e-08   
ref|XP_010312271.1|  PREDICTED: probable protein phosphatase 2C 3...  62.8    1e-08   
ref|XP_004249804.1|  PREDICTED: probable protein phosphatase 2C 3...  62.8    1e-08   
gb|KJB36782.1|  hypothetical protein B456_006G177400                  61.2    1e-08   
ref|XP_006339293.1|  PREDICTED: probable protein phosphatase 2C 3...  62.8    1e-08   
ref|XP_009629674.1|  PREDICTED: probable protein phosphatase 2C 38    62.8    1e-08   
ref|XP_010427245.1|  PREDICTED: probable protein phosphatase 2C 48    62.8    1e-08   
ref|XP_002312324.2|  phosphatase 2C family protein                    62.0    2e-08   
ref|XP_004239681.1|  PREDICTED: probable protein phosphatase 2C 38    62.0    2e-08   
gb|KJB36777.1|  hypothetical protein B456_006G177400                  61.2    2e-08   
ref|XP_007027175.1|  Phosphatase 2C family protein                    61.6    2e-08   
ref|XP_011095192.1|  PREDICTED: probable protein phosphatase 2C 38    62.0    2e-08   
gb|KJB36781.1|  hypothetical protein B456_006G177400                  61.2    3e-08   
ref|XP_011084375.1|  PREDICTED: probable protein phosphatase 2C 38    61.6    3e-08   
emb|CDM86965.1|  unnamed protein product                              61.6    3e-08   
ref|XP_006419368.1|  hypothetical protein CICLE_v10005185mg           61.2    4e-08   
ref|XP_006419367.1|  hypothetical protein CICLE_v10005185mg           61.2    4e-08   
ref|XP_006488833.1|  PREDICTED: probable protein phosphatase 2C 4...  61.2    4e-08   
ref|XP_006419369.1|  hypothetical protein CICLE_v10005185mg           60.8    4e-08   
ref|XP_004486541.1|  PREDICTED: probable protein phosphatase 2C 4...  61.2    4e-08   
gb|KHG10577.1|  hypothetical protein F383_13999                       61.2    4e-08   
gb|KJB36779.1|  hypothetical protein B456_006G177400                  61.2    4e-08   
ref|XP_006480541.1|  PREDICTED: probable protein phosphatase 2C 3...  61.2    4e-08   
emb|CDP04341.1|  unnamed protein product                              61.2    4e-08   
ref|XP_009338571.1|  PREDICTED: LOW QUALITY PROTEIN: probable pro...  61.2    5e-08   
ref|XP_002314955.2|  hypothetical protein POPTR_0010s15660g           60.8    6e-08   
ref|XP_011010579.1|  PREDICTED: probable protein phosphatase 2C 4...  60.8    6e-08   
ref|XP_011010586.1|  PREDICTED: probable protein phosphatase 2C 4...  60.5    6e-08   
emb|CDX75902.1|  BnaC03g39850D                                        60.5    6e-08   
ref|XP_011010593.1|  PREDICTED: probable protein phosphatase 2C 4...  60.5    6e-08   
ref|XP_011077398.1|  PREDICTED: probable protein phosphatase 2C 38    60.5    6e-08   
ref|XP_006373848.1|  hypothetical protein POPTR_0016s08370g           60.5    7e-08   
ref|XP_003537235.1|  PREDICTED: probable protein phosphatase 2C 3...  60.5    8e-08   
gb|KHN48341.1|  Hypothetical protein glysoja_008010                   60.1    8e-08   
ref|XP_007144506.1|  hypothetical protein PHAVU_007G161700g           60.1    8e-08   
ref|XP_003542486.1|  PREDICTED: probable protein phosphatase 2C 3...  60.1    8e-08   
ref|XP_008369822.1|  PREDICTED: probable protein phosphatase 2C 38    60.1    9e-08   
ref|XP_011048438.1|  PREDICTED: probable protein phosphatase 2C 38    59.7    1e-07   
gb|KJB62538.1|  hypothetical protein B456_009G421600                  59.7    1e-07   
ref|XP_010516060.1|  PREDICTED: probable protein phosphatase 2C 48    59.7    1e-07   
ref|XP_004302825.1|  PREDICTED: probable protein phosphatase 2C 38    59.7    1e-07   
ref|XP_001780124.1|  predicted protein                                59.7    1e-07   
ref|XP_003629241.1|  Protein phosphatase 2c-like protein              59.3    2e-07   
ref|XP_003629242.1|  Protein phosphatase 2c-like protein              59.3    2e-07   
ref|XP_002987879.1|  hypothetical protein SELMODRAFT_183449           59.3    2e-07   
ref|XP_006345807.1|  PREDICTED: probable protein phosphatase 2C 3...  58.9    2e-07   
ref|XP_002990452.1|  hypothetical protein SELMODRAFT_185274           58.9    3e-07   
gb|AFK42727.1|  unknown                                               58.2    3e-07   
gb|KDO47488.1|  hypothetical protein CISIN_1g017598mg                 58.5    3e-07   
ref|XP_007162702.1|  hypothetical protein PHAVU_001G173100g           58.2    3e-07   
gb|KHG10813.1|  hypothetical protein F383_12861                       58.2    4e-07   
ref|XP_008359691.1|  PREDICTED: probable protein phosphatase 2C 38    58.2    5e-07   
ref|XP_006597694.1|  PREDICTED: probable protein phosphatase 2C 4...  57.8    5e-07   
gb|KJB38495.1|  hypothetical protein B456_006G257900                  57.0    5e-07   
gb|KJB28751.1|  hypothetical protein B456_005G067600                  56.6    6e-07   
ref|XP_008442607.1|  PREDICTED: probable protein phosphatase 2C 38    57.4    7e-07   
ref|XP_004137794.1|  PREDICTED: probable protein phosphatase 2C 3...  57.4    7e-07   
ref|XP_004246719.1|  PREDICTED: probable protein phosphatase 2C 38    57.4    7e-07   
gb|KJB28750.1|  hypothetical protein B456_005G067600                  57.4    8e-07   
gb|KJB28752.1|  hypothetical protein B456_005G067600                  57.0    8e-07   
gb|ACJ84893.1|  unknown                                               56.2    9e-07   
ref|XP_003521364.1|  PREDICTED: probable protein phosphatase 2C 3...  57.0    9e-07   
ref|XP_002865087.1|  phosphatase 2C family protein                    57.0    1e-06   
ref|XP_006604545.1|  PREDICTED: probable protein phosphatase 2C 7...  57.0    1e-06   
ref|XP_001770282.1|  predicted protein                                57.0    1e-06   
gb|KHG07073.1|  hypothetical protein F383_01352                       57.0    1e-06   
ref|XP_002273100.1|  PREDICTED: probable protein phosphatase 2C 42    57.0    1e-06   
gb|KJB38494.1|  hypothetical protein B456_006G257900                  56.6    1e-06   
emb|CAN72598.1|  hypothetical protein VITISV_017615                   57.0    1e-06   
gb|KJB38493.1|  hypothetical protein B456_006G257900                  57.0    1e-06   
gb|KHG29304.1|  hypothetical protein F383_15428                       57.0    1e-06   
ref|XP_004493924.1|  PREDICTED: probable protein phosphatase 2C 3...  56.6    1e-06   
ref|XP_004493923.1|  PREDICTED: probable protein phosphatase 2C 3...  56.6    1e-06   
ref|XP_003625537.1|  Protein phosphatase 2c-like protein              56.6    1e-06   
ref|XP_006600378.1|  PREDICTED: probable protein phosphatase 2C 4...  56.6    1e-06   
gb|KHN18425.1|  Hypothetical protein glysoja_006838                   53.1    1e-06   
ref|XP_009787701.1|  PREDICTED: probable protein phosphatase 2C 3...  56.2    2e-06   
ref|XP_009787699.1|  PREDICTED: probable protein phosphatase 2C 3...  56.2    2e-06   
ref|XP_009616353.1|  PREDICTED: probable protein phosphatase 2C 3...  56.2    2e-06   
ref|XP_007147370.1|  hypothetical protein PHAVU_006G118600g           56.2    2e-06   
ref|XP_009616352.1|  PREDICTED: probable protein phosphatase 2C 3...  56.2    2e-06   
ref|XP_010267931.1|  PREDICTED: probable protein phosphatase 2C 42    56.2    2e-06   
ref|XP_007154392.1|  hypothetical protein PHAVU_003G115500g           55.8    2e-06   
ref|XP_010524586.1|  PREDICTED: probable protein phosphatase 2C 42    55.5    3e-06   
gb|KJB72847.1|  hypothetical protein B456_011G200800                  55.8    3e-06   
ref|XP_006345698.1|  PREDICTED: probable protein phosphatase 2C 3...  55.5    3e-06   
ref|XP_001776511.1|  predicted protein                                55.5    4e-06   
ref|XP_006841466.1|  hypothetical protein AMTR_s00003p00098390        55.1    5e-06   
ref|XP_006583996.1|  PREDICTED: probable protein phosphatase 2C 4...  54.3    7e-06   
ref|XP_008346820.1|  PREDICTED: death-associated protein kinase 2...  54.7    7e-06   
ref|XP_010265917.1|  PREDICTED: probable protein phosphatase 2C 43    54.3    7e-06   
ref|XP_004497440.1|  PREDICTED: probable protein phosphatase 2C 3...  53.9    1e-05   
ref|XP_010696499.1|  PREDICTED: probable protein phosphatase 2C 38    53.9    1e-05   
gb|KJB72849.1|  hypothetical protein B456_011G200800                  53.1    1e-05   
ref|XP_010259227.1|  PREDICTED: probable protein phosphatase 2C 4...  53.9    1e-05   
gb|KEH42314.1|  serine/threonine phosphatase family, 2C domain pr...  53.9    1e-05   
ref|XP_010259229.1|  PREDICTED: probable protein phosphatase 2C 4...  53.5    1e-05   
ref|XP_010259228.1|  PREDICTED: probable protein phosphatase 2C 4...  53.5    1e-05   
ref|XP_010086750.1|  putative protein phosphatase 2C 38               53.5    1e-05   
ref|XP_009114322.1|  PREDICTED: probable protein phosphatase 2C 42    53.5    1e-05   
emb|CDY39026.1|  BnaC01g34900D                                        53.5    1e-05   
gb|KJB72848.1|  hypothetical protein B456_011G200800                  53.5    1e-05   
ref|XP_010558929.1|  PREDICTED: probable protein phosphatase 2C 67    53.5    2e-05   
ref|XP_001754047.1|  predicted protein                                53.5    2e-05   
ref|XP_008777523.1|  PREDICTED: probable protein phosphatase 2C 43    52.8    2e-05   
gb|KFK24725.1|  hypothetical protein AALP_AA8G016500                  52.8    2e-05   
ref|XP_010504959.1|  PREDICTED: probable protein phosphatase 2C 42    52.8    3e-05   
ref|XP_010047084.1|  PREDICTED: probable protein phosphatase 2C 3...  52.8    3e-05   
ref|XP_010047086.1|  PREDICTED: probable protein phosphatase 2C 3...  52.8    3e-05   
gb|AAM61747.1|  protein phosphatase-2c, putative                      52.4    4e-05   
ref|XP_010065305.1|  PREDICTED: probable protein phosphatase 2C 42    52.0    4e-05   
ref|XP_006586887.1|  PREDICTED: probable protein phosphatase 2C 4...  52.0    5e-05   
ref|XP_008458343.1|  PREDICTED: probable protein phosphatase 2C 4...  52.0    5e-05   
ref|XP_008458342.1|  PREDICTED: probable protein phosphatase 2C 4...  52.0    5e-05   
gb|KHG17249.1|  hypothetical protein F383_02761                       51.6    6e-05   
ref|XP_009604367.1|  PREDICTED: probable protein phosphatase 2C 43    51.6    6e-05   
ref|XP_008791697.1|  PREDICTED: probable protein phosphatase 2C 42    51.6    6e-05   
gb|EYU39574.1|  hypothetical protein MIMGU_mgv1a008078mg              51.2    8e-05   
ref|XP_008681500.1|  PREDICTED: uncharacterized protein LOC100273...  50.8    1e-04   
gb|ACG34149.1|  catalytic/ protein phosphatase type 2C                50.8    1e-04   
emb|CAN71888.1|  hypothetical protein VITISV_040860                   50.8    1e-04   
ref|XP_002279599.1|  PREDICTED: probable protein phosphatase 2C 25    50.8    1e-04   
ref|NP_001141778.2|  uncharacterized protein LOC100273914             50.8    1e-04   
ref|XP_002323279.2|  phosphatase 2C family protein                    50.4    1e-04   
ref|XP_011033210.1|  PREDICTED: probable protein phosphatase 2C 68    50.4    1e-04   
ref|XP_010910157.1|  PREDICTED: probable protein phosphatase 2C 43    50.4    2e-04   
gb|EEC73802.1|  hypothetical protein OsI_08505                        47.8    2e-04   
emb|CDY55405.1|  BnaCnng28720D                                        50.1    2e-04   
emb|CDX70348.1|  BnaA10g26970D                                        50.1    2e-04   
emb|CDY10428.1|  BnaCnng03290D                                        50.1    2e-04   
ref|XP_008223376.1|  PREDICTED: probable protein phosphatase 2C 42    50.1    2e-04   
ref|XP_006406770.1|  hypothetical protein EUTSA_v10020928mg           50.1    2e-04   
ref|XP_006855631.1|  hypothetical protein AMTR_s00044p00096750        50.1    2e-04   
ref|XP_009413067.1|  PREDICTED: probable protein phosphatase 2C 25    50.1    2e-04   
ref|XP_010452122.1|  PREDICTED: probable protein phosphatase 2C 67    50.1    2e-04   
ref|XP_004953479.1|  PREDICTED: probable protein phosphatase 2C 2...  50.1    2e-04   
ref|XP_006288092.1|  hypothetical protein CARUB_v10001322mg           49.7    2e-04   
emb|CAB86030.1|  protein phosphatase-like protein                     49.7    2e-04   
ref|XP_010423830.1|  PREDICTED: probable protein phosphatase 2C 6...  49.7    2e-04   
ref|XP_010423831.1|  PREDICTED: probable protein phosphatase 2C 6...  49.7    3e-04   
ref|NP_195896.2|  putative protein phosphatase 2C 67                  49.7    3e-04   
ref|XP_010490738.1|  PREDICTED: probable protein phosphatase 2C 67    49.7    3e-04   
ref|XP_002870988.1|  phosphatase 2C family protein                    49.7    3e-04   
ref|XP_009792156.1|  PREDICTED: probable protein phosphatase 2C 4...  49.3    3e-04   
ref|XP_009792152.1|  PREDICTED: probable protein phosphatase 2C 4...  49.3    3e-04   
ref|XP_009792154.1|  PREDICTED: probable protein phosphatase 2C 4...  49.3    3e-04   
ref|XP_009792153.1|  PREDICTED: probable protein phosphatase 2C 4...  49.3    3e-04   
ref|XP_009792157.1|  PREDICTED: probable protein phosphatase 2C 4...  49.3    3e-04   
gb|KCW90310.1|  hypothetical protein EUGRSUZ_A02453                   49.3    3e-04   
emb|CDY04862.1|  BnaAnng00440D                                        49.3    3e-04   
ref|XP_009792155.1|  PREDICTED: probable protein phosphatase 2C 4...  49.3    3e-04   
gb|KFK39044.1|  hypothetical protein AALP_AA3G193600                  49.3    3e-04   
ref|XP_010543348.1|  PREDICTED: probable protein phosphatase 2C 6...  49.3    4e-04   
ref|XP_010543349.1|  PREDICTED: probable protein phosphatase 2C 6...  49.3    4e-04   



>ref|XP_006360895.1| PREDICTED: probable protein phosphatase 2C 60-like isoform X1 
[Solanum tuberosum]
 ref|XP_006360896.1| PREDICTED: probable protein phosphatase 2C 60-like isoform X2 
[Solanum tuberosum]
Length=388

 Score =   114 bits (284),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 50/61 (82%), Positives = 56/61 (92%), Gaps = 0/61 (0%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            MLSGLM  LRACF P+  RHV++GSDA+GRQDGLLWYKDTGQHF+GEFSMAVVQANNL+E
Sbjct  1    MLSGLMNFLRACFQPRANRHVHTGSDASGRQDGLLWYKDTGQHFNGEFSMAVVQANNLLE  60

Query  487  D  489
            D
Sbjct  61   D  61



>ref|XP_011092959.1| PREDICTED: probable protein phosphatase 2C 60 [Sesamum indicum]
Length=397

 Score =   113 bits (283),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 49/61 (80%), Positives = 57/61 (93%), Gaps = 0/61 (0%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            MLSGLM  LRACF P+ +RHV++GSDA+GRQDGLLWYKD+GQHF+GEFSMAVVQANNL+E
Sbjct  1    MLSGLMNFLRACFRPRADRHVHTGSDASGRQDGLLWYKDSGQHFNGEFSMAVVQANNLLE  60

Query  487  D  489
            D
Sbjct  61   D  61



>ref|XP_004248644.1| PREDICTED: probable protein phosphatase 2C 60 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010327397.1| PREDICTED: probable protein phosphatase 2C 60 isoform X1 [Solanum 
lycopersicum]
Length=388

 Score =   112 bits (279),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 49/61 (80%), Positives = 56/61 (92%), Gaps = 0/61 (0%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            MLSGLM  LRACF P+  RHV++GSDA+GRQDGLLWYKDTGQHF+G+FSMAVVQANNL+E
Sbjct  1    MLSGLMNYLRACFQPRANRHVHTGSDASGRQDGLLWYKDTGQHFNGDFSMAVVQANNLLE  60

Query  487  D  489
            D
Sbjct  61   D  61



>ref|XP_011088628.1| PREDICTED: probable protein phosphatase 2C 60 [Sesamum indicum]
 ref|XP_011088629.1| PREDICTED: probable protein phosphatase 2C 60 [Sesamum indicum]
Length=397

 Score =   110 bits (276),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 48/61 (79%), Positives = 57/61 (93%), Gaps = 0/61 (0%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            MLSGLM  LRACF P+ +R+V++GSDA+GRQDGLLWYKD+GQHF+GEFSMAVVQANNL+E
Sbjct  1    MLSGLMNFLRACFRPRADRYVHTGSDASGRQDGLLWYKDSGQHFNGEFSMAVVQANNLLE  60

Query  487  D  489
            D
Sbjct  61   D  61



>ref|XP_007041771.1| Phosphatase 2C family protein isoform 1 [Theobroma cacao]
 gb|EOX97602.1| Phosphatase 2C family protein isoform 1 [Theobroma cacao]
Length=397

 Score =   109 bits (272),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 49/61 (80%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            MLSGLM  LRACF P+ +R+V++ SDA GRQDGLLWYKDTGQHFSGEFSMAVVQANNL+E
Sbjct  1    MLSGLMNFLRACFRPRSDRYVHTSSDAGGRQDGLLWYKDTGQHFSGEFSMAVVQANNLLE  60

Query  487  D  489
            D
Sbjct  61   D  61



>ref|XP_010266043.1| PREDICTED: probable protein phosphatase 2C 60 [Nelumbo nucifera]
 ref|XP_010266044.1| PREDICTED: probable protein phosphatase 2C 60 [Nelumbo nucifera]
Length=231

 Score =   106 bits (264),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 47/61 (77%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            MLSGLM +LRAC+ P  +R+V++GSDA GRQDGLLWYKDTGQH +GEFSMAVVQANNL+E
Sbjct  1    MLSGLMNLLRACWRPSSDRYVHTGSDAVGRQDGLLWYKDTGQHLNGEFSMAVVQANNLLE  60

Query  487  D  489
            D
Sbjct  61   D  61



>ref|XP_009628267.1| PREDICTED: probable protein phosphatase 2C 60 [Nicotiana tomentosiformis]
Length=387

 Score =   107 bits (267),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 47/61 (77%), Positives = 54/61 (89%), Gaps = 0/61 (0%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            M+SGLM ILRACF P+ + HV++ SDA GRQDGLLWYKDTGQH +GEFSMAVVQANNL+E
Sbjct  1    MISGLMNILRACFQPRADGHVHTSSDAAGRQDGLLWYKDTGQHVNGEFSMAVVQANNLLE  60

Query  487  D  489
            D
Sbjct  61   D  61



>gb|KJB15851.1| hypothetical protein B456_002G199700 [Gossypium raimondii]
Length=388

 Score =   107 bits (267),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 48/61 (79%), Positives = 54/61 (89%), Gaps = 0/61 (0%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            MLSG M  LRACF P+ +R+V+S SDA GRQDGLLWYKDTGQHF+GEFSMAVVQANNL+E
Sbjct  1    MLSGFMNFLRACFRPRSDRYVHSSSDAGGRQDGLLWYKDTGQHFNGEFSMAVVQANNLLE  60

Query  487  D  489
            D
Sbjct  61   D  61



>gb|KJB15850.1| hypothetical protein B456_002G199700 [Gossypium raimondii]
 gb|KJB15852.1| hypothetical protein B456_002G199700 [Gossypium raimondii]
 gb|KJB15853.1| hypothetical protein B456_002G199700 [Gossypium raimondii]
Length=392

 Score =   107 bits (267),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 48/61 (79%), Positives = 54/61 (89%), Gaps = 0/61 (0%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            MLSG M  LRACF P+ +R+V+S SDA GRQDGLLWYKDTGQHF+GEFSMAVVQANNL+E
Sbjct  1    MLSGFMNFLRACFRPRSDRYVHSSSDAGGRQDGLLWYKDTGQHFNGEFSMAVVQANNLLE  60

Query  487  D  489
            D
Sbjct  61   D  61



>ref|XP_009783505.1| PREDICTED: probable protein phosphatase 2C 60 [Nicotiana sylvestris]
Length=387

 Score =   107 bits (267),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 47/61 (77%), Positives = 54/61 (89%), Gaps = 0/61 (0%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            M+SGLM ILRACF P+ + HV++ SDA GRQDGLLWYKDTGQH +GEFSMAVVQANNL+E
Sbjct  1    MISGLMNILRACFQPRADGHVHTSSDAAGRQDGLLWYKDTGQHVNGEFSMAVVQANNLLE  60

Query  487  D  489
            D
Sbjct  61   D  61



>ref|XP_010266045.1| PREDICTED: probable protein phosphatase 2C 60 [Nelumbo nucifera]
 ref|XP_010266046.1| PREDICTED: probable protein phosphatase 2C 60 [Nelumbo nucifera]
Length=397

 Score =   106 bits (265),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 47/61 (77%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            MLSGLM +LRAC+ P  +R+V++GSDA GRQDGLLWYKDTGQH +GEFSMAVVQANNL+E
Sbjct  1    MLSGLMNLLRACWRPSSDRYVHTGSDAVGRQDGLLWYKDTGQHLNGEFSMAVVQANNLLE  60

