BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001O11

Length=515
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AGH32904.1|  translation elongation factor 1-alpha                   290   1e-97   Camellia oleifera [abura-tsubaki]
gb|KJB73625.1|  hypothetical protein B456_011G2412001                   290   2e-97   Gossypium raimondii
gb|KJB73629.1|  hypothetical protein B456_011G2414002                   288   9e-97   Gossypium raimondii
gb|EAY88762.1|  hypothetical protein OsI_10238                          288   1e-96   Oryza sativa Indica Group [Indian rice]
ref|XP_002538495.1|  elongation factor 1-alpha, putative                289   1e-96   Ricinus communis
gb|ACG70967.1|  translation elongation factor 1                         290   2e-96   Ziziphus jujuba [Chinese jujube]
emb|CDY09214.1|  BnaA02g06400D                                          288   2e-96   Brassica napus [oilseed rape]
ref|XP_006307727.1|  hypothetical protein CARUB_v100096371mg            288   2e-96   
gb|AEQ94148.1|  elongation factor 1                                     290   2e-96   Elaeis guineensis
gb|AFW77598.1|  putative translation elongation factor Tu family ...    288   3e-96   
gb|AEG78681.1|  elongation factor 1 alpha                               290   3e-96   Erythroxylum coca [coca]
emb|CDO98621.1|  unnamed protein product                                292   2e-95   Coffea canephora [robusta coffee]
ref|XP_007009762.1|  GTP binding Elongation factor Tu family prot...    292   4e-95   
gb|AFW87115.1|  putative translation elongation factor Tu family ...    288   4e-95   
ref|XP_010248287.1|  PREDICTED: elongation factor 1-alpha               292   5e-95   Nelumbo nucifera [Indian lotus]
gb|AFO67216.1|  putative elongation factor 1-alpha                      289   5e-95   Aralia elata
gb|KDP29085.1|  hypothetical protein JCGZ_16474                         293   6e-95   Jatropha curcas
gb|KCW51623.1|  hypothetical protein EUGRSUZ_J01112                     290   7e-95   Eucalyptus grandis [rose gum]
ref|XP_010542596.1|  PREDICTED: elongation factor 1-alpha-like          294   7e-95   Tarenaya hassleriana [spider flower]
gb|ABA12220.1|  translation elongation factor 1A-4                      294   8e-95   Gossypium hirsutum [American cotton]
ref|XP_008783722.1|  PREDICTED: elongation factor 1-alpha isoform X1    294   8e-95   
gb|ABA12217.1|  translation elongation factor 1A-1                      294   9e-95   Gossypium hirsutum [American cotton]
ref|XP_010557310.1|  PREDICTED: elongation factor 1-alpha-like          294   9e-95   Tarenaya hassleriana [spider flower]
ref|XP_010521772.1|  PREDICTED: elongation factor 1-alpha-like          294   9e-95   Tarenaya hassleriana [spider flower]
ref|XP_010535587.1|  PREDICTED: elongation factor 1-alpha               294   9e-95   Tarenaya hassleriana [spider flower]
gb|AGY80449.1|  elongation factor 1-alpha                               294   9e-95   Dendrocalamus latiflorus [sweet bamboo]
ref|XP_001763198.1|  predicted protein                                  291   9e-95   
ref|NP_001290506.1|  elongation factor 1-alpha                          294   9e-95   Elaeis guineensis
ref|XP_009358244.1|  PREDICTED: elongation factor 1-alpha-like          294   9e-95   Pyrus x bretschneideri [bai li]
ref|XP_010542598.1|  PREDICTED: elongation factor 1-alpha-like          294   1e-94   Tarenaya hassleriana [spider flower]
gb|KHG28979.1|  Elongation factor 1-alpha                               294   1e-94   Gossypium arboreum [tree cotton]
ref|XP_003547695.1|  PREDICTED: elongation factor 1-alpha isoform 2     294   1e-94   Glycine max [soybeans]
ref|XP_008792073.1|  PREDICTED: elongation factor 1-alpha-like          294   1e-94   Phoenix dactylifera
gb|AEK98799.1|  translation elongation factor 1 alfa                    287   1e-94   Carthamus tinctorius
ref|XP_010916901.1|  PREDICTED: elongation factor 1-alpha               293   1e-94   Elaeis guineensis
gb|KHN42761.1|  Elongation factor 1-alpha                               293   1e-94   Glycine soja [wild soybean]
gb|ABA12225.1|  translation elongation factor 1A-9                      294   1e-94   Gossypium hirsutum [American cotton]
ref|XP_003536362.1|  PREDICTED: elongation factor 1-alpha-like is...    293   1e-94   Glycine max [soybeans]
gb|KHG01531.1|  Elongation factor 1-alpha                               293   1e-94   Gossypium arboreum [tree cotton]
ref|NP_001151074.1|  elongation factor 1-alpha                          293   1e-94   