Query  487  D  489
            D
Sbjct  61   D  61



>gb|KHG25255.1| hypothetical protein F383_08950 [Gossypium arboreum]
Length=397

 Score =   106 bits (265),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 46/61 (75%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            MLSGLM +LRACF P+ +RHV++ S+  GRQDGLLWYKD+GQHF+GEFSMAVVQANNL+E
Sbjct  1    MLSGLMNLLRACFLPRSDRHVHTSSENGGRQDGLLWYKDSGQHFNGEFSMAVVQANNLLE  60

Query  487  D  489
            D
Sbjct  61   D  61



>gb|EYU37974.1| hypothetical protein MIMGU_mgv1a007884mg [Erythranthe guttata]
Length=392

 Score =   106 bits (264),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 46/61 (75%), Positives = 56/61 (92%), Gaps = 0/61 (0%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            MLSGLM  LRACF P+ +++++SGSDA+GRQDGLLWYKD GQHF+G+FSMAVVQANNL+E
Sbjct  1    MLSGLMNFLRACFRPRADQYIHSGSDASGRQDGLLWYKDFGQHFNGDFSMAVVQANNLLE  60

Query  487  D  489
            D
Sbjct  61   D  61



>ref|XP_002521272.1| protein phosphatase 2c, putative [Ricinus communis]
 gb|EEF41128.1| protein phosphatase 2c, putative [Ricinus communis]
Length=397

 Score =   105 bits (263),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 46/61 (75%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            MLSGLM  LRACF P+ +R+V++ SD++GRQDGLLWYKD GQHF+GEFSMAVVQANNL+E
Sbjct  1    MLSGLMNFLRACFRPRSDRYVHTNSDSSGRQDGLLWYKDHGQHFNGEFSMAVVQANNLLE  60

Query  487  D  489
            D
Sbjct  61   D  61



>ref|XP_009791771.1| PREDICTED: probable protein phosphatase 2C 46 [Nicotiana sylvestris]
 ref|XP_009791772.1| PREDICTED: probable protein phosphatase 2C 46 [Nicotiana sylvestris]
Length=392

 Score =   105 bits (263),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 47/61 (77%), Positives = 54/61 (89%), Gaps = 0/61 (0%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            M SGLM +LRACF P+ + HV++GSDA GRQDGLLWYKD GQHF+GEFSMAVVQANNL+E
Sbjct  1    MSSGLMNLLRACFQPRADGHVHTGSDAGGRQDGLLWYKDIGQHFNGEFSMAVVQANNLLE  60

Query  487  D  489
            D
Sbjct  61   D  61



>ref|XP_009590077.1| PREDICTED: probable protein phosphatase 2C 46 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009590078.1| PREDICTED: probable protein phosphatase 2C 46 isoform X1 [Nicotiana 
tomentosiformis]
Length=392

 Score =   105 bits (263),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 47/61 (77%), Positives = 54/61 (89%), Gaps = 0/61 (0%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            M SGLM +LRACF P+ + HV++GSDA GRQDGLLWYKD GQHF+GEFSMAVVQANNL+E
Sbjct  1    MSSGLMNLLRACFQPRADGHVHTGSDAGGRQDGLLWYKDIGQHFNGEFSMAVVQANNLLE  60

Query  487  D  489
            D
Sbjct  61   D  61



>gb|KHG27171.1| hypothetical protein F383_05187 [Gossypium arboreum]
Length=392

 Score =   105 bits (261),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 47/61 (77%), Positives = 53/61 (87%), Gaps = 0/61 (0%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            MLSG M  LRACF P+ +R+V+S SDA  RQDGLLWYKDTGQHF+GEFSMAVVQANNL+E
Sbjct  1    MLSGFMNFLRACFRPRSDRYVHSSSDAGSRQDGLLWYKDTGQHFNGEFSMAVVQANNLLE  60

Query  487  D  489
            D
Sbjct  61   D  61



>ref|XP_009590079.1| PREDICTED: probable protein phosphatase 2C 60 isoform X2 [Nicotiana 
tomentosiformis]
Length=332

 Score =   104 bits (260),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 47/61 (77%), Positives = 54/61 (89%), Gaps = 0/61 (0%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            M SGLM +LRACF P+ + HV++GSDA GRQDGLLWYKD GQHF+GEFSMAVVQANNL+E
Sbjct  1    MSSGLMNLLRACFQPRADGHVHTGSDAGGRQDGLLWYKDIGQHFNGEFSMAVVQANNLLE  60

Query  487  D  489
            D
Sbjct  61   D  61



>ref|XP_002279993.1| PREDICTED: probable protein phosphatase 2C 60 [Vitis vinifera]
 ref|XP_003631567.1| PREDICTED: probable protein phosphatase 2C 60 [Vitis vinifera]
 emb|CBI37846.3| unnamed protein product [Vitis vinifera]
Length=397

 Score =   104 bits (260),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 47/61 (77%), Positives = 54/61 (89%), Gaps = 0/61 (0%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            MLSGLM  LRACF P  +R+V++GSDA GRQDGLLWYKD+GQH SGEFSMAV+QANNL+E
Sbjct  1    MLSGLMNFLRACFRPGSDRYVHTGSDAGGRQDGLLWYKDSGQHSSGEFSMAVIQANNLLE  60

Query  487  D  489
            D
Sbjct  61   D  61



>emb|CAN64313.1| hypothetical protein VITISV_023164 [Vitis vinifera]
Length=384

 Score =   104 bits (259),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 47/61 (77%), Positives = 54/61 (89%), Gaps = 0/61 (0%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            MLSGLM  LRACF P  +R+V++GSDA GRQDGLLWYKD+GQH SGEFSMAV+QANNL+E
Sbjct  1    MLSGLMNFLRACFRPGSDRYVHTGSDAGGRQDGLLWYKDSGQHSSGEFSMAVIQANNLLE  60

Query  487  D  489
            D
Sbjct  61   D  61



>ref|XP_007041776.1| Phosphatase 2C family protein [Theobroma cacao]
 gb|EOX97607.1| Phosphatase 2C family protein [Theobroma cacao]
Length=397

 Score =   104 bits (259),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 47/61 (77%), Positives = 54/61 (89%), Gaps = 0/61 (0%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            MLSGLM  L ACF P+ +R+V++ SDA GRQDGLLWYKDTGQHF+GEFSMAVVQANNL+E
Sbjct  1    MLSGLMNFLWACFRPRSDRYVHTSSDAGGRQDGLLWYKDTGQHFNGEFSMAVVQANNLLE  60

Query  487  D  489
            D
Sbjct  61   D  61



>ref|XP_009595549.1| PREDICTED: probable protein phosphatase 2C 46 [Nicotiana tomentosiformis]
 ref|XP_009595550.1| PREDICTED: probable protein phosphatase 2C 46 [Nicotiana tomentosiformis]
Length=395

 Score =   104 bits (259),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 49/63 (78%), Positives = 57/63 (90%), Gaps = 2/63 (3%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYS-GSDA-TGRQDGLLWYKDTGQHFSGEFSMAVVQANNL  480
            MLSGLM +LRACF P+  RHV++ GSDA +GRQDGLLWYKDTGQHF+G+FSMAVVQANNL
Sbjct  1    MLSGLMNLLRACFQPRANRHVHTTGSDAGSGRQDGLLWYKDTGQHFNGDFSMAVVQANNL  60

Query  481  MED  489
            +ED
Sbjct  61   LED  63



>ref|XP_007041772.1| Phosphatase 2C family protein isoform 2 [Theobroma cacao]
 gb|EOX97603.1| Phosphatase 2C family protein isoform 2 [Theobroma cacao]
Length=397

 Score =   104 bits (259),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 47/61 (77%), Positives = 54/61 (89%), Gaps = 0/61 (0%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            MLSGLM  L ACF P+ +R+V++ SDA GRQDGLLWYKDTGQHF+GEFSMAVVQANNL+E
Sbjct  1    MLSGLMNFLWACFRPRSDRYVHTSSDAGGRQDGLLWYKDTGQHFNGEFSMAVVQANNLLE  60

Query  487  D  489
            D
Sbjct  61   D  61



>gb|KJB32673.1| hypothetical protein B456_005G255000 [Gossypium raimondii]
 gb|KJB32675.1| hypothetical protein B456_005G255000 [Gossypium raimondii]
Length=397

 Score =   104 bits (259),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 45/61 (74%), Positives = 54/61 (89%), Gaps = 0/61 (0%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            MLSGLM +L ACF P+ +RHV++ S+  GRQDGLLWYKD+GQHF+GEFSMAVVQANNL+E
Sbjct  1    MLSGLMNLLMACFLPRSDRHVHTSSETGGRQDGLLWYKDSGQHFNGEFSMAVVQANNLLE  60

Query  487  D  489
            D
Sbjct  61   D  61



>ref|XP_004169425.1| PREDICTED: LOW QUALITY PROTEIN: probable protein phosphatase 
2C 60-like [Cucumis sativus]
Length=397

 Score =   103 bits (257),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 46/61 (75%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            M S LM  LRACF P+ +RHV+ GSDA GRQDGLLWYKD+GQH +GEFSMAVVQANNL+E
Sbjct  1    MFSELMNFLRACFRPRSDRHVHKGSDAGGRQDGLLWYKDSGQHANGEFSMAVVQANNLLE  60

Query  487  D  489
            D
Sbjct  61   D  61



>ref|XP_004147052.1| PREDICTED: probable protein phosphatase 2C 60-like [Cucumis sativus]
 gb|KGN61946.1| hypothetical protein Csa_2G271380 [Cucumis sativus]
Length=397

 Score =   103 bits (257),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 46/61 (75%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            M S LM  LRACF P+ +RHV+ GSDA GRQDGLLWYKD+GQH +GEFSMAVVQANNL+E
Sbjct  1    MFSELMNFLRACFRPRSDRHVHKGSDAGGRQDGLLWYKDSGQHANGEFSMAVVQANNLLE  60

Query  487  D  489
            D
Sbjct  61   D  61



>ref|XP_008457720.1| PREDICTED: probable protein phosphatase 2C 60 [Cucumis melo]
 ref|XP_008457721.1| PREDICTED: probable protein phosphatase 2C 60 [Cucumis melo]
 ref|XP_008457722.1| PREDICTED: probable protein phosphatase 2C 60 [Cucumis melo]
Length=397

 Score =   103 bits (257),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 46/61 (75%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            M S LM  LRACF P+ +RHV+ GSDA GRQDGLLWYKD+GQH +GEFSMAVVQANNL+E
Sbjct  1    MFSELMNFLRACFRPRSDRHVHKGSDAGGRQDGLLWYKDSGQHANGEFSMAVVQANNLLE  60

Query  487  D  489
            D
Sbjct  61   D  61



>gb|KDP33299.1| hypothetical protein JCGZ_13086 [Jatropha curcas]
Length=397

 Score =   103 bits (256),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 45/61 (74%), Positives = 54/61 (89%), Gaps = 0/61 (0%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            MLSGLM  LRACF P+ +R+V++ SD++GRQDGLLWYKD GQH +GEFSMAVVQANNL+E
Sbjct  1    MLSGLMNFLRACFRPRSDRYVHTNSDSSGRQDGLLWYKDHGQHVNGEFSMAVVQANNLLE  60

Query  487  D  489
            D
Sbjct  61   D  61



>ref|XP_006422534.1| hypothetical protein CICLE_v10028600mg [Citrus clementina]
 gb|ESR35774.1| hypothetical protein CICLE_v10028600mg [Citrus clementina]
Length=397

 Score =   102 bits (254),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/61 (74%), Positives = 53/61 (87%), Gaps = 0/61 (0%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            MLS LM +LRACF P+ +R+V+S SD+ GRQDGLLWYKD+G H SGEFSMAVVQANNL+E
Sbjct  1    MLSELMNLLRACFRPRSDRYVHSNSDSVGRQDGLLWYKDSGHHVSGEFSMAVVQANNLLE  60

Query  487  D  489
            D
Sbjct  61   D  61



>ref|XP_002530628.1| protein phosphatase 2c, putative [Ricinus communis]
 gb|EEF31736.1| protein phosphatase 2c, putative [Ricinus communis]
Length=395

 Score =   102 bits (253),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 46/61 (75%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            MLS L+  LRAC+ P  ER+V+ GSDA GRQDGLLWYKDTGQH +GEFSMAVVQANNL+E
Sbjct  1    MLSRLINFLRACWLPSSERYVHMGSDAAGRQDGLLWYKDTGQHVNGEFSMAVVQANNLLE  60

Query  487  D  489
            D
Sbjct  61   D  61



>ref|XP_006486691.1| PREDICTED: probable protein phosphatase 2C 60-like [Citrus sinensis]
Length=397

 Score =   101 bits (252),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 45/61 (74%), Positives = 53/61 (87%), Gaps = 0/61 (0%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            MLS LM +LRACF P+ +R+V+S SD+ GRQDGLLWYKD+G H SGEFSMAVVQANNL+E
Sbjct  1    MLSELMNLLRACFRPRSDRYVHSNSDSLGRQDGLLWYKDSGHHVSGEFSMAVVQANNLLE  60

Query  487  D  489
            D
Sbjct  61   D  61



>ref|XP_009781837.1| PREDICTED: probable protein phosphatase 2C 46 [Nicotiana sylvestris]
Length=395

 Score =   101 bits (251),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 48/63 (76%), Positives = 55/63 (87%), Gaps = 2/63 (3%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYS-GSDATG-RQDGLLWYKDTGQHFSGEFSMAVVQANNL  480
            MLSGLM +LRACF P+  RHV++ GSD  G RQDGLLWYKDTGQHF+G+FSMAVVQANNL
Sbjct  1    MLSGLMNLLRACFQPRANRHVHTTGSDVGGGRQDGLLWYKDTGQHFNGDFSMAVVQANNL  60

Query  481  MED  489
            +ED
Sbjct  61   LED  63



>ref|XP_002313699.1| phosphatase 2C family protein [Populus trichocarpa]
 gb|ABK94829.1| unknown [Populus trichocarpa]
 gb|EEE87654.1| phosphatase 2C family protein [Populus trichocarpa]
Length=397

 Score =   101 bits (251),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 45/61 (74%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            MLSGLM  LRACF P+ +R+V++ SD  GRQDGLLWYKD GQH +GEFSMAVVQANNL+E
Sbjct  1    MLSGLMNFLRACFRPRPDRYVHTNSDTGGRQDGLLWYKDHGQHVNGEFSMAVVQANNLLE  60

Query  487  D  489
            D
Sbjct  61   D  61



>ref|XP_011046655.1| PREDICTED: probable protein phosphatase 2C 64 [Populus euphratica]
 ref|XP_011046656.1| PREDICTED: probable protein phosphatase 2C 64 [Populus euphratica]
Length=397

 Score =   101 bits (251),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 45/61 (74%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            MLSGLM  LRACF P+ +R+V++ SD  GRQDGLLWYKD GQH +GEFSMAVVQANNL+E
Sbjct  1    MLSGLMNFLRACFRPRPDRYVHTNSDTGGRQDGLLWYKDHGQHVNGEFSMAVVQANNLLE  60

Query  487  D  489
            D
Sbjct  61   D  61



>ref|XP_011045811.1| PREDICTED: probable protein phosphatase 2C 64 [Populus euphratica]
Length=397

 Score =   101 bits (251),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 45/61 (74%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            MLSGLM  LRACF P+ +R+V++ SD  GRQDGLLWYKD GQH +GEFSMAVVQANNL+E
Sbjct  1    MLSGLMNFLRACFRPRPDRYVHTNSDTGGRQDGLLWYKDHGQHVNGEFSMAVVQANNLLE  60

Query  487  D  489
            D
Sbjct  61   D  61



>ref|XP_010239682.1| PREDICTED: probable protein phosphatase 2C 60 [Brachypodium distachyon]
 ref|XP_010239689.1| PREDICTED: probable protein phosphatase 2C 60 [Brachypodium distachyon]
Length=392

 Score =   100 bits (250),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 45/61 (74%), Positives = 51/61 (84%), Gaps = 0/61 (0%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            M+  LM +LRAC+ P   RH  +GSDATGRQDGLLWYKDTGQH +GEFSMAVVQANNL+E
Sbjct  1    MIVTLMNLLRACWRPSSNRHARTGSDATGRQDGLLWYKDTGQHVNGEFSMAVVQANNLLE  60

Query  487  D  489
            D
Sbjct  61   D  61



>ref|XP_011022262.1| PREDICTED: probable protein phosphatase 2C 46 [Populus euphratica]
Length=397

 Score =   100 bits (250),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 45/61 (74%), Positives = 53/61 (87%), Gaps = 0/61 (0%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            MLS L+  LRAC+ P  +R+V+SGS+A GRQDGLLWYKDTGQH +GEFSMAVVQANNL+E
Sbjct  1    MLSRLIIFLRACWLPSSDRYVHSGSEAAGRQDGLLWYKDTGQHMNGEFSMAVVQANNLLE  60

Query  487  D  489
            D
Sbjct  61   D  61



>ref|XP_006383046.1| phosphatase 2C family protein [Populus trichocarpa]
 gb|ABK95130.1| unknown [Populus trichocarpa]
 gb|ERP60843.1| phosphatase 2C family protein [Populus trichocarpa]
Length=397

 Score =   100 bits (249),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 53/61 (87%), Gaps = 0/61 (0%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            MLS L+  LRAC+ P  +R+V++GS+A GRQDGLLWYKDTGQH +GEFSMAVVQANNL+E
Sbjct  1    MLSRLINFLRACWLPSSDRYVHTGSEAAGRQDGLLWYKDTGQHMNGEFSMAVVQANNLLE  60

Query  487  D  489
            D
Sbjct  61   D  61



>ref|XP_002305529.1| hypothetical protein POPTR_0004s18340g [Populus trichocarpa]
 gb|EEE86040.1| hypothetical protein POPTR_0004s18340g [Populus trichocarpa]
Length=397

 Score =   100 bits (249),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 53/61 (87%), Gaps = 0/61 (0%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            MLSGLM +LRACF P+ +++V++ SD  GRQDGLLWYKD GQH +GEFSMAVVQANNL+E
Sbjct  1    MLSGLMNLLRACFRPRSDQYVHTNSDTGGRQDGLLWYKDHGQHVNGEFSMAVVQANNLLE  60

Query  487  D  489
            D
Sbjct  61   D  61



>ref|XP_007201072.1| hypothetical protein PRUPE_ppa006747mg [Prunus persica]
 ref|XP_008236049.1| PREDICTED: probable protein phosphatase 2C 60 [Prunus mume]
 gb|EMJ02271.1| hypothetical protein PRUPE_ppa006747mg [Prunus persica]
Length=397

 Score = 99.8 bits (247),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 43/61 (70%), Positives = 53/61 (87%), Gaps = 0/61 (0%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            MLS LM  LR+CF P+  R+V++G+D+ GRQDGLLWYKDTGQH +G+FSMAVVQANNL+E
Sbjct  1    MLSELMNFLRSCFRPRSNRYVHTGADSGGRQDGLLWYKDTGQHINGDFSMAVVQANNLLE  60

Query  487  D  489
            D
Sbjct  61   D  61



>ref|XP_009363444.1| PREDICTED: probable protein phosphatase 2C 46 [Pyrus x bretschneideri]
Length=394

 Score = 99.8 bits (247),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 45/61 (74%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            MLS LM ILR C+ P  +R+ +SGSDA GRQ+GLLWYKDTGQH +GEFSMAVVQANNL+E
Sbjct  1    MLSRLMNILRGCWLPSSDRYGHSGSDAAGRQEGLLWYKDTGQHMNGEFSMAVVQANNLLE  60

Query  487  D  489
            D
Sbjct  61   D  61



>ref|XP_008377721.1| PREDICTED: probable protein phosphatase 2C 60 [Malus domestica]
Length=397

 Score = 99.8 bits (247),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 43/61 (70%), Positives = 53/61 (87%), Gaps = 0/61 (0%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            MLS LM  LR+CF P+  R+V++G+D+ GRQDGLLWYKDTGQH +G+FSMAVVQANNL+E
Sbjct  1    MLSELMNFLRSCFRPRSNRYVHTGADSGGRQDGLLWYKDTGQHINGDFSMAVVQANNLLE  60

Query  487  D  489
            D
Sbjct  61   D  61



>ref|XP_010066286.1| PREDICTED: probable protein phosphatase 2C 60 [Eucalyptus grandis]
 ref|XP_010066287.1| PREDICTED: probable protein phosphatase 2C 60 [Eucalyptus grandis]
 ref|XP_010066288.1| PREDICTED: probable protein phosphatase 2C 60 [Eucalyptus grandis]
 ref|XP_010066289.1| PREDICTED: probable protein phosphatase 2C 60 [Eucalyptus grandis]
 ref|XP_010066290.1| PREDICTED: probable protein phosphatase 2C 60 [Eucalyptus grandis]
 gb|KCW64134.1| hypothetical protein EUGRSUZ_G01786 [Eucalyptus grandis]
 gb|KCW64135.1| hypothetical protein EUGRSUZ_G01786 [Eucalyptus grandis]
 gb|KCW64136.1| hypothetical protein EUGRSUZ_G01786 [Eucalyptus grandis]
 gb|KCW64137.1| hypothetical protein EUGRSUZ_G01786 [Eucalyptus grandis]
Length=385

 Score = 99.4 bits (246),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            MLSGLM  LR+CF P+ +R+V++GSD+ GRQDGLLWYKD GQH  GEFSMAVVQAN L+E
Sbjct  1    MLSGLMNFLRSCFRPRSDRYVHAGSDSGGRQDGLLWYKDLGQHLVGEFSMAVVQANALIE  60

Query  487  D  489
            D
Sbjct  61   D  61



>ref|XP_010086827.1| putative protein phosphatase 2C 60 [Morus notabilis]
 gb|EXB24025.1| putative protein phosphatase 2C 60 [Morus notabilis]
Length=397

 Score = 99.4 bits (246),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 53/61 (87%), Gaps = 0/61 (0%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            MLS LM  LRACF P+ + +V++ SD+ GRQDGLLWYKD+GQHF+GEFSMAVVQANNL+E
Sbjct  1    MLSELMNFLRACFRPRSKGYVHTNSDSGGRQDGLLWYKDSGQHFNGEFSMAVVQANNLLE  60

Query  487  D  489
            D
Sbjct  61   D  61



>ref|XP_007202114.1| hypothetical protein PRUPE_ppa006861mg [Prunus persica]
 gb|EMJ03313.1| hypothetical protein PRUPE_ppa006861mg [Prunus persica]
Length=392

 Score = 99.4 bits (246),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/61 (74%), Positives = 51/61 (84%), Gaps = 0/61 (0%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            MLS LM  LRAC+ P  +R+V  GSDA GRQDGLLWYKDTGQH +GEFSMAVVQAN+L+E
Sbjct  1    MLSRLMNFLRACWLPSSDRYVQLGSDAAGRQDGLLWYKDTGQHLNGEFSMAVVQANSLLE  60

Query  487  D  489
            D
Sbjct  61   D  61



>ref|XP_008337969.1| PREDICTED: probable protein phosphatase 2C 46 [Malus domestica]
 ref|XP_008337970.1| PREDICTED: probable protein phosphatase 2C 46 [Malus domestica]
Length=394

 Score = 99.4 bits (246),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/61 (74%), Positives = 53/61 (87%), Gaps = 0/61 (0%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            MLS LM ILRAC+ P  +R+ ++GSDA GRQ+GLLWYKDTGQH +GEFSMAVVQANNL+E
Sbjct  1    MLSRLMNILRACWLPSLDRYGHAGSDAAGRQEGLLWYKDTGQHMNGEFSMAVVQANNLLE  60

Query  487  D  489
            D
Sbjct  61   D  61



>ref|XP_003536720.1| PREDICTED: probable protein phosphatase 2C 64-like [Glycine max]
 gb|KHN37390.1| Hypothetical protein glysoja_013605 [Glycine soja]
Length=397

 Score = 99.4 bits (246),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/61 (74%), Positives = 51/61 (84%), Gaps = 0/61 (0%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            MLSGLM +LRACF P  +    +GSDA GRQDGLLWYKD+GQH SGEFSMAV+QANNL+E
Sbjct  1    MLSGLMNLLRACFRPGSDGFTLAGSDAGGRQDGLLWYKDSGQHLSGEFSMAVIQANNLLE  60

Query  487  D  489
            D
Sbjct  61   D  61



>gb|EYU40449.1| hypothetical protein MIMGU_mgv1a0103672mg, partial [Erythranthe 
guttata]
Length=229

 Score = 97.4 bits (241),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 43/61 (70%), Positives = 53/61 (87%), Gaps = 0/61 (0%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            MLSGLM  L ACF P+ +R V++GSD++GR+DGLLWYKD GQH +G+FSMAVVQANNL+E
Sbjct  1    MLSGLMDFLTACFRPRADRSVHTGSDSSGRKDGLLWYKDAGQHSNGDFSMAVVQANNLLE  60

Query  487  D  489
            D
Sbjct  61   D  61



>gb|KCW64133.1| hypothetical protein EUGRSUZ_G01786 [Eucalyptus grandis]
Length=413

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            MLSGLM  LR+CF P+ +R+V++GSD+ GRQDGLLWYKD GQH  GEFSMAVVQAN L+E
Sbjct  1    MLSGLMNFLRSCFRPRSDRYVHAGSDSGGRQDGLLWYKDLGQHLVGEFSMAVVQANALIE  60

Query  487  D  489
            D
Sbjct  61   D  61



>gb|KDP23958.1| hypothetical protein JCGZ_25346 [Jatropha curcas]
Length=394

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 43/61 (70%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            MLS L+  LRAC+ P  E++ ++G+DA GRQDGLLWYKDTGQH +GEFSMAVVQANNL+E
Sbjct  1    MLSRLINFLRACWLPSSEQYAHTGADAAGRQDGLLWYKDTGQHVNGEFSMAVVQANNLLE  60

Query  487  D  489
            D
Sbjct  61   D  61



>emb|CDP14549.1| unnamed protein product [Coffea canephora]
Length=392

 Score = 98.6 bits (244),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 43/56 (77%), Positives = 49/56 (88%), Gaps = 0/56 (0%)
 Frame = +1

Query  322  MKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLMED  489
            M  LRACF P+ +R+V+SGSD  GRQDGLLWYKDTGQH +GEFSMAVVQANNL+ED
Sbjct  1    MNFLRACFWPRTDRYVHSGSDTIGRQDGLLWYKDTGQHVNGEFSMAVVQANNLLED  56



>ref|NP_001147802.1| LOC100281412 [Zea mays]
 gb|ACG28741.1| protein phosphatase 2C [Zea mays]
Length=392

 Score = 98.6 bits (244),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            ML  LM +LRAC+ P   RH  +GSD TGRQDGLLWYKD GQH +GEFSMAVVQANNL+E
Sbjct  1    MLVTLMNLLRACWRPSSNRHARTGSDVTGRQDGLLWYKDAGQHVNGEFSMAVVQANNLLE  60

Query  487  D  489
            D
Sbjct  61   D  61



>ref|XP_004966475.1| PREDICTED: probable protein phosphatase 2C 60-like [Setaria italica]
Length=388

 Score = 98.6 bits (244),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            ML  LM +LRAC+ P   RH  +GSD  GRQDGLLWYKDTGQH +GEFSMAVVQANNL+E
Sbjct  1    MLVTLMNLLRACWRPSSNRHARTGSDVAGRQDGLLWYKDTGQHVNGEFSMAVVQANNLLE  60

Query  487  D  489
            D
Sbjct  61   D  61



>gb|AFW69526.1| hypothetical protein ZEAMMB73_815291 [Zea mays]
Length=310

 Score = 98.2 bits (243),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            ML  LM +LRAC+ P   RH  +GSD TGRQDGLLWYKD GQH +GEFSMAVVQANNL+E
Sbjct  1    MLVTLMNLLRACWRPSSNRHARTGSDVTGRQDGLLWYKDAGQHVNGEFSMAVVQANNLLE  60

Query  487  D  489
            D
Sbjct  61   D  61



>ref|XP_009589840.1| PREDICTED: probable protein phosphatase 2C 60 [Nicotiana tomentosiformis]
 ref|XP_009589841.1| PREDICTED: probable protein phosphatase 2C 60 [Nicotiana tomentosiformis]
 ref|XP_009589842.1| PREDICTED: probable protein phosphatase 2C 60 [Nicotiana tomentosiformis]
 ref|XP_009589843.1| PREDICTED: probable protein phosphatase 2C 60 [Nicotiana tomentosiformis]
Length=397

 Score = 98.6 bits (244),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            MLS L+  LRAC+ P  +R VY+GSDA GRQDGL WYKD+GQH  GEFSMAVVQANNL+E
Sbjct  1    MLSRLINFLRACWRPSSDRSVYAGSDAAGRQDGLFWYKDSGQHLIGEFSMAVVQANNLLE  60

Query  487  D  489
            D
Sbjct  61   D  61



>gb|ACG29902.1| protein phosphatase 2C [Zea mays]
Length=392

 Score = 98.2 bits (243),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            ML  LM +LRAC+ P   RH  +GSD TGRQDGLLWYKD GQH +GEFSMAVVQANNL+E
Sbjct  1    MLVTLMNLLRACWRPSSNRHARTGSDVTGRQDGLLWYKDAGQHVNGEFSMAVVQANNLLE  60

Query  487  D  489
            D
Sbjct  61   D  61



>ref|NP_001146390.1| protein phosphatase 2C isoform 1 [Zea mays]
 ref|XP_008647733.1| PREDICTED: protein phosphatase 2C isoform 1 isoform X1 [Zea mays]
 ref|XP_008647735.1| PREDICTED: protein phosphatase 2C isoform 1 isoform X1 [Zea mays]
 ref|XP_008647736.1| PREDICTED: protein phosphatase 2C isoform 1 isoform X1 [Zea mays]
 gb|ACL53864.1| unknown [Zea mays]
 gb|ACN34369.1| unknown [Zea mays]
 gb|AFW75749.1| protein phosphatase 2C isoform 1 [Zea mays]
 gb|AFW75750.1| protein phosphatase 2C isoform 2 [Zea mays]
 gb|AFW75751.1| protein phosphatase 2C isoform 3 [Zea mays]
 gb|AFW75752.1| protein phosphatase 2C isoform 4 [Zea mays]
 gb|AIB05420.1| orphans transcription factor, partial [Zea mays]
Length=390

 Score = 98.2 bits (243),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            ML  LM +LRAC+ P   RH  +GSD TGRQDGLLWYKD GQH +GEFSMAVVQANNL+E
Sbjct  1    MLVKLMNLLRACWRPSSNRHARTGSDVTGRQDGLLWYKDAGQHVNGEFSMAVVQANNLLE  60

Query  487  D  489
            D
Sbjct  61   D  61



>gb|KHG28703.1| hypothetical protein F383_13791 [Gossypium arboreum]
Length=397

 Score = 98.2 bits (243),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 51/61 (84%), Gaps = 0/61 (0%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            MLSGLM  LRACF PK +++ ++  D  GRQDGLLWYKDTGQH +GEFSMAVVQANNL+E
Sbjct  1    MLSGLMNFLRACFRPKSDQYSHTSLDTGGRQDGLLWYKDTGQHVNGEFSMAVVQANNLLE  60

Query  487  D  489
            D
Sbjct  61   D  61



>ref|XP_003635344.1| PREDICTED: LOW QUALITY PROTEIN: probable protein phosphatase 
2C 60 [Vitis vinifera]
Length=397

 Score = 98.2 bits (243),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 51/61 (84%), Gaps = 0/61 (0%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            MLS LM  LRAC+ P  ER+++ GSDA  RQDGLLWYKDTGQH +GEFSMAVVQAN+L+E
Sbjct  1    MLSRLMNFLRACWRPSAERYIHKGSDAAVRQDGLLWYKDTGQHLNGEFSMAVVQANSLLE  60

Query  487  D  489
            D
Sbjct  61   D  61



>ref|XP_008643604.1| PREDICTED: LOC100281412 isoform X1 [Zea mays]
 ref|XP_008643605.1| PREDICTED: LOC100281412 isoform X1 [Zea mays]
 ref|XP_008643606.1| PREDICTED: LOC100281412 isoform X1 [Zea mays]
 gb|ACN34437.1| unknown [Zea mays]
 gb|AFW69527.1| protein phosphatase 2C isoform 1 [Zea mays]
 gb|AFW69528.1| protein phosphatase 2C isoform 2 [Zea mays]
 gb|AIB05422.1| orphans transcription factor, partial [Zea mays]
Length=394

 Score = 98.2 bits (243),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            ML  LM +LRAC+ P   RH  +GSD TGRQDGLLWYKD GQH +GEFSMAVVQANNL+E
Sbjct  1    MLVTLMNLLRACWRPSSNRHARTGSDVTGRQDGLLWYKDAGQHVNGEFSMAVVQANNLLE  60

Query  487  D  489
            D
Sbjct  61   D  61



>ref|XP_009355640.1| PREDICTED: probable protein phosphatase 2C 60 [Pyrus x bretschneideri]
Length=397

 Score = 97.8 bits (242),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            MLS LM  LR+CF P+  R+V++G+D+ GRQDGLLWYKD GQH +G+FSMAVVQANNL+E
Sbjct  1    MLSELMNFLRSCFRPRSNRYVHTGADSGGRQDGLLWYKDIGQHINGDFSMAVVQANNLLE  60

Query  487  D  489
            D
Sbjct  61   D  61



>dbj|BAK01278.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=392

 Score = 97.4 bits (241),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 43/61 (70%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            M+  LM  LRAC+ P   RH  +GSDATGRQDGLLWYKDTG+H +G+FSMAVVQANNL+E
Sbjct  1    MIVTLMNFLRACWRPSSNRHARTGSDATGRQDGLLWYKDTGEHVNGDFSMAVVQANNLLE  60

Query  487  D  489
            D
Sbjct  61   D  61



>gb|EMS54114.1| putative protein phosphatase 2C 60 [Triticum urartu]
Length=392

 Score = 97.4 bits (241),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 43/61 (70%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            M+  LM  LRAC+ P   RH  +GSDATGRQDGLLWYKDTG+H +G+FSMAVVQANNL+E
Sbjct  1    MIVTLMNFLRACWRPSSNRHARTGSDATGRQDGLLWYKDTGEHVNGDFSMAVVQANNLLE  60

Query  487  D  489
            D
Sbjct  61   D  61



>ref|XP_008382096.1| PREDICTED: probable protein phosphatase 2C 60 [Malus domestica]
Length=314

 Score = 97.1 bits (240),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            MLS LM  L+ CF P+  R+V++G+D+ GRQDGLLWYKDTGQH +G+FSMAVVQANNL+E
Sbjct  1    MLSELMNYLKXCFRPRSNRYVHTGADSGGRQDGLLWYKDTGQHINGDFSMAVVQANNLLE  60

Query  487  D  489
            D
Sbjct  61   D  61



>gb|KJB47696.1| hypothetical protein B456_008G037200 [Gossypium raimondii]
Length=393

 Score = 97.4 bits (241),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 43/61 (70%), Positives = 51/61 (84%), Gaps = 0/61 (0%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            MLSGLM  LRACF P+ +++ ++  D  GRQDGLLWYKDTGQH +GEFSMAVVQANNL+E
Sbjct  1    MLSGLMNFLRACFRPRSDQYSHTSLDTGGRQDGLLWYKDTGQHVNGEFSMAVVQANNLLE  60

Query  487  D  489
            D
Sbjct  61   D  61



>gb|KJB47691.1| hypothetical protein B456_008G037200 [Gossypium raimondii]
 gb|KJB47693.1| hypothetical protein B456_008G037200 [Gossypium raimondii]
 gb|KJB47697.1| hypothetical protein B456_008G037200 [Gossypium raimondii]
Length=397

 Score = 97.4 bits (241),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 43/61 (70%), Positives = 51/61 (84%), Gaps = 0/61 (0%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            MLSGLM  LRACF P+ +++ ++  D  GRQDGLLWYKDTGQH +GEFSMAVVQANNL+E
Sbjct  1    MLSGLMNFLRACFRPRSDQYSHTSLDTGGRQDGLLWYKDTGQHVNGEFSMAVVQANNLLE  60

Query  487  D  489
            D
Sbjct  61   D  61



>gb|KJB47694.1| hypothetical protein B456_008G037200 [Gossypium raimondii]
Length=318

 Score = 96.7 bits (239),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 43/61 (70%), Positives = 51/61 (84%), Gaps = 0/61 (0%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            MLSGLM  LRACF P+ +++ ++  D  GRQDGLLWYKDTGQH +GEFSMAVVQANNL+E
Sbjct  1    MLSGLMNFLRACFRPRSDQYSHTSLDTGGRQDGLLWYKDTGQHVNGEFSMAVVQANNLLE  60

Query  487  D  489
            D
Sbjct  61   D  61



>ref|XP_007142806.1| hypothetical protein PHAVU_007G018300g [Phaseolus vulgaris]
 gb|ESW14800.1| hypothetical protein PHAVU_007G018300g [Phaseolus vulgaris]
Length=397

 Score = 97.1 bits (240),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            MLSGLM +LRACF P  E    +GSD  GRQDGLLWYKD+GQH +GEFSMAV+QANNL+E
Sbjct  1    MLSGLMNLLRACFRPGSEGFSRTGSDGGGRQDGLLWYKDSGQHLNGEFSMAVIQANNLLE  60

Query  487  D  489
            D
Sbjct  61   D  61



>ref|XP_008242016.1| PREDICTED: probable protein phosphatase 2C 46 [Prunus mume]
 ref|XP_008242017.1| PREDICTED: probable protein phosphatase 2C 46 [Prunus mume]
 ref|XP_008242018.1| PREDICTED: probable protein phosphatase 2C 46 [Prunus mume]
 ref|XP_008242019.1| PREDICTED: probable protein phosphatase 2C 46 [Prunus mume]
 ref|XP_008242020.1| PREDICTED: probable protein phosphatase 2C 46 [Prunus mume]
 ref|XP_008242021.1| PREDICTED: probable protein phosphatase 2C 46 [Prunus mume]
 ref|XP_008242022.1| PREDICTED: probable protein phosphatase 2C 46 [Prunus mume]
 ref|XP_008242023.1| PREDICTED: probable protein phosphatase 2C 46 [Prunus mume]
Length=392

 Score = 97.1 bits (240),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            MLS LM  LRAC+ P   R+V  GSDA GRQDGLLWYKD GQH +GEFSMAVVQAN+L+E
Sbjct  1    MLSRLMNFLRACWLPSSYRYVQPGSDAVGRQDGLLWYKDNGQHLNGEFSMAVVQANSLLE  60

Query  487  D  489
            D
Sbjct  61   D  61



>ref|XP_010029636.1| PREDICTED: probable protein phosphatase 2C 60 [Eucalyptus grandis]
 gb|KCW56582.1| hypothetical protein EUGRSUZ_I02310 [Eucalyptus grandis]
 gb|KCW56583.1| hypothetical protein EUGRSUZ_I02310 [Eucalyptus grandis]
Length=394

 Score = 96.7 bits (239),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 43/61 (70%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            MLS L+  LRAC+ P  +R+V++GSD  GRQDGLLWYKDTGQH +G+FSMAVVQANNL+E
Sbjct  1    MLSRLINFLRACWRPSSDRYVHTGSDLGGRQDGLLWYKDTGQHLNGDFSMAVVQANNLLE  60

Query  487  D  489
            D
Sbjct  61   D  61



>ref|XP_008811724.1| PREDICTED: probable protein phosphatase 2C 60 [Phoenix dactylifera]
Length=397

 Score = 96.7 bits (239),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            ML+ LM  L+AC+ P  +R+V++GSD  GRQDGLLWYKDTGQH +GEFSMAVVQAN+L+E
Sbjct  1    MLARLMNFLKACWRPSSDRYVHTGSDTVGRQDGLLWYKDTGQHMNGEFSMAVVQANSLLE  60

Query  487  D  489
            D
Sbjct  61   D  61



>ref|XP_004497192.1| PREDICTED: probable protein phosphatase 2C 60-like [Cicer arietinum]
Length=398

 Score = 96.7 bits (239),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            MLS L++ L+ACF P  +++V++G DA GRQDGLLWYKD+GQH  GEFSMAVVQANNL+E
Sbjct  1    MLSELVRFLKACFRPSSDKYVHAGPDAGGRQDGLLWYKDSGQHMCGEFSMAVVQANNLLE  60

Query  487  D  489
            D
Sbjct  61   D  61



>ref|XP_004290738.1| PREDICTED: probable protein phosphatase 2C 46 [Fragaria vesca 
subsp. vesca]
Length=395

 Score = 96.7 bits (239),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 43/61 (70%), Positives = 51/61 (84%), Gaps = 0/61 (0%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            MLS LM  LR+CF P+   +V++ SDA GRQDGLLWYKDTGQH +G+FSMAVVQANNL+E
Sbjct  1    MLSELMNFLRSCFRPRSNGYVHTSSDAGGRQDGLLWYKDTGQHINGDFSMAVVQANNLLE  60

Query  487  D  489
            D
Sbjct  61   D  61



>ref|XP_006656500.1| PREDICTED: probable protein phosphatase 2C 60-like [Oryza brachyantha]
Length=392

 Score = 96.3 bits (238),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            M+  LM + RAC+ P   +H  +GSDA GRQDGLLWYKDTGQH +GEFSMAVVQANNL+E
Sbjct  1    MIVALMNLFRACWRPSSNQHARAGSDAAGRQDGLLWYKDTGQHVNGEFSMAVVQANNLLE  60

Query  487  D  489
            D
Sbjct  61   D  61



>gb|ACG45008.1| protein phosphatase 2C [Zea mays]
Length=390

 Score = 96.3 bits (238),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 43/61 (70%), Positives = 48/61 (79%), Gaps = 0/61 (0%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            ML  LM +LRAC+ P   RH  +GSD TGRQDGLLWY D GQH +GEFSMAVVQANNL+E
Sbjct  1    MLVKLMNLLRACWRPSSNRHARTGSDVTGRQDGLLWYNDAGQHVNGEFSMAVVQANNLLE  60

Query  487  D  489
            D
Sbjct  61   D  61



>gb|KHN11497.1| Hypothetical protein glysoja_015392 [Glycine soja]
Length=397

 Score = 96.3 bits (238),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 43/61 (70%), Positives = 51/61 (84%), Gaps = 0/61 (0%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            MLSGLM +LRACF P  +    +GSDA GRQDGLLWYKD+GQH +G+FSMAV+QANNL+E
Sbjct  1    MLSGLMNLLRACFRPGSDGFTRAGSDAGGRQDGLLWYKDSGQHLNGDFSMAVIQANNLLE  60

Query  487  D  489
            D
Sbjct  61   D  61



>ref|XP_003555860.1| PREDICTED: probable protein phosphatase 2C 64-like isoform X1 
[Glycine max]
 ref|XP_006605858.1| PREDICTED: probable protein phosphatase 2C 64-like isoform X2 
[Glycine max]
Length=397

 Score = 96.3 bits (238),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 43/61 (70%), Positives = 51/61 (84%), Gaps = 0/61 (0%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            MLSGLM +LRACF P  +    +GSDA GRQDGLLWYKD+GQH +G+FSMAV+QANNL+E
Sbjct  1    MLSGLMNLLRACFRPGSDGFTRAGSDAGGRQDGLLWYKDSGQHLNGDFSMAVIQANNLLE  60

Query  487  D  489
            D
Sbjct  61   D  61



>ref|XP_008393780.1| PREDICTED: probable protein phosphatase 2C 60 [Malus domestica]
Length=394

 Score = 95.9 bits (237),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 43/61 (70%), Positives = 51/61 (84%), Gaps = 0/61 (0%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            MLS LM  LRAC+ P  +++ ++GSDA GRQDGLLWYKD GQH +GEFSMAVVQANNL+E
Sbjct  1    MLSRLMNFLRACWLPSSDQYGHAGSDAAGRQDGLLWYKDIGQHMNGEFSMAVVQANNLLE  60

Query  487  D  489
            D
Sbjct  61   D  61



>ref|XP_009340482.1| PREDICTED: probable protein phosphatase 2C 60 [Pyrus x bretschneideri]
Length=397

 Score = 95.9 bits (237),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            MLS LM  L++CF P+  R+V++ +D+ GRQDGLLWYKDTGQH +G+FSMAVVQANNL+E
Sbjct  1    MLSELMNYLKSCFRPRSNRYVHTSADSGGRQDGLLWYKDTGQHINGDFSMAVVQANNLLE  60

Query  487  D  489
            D
Sbjct  61   D  61



>ref|XP_009801750.1| PREDICTED: probable protein phosphatase 2C 60 [Nicotiana sylvestris]
 ref|XP_009801751.1| PREDICTED: probable protein phosphatase 2C 60 [Nicotiana sylvestris]
Length=397