dbj|BAA34348.1|  elongation factor-1 alpha                              293   1e-94   Nicotiana paniculata
ref|XP_010541344.1|  PREDICTED: elongation factor 1-alpha               294   1e-94   Tarenaya hassleriana [spider flower]
gb|KHG26926.1|  Elongation factor 1-alpha                               293   1e-94   Gossypium arboreum [tree cotton]
gb|ABF94275.1|  Elongation factor 1-alpha, putative, expressed          290   1e-94   Oryza sativa Japonica Group [Japonica rice]
gb|AHA84124.1|  elongation factor 1-alpha                               293   1e-94   Phaseolus vulgaris [French bean]
emb|CDP07148.1|  unnamed protein product                                292   1e-94   Coffea canephora [robusta coffee]
gb|ABA12219.1|  translation elongation factor 1A-3                      293   1e-94   Gossypium hirsutum [American cotton]
ref|XP_009762748.1|  PREDICTED: elongation factor 1-alpha-like          293   1e-94   Nicotiana sylvestris
ref|XP_008789061.1|  PREDICTED: elongation factor 1-alpha-like          293   1e-94   Phoenix dactylifera
ref|XP_007151593.1|  hypothetical protein PHAVU_004G060000g             293   1e-94   Phaseolus vulgaris [French bean]
gb|AGI15328.1|  elongation factor 1                                     293   1e-94   Aegiceras corniculatum
gb|KCW65375.1|  hypothetical protein EUGRSUZ_G02807                     293   1e-94   Eucalyptus grandis [rose gum]
ref|XP_010920912.1|  PREDICTED: elongation factor 1-alpha-like          293   1e-94   Elaeis guineensis
ref|XP_008792062.1|  PREDICTED: elongation factor 1-alpha               293   1e-94   Phoenix dactylifera
gb|KHG23927.1|  Elongation factor 1-alpha                               293   1e-94   Gossypium arboreum [tree cotton]
ref|XP_010032224.1|  PREDICTED: elongation factor 1-alpha isoform X3    293   1e-94   
gb|ABA12221.1|  translation elongation factor 1A-5                      293   1e-94   Gossypium hirsutum [American cotton]
ref|XP_011089874.1|  PREDICTED: elongation factor 1-alpha               293   1e-94   Sesamum indicum [beniseed]
ref|XP_003604587.1|  Elongation factor 1-alpha                          293   1e-94   Medicago truncatula
ref|XP_011091454.1|  PREDICTED: elongation factor 1-alpha-like          293   1e-94   Sesamum indicum [beniseed]
ref|XP_011089339.1|  PREDICTED: elongation factor 1-alpha isoform X1    293   1e-94   Sesamum indicum [beniseed]
gb|ABA12223.1|  translation elongation factor 1A-7                      293   1e-94   Gossypium hirsutum [American cotton]
gb|AAX54511.1|  elongation factor 1 alpha                               293   1e-94   Actinidia deliciosa [Chinese gooseberry]
ref|XP_009381507.1|  PREDICTED: elongation factor 1-alpha-like          293   1e-94   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009403064.1|  PREDICTED: elongation factor 1-alpha-like          293   1e-94   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002528028.1|  elongation factor 1-alpha, putative                293   1e-94   
gb|ABA12224.1|  translation elongation factor 1A-8                      293   1e-94   Gossypium hirsutum [American cotton]
ref|XP_009613861.1|  PREDICTED: elongation factor 1-alpha-like          293   1e-94   Nicotiana tomentosiformis
gb|EPS66069.1|  elongation factor 1-alpha                               293   1e-94   Genlisea aurea
ref|XP_010067278.1|  PREDICTED: elongation factor 1-alpha-like          293   1e-94   Eucalyptus grandis [rose gum]
sp|O49169.1|EF1A_MANES  RecName: Full=Elongation factor 1-alpha; ...    293   1e-94   Manihot esculenta [manioc]
ref|XP_006340223.1|  PREDICTED: elongation factor 1-alpha-like          293   1e-94   Solanum tuberosum [potatoes]
ref|XP_002277159.1|  PREDICTED: elongation factor 1-alpha               293   1e-94   Vitis vinifera
ref|XP_010937512.1|  PREDICTED: elongation factor 1-alpha               293   1e-94   Elaeis guineensis
ref|XP_009593325.1|  PREDICTED: elongation factor 1-alpha               293   1e-94   Nicotiana tomentosiformis
ref|XP_011089340.1|  PREDICTED: elongation factor 1-alpha isoform X2    293   1e-94   
ref|XP_007009760.1|  GTP binding Elongation factor Tu family prot...    293   1e-94   Theobroma cacao [chocolate]
ref|XP_010244958.1|  PREDICTED: elongation factor 1-alpha-like          293   1e-94   Nelumbo nucifera [Indian lotus]
ref|XP_010937806.1|  PREDICTED: elongation factor 1-alpha-like          293   1e-94   Elaeis guineensis
ref|XP_004251154.1|  PREDICTED: elongation factor 1-alpha-like          293   1e-94   Solanum lycopersicum
ref|XP_010032221.1|  PREDICTED: elongation factor 1-alpha isoform X1    293   1e-94   Eucalyptus grandis [rose gum]