 Score = 95.9 bits (237),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 43/61 (70%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            MLS L+  LRAC+ P  +  VY+GSDA GRQDGL WYKD+GQH  GEFSMAVVQANNL+E
Sbjct  1    MLSRLINFLRACWRPSSDHSVYAGSDAAGRQDGLFWYKDSGQHLIGEFSMAVVQANNLLE  60

Query  487  D  489
            D
Sbjct  61   D  61



>ref|XP_007046602.1| Phosphatase 2C family protein isoform 1 [Theobroma cacao]
 ref|XP_007046603.1| Phosphatase 2C family protein isoform 1 [Theobroma cacao]
 gb|EOX90759.1| Phosphatase 2C family protein isoform 1 [Theobroma cacao]
 gb|EOX90760.1| Phosphatase 2C family protein isoform 1 [Theobroma cacao]
Length=397

 Score = 95.9 bits (237),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 43/61 (70%), Positives = 48/61 (79%), Gaps = 0/61 (0%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            MLS L+  LRAC  P  +R+   GSDA GRQDGLLWYKD+GQH  GEFSMAVVQANNL+E
Sbjct  1    MLSRLVNFLRACLRPSSDRYAQKGSDAAGRQDGLLWYKDSGQHLVGEFSMAVVQANNLLE  60

Query  487  D  489
            D
Sbjct  61   D  61



>ref|XP_010935169.1| PREDICTED: probable protein phosphatase 2C 60 [Elaeis guineensis]
Length=397

 Score = 95.5 bits (236),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 40/61 (66%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            M++ L+  L+AC+ P  +RHV++GSD  GRQDGLLWYKD+GQH +GEFSMAVVQAN+L+E
Sbjct  1    MIAELVNFLKACWRPSADRHVHTGSDTVGRQDGLLWYKDSGQHMNGEFSMAVVQANSLLE  60

Query  487  D  489
            D
Sbjct  61   D  61



>ref|NP_001058597.1| Os06g0717800 [Oryza sativa Japonica Group]
 sp|Q5Z8P0.1|P2C60_ORYSJ RecName: Full=Probable protein phosphatase 2C 60; Short=OsPP2C60 
[Oryza sativa Japonica Group]
 gb|AAL79731.1|AC091774_22 putative protein phosphatase [Oryza sativa Japonica Group]
 dbj|BAD61722.1| putative protein phosphatase 2C homolog [Oryza sativa Japonica 
Group]
 dbj|BAF20511.1| Os06g0717800 [Oryza sativa Japonica Group]
 dbj|BAG89257.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH00528.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE66369.1| hypothetical protein OsJ_22677 [Oryza sativa Japonica Group]
Length=392

 Score = 95.5 bits (236),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            M+  LM +LRAC+ P   +H  +GSD  GRQDGLLWYKDTGQH +GEFSMAVVQANNL+E
Sbjct  1    MIVTLMNLLRACWRPSSNQHARAGSDVAGRQDGLLWYKDTGQHVNGEFSMAVVQANNLLE  60

Query  487  D  489
            D
Sbjct  61   D  61



>ref|XP_006828820.1| hypothetical protein AMTR_s00001p00136050 [Amborella trichopoda]
 gb|ERM96236.1| hypothetical protein AMTR_s00001p00136050 [Amborella trichopoda]
Length=393

 Score = 95.5 bits (236),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 53/62 (85%), Gaps = 1/62 (2%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSG-SDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLM  483
            MLS LMK++ AC+ P  +R+V++G SD  GRQDGLLWYKDTGQH +G+FSMAVVQANNL+
Sbjct  1    MLSALMKLVSACWRPSPDRYVHTGGSDVVGRQDGLLWYKDTGQHLNGDFSMAVVQANNLL  60

Query  484  ED  489
            ED
Sbjct  61   ED  62



>gb|EEC81321.1| hypothetical protein OsI_24486 [Oryza sativa Indica Group]
Length=392

 Score = 95.5 bits (236),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            M+  LM +LRAC+ P   +H  +GSD  GRQDGLLWYKDTGQH +GEFSMAVVQANNL+E
Sbjct  1    MIVTLMNLLRACWRPSSNQHARAGSDVAGRQDGLLWYKDTGQHVNGEFSMAVVQANNLLE  60

Query  487  D  489
            D
Sbjct  61   D  61



>ref|XP_010266882.1| PREDICTED: probable protein phosphatase 2C 60 [Nelumbo nucifera]
 ref|XP_010266883.1| PREDICTED: probable protein phosphatase 2C 60 [Nelumbo nucifera]
Length=397

 Score = 95.5 bits (236),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 43/61 (70%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            MLS LM  LRAC+    +R+ ++ SDA GRQDGLLWYKDTGQH +GEFSMAVVQANNL+E
Sbjct  1    MLSRLMNFLRACWRSSSDRYAHTSSDAVGRQDGLLWYKDTGQHLNGEFSMAVVQANNLLE  60

Query  487  D  489
            D
Sbjct  61   D  61



>gb|KDO71338.1| hypothetical protein CISIN_1g015989mg [Citrus sinensis]
 gb|KDO71339.1| hypothetical protein CISIN_1g015989mg [Citrus sinensis]
Length=236

 Score = 94.0 bits (232),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            MLS LM  LRAC+ P  +R+V++ +D  GRQ+GLLWYKD GQH +GEFSMAVVQANNL+E
Sbjct  1    MLSRLMNFLRACWRPSSDRYVHTSADTAGRQEGLLWYKDNGQHINGEFSMAVVQANNLLE  60

Query  487  D  489
            D
Sbjct  61   D  61



>gb|KJB77608.1| hypothetical protein B456_012G156600 [Gossypium raimondii]
Length=248

 Score = 94.0 bits (232),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            MLS LM +L+ACF P+ +R ++  +D  G QDGLLWYKDTGQH +GEFSMAVVQANNL+E
Sbjct  1    MLSRLMNLLKACFRPRSDRFIHKNADTGGHQDGLLWYKDTGQHVNGEFSMAVVQANNLLE  60

Query  487  D  489
            D
Sbjct  61   D  61



>gb|KDO71337.1| hypothetical protein CISIN_1g015989mg [Citrus sinensis]
Length=326

 Score = 94.4 bits (233),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            MLS LM  LRAC+ P  +R+V++ +D  GRQ+GLLWYKD GQH +GEFSMAVVQANNL+E
Sbjct  1    MLSRLMNFLRACWRPSSDRYVHTSADTAGRQEGLLWYKDNGQHINGEFSMAVVQANNLLE  60

Query  487  D  489
            D
Sbjct  61   D  61



>ref|XP_010941352.1| PREDICTED: probable protein phosphatase 2C 79 isoform X2 [Elaeis 
guineensis]
Length=318

 Score = 94.4 bits (233),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            ML+ LM  L+AC+ P  +R+V++GSD  GRQDGLLWYKD+GQH +GEFSMAVVQAN+L+E
Sbjct  1    MLAELMNFLKACWRPSSDRYVHTGSDTVGRQDGLLWYKDSGQHTNGEFSMAVVQANSLLE  60

Query  487  D  489
            D
Sbjct  61   D  61



>ref|XP_009418617.1| PREDICTED: probable protein phosphatase 2C 60 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=362

 Score = 94.4 bits (233),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 51/61 (84%), Gaps = 0/61 (0%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            ML+ LM IL+AC+ P    HV++GSD  GRQDGLLWYKD+GQH +GEFSMAV+QAN+L+E
Sbjct  1    MLAALMNILKACWQPAVGGHVHTGSDVVGRQDGLLWYKDSGQHINGEFSMAVIQANSLLE  60

Query  487  D  489
            D
Sbjct  61   D  61



>gb|KJB77607.1| hypothetical protein B456_012G156600 [Gossypium raimondii]
Length=396

 Score = 94.7 bits (234),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            MLS LM +L+ACF P+ +R ++  +D  G QDGLLWYKDTGQH +GEFSMAVVQANNL+E
Sbjct  1    MLSRLMNLLKACFRPRSDRFIHKNADTGGHQDGLLWYKDTGQHVNGEFSMAVVQANNLLE  60

Query  487  D  489
            D
Sbjct  61   D  61



>ref|XP_006425370.1| hypothetical protein CICLE_v10025781mg [Citrus clementina]
 ref|XP_006425371.1| hypothetical protein CICLE_v10025781mg [Citrus clementina]
 ref|XP_006425372.1| hypothetical protein CICLE_v10025781mg [Citrus clementina]
 ref|XP_006425373.1| hypothetical protein CICLE_v10025781mg [Citrus clementina]
 gb|ESR38610.1| hypothetical protein CICLE_v10025781mg [Citrus clementina]
 gb|ESR38611.1| hypothetical protein CICLE_v10025781mg [Citrus clementina]
 gb|ESR38612.1| hypothetical protein CICLE_v10025781mg [Citrus clementina]
 gb|ESR38613.1| hypothetical protein CICLE_v10025781mg [Citrus clementina]
Length=397

 Score = 94.7 bits (234),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            MLS LM  LRAC+ P  +R+V++ +D  GRQ+GLLWYKD GQH +GEFSMAVVQANNL+E
Sbjct  1    MLSRLMNFLRACWRPSSDRYVHTSADTAGRQEGLLWYKDNGQHINGEFSMAVVQANNLLE  60

Query  487  D  489
            D
Sbjct  61   D  61



>gb|KHG19895.1| hypothetical protein F383_10069 [Gossypium arboreum]
 gb|KHG21644.1| hypothetical protein F383_05608 [Gossypium arboreum]
Length=396

 Score = 94.7 bits (234),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            MLS LM +L+ACF P+ +R ++  +D  G QDGLLWYKDTGQH +GEFSMAVVQANNL+E
Sbjct  1    MLSRLMNLLKACFRPRSDRFIHKNADTGGHQDGLLWYKDTGQHVNGEFSMAVVQANNLLE  60

Query  487  D  489
            D
Sbjct  61   D  61



>ref|XP_009391019.1| PREDICTED: probable protein phosphatase 2C 60 [Musa acuminata 
subsp. malaccensis]
Length=396

 Score = 94.7 bits (234),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 43/61 (70%), Positives = 52/61 (85%), Gaps = 1/61 (2%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            ML+ LM +LRAC+ P  +R V+SGS+  GRQDGLLWYKD+GQH +GEFSMAVVQANNL+E
Sbjct  1    MLAALMNLLRACWQP-SDRSVHSGSEVVGRQDGLLWYKDSGQHINGEFSMAVVQANNLLE  59

Query  487  D  489
            D
Sbjct  60   D  60



>ref|XP_009344827.1| PREDICTED: probable protein phosphatase 2C 46 [Pyrus x bretschneideri]
 ref|XP_009344830.1| PREDICTED: probable protein phosphatase 2C 46 [Pyrus x bretschneideri]
Length=394

 Score = 94.7 bits (234),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 43/61 (70%), Positives = 51/61 (84%), Gaps = 0/61 (0%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            MLS LM  LRAC+ P  +++ ++GSDA GRQDGLLWYKD GQH +GEFSMAVVQANNL+E
Sbjct  1    MLSRLMNFLRACWLPSLDQYGHAGSDAAGRQDGLLWYKDIGQHMNGEFSMAVVQANNLLE  60

Query  487  D  489
            D
Sbjct  61   D  61



>ref|XP_006467020.1| PREDICTED: probable protein phosphatase 2C 60-like [Citrus sinensis]
 gb|KDO71335.1| hypothetical protein CISIN_1g015989mg [Citrus sinensis]
 gb|KDO71336.1| hypothetical protein CISIN_1g015989mg [Citrus sinensis]
Length=397

 Score = 94.7 bits (234),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            MLS LM  LRAC+ P  +R+V++ +D  GRQ+GLLWYKD GQH +GEFSMAVVQANNL+E
Sbjct  1    MLSRLMNFLRACWRPSSDRYVHTSADTAGRQEGLLWYKDNGQHINGEFSMAVVQANNLLE  60

Query  487  D  489
            D
Sbjct  61   D  61



>gb|KJB77609.1| hypothetical protein B456_012G156600 [Gossypium raimondii]
Length=344

 Score = 94.0 bits (232),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            MLS LM +L+ACF P+ +R ++  +D  G QDGLLWYKDTGQH +GEFSMAVVQANNL+E
Sbjct  1    MLSRLMNLLKACFRPRSDRFIHKNADTGGHQDGLLWYKDTGQHVNGEFSMAVVQANNLLE  60

Query  487  D  489
            D
Sbjct  61   D  61



>ref|XP_010941349.1| PREDICTED: probable protein phosphatase 2C 60 isoform X1 [Elaeis 
guineensis]
 ref|XP_010941350.1| PREDICTED: probable protein phosphatase 2C 60 isoform X1 [Elaeis 
guineensis]
Length=397

 Score = 94.4 bits (233),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            ML+ LM  L+AC+ P  +R+V++GSD  GRQDGLLWYKD+GQH +GEFSMAVVQAN+L+E
Sbjct  1    MLAELMNFLKACWRPSSDRYVHTGSDTVGRQDGLLWYKDSGQHTNGEFSMAVVQANSLLE  60

Query  487  D  489
            D
Sbjct  61   D  61



>gb|EMT20424.1| Putative protein phosphatase 2C 60 [Aegilops tauschii]
Length=365

 Score = 94.4 bits (233),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 48/61 (79%), Gaps = 0/61 (0%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            M+  LM  LRAC+ P   RH  +GSDA GRQDGLLWYKD G+H +G+FSMAVVQANNL+E
Sbjct  1    MIVTLMNFLRACWRPSSNRHARTGSDAAGRQDGLLWYKDAGEHVNGDFSMAVVQANNLLE  60

Query  487  D  489
            D
Sbjct  61   D  61



>ref|XP_009418584.1| PREDICTED: probable protein phosphatase 2C 60 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009418592.1| PREDICTED: probable protein phosphatase 2C 60 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009418600.1| PREDICTED: probable protein phosphatase 2C 60 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009418609.1| PREDICTED: probable protein phosphatase 2C 60 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=397

 Score = 94.4 bits (233),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 51/61 (84%), Gaps = 0/61 (0%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            ML+ LM IL+AC+ P    HV++GSD  GRQDGLLWYKD+GQH +GEFSMAV+QAN+L+E
Sbjct  1    MLAALMNILKACWQPAVGGHVHTGSDVVGRQDGLLWYKDSGQHINGEFSMAVIQANSLLE  60

Query  487  D  489
            D
Sbjct  61   D  61



>ref|XP_009602153.1| PREDICTED: probable protein phosphatase 2C 60 [Nicotiana tomentosiformis]
 ref|XP_009602154.1| PREDICTED: probable protein phosphatase 2C 60 [Nicotiana tomentosiformis]
Length=385

 Score = 94.4 bits (233),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            MLS L+  LRAC+ P  +R+V++G D+ GRQDGLLWYKD+G H  GEFSMAVVQANNL+E
Sbjct  1    MLSKLINFLRACWRPSSDRYVHTGPDSAGRQDGLLWYKDSGLHLVGEFSMAVVQANNLLE  60

Query  487  D  489
            D
Sbjct  61   D  61



>ref|XP_008440869.1| PREDICTED: probable protein phosphatase 2C 60 isoform X1 [Cucumis 
melo]
 ref|XP_008440870.1| PREDICTED: probable protein phosphatase 2C 60 isoform X1 [Cucumis 
melo]
 ref|XP_008440871.1| PREDICTED: probable protein phosphatase 2C 60 isoform X1 [Cucumis 
melo]
 ref|XP_008440872.1| PREDICTED: probable protein phosphatase 2C 60 isoform X1 [Cucumis 
melo]
Length=398

 Score = 94.4 bits (233),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            MLS LM  LRAC+ P  +  V+SGSD+ GR +GLLWYKD GQH +GEFSMAVVQANNL+E
Sbjct  1    MLSSLMNFLRACWVPSSDNIVHSGSDSAGRHEGLLWYKDIGQHMNGEFSMAVVQANNLLE  60

Query  487  D  489
            D
Sbjct  61   D  61



>ref|XP_009408204.1| PREDICTED: probable protein phosphatase 2C 60 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009408205.1| PREDICTED: probable protein phosphatase 2C 60 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009408207.1| PREDICTED: probable protein phosphatase 2C 60 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009408208.1| PREDICTED: probable protein phosphatase 2C 60 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009408209.1| PREDICTED: probable protein phosphatase 2C 60 [Musa acuminata 
subsp. malaccensis]
Length=388

 Score = 94.0 bits (232),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 53/61 (87%), Gaps = 1/61 (2%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            ML+ LM +LRAC+ P  +R+V++GSDA GR DGLLWYKD+GQH +GEFSMAVVQAN+L+E
Sbjct  1    MLAALMNLLRACWLP-SDRYVHTGSDAVGRHDGLLWYKDSGQHTNGEFSMAVVQANSLLE  59

Query  487  D  489
            D
Sbjct  60   D  60



>gb|KJB43265.1| hypothetical protein B456_007G190900 [Gossypium raimondii]
 gb|KJB43267.1| hypothetical protein B456_007G190900 [Gossypium raimondii]
Length=388

 Score = 94.0 bits (232),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 51/61 (84%), Gaps = 0/61 (0%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            MLS L+  L+AC+ P  +R+ + GSDA+G QDGLLWYKD GQHF+GEFSMAVVQANNL+E
Sbjct  1    MLSRLVNFLKACWWPSLDRYAHKGSDASGWQDGLLWYKDNGQHFNGEFSMAVVQANNLLE  60

Query  487  D  489
            D
Sbjct  61   D  61



>ref|XP_002439035.1| hypothetical protein SORBIDRAFT_10g030320 [Sorghum bicolor]
 gb|EER90402.1| hypothetical protein SORBIDRAFT_10g030320 [Sorghum bicolor]
Length=389

 Score = 94.0 bits (232),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 49/61 (80%), Gaps = 1/61 (2%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            ML  LM +LRAC+ P   RH  +GSD TGRQDGLLWYKD GQH +GEFSMAVVQANNL+E
Sbjct  1    MLVTLMNLLRACWRP-SNRHARTGSDVTGRQDGLLWYKDAGQHVNGEFSMAVVQANNLLE  59

Query  487  D  489
            D
Sbjct  60   D  60



>ref|XP_006367872.1| PREDICTED: probable protein phosphatase 2C 64-like [Solanum tuberosum]
Length=388

 Score = 93.6 bits (231),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 51/62 (82%), Gaps = 1/62 (2%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVY-SGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLM  483
            M SGLM  LRACF P+ +  V+ S SD+ GRQDGLLWYKDTGQH +GEFSMAVVQANNL+
Sbjct  1    MPSGLMNFLRACFQPRADGLVHTSSSDSGGRQDGLLWYKDTGQHVNGEFSMAVVQANNLL  60

Query  484  ED  489
            ED
Sbjct  61   ED  62



>gb|AAD11430.1| protein phosphatase 2C homolog [Mesembryanthemum crystallinum]
Length=396

 Score = 93.6 bits (231),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 51/61 (84%), Gaps = 1/61 (2%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            MLS L+  L+AC+ P  +R  +SGSDA GRQDGLLWYKDTGQH +GEFSMAVVQANNL+E
Sbjct  1    MLSRLISFLKACWRPSSDRS-HSGSDAAGRQDGLLWYKDTGQHINGEFSMAVVQANNLLE  59

Query  487  D  489
            D
Sbjct  60   D  60



>emb|CAB90634.1| protein phosphatase 2C (PP2C) [Fagus sylvatica]
Length=397

 Score = 93.6 bits (231),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            M S LM  LRACF  K +RHV++GS+A GRQDGLLWYKD+GQHF+GEFS    QANNL+E
Sbjct  1    MFSELMNFLRACFRAKSDRHVHTGSNARGRQDGLLWYKDSGQHFNGEFSYGCGQANNLLE  60

Query  487  D  489
            D
Sbjct  61   D  61



>ref|XP_004492898.1| PREDICTED: probable protein phosphatase 2C 60-like isoform X1 
[Cicer arietinum]
 ref|XP_004492899.1| PREDICTED: probable protein phosphatase 2C 60-like isoform X2 
[Cicer arietinum]
Length=391

 Score = 93.2 bits (230),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            MLS LM  L  CF P+ +R+  SGSDA G+QDGLLWYKD+G+H +GEFSMAVVQANNL+E
Sbjct  1    MLSELMNYLTVCFRPRLDRYTRSGSDAGGKQDGLLWYKDSGRHLNGEFSMAVVQANNLLE  60

Query  487  D  489
            D
Sbjct  61   D  61



>ref|XP_008791943.1| PREDICTED: probable protein phosphatase 2C 60 [Phoenix dactylifera]
 ref|XP_008791944.1| PREDICTED: probable protein phosphatase 2C 60 [Phoenix dactylifera]
 ref|XP_008791945.1| PREDICTED: probable protein phosphatase 2C 60 [Phoenix dactylifera]
Length=397

 Score = 93.2 bits (230),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/61 (70%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            ML   M  L+AC+ P   + ++SGSDA GRQDGLLWYKDTGQH SGEFSMAVVQANNL+E
Sbjct  1    MLEVWMNFLKACWGPSSAQCIHSGSDAVGRQDGLLWYKDTGQHTSGEFSMAVVQANNLLE  60

Query  487  D  489
            D
Sbjct  61   D  61



>ref|XP_004231056.1| PREDICTED: probable protein phosphatase 2C 46 [Solanum lycopersicum]
Length=388

 Score = 92.4 bits (228),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 50/62 (81%), Gaps = 1/62 (2%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVY-SGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLM  483
            M SGLM  LRACF P  +  V+ S SD+ GRQDGLLWYKDTGQH +GEFSMAVVQANNL+
Sbjct  1    MTSGLMNFLRACFQPGADGLVHTSSSDSGGRQDGLLWYKDTGQHVNGEFSMAVVQANNLL  60

Query  484  ED  489
            ED
Sbjct  61   ED  62



>ref|XP_006343345.1| PREDICTED: probable protein phosphatase 2C 60-like isoform X1 
[Solanum tuberosum]
 ref|XP_006343346.1| PREDICTED: probable protein phosphatase 2C 60-like isoform X2 
[Solanum tuberosum]
Length=397

 Score = 92.4 bits (228),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            MLS L+  L+AC+ P  +  V++GSDA GRQDGL WYKD+GQH  GEFSMAVVQANNL+E
Sbjct  1    MLSRLINFLKACWRPSSDHSVHAGSDAAGRQDGLFWYKDSGQHLIGEFSMAVVQANNLLE  60

Query  487  D  489
            D
Sbjct  61   D  61



>ref|XP_004234522.1| PREDICTED: probable protein phosphatase 2C 60 [Solanum lycopersicum]
 ref|XP_004234523.1| PREDICTED: probable protein phosphatase 2C 60 [Solanum lycopersicum]
Length=397

 Score = 92.4 bits (228),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            MLS L+  L+AC+ P  +  V++GSDA GRQDGL WYKD+GQH  GEFSMAVVQANNL+E
Sbjct  1    MLSRLINFLKACWRPSSDHSVHAGSDAAGRQDGLFWYKDSGQHLIGEFSMAVVQANNLLE  60

Query  487  D  489
            D
Sbjct  61   D  61



>ref|XP_010918123.1| PREDICTED: probable protein phosphatase 2C 60 [Elaeis guineensis]
 ref|XP_010918124.1| PREDICTED: probable protein phosphatase 2C 60 [Elaeis guineensis]
Length=397

 Score = 92.0 bits (227),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 40/61 (66%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            M    M  +RAC+ P   ++++SGSDA GRQDGLLWYKD+GQH +GEFSMAVVQANNL+E
Sbjct  1    MSEAWMNFVRACWGPSSAQYIHSGSDAVGRQDGLLWYKDSGQHTTGEFSMAVVQANNLLE  60

Query  487  D  489
            D
Sbjct  61   D  61



>ref|XP_010683039.1| PREDICTED: probable protein phosphatase 2C 60 [Beta vulgaris 
subsp. vulgaris]
Length=397

 Score = 92.0 bits (227),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 40/61 (66%), Positives = 51/61 (84%), Gaps = 0/61 (0%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            MLS L+  L+AC+ P  +R+ +SGSDA GRQ+GLLWYKD G+H +G+FSMAVVQANNL+E
Sbjct  1    MLSRLISFLKACWRPSSDRYSHSGSDAAGRQEGLLWYKDIGKHINGDFSMAVVQANNLLE  60

Query  487  D  489
            D
Sbjct  61   D  61



>ref|XP_006411644.1| hypothetical protein EUTSA_v10025386mg [Eutrema salsugineum]
 dbj|BAJ33799.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ53097.1| hypothetical protein EUTSA_v10025386mg [Eutrema salsugineum]
Length=397

 Score = 91.7 bits (226),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            MLSGLM  L AC  P+ ++   SGSD+ GRQ+GLLWY+D+GQH SG+FSMAVVQANNL+E
Sbjct  1    MLSGLMNFLNACLWPRSDQQGRSGSDSGGRQEGLLWYRDSGQHVSGDFSMAVVQANNLLE  60

Query  487  D  489
            D
Sbjct  61   D  61



>emb|CDP01847.1| unnamed protein product [Coffea canephora]
Length=393

 Score = 90.9 bits (224),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            MLS L++ L+AC  P  +R  +SGSD  GRQDGLLWYKDTGQH  G+FSMAVVQANNL+E
Sbjct  1    MLSRLIEFLKACCRPSSDRCAHSGSDTAGRQDGLLWYKDTGQHSIGDFSMAVVQANNLLE  60

Query  487  D  489
            D
Sbjct  61   D  61



>ref|XP_009803770.1| PREDICTED: probable protein phosphatase 2C 46 isoform X2 [Nicotiana 
sylvestris]
Length=257

 Score = 89.7 bits (221),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/61 (66%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            MLS L+  LRAC+ P  + +V++G D+ GRQDGLLWYKD+G H  GEFSMAVVQANNL+E
Sbjct  1    MLSKLIIFLRACWRPSSDSYVHTGPDSAGRQDGLLWYKDSGLHLVGEFSMAVVQANNLLE  60

Query  487  D  489
            D
Sbjct  61   D  61



>ref|XP_010526813.1| PREDICTED: probable protein phosphatase 2C 46 [Tarenaya hassleriana]
 ref|XP_010526814.1| PREDICTED: probable protein phosphatase 2C 46 [Tarenaya hassleriana]
 ref|XP_010526815.1| PREDICTED: probable protein phosphatase 2C 46 [Tarenaya hassleriana]
 ref|XP_010526817.1| PREDICTED: probable protein phosphatase 2C 46 [Tarenaya hassleriana]
Length=390

 Score = 90.9 bits (224),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/61 (70%), Positives = 49/61 (80%), Gaps = 3/61 (5%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            MLS LM  LR+C+ P      +SGSDATGRQDGLLWYKD GQH +G+FSMAVVQANNL+E
Sbjct  1    MLSKLMNFLRSCWRPYS---AHSGSDATGRQDGLLWYKDIGQHLAGDFSMAVVQANNLLE  57

Query  487  D  489
            D
Sbjct  58   D  58



>ref|XP_010531120.1| PREDICTED: probable protein phosphatase 2C 46 [Tarenaya hassleriana]
Length=384

 Score = 90.9 bits (224),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/61 (70%), Positives = 49/61 (80%), Gaps = 3/61 (5%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            MLS LM  LR+C+ P      +SGSDATGRQDGLLWYKD GQH +G+FSMAVVQANNL+E
Sbjct  1    MLSKLMNFLRSCWRPYS---AHSGSDATGRQDGLLWYKDVGQHLAGDFSMAVVQANNLLE  57

Query  487  D  489
            D
Sbjct  58   D  58



>ref|XP_010690331.1| PREDICTED: probable protein phosphatase 2C 60 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010690332.1| PREDICTED: probable protein phosphatase 2C 60 [Beta vulgaris 
subsp. vulgaris]
Length=390

 Score = 90.5 bits (223),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 52/62 (84%), Gaps = 1/62 (2%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATG-RQDGLLWYKDTGQHFSGEFSMAVVQANNLM  483
            MLSG M +LRAC  P  +  +++GSD++G RQ+GLLWYKDTGQH +GEFSMAVVQAN+L+
Sbjct  1    MLSGFMNLLRACLWPVSDPSIHAGSDSSGGRQEGLLWYKDTGQHVNGEFSMAVVQANSLL  60

Query  484  ED  489
            ED
Sbjct  61   ED  62



>ref|XP_009803756.1| PREDICTED: probable protein phosphatase 2C 60 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009803763.1| PREDICTED: probable protein phosphatase 2C 60 isoform X1 [Nicotiana 
sylvestris]
Length=390

 Score = 90.5 bits (223),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/61 (66%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            MLS L+  LRAC+ P  + +V++G D+ GRQDGLLWYKD+G H  GEFSMAVVQANNL+E
Sbjct  1    MLSKLIIFLRACWRPSSDSYVHTGPDSAGRQDGLLWYKDSGLHLVGEFSMAVVQANNLLE  60

Query  487  D  489
            D
Sbjct  61   D  61



>ref|XP_004287772.1| PREDICTED: probable protein phosphatase 2C 46 [Fragaria vesca 
subsp. vesca]
Length=393

 Score = 90.5 bits (223),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            MLS LM  LRAC+ P  + +V +GSDA G+Q+GLLWYKD GQH +G+FSMAVVQANNL+E
Sbjct  1    MLSRLMNFLRACWRPSSDGYVNAGSDAAGKQEGLLWYKDFGQHLNGDFSMAVVQANNLLE  60

Query  487  D  489
            D
Sbjct  61   D  61



>ref|XP_009418691.1| PREDICTED: probable protein phosphatase 2C 60 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=397

 Score = 90.1 bits (222),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            ML+ LM +L+AC+ P   ++ ++GSD  GR+DGLLWYKD+GQH  GEFSMA+VQANNL+E
Sbjct  1    MLAKLMNLLKACWQPSSNKYAHAGSDVIGRKDGLLWYKDSGQHVYGEFSMAMVQANNLLE  60

Query  487  D  489
            D
Sbjct  61   D  61



>ref|XP_006380555.1| hypothetical protein POPTR_0007s09220g [Populus trichocarpa]
 ref|XP_006380556.1| hypothetical protein POPTR_0007s09220g [Populus trichocarpa]
 gb|ERP58352.1| hypothetical protein POPTR_0007s09220g [Populus trichocarpa]
 gb|ERP58353.1| hypothetical protein POPTR_0007s09220g [Populus trichocarpa]
Length=397

 Score = 90.1 bits (222),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 40/61 (66%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            MLS L+  LRAC+ P  +  +++G +A GRQDGLLWYKD GQH +GEFSMAVVQANNL+E
Sbjct  1    MLSRLINFLRACWLPSSDPCIHTGLEAAGRQDGLLWYKDKGQHMNGEFSMAVVQANNLLE  60

Query  487  D  489
            D
Sbjct  61   D  61



>ref|XP_009418690.1| PREDICTED: probable protein phosphatase 2C 60 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=449

 Score = 90.1 bits (222),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            ML+ LM +L+AC+ P   ++ ++GSD  GR+DGLLWYKD+GQH  GEFSMA+VQANNL+E
Sbjct  1    MLAKLMNLLKACWQPSSNKYAHAGSDVIGRKDGLLWYKDSGQHVYGEFSMAMVQANNLLE  60

Query  487  D  489
            D
Sbjct  61   D  61



>ref|XP_009392876.1| PREDICTED: probable protein phosphatase 2C 60 [Musa acuminata 
subsp. malaccensis]
Length=394

 Score = 88.6 bits (218),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 48/61 (79%), Gaps = 0/61 (0%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            M + LM +L+AC+ P   ++ ++GSD  G QDGLLWYKD+GQH  GEFSMAVVQANNL+E
Sbjct  1    MFAKLMNLLKACWRPSSHKYAHTGSDVVGWQDGLLWYKDSGQHVYGEFSMAVVQANNLLE  60

Query  487  D  489
            D
Sbjct  61   D  61



>ref|XP_008806142.1| PREDICTED: probable protein phosphatase 2C 60 [Phoenix dactylifera]
Length=397

 Score = 88.6 bits (218),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            M++ LM  L+AC+ P    + ++GSD  GRQDGLLWYKD+GQH +GEFSMAVVQAN+L+E
Sbjct  1    MIAELMNFLKACWRPSSVPYAHTGSDTVGRQDGLLWYKDSGQHMNGEFSMAVVQANSLLE  60

Query  487  D  489
            D
Sbjct  61   D  61



>ref|XP_004232521.1| PREDICTED: probable protein phosphatase 2C 60 [Solanum lycopersicum]
Length=390

 Score = 88.2 bits (217),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/61 (64%), Positives = 48/61 (79%), Gaps = 0/61 (0%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            MLS L+  L+AC     +R+V+S +D+ GRQDGL WYKD+GQH  GEFSMAVVQANNL+E
Sbjct  1    MLSRLINFLKACCRSSADRYVHSATDSAGRQDGLFWYKDSGQHLLGEFSMAVVQANNLLE  60

Query  487  D  489
            D
Sbjct  61   D  61



>ref|XP_009395356.1| PREDICTED: probable protein phosphatase 2C 60 [Musa acuminata 
subsp. malaccensis]
Length=391

 Score = 88.2 bits (217),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/61 (64%), Positives = 46/61 (75%), Gaps = 0/61 (0%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            M + LM IL+AC+ P    + ++ SD  GRQDGLLWYKD GQH  GEFSMAVVQANNL+E
Sbjct  1    MFAKLMNILKACWQPSSNSYAHTSSDLVGRQDGLLWYKDCGQHVYGEFSMAVVQANNLLE  60

Query  487  D  489
            D
Sbjct  61   D  61



>gb|KGN48956.1| hypothetical protein Csa_6G507290 [Cucumis sativus]
Length=398

 Score = 87.4 bits (215),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/61 (64%), Positives = 47/61 (77%), Gaps = 0/61 (0%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            MLS  M  LRAC+ P  +  V+ GS++ GR +GLLWYKD GQH +GEFSMAVVQANNL+E
Sbjct  1    MLSSSMNFLRACWMPSSDNIVHRGSNSAGRHEGLLWYKDIGQHMNGEFSMAVVQANNLLE  60

Query  487  D  489
            D
Sbjct  61   D  61



>ref|XP_008440874.1| PREDICTED: probable protein phosphatase 2C 60 isoform X2 [Cucumis 
melo]
 ref|XP_008440875.1| PREDICTED: probable protein phosphatase 2C 60 isoform X2 [Cucumis 
melo]
 ref|XP_008440876.1| PREDICTED: probable protein phosphatase 2C 60 isoform X2 [Cucumis 
melo]
Length=393

 Score = 87.4 bits (215),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = +1

Query  322  MKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLMED  489
            M  LRAC+ P  +  V+SGSD+ GR +GLLWYKD GQH +GEFSMAVVQANNL+ED
Sbjct  1    MNFLRACWVPSSDNIVHSGSDSAGRHEGLLWYKDIGQHMNGEFSMAVVQANNLLED  56



>ref|XP_006282643.1| hypothetical protein CARUB_v10004984mg [Capsella rubella]
 ref|XP_006282644.1| hypothetical protein CARUB_v10004984mg [Capsella rubella]
 gb|EOA15541.1| hypothetical protein CARUB_v10004984mg [Capsella rubella]
 gb|EOA15542.1| hypothetical protein CARUB_v10004984mg [Capsella rubella]
Length=319

 Score = 86.7 bits (213),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 48/61 (79%), Gaps = 0/61 (0%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            MLSGLM  L AC  P+ ++   S SD+ GRQ+GLLWY+D+GQH  G+FSMAVVQAN+L+E
Sbjct  1    MLSGLMNFLNACLWPRSDQQARSASDSGGRQEGLLWYRDSGQHVFGDFSMAVVQANSLLE  60

Query  487  D  489
            D
Sbjct  61   D  61



>ref|XP_010548248.1| PREDICTED: probable protein phosphatase 2C 46 [Tarenaya hassleriana]
 ref|XP_010548249.1| PREDICTED: probable protein phosphatase 2C 46 [Tarenaya hassleriana]
 ref|XP_010548250.1| PREDICTED: probable protein phosphatase 2C 46 [Tarenaya hassleriana]
 ref|XP_010548251.1| PREDICTED: probable protein phosphatase 2C 46 [Tarenaya hassleriana]
 ref|XP_010548252.1| PREDICTED: probable protein phosphatase 2C 46 [Tarenaya hassleriana]
Length=392

 Score = 87.0 bits (214),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 40/61 (66%), Positives = 47/61 (77%), Gaps = 3/61 (5%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            MLS LM  LR+C+ P      +SGSD  GRQDGLLWYKD GQH +G+FSMAV+QANNL+E
Sbjct  1    MLSKLMNFLRSCWRPYS---AHSGSDTAGRQDGLLWYKDIGQHLAGDFSMAVIQANNLLE  57

Query  487  D  489
            D
Sbjct  58   D  58



>gb|KJB40119.1| hypothetical protein B456_007G047600 [Gossypium raimondii]
 gb|KJB40120.1| hypothetical protein B456_007G047600 [Gossypium raimondii]
Length=387

 Score = 86.7 bits (213),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 47/61 (77%), Gaps = 4/61 (7%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            MLS L+  LRAC+    +R    GSDA GRQDGLLWYKD GQH +GEFSMAVVQANNL+E
Sbjct  1    MLSRLVNFLRACWRTSSDR----GSDAAGRQDGLLWYKDIGQHLNGEFSMAVVQANNLLE  56

Query  487  D  489
            D
Sbjct  57   D  57



>ref|XP_006282642.1| hypothetical protein CARUB_v10004984mg [Capsella rubella]
 gb|EOA15540.1| hypothetical protein CARUB_v10004984mg [Capsella rubella]
Length=396

 Score = 86.7 bits (213),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 48/61 (79%), Gaps = 0/61 (0%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            MLSGLM  L AC  P+ ++   S SD+ GRQ+GLLWY+D+GQH  G+FSMAVVQAN+L+E
Sbjct  1    MLSGLMNFLNACLWPRSDQQARSASDSGGRQEGLLWYRDSGQHVFGDFSMAVVQANSLLE  60

Query  487  D  489
            D
Sbjct  61   D  61



>gb|KHG27051.1| hypothetical protein F383_06469 [Gossypium arboreum]
Length=387

 Score = 86.3 bits (212),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 47/61 (77%), Gaps = 4/61 (7%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            MLS L+  LRAC+    +R    GSDA GRQDGLLWYKD GQH +GEFSMAVVQANNL+E
Sbjct  1    MLSRLVNFLRACWRTSSDR----GSDAAGRQDGLLWYKDKGQHLNGEFSMAVVQANNLLE  56

Query  487  D  489
            D
Sbjct  57   D  57



>gb|ACJ84882.1| unknown [Medicago truncatula]
Length=378

 Score = 85.9 bits (211),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 39/61 (64%), Positives = 48/61 (79%), Gaps = 0/61 (0%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            MLS L+  L+ACF P  + +  + SDA G+QDGLLWYKD+GQH  G+FSMAVVQANNL+E
Sbjct  1    MLSELVNFLKACFRPGSDGYARTTSDAGGKQDGLLWYKDSGQHICGDFSMAVVQANNLLE  60

Query  487  D  489
            D
Sbjct  61   D  61



>gb|KEH44379.1| serine/threonine phosphatase family, 2C domain protein [Medicago 
truncatula]
Length=397

 Score = 86.3 bits (212),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 39/61 (64%), Positives = 48/61 (79%), Gaps = 0/61 (0%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            MLS L+  L+ACF P  + +  + SDA G+QDGLLWYKD+GQH  G+FSMAVVQANNL+E
Sbjct  1    MLSELVNFLKACFRPGSDGYARTTSDAGGKQDGLLWYKDSGQHICGDFSMAVVQANNLLE  60

Query  487  D  489
            D
Sbjct  61   D  61



>gb|KEH23415.1| protein phosphatase 2C family protein [Medicago truncatula]
Length=321

 Score = 85.1 bits (209),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 37/56 (66%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = +1

Query  322  MKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLMED  489
            M  L ACF  + +R+ +SGSD+ G+QDGLLWYKD+G+H +GEFSMAVVQANNL+ED
Sbjct  1    MNYLTACFRSRLDRYTHSGSDSGGKQDGLLWYKDSGKHLNGEFSMAVVQANNLLED  56



>ref|XP_002868847.1| phosphatase 2C family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45106.1| phosphatase 2C family protein [Arabidopsis lyrata subsp. lyrata]
Length=399

 Score = 85.9 bits (211),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 48/61 (79%), Gaps = 0/61 (0%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            MLSGLM  L AC  P+ ++   S SD+ GRQ+GLLWY+D+GQH  G+FSMAVVQAN+L+E
Sbjct  1    MLSGLMNFLNACLWPRSDQQARSPSDSGGRQEGLLWYRDSGQHVFGDFSMAVVQANSLLE  60

Query  487  D  489
            D
Sbjct  61   D  61



>ref|XP_006340779.1| PREDICTED: probable protein phosphatase 2C 60-like isoform X1 
[Solanum tuberosum]
 ref|XP_006340780.1| PREDICTED: probable protein phosphatase 2C 60-like isoform X2 
[Solanum tuberosum]
Length=390

 Score = 85.5 bits (210),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 48/61 (79%), Gaps = 0/61 (0%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            MLS L+  L+AC     + +V++G+D+ GRQDGL WYKD+GQH  GEFSMAVVQANNL+E
Sbjct  1    MLSRLINFLKACCRSSADLYVHNGTDSAGRQDGLFWYKDSGQHLLGEFSMAVVQANNLLE  60

Query  487  D  489
            D
Sbjct  61   D  61



>ref|XP_003624259.1| Protein phosphatase 2C (PP2C) [Medicago truncatula]
 gb|AES80477.1| protein phosphatase 2C family protein [Medicago truncatula]
Length=387

 Score = 85.5 bits (210),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/56 (66%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = +1

Query  322  MKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLMED  489
            M  L ACF  + +R+ +SGSD+ G+QDGLLWYKD+G+H +GEFSMAVVQANNL+ED
Sbjct  1    MNYLTACFRSRLDRYTHSGSDSGGKQDGLLWYKDSGKHLNGEFSMAVVQANNLLED  56



>ref|NP_195564.2| putative protein phosphatase 2C 64 [Arabidopsis thaliana]
 ref|NP_974708.1| putative protein phosphatase 2C 64 [Arabidopsis thaliana]
 sp|Q5PNS9.1|P2C64_ARATH RecName: Full=Probable protein phosphatase 2C 64; Short=AtPP2C64 
[Arabidopsis thaliana]
 gb|AAV85723.1| At4g38520 [Arabidopsis thaliana]
 gb|AAX12864.1| At4g38520 [Arabidopsis thaliana]
 gb|AEE86941.1| putative protein phosphatase 2C 64 [Arabidopsis thaliana]
 gb|AEE86942.1| putative protein phosphatase 2C 64 [Arabidopsis thaliana]
Length=400

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 48/61 (79%), Gaps = 0/61 (0%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            MLSGLM  L AC  P+ ++   S SD+ GRQ+GLLW++D+GQH  G+FSMAVVQAN+L+E
Sbjct  1    MLSGLMNFLNACLWPRSDQQARSASDSGGRQEGLLWFRDSGQHVFGDFSMAVVQANSLLE  60

Query  487  D  489
            D
Sbjct  61   D  61



>ref|XP_010555215.1| PREDICTED: probable protein phosphatase 2C 64 [Tarenaya hassleriana]
Length=375

 Score = 84.0 bits (206),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 48/62 (77%), Gaps = 7/62 (11%)
 Frame = +1

Query  307  MLSGLMKILR-ACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLM  483
            MLSGLMK+LR +CF P       SGSD+ GRQDGLLWYKD GQH  G+FSMAVVQANNL 
Sbjct  1    MLSGLMKLLRVSCFWPS------SGSDSGGRQDGLLWYKDFGQHVYGDFSMAVVQANNLA  54

Query  484  ED  489
            ED
Sbjct  55   ED  56



>gb|ACR37869.1| unknown [Zea mays]
 gb|AFW88242.1| hypothetical protein ZEAMMB73_732913 [Zea mays]
Length=136

 Score = 80.9 bits (198),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 45/62 (73%), Gaps = 1/62 (2%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGER-HVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLM  483
            MLS LM  L++C+ P         GSDATGRQDGLLWYKD GQ   GEFSMAVVQANNL+
Sbjct  1    MLSALMDYLKSCWGPASPAGRPRKGSDATGRQDGLLWYKDGGQVVDGEFSMAVVQANNLL  60

Query  484  ED  489
            ED
Sbjct  61   ED  62



>gb|AAL32532.1| putative protein phosphatase-2c [Arabidopsis thaliana]
Length=400

 Score = 84.0 bits (206),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 47/61 (77%), Gaps = 0/61 (0%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            MLSGLM  L AC  P+ ++   S SD+ GRQ+GLLW+ D+GQH  G+FSMAVVQAN+L+E
Sbjct  1    MLSGLMNFLNACLWPRSDQQARSASDSGGRQEGLLWFSDSGQHVFGDFSMAVVQANSLLE  60

Query  487  D  489
            D
Sbjct  61   D  61



>ref|XP_008447931.1| PREDICTED: probable protein phosphatase 2C 60 isoform X3 [Cucumis 
melo]
Length=312

 Score = 82.8 bits (203),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 46/61 (75%), Gaps = 2/61 (3%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            MLS LM  LRACF    +R  Y   +  GRQDGLLWYKD+GQH +G+FSM+V+QANNL+E
Sbjct  1    MLSELMNFLRACFQSSSDR--YGAGEIRGRQDGLLWYKDSGQHLNGDFSMSVIQANNLLE  58

Query  487  D  489
            D
Sbjct  59   D  59



>ref|XP_006662022.1| PREDICTED: probable protein phosphatase 2C 72-like [Oryza brachyantha]
Length=393

 Score = 83.6 bits (205),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 47/63 (75%), Gaps = 2/63 (3%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGER--HVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNL  480
            MLS +M+ LR+C+ P          GSDA GRQDGLLWYKDTGQ  +GEFSMAVVQANNL
Sbjct  1    MLSAVMEYLRSCWGPASSPAGRPRKGSDAAGRQDGLLWYKDTGQLVAGEFSMAVVQANNL  60

Query  481  MED  489
            +ED
Sbjct  61   LED  63



>gb|EPS71472.1| hypothetical protein M569_03278, partial [Genlisea aurea]
Length=380

 Score = 83.2 bits (204),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 42/56 (75%), Gaps = 0/56 (0%)
 Frame = +1

Query  322  MKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLMED  489
            M  LR CF PK +      SD+ GRQDGLLW+KD GQHF GEFSMAVVQANNL+ED
Sbjct  1    MDFLRCCFQPKADGRSRVVSDSVGRQDGLLWFKDLGQHFGGEFSMAVVQANNLLED  56



>ref|XP_004135015.1| PREDICTED: probable protein phosphatase 2C 60-like [Cucumis sativus]
 ref|XP_004166973.1| PREDICTED: probable protein phosphatase 2C 60-like [Cucumis sativus]
Length=393

 Score = 83.6 bits (205),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 36/56 (64%), Positives = 44/56 (79%), Gaps = 0/56 (0%)
 Frame = +1

Query  322  MKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLMED  489
            M  LRAC+ P  +  V+ GS++ GR +GLLWYKD GQH +GEFSMAVVQANNL+ED
Sbjct  1    MNFLRACWMPSSDNIVHRGSNSAGRHEGLLWYKDIGQHMNGEFSMAVVQANNLLED  56



>ref|XP_010503831.1| PREDICTED: probable protein phosphatase 2C 46 [Camelina sativa]
Length=381

 Score = 83.2 bits (204),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 46/61 (75%), Gaps = 0/61 (0%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            MLS LMK+L AC  P         SD+TG+QDGLLWYKD+GQH  GEFSMAVVQANNL+E
Sbjct  1    MLSTLMKLLSACLWPSSSSSSGKSSDSTGKQDGLLWYKDSGQHLIGEFSMAVVQANNLLE  60

Query  487  D  489
            D
Sbjct  61   D  61



>ref|XP_009115817.1| PREDICTED: probable protein phosphatase 2C 46 [Brassica rapa]
Length=377

 Score = 83.2 bits (204),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 39/61 (64%), Positives = 47/61 (77%), Gaps = 4/61 (7%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            ML+ LMK+L AC  P   R V    D++G+QDGLLWYKD+GQH  G+FSMAVVQANNL+E
Sbjct  1    MLTTLMKLLSACLWPSSGRSV----DSSGKQDGLLWYKDSGQHLLGDFSMAVVQANNLLE  56

Query  487  D  489
            D
Sbjct  57   D  57



>ref|XP_004144860.1| PREDICTED: probable protein phosphatase 2C 60-like [Cucumis sativus]
 ref|XP_004164213.1| PREDICTED: probable protein phosphatase 2C 60-like [Cucumis sativus]
 gb|KGN43269.1| hypothetical protein Csa_7G014550 [Cucumis sativus]
Length=390

 Score = 83.2 bits (204),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 46/61 (75%), Gaps = 2/61 (3%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            MLS LM  LRACF    +RH     +  GRQ+GLLWYKD+GQH +GEFSM+V+QANNL+E
Sbjct  1    MLSELMNFLRACFQSSSDRH--GAGEIRGRQEGLLWYKDSGQHLNGEFSMSVIQANNLLE  58

Query  487  D  489
            D
Sbjct  59   D  59



>ref|XP_008447929.1| PREDICTED: probable protein phosphatase 2C 60 isoform X1 [Cucumis 
melo]
Length=390

 Score = 83.2 bits (204),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 46/61 (75%), Gaps = 2/61 (3%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            MLS LM  LRACF    +R  Y   +  GRQDGLLWYKD+GQH +G+FSM+V+QANNL+E
Sbjct  1    MLSELMNFLRACFQSSSDR--YGAGEIRGRQDGLLWYKDSGQHLNGDFSMSVIQANNLLE  58

Query  487  D  489
            D
Sbjct  59   D  59



>ref|XP_009413031.1| PREDICTED: probable protein phosphatase 2C 60 [Musa acuminata 
subsp. malaccensis]
Length=392

 Score = 83.2 bits (204),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = +1

Query  322  MKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLMED  489
            M +LR C+ P    +V SGSDA GR+DGLLWYKD+G+H  GEFSMAVVQANNL+ED
Sbjct  1    MDLLRYCWGPSLAHYVNSGSDAVGRRDGLLWYKDSGRHACGEFSMAVVQANNLLED  56



>emb|CDX73725.1| BnaC08g22780D [Brassica napus]
Length=377

 Score = 82.8 bits (203),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 39/61 (64%), Positives = 47/61 (77%), Gaps = 4/61 (7%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            ML+ LMK+L AC  P   R V    D++G+QDGLLWYKD+GQH  G+FSMAVVQANNL+E
Sbjct  1    MLATLMKLLSACLWPSSGRSV----DSSGKQDGLLWYKDSGQHLLGDFSMAVVQANNLLE  56

Query  487  D  489
            D
Sbjct  57   D  57



>ref|XP_010028765.1| PREDICTED: probable protein phosphatase 2C 60 [Eucalyptus grandis]
 gb|KCW55582.1| hypothetical protein EUGRSUZ_I01452 [Eucalyptus grandis]
Length=397

 Score = 82.8 bits (203),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/61 (64%), Positives = 46/61 (75%), Gaps = 0/61 (0%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            M S L+ +L ACF P  +R  + GS A G QDGLLW+KD GQH +GEFSMAVVQANNL+E
Sbjct  1    MFSELINLLGACFRPSSDRCAHRGSVAGGCQDGLLWFKDLGQHLNGEFSMAVVQANNLLE  60

Query  487  D  489
            D
Sbjct  61   D  61



>ref|XP_008447930.1| PREDICTED: probable protein phosphatase 2C 60 isoform X2 [Cucumis 
melo]
Length=360

 Score = 82.0 bits (201),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 46/61 (75%), Gaps = 2/61 (3%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            MLS LM  LRACF    +R  Y   +  GRQDGLLWYKD+GQH +G+FSM+V+QANNL+E
Sbjct  1    MLSELMNFLRACFQSSSDR--YGAGEIRGRQDGLLWYKDSGQHLNGDFSMSVIQANNLLE  58

Query  487  D  489
            D
Sbjct  59   D  59



>ref|XP_009400339.1| PREDICTED: probable protein phosphatase 2C 60 [Musa acuminata 
subsp. malaccensis]
Length=396

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 46/61 (75%), Gaps = 0/61 (0%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            M    M  LR+C+ P   RH +SG+DA GRQDGLLWYKD G+  +G+FSMAVVQAN+L+E
Sbjct  1    MTERFMNFLRSCWGPSSRRHDHSGTDALGRQDGLLWYKDIGRLANGDFSMAVVQANSLLE  60

Query  487  D  489
            D
Sbjct  61   D  61



>ref|XP_004146159.1| PREDICTED: probable protein phosphatase 2C 60-like [Cucumis sativus]
 ref|XP_004159731.1| PREDICTED: probable protein phosphatase 2C 60-like [Cucumis sativus]
 gb|KGN55637.1| hypothetical protein Csa_3G002570 [Cucumis sativus]
Length=390

 Score = 82.0 bits (201),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 47/64 (73%), Gaps = 3/64 (5%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGE---RHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANN  477
            MLS LM  LRAC+ P  +   R   SGSD+ G QDGLLWYKD G H +GEFSMAVVQANN
Sbjct  1    MLSSLMNFLRACWQPCADGLLRRGGSGSDSVGCQDGLLWYKDHGHHINGEFSMAVVQANN  60

Query  478  LMED  489
            L+ED
Sbjct  61   LLED  64



>emb|CDX78002.1| BnaA09g31970D [Brassica napus]
Length=499

 Score = 82.8 bits (203),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/61 (64%), Positives = 47/61 (77%), Gaps = 4/61 (7%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            ML+ LMK+L AC  P   R V    D++G+QDGLLWYKD+GQH  G+FSMAVVQANNL+E
Sbjct  1    MLTTLMKLLSACLWPSSGRSV----DSSGKQDGLLWYKDSGQHLLGDFSMAVVQANNLLE  56

Query  487  D  489
            D
Sbjct  57   D  57



>gb|ABF93865.1| protein phosphatase 2C, putative, expressed [Oryza sativa Japonica 
Group]
Length=319

 Score = 80.9 bits (198),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 45/62 (73%), Gaps = 1/62 (2%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGER-HVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLM  483
            ML+ +M   R+C+ P+    H   GSD  GRQDGLLWYKD GQ  +GEFSMAVVQANNL+
Sbjct  1    MLAAVMDYFRSCWGPRSPAGHRVRGSDVAGRQDGLLWYKDAGQLVTGEFSMAVVQANNLL  60

Query  484  ED  489
            ED
Sbjct  61   ED  62



>gb|ACN25494.1| unknown [Zea mays]
 gb|AFW88241.1| protein phosphatase 2C [Zea mays]
 gb|AIB05709.1| orphans transcription factor, partial [Zea mays]
Length=398

 Score = 81.3 bits (199),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 45/62 (73%), Gaps = 1/62 (2%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGER-HVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLM  483
            MLS LM  L++C+ P         GSDATGRQDGLLWYKD GQ   GEFSMAVVQANNL+
Sbjct  1    MLSALMDYLKSCWGPASPAGRPRKGSDATGRQDGLLWYKDGGQVVDGEFSMAVVQANNLL  60

Query  484  ED  489
            ED
Sbjct  61   ED  62



>ref|NP_001151373.1| LOC100285006 [Zea mays]
 gb|ACG42595.1| protein phosphatase 2C [Zea mays]
Length=397

 Score = 81.3 bits (199),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 45/62 (73%), Gaps = 1/62 (2%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGER-HVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLM  483
            MLS LM  L++C+ P         GSDATGRQDGLLWYKD GQ   GEFSMAVVQANNL+
Sbjct  1    MLSALMDYLKSCWGPASPAGRPRKGSDATGRQDGLLWYKDGGQVVDGEFSMAVVQANNLL  60

Query  484  ED  489
            ED
Sbjct  61   ED  62



>ref|NP_001048899.1| Os03g0137200 [Oryza sativa Japonica Group]
 sp|Q10S32.1|P2C28_ORYSJ RecName: Full=Probable protein phosphatase 2C 28; Short=OsPP2C28 
[Oryza sativa Japonica Group]
 gb|ABF93863.1| protein phosphatase 2C, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF10813.1| Os03g0137200 [Oryza sativa Japonica Group]
Length=399

 Score = 81.3 bits (199),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 45/62 (73%), Gaps = 1/62 (2%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGER-HVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLM  483
            ML+ +M   R+C+ P+    H   GSD  GRQDGLLWYKD GQ  +GEFSMAVVQANNL+
Sbjct  1    MLAAVMDYFRSCWGPRSPAGHRVRGSDVAGRQDGLLWYKDAGQLVTGEFSMAVVQANNLL  60

Query  484  ED  489
            ED
Sbjct  61   ED  62



>ref|NP_001065203.1| Os10g0544900 [Oryza sativa Japonica Group]
 sp|Q7XCJ7.1|P2C72_ORYSJ RecName: Full=Probable protein phosphatase 2C 72; Short=OsPP2C72 
[Oryza sativa Japonica Group]
 gb|AAP54876.1| protein phosphatase 2C, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF27117.1| Os10g0544900 [Oryza sativa Japonica Group]
 dbj|BAG99722.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC67386.1| hypothetical protein OsI_34528 [Oryza sativa Indica Group]
 gb|EEE69065.1| hypothetical protein OsJ_28079 [Oryza sativa Japonica Group]
Length=393

 Score = 80.9 bits (198),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 45/63 (71%), Gaps = 2/63 (3%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGER--HVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNL  480
            MLS  M+ LR+C+ P          GSDA GRQDGLLWYKD GQ  +GEFSMAVVQANNL
Sbjct  1    MLSAAMEYLRSCWGPASSPAGRPRKGSDAAGRQDGLLWYKDAGQLVAGEFSMAVVQANNL  60

Query  481  MED  489
            +ED
Sbjct  61   LED  63



>ref|XP_006291301.1| hypothetical protein CARUB_v10017436mg [Capsella rubella]
 gb|EOA24199.1| hypothetical protein CARUB_v10017436mg [Capsella rubella]
Length=328

 Score = 79.7 bits (195),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 46/61 (75%), Gaps = 2/61 (3%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            MLS LMK+L AC  P         SD+TG+QDGLLWYKD+GQH  GEFSMAVVQANNL+E
Sbjct  1    MLSTLMKLLSACLWPS--SSSGKSSDSTGKQDGLLWYKDSGQHLVGEFSMAVVQANNLLE  58

Query  487  D  489
            D
Sbjct  59   D  59



>ref|XP_006649361.1| PREDICTED: probable protein phosphatase 2C 28-like [Oryza brachyantha]
Length=399

 Score = 80.5 bits (197),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 45/62 (73%), Gaps = 1/62 (2%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGER-HVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLM  483
            M++ +M   R+C+ P+    H   GSD  GRQDGLLWYKD GQ  +GEFSMAVVQANNL+
Sbjct  1    MMAAVMDYFRSCWGPRSPAGHRVRGSDVAGRQDGLLWYKDAGQLVTGEFSMAVVQANNLL  60

Query  484  ED  489
            ED
Sbjct  61   ED  62



>ref|XP_003520132.1| PREDICTED: probable protein phosphatase 2C 60-like [Glycine max]
Length=394

 Score = 80.1 bits (196),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 46/61 (75%), Gaps = 0/61 (0%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            MLS LM  L AC+  +G      GS+ +GR++GLLWYKDTGQH  GE+SMAVVQANNL+E
Sbjct  1    MLSRLMDFLTACWRRRGSSSDGKGSEVSGRKEGLLWYKDTGQHLFGEYSMAVVQANNLLE  60

Query  487  D  489
            D
Sbjct  61   D  61



>gb|KHN00444.1| Hypothetical protein glysoja_000112 [Glycine soja]
Length=394

 Score = 80.1 bits (196),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 46/61 (75%), Gaps = 0/61 (0%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            MLS LM  L AC+  +G      GS+ +GR++GLLWYKDTGQH  GE+SMAVVQANNL+E
Sbjct  1    MLSRLMDFLTACWRRRGSSSDGKGSEVSGRKEGLLWYKDTGQHLFGEYSMAVVQANNLLE  60

Query  487  D  489
            D
Sbjct  61   D  61



>ref|XP_006291300.1| hypothetical protein CARUB_v10017436mg [Capsella rubella]
 gb|EOA24198.1| hypothetical protein CARUB_v10017436mg [Capsella rubella]
Length=379

 Score = 79.7 bits (195),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 46/61 (75%), Gaps = 2/61 (3%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            MLS LMK+L AC  P         SD+TG+QDGLLWYKD+GQH  GEFSMAVVQANNL+E
Sbjct  1    MLSTLMKLLSACLWPSSSS--GKSSDSTGKQDGLLWYKDSGQHLVGEFSMAVVQANNLLE  58

Query  487  D  489
            D
Sbjct  59   D  59



>ref|XP_010234959.1| PREDICTED: probable protein phosphatase 2C 72 [Brachypodium distachyon]
Length=395

 Score = 79.7 bits (195),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 46/63 (73%), Gaps = 2/63 (3%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYS--GSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNL  480
            MLS  M+ LR+C+ P       S  G+DA GRQDGLLWYKD GQ  +GEFSMAVVQANNL
Sbjct  1    MLSAAMEYLRSCWGPASSPDGRSRKGADAAGRQDGLLWYKDAGQLVAGEFSMAVVQANNL  60

Query  481  MED  489
            +ED
Sbjct  61   LED  63



>ref|XP_010515547.1| PREDICTED: probable protein phosphatase 2C 46 [Camelina sativa]
Length=380

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 46/61 (75%), Gaps = 1/61 (2%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            MLS LMK+L AC  P         SD+TG+QDGLLWYKD+GQH  GEFSMAVVQANNL+E
Sbjct  1    MLSTLMKLLSACLWPSSSS-SGKSSDSTGKQDGLLWYKDSGQHLVGEFSMAVVQANNLLE  59

Query  487  D  489
            D
Sbjct  60   D  60



>ref|XP_010426694.1| PREDICTED: probable protein phosphatase 2C 46 [Camelina sativa]
Length=380

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 40/61 (66%), Positives = 46/61 (75%), Gaps = 1/61 (2%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            MLS LMK+L AC  P         +D+TG+QDGLLWYKD+GQH  GEFSMAVVQANNL+E
Sbjct  1    MLSTLMKLLSACLWPSSSS-SGKSADSTGKQDGLLWYKDSGQHLVGEFSMAVVQANNLLE  59

Query  487  D  489
            D
Sbjct  60   D  60



>ref|XP_006403924.1| hypothetical protein EUTSA_v10010452mg [Eutrema salsugineum]
 ref|XP_006403925.1| hypothetical protein EUTSA_v10010452mg [Eutrema salsugineum]
 gb|AAM19705.1|AF499718_1 protein phosphatase 2c-like protein [Eutrema halophilum]
 gb|ESQ45377.1| hypothetical protein EUTSA_v10010452mg [Eutrema salsugineum]
 gb|ESQ45378.1| hypothetical protein EUTSA_v10010452mg [Eutrema salsugineum]
Length=378

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 46/61 (75%), Gaps = 3/61 (5%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            MLS LMK+L AC  P         SD+TG+QDGLLWYKD+GQH  GEFSMAVVQANNL+E
Sbjct  1    MLSTLMKLLSACLWPSSS---GKSSDSTGKQDGLLWYKDSGQHLLGEFSMAVVQANNLLE  57

Query  487  D  489
            D
Sbjct  58   D  58



>ref|XP_009149079.1| PREDICTED: probable protein phosphatase 2C 46 [Brassica rapa]
 ref|XP_009149083.1| PREDICTED: probable protein phosphatase 2C 46 [Brassica rapa]
 ref|XP_009149091.1| PREDICTED: probable protein phosphatase 2C 46 [Brassica rapa]
 ref|XP_009149101.1| PREDICTED: probable protein phosphatase 2C 46 [Brassica rapa]
 ref|XP_009149107.1| PREDICTED: probable protein phosphatase 2C 46 [Brassica rapa]
 emb|CDY33283.1| BnaA01g19500D [Brassica napus]
Length=382

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/61 (64%), Positives = 44/61 (72%), Gaps = 0/61 (0%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            ML+ LMK+L AC  P       S S + GRQDGLLWYKD+G H  GEFSMAVVQANNL+E
Sbjct  1    MLATLMKLLSACLWPSSSSGKSSDSSSAGRQDGLLWYKDSGHHLLGEFSMAVVQANNLLE  60

Query  487  D  489
            D
Sbjct  61   D  61



>ref|NP_001168381.1| uncharacterized protein LOC100382150 [Zea mays]
 ref|XP_008643791.1| PREDICTED: uncharacterized protein LOC100382150 isoform X1 [Zea 
mays]
 gb|ACN28032.1| unknown [Zea mays]
 tpg|DAA43254.1| TPA: hypothetical protein ZEAMMB73_941915 [Zea mays]
Length=357

 Score = 79.0 bits (193),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 45/62 (73%), Gaps = 1/62 (2%)
 Frame = +1

Query  307  MLSGLMKILRACFCPK-GERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLM  483
            ML+ +M    +C+ P+ G  H   GSDA GRQDGLLWYKD GQ  +GEFSMAVVQAN L+
Sbjct  1    MLAAVMDYFSSCWGPRSGAGHREKGSDAAGRQDGLLWYKDVGQLVTGEFSMAVVQANQLL  60

Query  484  ED  489
            ED
Sbjct  61   ED  62



>gb|AIB05855.1| orphans transcription factor, partial [Zea mays]
Length=357

 Score = 79.0 bits (193),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 45/62 (73%), Gaps = 1/62 (2%)
 Frame = +1

Query  307  MLSGLMKILRACFCPK-GERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLM  483
            ML+ +M    +C+ P+ G  H   GSDA GRQDGLLWYKD GQ  +GEFSMAVVQAN L+
Sbjct  1    MLAAVMDYFSSCWGPRSGAGHREKGSDAAGRQDGLLWYKDVGQLVTGEFSMAVVQANQLL  60

Query  484  ED  489
            ED
Sbjct  61   ED  62



>ref|XP_010436947.1| PREDICTED: probable protein phosphatase 2C 64 [Camelina sativa]
Length=393

 Score = 79.0 bits (193),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 46/61 (75%), Gaps = 3/61 (5%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            MLSGLM  L AC  P+ +   +  SD+ GRQ+GLLWY+D+ QH  G+FSMAVVQAN+L+E
Sbjct  1    MLSGLMNFLNACLWPRSD---HQASDSGGRQEGLLWYRDSAQHVFGDFSMAVVQANSLLE  57

Query  487  D  489
            D
Sbjct  58   D  58



>ref|XP_010431790.1| PREDICTED: probable protein phosphatase 2C 64 isoform X1 [Camelina 
sativa]
 ref|XP_010431791.1| PREDICTED: probable protein phosphatase 2C 64 isoform X2 [Camelina 
sativa]
Length=397

 Score = 79.0 bits (193),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 46/61 (75%), Gaps = 3/61 (5%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            MLSGLM  L AC  P+ +   +  SD+ GRQ+GLLWY+D+ QH  G+FSMAVVQAN+L+E
Sbjct  1    MLSGLMNFLNACLWPRSD---HQASDSGGRQEGLLWYRDSAQHVFGDFSMAVVQANSLLE  57

Query  487  D  489
            D
Sbjct  58   D  58



>ref|XP_004983777.1| PREDICTED: probable protein phosphatase 2C 72-like [Setaria italica]
Length=398

 Score = 79.0 bits (193),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 45/62 (73%), Gaps = 1/62 (2%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGER-HVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLM  483
            MLS +M+ LR+C+ P         GSDA GRQDGLLWYKD G+   GEFSMAVVQANNL+
Sbjct  1    MLSAVMEYLRSCWGPSSPAGRSRRGSDAAGRQDGLLWYKDGGRVVDGEFSMAVVQANNLL  60

Query  484  ED  489
            ED
Sbjct  61   ED  62



>gb|ACR38514.1| unknown [Zea mays]
 tpg|DAA43255.1| TPA: hypothetical protein ZEAMMB73_841388 [Zea mays]
Length=274

 Score = 77.4 bits (189),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 45/62 (73%), Gaps = 1/62 (2%)
 Frame = +1

Query  307  MLSGLMKILRACFCPK-GERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLM  483
            ML+ +M    +C+ P+ G+ H   G DA GRQDGLLWYKD GQ  +GEFSMAVVQAN L+
Sbjct  1    MLAAVMDYFSSCWGPRSGDGHRGKGPDAAGRQDGLLWYKDAGQLVTGEFSMAVVQANQLL  60

Query  484  ED  489
            ED
Sbjct  61   ED  62



>ref|XP_004951589.1| PREDICTED: probable protein phosphatase 2C 72-like [Setaria italica]
Length=398

 Score = 78.6 bits (192),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 44/62 (71%), Gaps = 1/62 (2%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGER-HVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLM  483
            MLS +M  LR+C+ P         GSD  GRQDGLLWYKD GQ  +GEFSMAVVQANNL+
Sbjct  1    MLSAVMDYLRSCWGPASPAGRPRRGSDTAGRQDGLLWYKDGGQLVNGEFSMAVVQANNLL  60

Query  484  ED  489
            ED
Sbjct  61   ED  62



>ref|NP_566949.2| putative protein phosphatase 2C [Arabidopsis thaliana]
 sp|Q9SD12.1|P2C46_ARATH RecName: Full=Probable protein phosphatase 2C 46; Short=AtPP2C46; 
Flags: Precursor [Arabidopsis thaliana]
 emb|CAB63001.1| protein phosphatase 2C-like protein [Arabidopsis thaliana]
 gb|AEE78784.1| putative protein phosphatase 2C [Arabidopsis thaliana]
Length=379

 Score = 78.2 bits (191),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 45/61 (74%), Gaps = 2/61 (3%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            MLS LMK+L AC  P         SD+TG+QDGLLWYKD GQH  GEFSMAVVQANNL+E
Sbjct  1    MLSTLMKLLSACLWPSSSS--GKSSDSTGKQDGLLWYKDFGQHLVGEFSMAVVQANNLLE  58

Query  487  D  489
            D
Sbjct  59   D  59



>ref|NP_001288424.1| uncharacterized protein LOC103631685 [Zea mays]
 ref|XP_008650800.1| PREDICTED: probable protein phosphatase 2C 28 [Zea mays]
 gb|ACL52901.1| unknown [Zea mays]
 gb|ACL54138.1| unknown [Zea mays]
 tpg|DAA43257.1| TPA: protein phosphatase 2C isoform 1 [Zea mays]
 tpg|DAA43258.1| TPA: protein phosphatase 2C isoform 2 [Zea mays]
 gb|AIB05419.1| orphans transcription factor, partial [Zea mays]
Length=399

 Score = 78.2 bits (191),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 45/62 (73%), Gaps = 1/62 (2%)
 Frame = +1

Query  307  MLSGLMKILRACFCPK-GERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLM  483
            ML+ +M    +C+ P+ G  H   GSDA GRQDGLLWYKD GQ  +GEFSMAVVQAN L+
Sbjct  1    MLAAVMDYFSSCWGPRSGAGHRGKGSDAAGRQDGLLWYKDAGQLVTGEFSMAVVQANQLL  60

Query  484  ED  489
            ED
Sbjct  61   ED  62



>ref|XP_007009637.1| Phosphatase 2C family protein isoform 1 [Theobroma cacao]
 ref|XP_007009640.1| Phosphatase 2C family protein isoform 1 [Theobroma cacao]
 gb|EOY18447.1| Phosphatase 2C family protein isoform 1 [Theobroma cacao]
 gb|EOY18450.1| Phosphatase 2C family protein isoform 1 [Theobroma cacao]
Length=379

 Score = 78.2 bits (191),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 45/60 (75%), Gaps = 1/60 (2%)
 Frame = +1

Query  313  SGLMKILRACFCPKGE-RHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLMED  489
            + LM+I+  C+ P  E  +   G DA GR DGLLWYKD+GQH +GEFSMAV+QANNL+ED
Sbjct  4    ASLMRIVSPCWRPSVEGENSSRGGDANGRVDGLLWYKDSGQHVTGEFSMAVIQANNLLED  63



>gb|ACG32321.1| protein phosphatase 2C [Zea mays]
Length=399

 Score = 78.2 bits (191),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 45/62 (73%), Gaps = 1/62 (2%)
 Frame = +1

Query  307  MLSGLMKILRACFCPK-GERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLM  483
            ML+ +M    +C+ P+ G  H   GSDA GRQDGLLWYKD GQ  +GEFSMAVVQAN L+
Sbjct  1    MLAAVMDYFSSCWGPRSGAGHRGKGSDAAGRQDGLLWYKDAGQLVTGEFSMAVVQANQLL  60

Query  484  ED  489
            ED
Sbjct  61   ED  62



>ref|XP_007009638.1| Phosphatase 2C family protein isoform 2 [Theobroma cacao]
 ref|XP_007009639.1| Phosphatase 2C family protein isoform 2 [Theobroma cacao]
 gb|EOY18448.1| Phosphatase 2C family protein isoform 2 [Theobroma cacao]
 gb|EOY18449.1| Phosphatase 2C family protein isoform 2 [Theobroma cacao]
Length=384

 Score = 78.2 bits (191),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 45/60 (75%), Gaps = 1/60 (2%)
 Frame = +1

Query  313  SGLMKILRACFCPKGE-RHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLMED  489
            + LM+I+  C+ P  E  +   G DA GR DGLLWYKD+GQH +GEFSMAV+QANNL+ED
Sbjct  4    ASLMRIVSPCWRPSVEGENSSRGGDANGRVDGLLWYKDSGQHVTGEFSMAVIQANNLLED  63



>dbj|BAK02779.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=474

 Score = 78.6 bits (192),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 37/64 (58%), Positives = 46/64 (72%), Gaps = 2/64 (3%)
 Frame = +1

Query  304  GMLSGLMKILRACFCPKGE--RHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANN  477
            G+++ +M   R+C+  +    R    GSDA GRQDGLLWYKD GQ  +GEFSMAVVQANN
Sbjct  74   GVMAAVMDYFRSCWGARSRSGRRSKKGSDAAGRQDGLLWYKDAGQAATGEFSMAVVQANN  133

Query  478  LMED  489
            L+ED
Sbjct  134  LLED  137



>emb|CDY16313.1| BnaC01g23480D [Brassica napus]
Length=377

 Score = 77.8 bits (190),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 39/61 (64%), Positives = 44/61 (72%), Gaps = 5/61 (8%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            ML+ LMK+L AC  P       S   + GRQDGLLWYKD+GQH  GEFSMAVVQANNL+E
Sbjct  1    MLATLMKLLSACLWPS-----SSSDSSAGRQDGLLWYKDSGQHLLGEFSMAVVQANNLLE  55

Query  487  D  489
            D
Sbjct  56   D  56



>ref|NP_001152449.1| protein phosphatase 2C [Zea mays]
 gb|ACG47671.1| protein phosphatase 2C [Zea mays]
Length=399

 Score = 77.8 bits (190),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 45/62 (73%), Gaps = 1/62 (2%)
 Frame = +1

Query  307  MLSGLMKILRACFCPK-GERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLM  483
            ML+ +M    +C+ P+ G+ H   G DA GRQDGLLWYKD GQ  +GEFSMAVVQAN L+
Sbjct  1    MLAAVMDYFSSCWGPRSGDGHRGKGPDAAGRQDGLLWYKDAGQLVTGEFSMAVVQANQLL  60

Query  484  ED  489
            ED
Sbjct  61   ED  62



>ref|XP_008680928.1| PREDICTED: protein phosphatase 2C isoform X1 [Zea mays]
 gb|ACF87377.1| unknown [Zea mays]
 tpg|DAA43256.1| TPA: protein phosphatase 2C [Zea mays]
 gb|AIB05384.1| orphans transcription factor, partial [Zea mays]
Length=399

 Score = 77.8 bits (190),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 45/62 (73%), Gaps = 1/62 (2%)
 Frame = +1

Query  307  MLSGLMKILRACFCPK-GERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLM  483
            ML+ +M    +C+ P+ G+ H   G DA GRQDGLLWYKD GQ  +GEFSMAVVQAN L+
Sbjct  1    MLAAVMDYFSSCWGPRSGDGHRGKGPDAAGRQDGLLWYKDAGQLVTGEFSMAVVQANQLL  60

Query  484  ED  489
            ED
Sbjct  61   ED  62



>ref|XP_006378750.1| hypothetical protein POPTR_0010s22180g [Populus trichocarpa]
 ref|XP_002315265.2| hypothetical protein POPTR_0010s22180g [Populus trichocarpa]
 gb|ERP56547.1| hypothetical protein POPTR_0010s22180g [Populus trichocarpa]
 gb|EEF01436.2| hypothetical protein POPTR_0010s22180g [Populus trichocarpa]
Length=386

 Score = 77.4 bits (189),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 46/60 (77%), Gaps = 1/60 (2%)
 Frame = +1

Query  313  SGLMKILRACFCPKGE-RHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLMED  489
            + LM+I+  C+ P  E  +  +G DA GR +GLLWYKD+GQH +GEFSMAV+QANNL+ED
Sbjct  4    TSLMRIVSPCWKPSVEGENSSNGGDAAGRAEGLLWYKDSGQHVNGEFSMAVIQANNLLED  63



>gb|KHN35550.1| Hypothetical protein glysoja_033039 [Glycine soja]
Length=394

 Score = 77.4 bits (189),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 44/61 (72%), Gaps = 0/61 (0%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            MLS LM  L AC+  +       GS+ TGR++GLLWYKD GQH  GE+SMAVVQANNL+E
Sbjct  1    MLSRLMDFLTACWRRRSSSDGKGGSEVTGRKEGLLWYKDAGQHLFGEYSMAVVQANNLLE  60

Query  487  D  489
            D
Sbjct  61   D  61



>ref|XP_010446360.1| PREDICTED: probable protein phosphatase 2C 64 [Camelina sativa]
Length=393

 Score = 77.4 bits (189),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 35/61 (57%), Positives = 46/61 (75%), Gaps = 3/61 (5%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            MLSGLM  L AC  P+ +   +  SD+ GRQ+GLLW++D+ QH  G+FSMAVVQAN+L+E
Sbjct  1    MLSGLMNFLNACLWPRSD---HQASDSGGRQEGLLWFRDSAQHVFGDFSMAVVQANSLLE  57

Query  487  D  489
            D
Sbjct  58   D  58



>ref|XP_011027064.1| PREDICTED: probable protein phosphatase 2C 38 isoform X2 [Populus 
euphratica]
Length=386

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 46/60 (77%), Gaps = 1/60 (2%)
 Frame = +1

Query  313  SGLMKILRACFCPKGE-RHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLMED  489
            + LM+I+  C+ P  E  +  +G DA GR +GLLWYKD+GQH +GEFSMAV+QANNL+ED
Sbjct  4    TSLMRIVSPCWKPSVEGENSSNGGDAAGRAEGLLWYKDSGQHVNGEFSMAVIQANNLLED  63



>ref|XP_011027061.1| PREDICTED: probable protein phosphatase 2C 38 isoform X1 [Populus 
euphratica]
 ref|XP_011027062.1| PREDICTED: probable protein phosphatase 2C 38 isoform X1 [Populus 
euphratica]
 ref|XP_011027063.1| PREDICTED: probable protein phosphatase 2C 38 isoform X1 [Populus 
euphratica]
Length=391

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 46/60 (77%), Gaps = 1/60 (2%)
 Frame = +1

Query  313  SGLMKILRACFCPKGE-RHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLMED  489
            + LM+I+  C+ P  E  +  +G DA GR +GLLWYKD+GQH +GEFSMAV+QANNL+ED
Sbjct  4    TSLMRIVSPCWKPSVEGENSSNGGDAAGRAEGLLWYKDSGQHVNGEFSMAVIQANNLLED  63



>ref|XP_009101943.1| PREDICTED: probable protein phosphatase 2C 64 isoform X2 [Brassica 
rapa]
Length=397

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 41/61 (67%), Gaps = 0/61 (0%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            MLS LM  L AC  P    H +      GRQDGLLWY+D+G H  G+FSMAVVQANNL+E
Sbjct  1    MLSALMNFLNACLWPTRSDHHHHQDGDGGRQDGLLWYRDSGHHVFGDFSMAVVQANNLLE  60

Query  487  D  489
            D
Sbjct  61   D  61



>ref|XP_009101942.1| PREDICTED: probable protein phosphatase 2C 64 isoform X1 [Brassica 
rapa]
Length=405

 Score = 77.0 bits (188),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 41/61 (67%), Gaps = 0/61 (0%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            MLS LM  L AC  P    H +      GRQDGLLWY+D+G H  G+FSMAVVQANNL+E
Sbjct  1    MLSALMNFLNACLWPTRSDHHHHQDGDGGRQDGLLWYRDSGHHVFGDFSMAVVQANNLLE  60

Query  487  D  489
            D
Sbjct  61   D  61



>ref|XP_010253439.1| PREDICTED: probable protein phosphatase 2C 38 [Nelumbo nucifera]
 ref|XP_010253440.1| PREDICTED: probable protein phosphatase 2C 38 [Nelumbo nucifera]
Length=388

 Score = 77.0 bits (188),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 43/59 (73%), Gaps = 2/59 (3%)
 Frame = +1

Query  313  SGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLMED  489
            SG MKI+  C+ P  E       DA+GR DGLLWYKD+G H +GEFSMAV+QANNL+ED
Sbjct  4    SGFMKIVTPCWKPSVEDS--KSGDASGRVDGLLWYKDSGHHVNGEFSMAVIQANNLLED  60



>emb|CDY54807.1| BnaA06g40990D [Brassica napus]
Length=390

 Score = 77.0 bits (188),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 41/61 (67%), Gaps = 0/61 (0%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            MLS LM  L AC  P    H +      GRQDGLLWY+D+G H  G+FSMAVVQANNL+E
Sbjct  1    MLSALMNFLNACLWPTRSDHHHHQDGDGGRQDGLLWYRDSGHHVFGDFSMAVVQANNLLE  60

Query  487  D  489
            D
Sbjct  61   D  61



>ref|XP_002468552.1| hypothetical protein SORBIDRAFT_01g047830 [Sorghum bicolor]
 gb|EER95550.1| hypothetical protein SORBIDRAFT_01g047830 [Sorghum bicolor]
Length=399

 Score = 77.0 bits (188),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 44/62 (71%), Gaps = 1/62 (2%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGER-HVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLM  483
            ML+ +M    +C+ P+    H   GSDA GRQDGLLWYKD GQ  +GEFSMAVVQAN L+
Sbjct  1    MLAAVMDYFSSCWGPRSRAGHRGKGSDAAGRQDGLLWYKDAGQLVTGEFSMAVVQANQLL  60

Query  484  ED  489
            ED
Sbjct  61   ED  62



>gb|EAY88457.1| hypothetical protein OsI_09922 [Oryza sativa Indica Group]
Length=394

 Score = 76.3 bits (186),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 41/57 (72%), Gaps = 1/57 (2%)
 Frame = +1

Query  322  MKILRACFCPKGER-HVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLMED  489
            M   R+C+ P+    H   GSD  GRQDGLLWYKD GQ  +GEFSMAVVQANNL+ED
Sbjct  1    MDYFRSCWGPRSPAGHRVRGSDVAGRQDGLLWYKDAGQLVTGEFSMAVVQANNLLED  57



>ref|XP_003547908.1| PREDICTED: probable protein phosphatase 2C 60-like isoform 1 
[Glycine max]
Length=394

 Score = 76.3 bits (186),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 44/61 (72%), Gaps = 0/61 (0%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            MLS LM  L AC+  +       GS+ TGR++GLLWYKD GQH  GE+SMAVVQANNL+E
Sbjct  1    MLSRLMDFLTACWRRRSFSDGKGGSEVTGRKEGLLWYKDAGQHLFGEYSMAVVQANNLLE  60

Query  487  D  489
            D
Sbjct  61   D  61



>emb|CAB37508.1| putative protein phosphatase-2c [Arabidopsis thaliana]
 emb|CAB80516.1| putative protein phosphatase-2c [Arabidopsis thaliana]
Length=395

 Score = 76.3 bits (186),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 43/56 (77%), Gaps = 0/56 (0%)
 Frame = +1

Query  322  MKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLMED  489
            M  L AC  P+ ++   S SD+ GRQ+GLLW++D+GQH  G+FSMAVVQAN+L+ED
Sbjct  1    MNFLNACLWPRSDQQARSASDSGGRQEGLLWFRDSGQHVFGDFSMAVVQANSLLED  56



>dbj|BAJ95758.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ93286.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=392

 Score = 76.3 bits (186),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 42/63 (67%), Gaps = 2/63 (3%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGER--HVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNL  480
            MLS  M  LR+C+ P          G D  GRQDGLLWYKD GQ  +GEFSMAVVQANNL
Sbjct  1    MLSSAMDYLRSCWGPTSSPDGRPRKGVDVAGRQDGLLWYKDAGQLVAGEFSMAVVQANNL  60

Query  481  MED  489
            +ED
Sbjct  61   LED  63



>gb|AIG52087.1| 2C-type protein phosphatase protein [Zea mays]
Length=399

 Score = 75.9 bits (185),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 44/62 (71%), Gaps = 1/62 (2%)
 Frame = +1

Query  307  MLSGLMKILRACFCPK-GERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLM  483
            ML+ +M    +C+ P+ G  H   G DA GRQDGLLWYKD GQ  +GEFSMAVVQAN L+
Sbjct  1    MLAAVMDYFSSCWGPRSGGGHRGKGPDAAGRQDGLLWYKDAGQLVTGEFSMAVVQANQLL  60

Query  484  ED  489
            ED
Sbjct  61   ED  62



>gb|AAK20060.1|AC025783_20 putative protein phosphatase 2C [Oryza sativa Japonica Group]
Length=388

 Score = 75.9 bits (185),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 37/58 (64%), Positives = 42/58 (72%), Gaps = 2/58 (3%)
 Frame = +1

Query  322  MKILRACFCPKGER--HVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLMED  489
            M+ LR+C+ P          GSDA GRQDGLLWYKD GQ  +GEFSMAVVQANNL+ED
Sbjct  1    MEYLRSCWGPASSPAGRPRKGSDAAGRQDGLLWYKDAGQLVAGEFSMAVVQANNLLED  58



>ref|XP_010558777.1| PREDICTED: probable protein phosphatase 2C 38 [Tarenaya hassleriana]
Length=388

 Score = 75.9 bits (185),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 46/63 (73%), Gaps = 2/63 (3%)
 Frame = +1

Query  307  MLSG-LMKILRACFCPKGE-RHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNL  480
            M+SG  M+I+  C+ P GE  +     D+ GR DGLLWYKD+G H SGEFSMAV+QANNL
Sbjct  1    MVSGSFMRIVSNCWRPSGEGENSTRQGDSNGRIDGLLWYKDSGHHVSGEFSMAVIQANNL  60

Query  481  MED  489
            +ED
Sbjct  61   LED  63



>gb|KJB73662.1| hypothetical protein B456_011G242300 [Gossypium raimondii]
Length=386

 Score = 75.5 bits (184),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/63 (62%), Positives = 46/63 (73%), Gaps = 2/63 (3%)
 Frame = +1

Query  307  MLSG-LMKILRACFCPKGERHVYS-GSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNL  480
            MLSG LM+++  C+ P  E    S G DA GR DGLLWYKD G H +GEFSMAV+QANNL
Sbjct  1    MLSGSLMRMMPPCWRPSVEGEDSSRGDDANGRVDGLLWYKDLGDHVTGEFSMAVIQANNL  60

Query  481  MED  489
            +ED
Sbjct  61   LED  63



>ref|XP_008445826.1| PREDICTED: probable protein phosphatase 2C 38 isoform X2 [Cucumis 
melo]
Length=384

 Score = 75.5 bits (184),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 36/58 (62%), Positives = 44/58 (76%), Gaps = 1/58 (2%)
 Frame = +1

Query  319  LMKILRACFCPKGERHVYS-GSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLMED  489
             MKI+  C+ P  E    S G DA+GR DGLLWYKD+G+H +GEFSMAV+QANNL+ED
Sbjct  6    FMKIVSPCWKPLVEGENSSRGGDASGRVDGLLWYKDSGRHINGEFSMAVIQANNLLED  63



>ref|XP_010101501.1| putative protein phosphatase 2C 38 [Morus notabilis]
 gb|EXB88498.1| putative protein phosphatase 2C 38 [Morus notabilis]
Length=635

 Score = 76.3 bits (186),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 45/62 (73%), Gaps = 1/62 (2%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYS-GSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLM  483
            + + LMKI+ +CF P  E    S G DA  R DGLLWYKD+G+H  G+FSMAVVQANNL+
Sbjct  2    VTATLMKIVSSCFKPSVEEENSSRGGDANDRVDGLLWYKDSGRHVGGDFSMAVVQANNLL  61

Query  484  ED  489
            ED
Sbjct  62   ED  63



>ref|XP_008445820.1| PREDICTED: probable protein phosphatase 2C 38 isoform X1 [Cucumis 
melo]
 ref|XP_008445821.1| PREDICTED: probable protein phosphatase 2C 38 isoform X1 [Cucumis 
melo]
 ref|XP_008445822.1| PREDICTED: probable protein phosphatase 2C 38 isoform X1 [Cucumis 
melo]
 ref|XP_008445823.1| PREDICTED: probable protein phosphatase 2C 38 isoform X1 [Cucumis 
melo]
 ref|XP_008445824.1| PREDICTED: probable protein phosphatase 2C 38 isoform X1 [Cucumis 
melo]
 ref|XP_008445825.1| PREDICTED: probable protein phosphatase 2C 38 isoform X1 [Cucumis 
melo]
Length=389

 Score = 75.1 bits (183),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 36/58 (62%), Positives = 44/58 (76%), Gaps = 1/58 (2%)
 Frame = +1

Query  319  LMKILRACFCPKGERHVYS-GSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLMED  489
             MKI+  C+ P  E    S G DA+GR DGLLWYKD+G+H +GEFSMAV+QANNL+ED
Sbjct  6    FMKIVSPCWKPLVEGENSSRGGDASGRVDGLLWYKDSGRHINGEFSMAVIQANNLLED  63



>ref|XP_008233398.1| PREDICTED: probable protein phosphatase 2C 38 isoform X2 [Prunus 
mume]
Length=385

 Score = 74.7 bits (182),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 34/61 (56%), Positives = 45/61 (74%), Gaps = 2/61 (3%)
 Frame = +1

Query  313  SGLMKILRACFCP--KGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            + LMK++  C+ P  +GE     G D +GR DGLLWYKD+G H +G+FSMAV+QANNL+E
Sbjct  4    TTLMKLVAPCWKPSVEGENSNNRGGDVSGRLDGLLWYKDSGHHVNGDFSMAVIQANNLLE  63

Query  487  D  489
            D
Sbjct  64   D  64



>ref|XP_010526549.1| PREDICTED: probable protein phosphatase 2C 64 [Tarenaya hassleriana]
Length=392

 Score = 74.7 bits (182),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 48/61 (79%), Gaps = 3/61 (5%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            MLSGLM +LRACF P       SGSD+ G+QDGLLWY+D GQH  G+FSMAVVQANNL+E
Sbjct  1    MLSGLMNLLRACFWPSSG---RSGSDSGGQQDGLLWYRDFGQHACGDFSMAVVQANNLLE  57

Query  487  D  489
            D
Sbjct  58   D  58



>ref|XP_002312054.1| serine/threonine protein phosphatase 2C [Populus trichocarpa]
 gb|EEE89421.1| serine/threonine protein phosphatase 2C [Populus trichocarpa]
Length=386

 Score = 74.7 bits (182),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 44/58 (76%), Gaps = 1/58 (2%)
 Frame = +1

Query  319  LMKILRACFCPKGE-RHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLMED  489
            LM+ +  C+ P  E  +  +G DA GR +GLLWYKD+GQH +GEFSMAV+QANNL+ED
Sbjct  6    LMRFVSPCWKPSVEGENSSNGGDAAGRAEGLLWYKDSGQHVNGEFSMAVIQANNLLED  63



>ref|XP_011017023.1| PREDICTED: probable protein phosphatase 2C 38 isoform X3 [Populus 
euphratica]
Length=391

 Score = 74.7 bits (182),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 44/58 (76%), Gaps = 1/58 (2%)
 Frame = +1

Query  319  LMKILRACFCPKGE-RHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLMED  489
            LM+ +  C+ P  E  +  +G DA GR +GLLWYKD+GQH +GEFSMAV+QANNL+ED
Sbjct  6    LMRFVSPCWKPSVEGENSSNGGDAAGRAEGLLWYKDSGQHVNGEFSMAVIQANNLLED  63



>ref|XP_008233397.1| PREDICTED: probable protein phosphatase 2C 38 isoform X1 [Prunus 
mume]
Length=390

 Score = 74.7 bits (182),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 34/61 (56%), Positives = 45/61 (74%), Gaps = 2/61 (3%)
 Frame = +1

Query  313  SGLMKILRACFCP--KGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            + LMK++  C+ P  +GE     G D +GR DGLLWYKD+G H +G+FSMAV+QANNL+E
Sbjct  4    TTLMKLVAPCWKPSVEGENSNNRGGDVSGRLDGLLWYKDSGHHVNGDFSMAVIQANNLLE  63

Query  487  D  489
            D
Sbjct  64   D  64



>ref|XP_011016941.1| PREDICTED: probable protein phosphatase 2C 38 isoform X2 [Populus 
euphratica]
Length=396

 Score = 74.7 bits (182),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 44/58 (76%), Gaps = 1/58 (2%)
 Frame = +1

Query  319  LMKILRACFCPKGE-RHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLMED  489
            LM+ +  C+ P  E  +  +G DA GR +GLLWYKD+GQH +GEFSMAV+QANNL+ED
Sbjct  6    LMRFVSPCWKPSVEGENSSNGGDAAGRAEGLLWYKDSGQHVNGEFSMAVIQANNLLED  63



>ref|XP_004985788.1| PREDICTED: probable protein phosphatase 2C 28-like [Setaria italica]
Length=399

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 44/62 (71%), Gaps = 1/62 (2%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGER-HVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLM  483
            ML+ +M    +C+ P+    H   GSDA GRQ+GLLWYKD GQ  +GEFSMAVVQAN L+
Sbjct  1    MLAAVMDYFSSCWGPRSRAGHRGKGSDAAGRQEGLLWYKDAGQLATGEFSMAVVQANQLL  60

Query  484  ED  489
            ED
Sbjct  61   ED  62



>ref|XP_011016344.1| PREDICTED: probable protein phosphatase 2C 38 isoform X1 [Populus 
euphratica]
 ref|XP_011016863.1| PREDICTED: probable protein phosphatase 2C 38 isoform X1 [Populus 
euphratica]
Length=401

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 44/58 (76%), Gaps = 1/58 (2%)
 Frame = +1

Query  319  LMKILRACFCPKGE-RHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLMED  489
            LM+ +  C+ P  E  +  +G DA GR +GLLWYKD+GQH +GEFSMAV+QANNL+ED
Sbjct  6    LMRFVSPCWKPSVEGENSSNGGDAAGRAEGLLWYKDSGQHVNGEFSMAVIQANNLLED  63



>gb|KHG04682.1| hypothetical protein F383_30115 [Gossypium arboreum]
Length=368

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 46/63 (73%), Gaps = 2/63 (3%)
 Frame = +1

Query  307  MLSG-LMKILRACFCPKGERHVYS-GSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNL  480
            M+SG LM+++  C+ P  E    S G DA GR DGLLWYKD G H +GEFSMAV+QANNL
Sbjct  1    MVSGSLMRMMPPCWRPSVEGEDSSRGDDANGRVDGLLWYKDLGDHVTGEFSMAVIQANNL  60

Query  481  MED  489
            +ED
Sbjct  61   LED  63



>ref|XP_002525065.1| protein phosphatase 2c, putative [Ricinus communis]
 gb|EEF37312.1| protein phosphatase 2c, putative [Ricinus communis]
Length=237

 Score = 72.8 bits (177),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 43/58 (74%), Gaps = 1/58 (2%)
 Frame = +1

Query  319  LMKILRACFCPKGERHVYS-GSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLMED  489
             M+I+  C+ P  E    S G +A+GR DGLLWYKD+G H +GEFSMAV+QANNL+ED
Sbjct  6    FMRIVAPCWKPSVEGENSSRGGEASGRADGLLWYKDSGHHVNGEFSMAVIQANNLLED  63



>ref|XP_004307440.1| PREDICTED: probable protein phosphatase 2C 38 [Fragaria vesca 
subsp. vesca]
Length=385

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 45/60 (75%), Gaps = 4/60 (7%)
 Frame = +1

Query  319  LMKILRACFCP---KGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLMED  489
            LMKI+  C+ P   +GE    +G DA+GR DGLLWYKD G H +GEFSMAV+QANNL+ED
Sbjct  6    LMKIMAPCWRPSVVEGENSNRAG-DASGRVDGLLWYKDLGTHVNGEFSMAVIQANNLLED  64



>ref|XP_002467561.1| hypothetical protein SORBIDRAFT_01g030180 [Sorghum bicolor]
 gb|EER94559.1| hypothetical protein SORBIDRAFT_01g030180 [Sorghum bicolor]
Length=393

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/57 (65%), Positives = 41/57 (72%), Gaps = 1/57 (2%)
 Frame = +1

Query  322  MKILRACFCPKGER-HVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLMED  489
            M  L++C+ P         GSDATGRQDGLLWYKD GQ   GEFSMAVVQANNL+ED
Sbjct  1    MDYLKSCWGPASPAGRPRRGSDATGRQDGLLWYKDGGQVVDGEFSMAVVQANNLLED  57



>ref|XP_007156202.1| hypothetical protein PHAVU_003G266900g [Phaseolus vulgaris]
 gb|ESW28196.1| hypothetical protein PHAVU_003G266900g [Phaseolus vulgaris]
Length=392

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 44/61 (72%), Gaps = 2/61 (3%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            MLS LM  L AC+  +       GS+ TGR++GLLWYKD GQH  GE+SMAVVQANNL+E
Sbjct  1    MLSRLMDFLTACWRRRSSDG--KGSEVTGRKEGLLWYKDAGQHLFGEYSMAVVQANNLLE  58

Query  487  D  489
            D
Sbjct  59   D  59



>ref|XP_002876083.1| hypothetical protein ARALYDRAFT_485488 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52342.1| hypothetical protein ARALYDRAFT_485488 [Arabidopsis lyrata subsp. 
lyrata]
Length=374

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/56 (66%), Positives = 42/56 (75%), Gaps = 2/56 (4%)
 Frame = +1

Query  322  MKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLMED  489
            MK+L AC  P         SD+TG+QDGLLWYKD+GQH  GEFSMAVVQANNL+ED
Sbjct  1    MKLLSACLWPSSSS--GKSSDSTGKQDGLLWYKDSGQHLVGEFSMAVVQANNLLED  54



>ref|NP_001130554.1| protein phosphatase 2C isoform 1 [Zea mays]
 ref|XP_008658019.1| PREDICTED: protein phosphatase 2C isoform 1 isoform X1 [Zea mays]
 gb|ACF78817.1| unknown [Zea mays]
 gb|ACG33728.1| protein phosphatase 2C [Zea mays]
 gb|ACN28452.1| unknown [Zea mays]
 gb|ACN28986.1| unknown [Zea mays]
 gb|ACN36242.1| unknown [Zea mays]
 gb|AFW89613.1| protein phosphatase 2C isoform 1 [Zea mays]
 gb|AFW89614.1| protein phosphatase 2C isoform 2 [Zea mays]
 gb|AFW89615.1| protein phosphatase 2C isoform 3 [Zea mays]
 gb|AIB05669.1| orphans transcription factor, partial [Zea mays]
Length=399

 Score = 73.6 bits (179),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 42/62 (68%), Gaps = 1/62 (2%)
 Frame = +1

Query  307  MLSGLMKILRACFCPKGER-HVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLM  483
            ML+ +M     C+ P+    H   GSDA GRQDGLLWYKD GQ  +G FSMAVVQAN L+
Sbjct  1    MLAAVMDYFSTCWGPRSRAGHRGKGSDAAGRQDGLLWYKDAGQLVTGGFSMAVVQANQLL  60

Query  484  ED  489
            ED
Sbjct  61   ED  62



>ref|XP_008349400.1| PREDICTED: probable protein phosphatase 2C 38 [Malus domestica]
Length=292

 Score = 72.0 bits (175),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 41/57 (72%), Gaps = 0/57 (0%)
 Frame = +1

Query  319  LMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLMED  489
            LMK++  C+ P  E    S  D  GR DGLLW+KD+G H +G+FSMAV+QANNL+ED
Sbjct  6    LMKLVSPCWKPSVEGENSSRGDVIGRIDGLLWHKDSGHHVNGDFSMAVIQANNLLED  62



>gb|EMT14261.1| Putative protein phosphatase 2C 72 [Aegilops tauschii]
Length=387

 Score = 73.2 bits (178),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/58 (62%), Positives = 41/58 (71%), Gaps = 2/58 (3%)
 Frame = +1

Query  322  MKILRACFCPKG--ERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLMED  489
            M  LR+C+ P    +     G DA GRQDGLLWYKD GQ  +GEFSMAVVQANNL+ED
Sbjct  1    MDYLRSCWGPTSSPDGRPRKGVDAAGRQDGLLWYKDAGQLVAGEFSMAVVQANNLLED  58



>gb|EMS63543.1| putative protein phosphatase 2C 72 [Triticum urartu]
Length=387

 Score = 73.2 bits (178),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/58 (62%), Positives = 41/58 (71%), Gaps = 2/58 (3%)
 Frame = +1

Query  322  MKILRACFCPKG--ERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLMED  489
            M  LR+C+ P    +     G DA GRQDGLLWYKD GQ  +GEFSMAVVQANNL+ED
Sbjct  1    MDYLRSCWGPTSSPDGRPRKGVDAAGRQDGLLWYKDAGQLVAGEFSMAVVQANNLLED  58



>gb|KGN50486.1| hypothetical protein Csa_5G177060 [Cucumis sativus]
Length=384

 Score = 72.8 bits (177),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 35/59 (59%), Positives = 45/59 (76%), Gaps = 3/59 (5%)
 Frame = +1

Query  319  LMKILRACFCP--KGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLMED  489
             MKI+  C+ P  +GE     G DA+GR DGLLWYKD+G+H +G+FSMAV+QANNL+ED
Sbjct  6    FMKIVSPCWKPLVEGENSSRDG-DASGRVDGLLWYKDSGRHINGDFSMAVIQANNLLED  63



>gb|KDP46132.1| hypothetical protein JCGZ_06643 [Jatropha curcas]
Length=385

 Score = 72.8 bits (177),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 43/58 (74%), Gaps = 1/58 (2%)
 Frame = +1

Query  319  LMKILRACFCPKGE-RHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLMED  489
            LM+I+  C+ P  E  +     D +GR +GLLWYKD+GQH +GEFSMAV+QANNL+ED
Sbjct  6    LMRIVATCWKPSAEGENSNRCGDTSGRAEGLLWYKDSGQHVNGEFSMAVIQANNLLED  63



>ref|XP_007218123.1| hypothetical protein PRUPE_ppa007029mg [Prunus persica]
 gb|EMJ19322.1| hypothetical protein PRUPE_ppa007029mg [Prunus persica]
Length=385

 Score = 72.8 bits (177),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 45/61 (74%), Gaps = 2/61 (3%)
 Frame = +1

Query  313  SGLMKILRACFCP--KGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLME  486
            + LMK++  C+ P  +GE     G D +GR DGLLW+KD+G H +G+FSMAV+QANNL+E
Sbjct  4    TTLMKLVAPCWKPSVEGENSNNRGGDVSGRLDGLLWHKDSGHHVNGDFSMAVIQANNLLE  63

Query  487  D  489
            D
Sbjct  64   D  64



>ref|XP_004143597.1| PREDICTED: probable protein phosphatase 2C 38-like [Cucumis sativus]
 ref|XP_004163467.1| PREDICTED: probable protein phosphatase 2C 38-like [Cucumis sativus]
Length=389

 Score = 72.8 bits (177),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 35/59 (59%), Positives = 45/59 (76%), Gaps = 3/59 (5%)
 Frame = +1

Query  319  LMKILRACFCP--KGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLMED  489
             MKI+  C+ P  +GE     G DA+GR DGLLWYKD+G+H +G+FSMAV+QANNL+ED
Sbjct  6    FMKIVSPCWKPLVEGENSSRDG-DASGRVDGLLWYKDSGRHINGDFSMAVIQANNLLED  63



>ref|XP_008384321.1| PREDICTED: probable protein phosphatase 2C 38 isoform X2 [Malus 
domestica]
Length=383

 Score = 72.0 bits (175),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 41/57 (72%), Gaps = 0/57 (0%)
 Frame = +1

Query  319  LMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLMED  489
            LMK++  C+ P  E    S  D  GR DGLLW+KD+G H +G+FSMAV+QANNL+ED
Sbjct  6    LMKLVSPCWKPSVEGENSSRGDVIGRIDGLLWHKDSGHHVNGDFSMAVIQANNLLED  62



>gb|ABE77197.1| putative protein phosphatase 2C [Sorghum bicolor]
Length=394

 Score = 72.0 bits (175),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 35/57 (61%), Positives = 40/57 (70%), Gaps = 1/57 (2%)
 Frame = +1

Query  322  MKILRACFCPKGER-HVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLMED  489
            M    +C+ P+    H   GSDA GRQDGLLWYKD GQ  +GEFSMAVVQAN L+ED
Sbjct  1    MDYFSSCWGPRSRAGHRGKGSDAAGRQDGLLWYKDAGQLVTGEFSMAVVQANQLLED  57



>ref|XP_008384320.1| PREDICTED: probable protein phosphatase 2C 38 isoform X1 [Malus 
domestica]
Length=388

 Score = 72.0 bits (175),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 41/57 (72%), Gaps = 0/57 (0%)
 Frame = +1

Query  319  LMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLMED  489
            LMK++  C+ P  E    S  D  GR DGLLW+KD+G H +G+FSMAV+QANNL+ED
Sbjct  6    LMKLVSPCWKPSVEGENSSRGDVIGRIDGLLWHKDSGHHVNGDFSMAVIQANNLLED  62



>gb|KDO67861.1| hypothetical protein CISIN_1g026383mg [Citrus sinensis]
Length=239

 Score = 70.1 bits (170),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 41/59 (69%), Gaps = 3/59 (5%)
 Frame = +1

Query  319  LMKILRACFCP--KGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLMED  489
             MKI+  C+ P  +GE     G D  GR DGLLWYKD+G H SGEFSMAVVQANN +ED
Sbjct  6    FMKIVSPCWKPSTEGENSNSDGED-NGRVDGLLWYKDSGHHVSGEFSMAVVQANNQLED  63



>gb|KDO67862.1| hypothetical protein CISIN_1g026383mg [Citrus sinensis]
 gb|KDO67863.1| hypothetical protein CISIN_1g026383mg [Citrus sinensis]
 gb|KDO67864.1| hypothetical protein CISIN_1g026383mg [Citrus sinensis]
Length=234

 Score = 70.1 bits (170),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 41/59 (69%), Gaps = 3/59 (5%)
 Frame = +1

Query  319  LMKILRACFCP--KGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLMED  489
             MKI+  C+ P  +GE     G D  GR DGLLWYKD+G H SGEFSMAVVQANN +ED
Sbjct  6    FMKIVSPCWKPSTEGENSNSDGED-NGRVDGLLWYKDSGHHVSGEFSMAVVQANNQLED  63



>ref|XP_006436169.1| hypothetical protein CICLE_v10031798mg [Citrus clementina]
 ref|XP_006485971.1| PREDICTED: probable protein phosphatase 2C 38-like isoform X3 
[Citrus sinensis]
 gb|ESR49409.1| hypothetical protein CICLE_v10031798mg [Citrus clementina]
Length=246

 Score = 69.7 bits (169),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 41/59 (69%), Gaps = 3/59 (5%)
 Frame = +1

Query  319  LMKILRACFCP--KGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLMED  489
             MKI+  C+ P  +GE     G D  GR DGLLWYKD+G H SGEFSMAVVQANN +ED
Sbjct  6    FMKIVSPCWKPSTEGENSNSDGED-NGRVDGLLWYKDSGHHVSGEFSMAVVQANNQLED  63



>gb|EPS66771.1| hypothetical protein M569_08005, partial [Genlisea aurea]
Length=373

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/56 (63%), Positives = 41/56 (73%), Gaps = 2/56 (4%)
 Frame = +1

Query  322  MKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLMED  489
            M  L +CF  +      + SD+ G QDGLLWYKD GQHF+GEFSMAVVQANNL+ED
Sbjct  1    MNCLSSCF--RSNSDFRTVSDSGGCQDGLLWYKDLGQHFNGEFSMAVVQANNLLED  54



>ref|XP_002276631.1| PREDICTED: probable protein phosphatase 2C 38 [Vitis vinifera]
Length=387

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 43/58 (74%), Gaps = 1/58 (2%)
 Frame = +1

Query  319  LMKILRACFCPKGERHVYSGS-DATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLMED  489
             MK+++ C+ P  E     G  D++GR DGLLWYKD GQH +GEFSMAV+QAN+L+ED
Sbjct  6    FMKMVKPCWKPSVEGDGTRGKGDSSGRVDGLLWYKDLGQHINGEFSMAVIQANSLLED  63



>emb|CBI32641.3| unnamed protein product [Vitis vinifera]
Length=380

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 42/57 (74%), Gaps = 6/57 (11%)
 Frame = +1

Query  319  LMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLMED  489
             MK+++ C+ P  E       D++GR DGLLWYKD GQH +GEFSMAV+QAN+L+ED
Sbjct  6    FMKMVKPCWKPSVE------GDSSGRVDGLLWYKDLGQHINGEFSMAVIQANSLLED  56



>ref|XP_010658151.1| PREDICTED: probable protein phosphatase 2C 38 isoform X1 [Vitis 
vinifera]
Length=390

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/59 (53%), Positives = 42/59 (71%), Gaps = 0/59 (0%)
 Frame = +1

Query  313  SGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLMED  489
            + LM+I+  C+ P  E       D  GR DGLLWYKD+G+H +G+FSMAV+QANN++ED
Sbjct  4    NSLMRIVAPCWRPSIEGENSGRGDVAGRVDGLLWYKDSGRHVNGDFSMAVIQANNVLED  62



>ref|XP_002281610.1| PREDICTED: probable protein phosphatase 2C 38 isoform X2 [Vitis 
vinifera]
 emb|CBI25323.3| unnamed protein product [Vitis vinifera]
Length=385

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/59 (53%), Positives = 42/59 (71%), Gaps = 0/59 (0%)
 Frame = +1

Query  313  SGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLMED  489
            + LM+I+  C+ P  E       D  GR DGLLWYKD+G+H +G+FSMAV+QANN++ED
Sbjct  4    NSLMRIVAPCWRPSIEGENSGRGDVAGRVDGLLWYKDSGRHVNGDFSMAVIQANNVLED  62



>ref|XP_006292665.1| hypothetical protein CARUB_v10018907mg [Capsella rubella]
 gb|EOA25563.1| hypothetical protein CARUB_v10018907mg [Capsella rubella]
Length=384

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 41/57 (72%), Gaps = 2/57 (4%)
 Frame = +1

Query  325  KILRACFCP--KGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLMED  489
            +I+  C+ P   GE    +  DA GR DGLLWYKD+G H +GEFSMAVVQANN++ED
Sbjct  8    RIVSPCWRPFGIGEDSSPAADDANGRLDGLLWYKDSGNHITGEFSMAVVQANNILED  64



>ref|XP_010260120.1| PREDICTED: probable protein phosphatase 2C 38 isoform X2 [Nelumbo 
nucifera]
Length=374

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/59 (56%), Positives = 42/59 (71%), Gaps = 5/59 (8%)
 Frame = +1

Query  313  SGLMKILRACFCPKGERHVYSGSDATGRQDGLLWYKDTGQHFSGEFSMAVVQANNLMED  489
            SGL+K +  C+ P  E       DA+GR  GLLWYK++G H +GEFSMAV+QANNL+ED
Sbjct  4    SGLLKFVSPCWKPSLE-----DDDASGRAKGLLWYKNSGHHVNGEFSMAVIQANNLLED  57



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 557548962370