ref|XP_003604823.1|  Elongation factor 1-alpha                          293   1e-94   
ref|XP_009388387.1|  PREDICTED: elongation factor 1-alpha-like          293   1e-94   Musa acuminata subsp. malaccensis [pisang utan]
gb|AES62210.2|  GTP-binding elongation factor Tu family protein         293   1e-94   Medicago truncatula
gb|KDP29083.1|  hypothetical protein JCGZ_16472                         293   1e-94   Jatropha curcas
ref|XP_002460859.1|  hypothetical protein SORBIDRAFT_02g036420          293   1e-94   Sorghum bicolor [broomcorn]
ref|XP_006846237.1|  hypothetical protein AMTR_s00012p00237190          293   1e-94   Amborella trichopoda
ref|XP_010937804.1|  PREDICTED: elongation factor 1-alpha-like          293   1e-94   Elaeis guineensis
gb|EPS66340.1|  elongation factor 1-alpha                               293   1e-94   Genlisea aurea
ref|XP_004512426.1|  PREDICTED: elongation factor 1-alpha-like          293   1e-94   Cicer arietinum [garbanzo]
gb|ADR70874.1|  eukaryotic translation elongation factor 1-alpha        293   1e-94   Hevea brasiliensis [jebe]
gb|ADR70875.1|  eukaryotic translation elongation factor 1-alpha        293   1e-94   Hevea brasiliensis [jebe]
ref|XP_009403341.1|  PREDICTED: elongation factor 1-alpha-like          293   1e-94   Musa acuminata subsp. malaccensis [pisang utan]
gb|KEH43536.1|  GTP-binding elongation factor Tu family protein         293   2e-94   Medicago truncatula
gb|AFJ04514.1|  elongation factor 1-alpha                               293   2e-94   Vernicia fordii [tung oil tree]
ref|XP_007009751.1|  GTP binding Elongation factor Tu family prot...    293   2e-94   Theobroma cacao [chocolate]
emb|CDP08919.1|  unnamed protein product                                293   2e-94   Coffea canephora [robusta coffee]
ref|XP_006856244.1|  hypothetical protein AMTR_s00059p00216110          293   2e-94   Amborella trichopoda
gb|AHZ58493.1|  translation elongation factor alpha                     293   2e-94   Syntrichia caninervis
gb|AFW90638.1|  elongation factor 1-alpha-like protein                  288   2e-94   Solanum tuberosum [potatoes]
ref|XP_010043711.1|  PREDICTED: elongation factor 1-alpha               293   2e-94   Eucalyptus grandis [rose gum]
gb|AAD56019.1|AF181491_1  elongation factor-1 alpha 2                   293   2e-94   Lilium longiflorum [Easter lily]
ref|XP_010032227.1|  PREDICTED: elongation factor 1-alpha-like          293   2e-94   Eucalyptus grandis [rose gum]
dbj|BAC22125.1|  eukaryotic elongation factor 1A                        293   2e-94   Bruguiera sexangula
ref|XP_010521578.1|  PREDICTED: elongation factor 1-alpha               293   2e-94   Tarenaya hassleriana [spider flower]
gb|ABA12222.1|  translation elongation factor 1A-6                      293   2e-94   Gossypium hirsutum [American cotton]
gb|AAD56020.1|AF181492_1  elongation factor-1 alpha 3                   293   2e-94   Lilium longiflorum [Easter lily]
gb|AES74993.2|  GTP-binding elongation factor Tu family protein         293   2e-94   Medicago truncatula
ref|XP_002279598.1|  PREDICTED: elongation factor 1-alpha               293   2e-94   Vitis vinifera
gb|EEE58429.1|  hypothetical protein OsJ_09630                          292   2e-94   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002284964.1|  PREDICTED: elongation factor 1-alpha               293   3e-94   Vitis vinifera
ref|NP_001077483.1|  elongation factor 1-alpha 2                        290   3e-94   Arabidopsis thaliana [mouse-ear cress]
gb|EYU36203.1|  hypothetical protein MIMGU_mgv1a006301mg                293   3e-94   Erythranthe guttata [common monkey flower]
ref|XP_009342341.1|  PREDICTED: elongation factor 1-alpha               292   3e-94   Pyrus x bretschneideri [bai li]
ref|XP_009617039.1|  PREDICTED: elongation factor 1-alpha               292   3e-94   Nicotiana tomentosiformis
sp|O24534.1|EF1A_VICFA  RecName: Full=Elongation factor 1-alpha; ...    292   3e-94   Vicia faba [broad bean]
ref|NP_001049145.1|  Os03g0177400                                       292   3e-94   
dbj|BAA23658.1|  EF-1 alpha                                             292   4e-94   Oryza sativa [red rice]
ref|XP_006381487.1|  hypothetical protein POPTR_0006s13310g             292   4e-94   Populus trichocarpa [western balsam poplar]
ref|XP_008457229.1|  PREDICTED: elongation factor 1-alpha               292   4e-94   Cucumis melo [Oriental melon]
gb|AAC15413.1|  translation elongation factor-1 alpha                   292   4e-94   Oryza sativa Japonica Group [Japonica rice]
gb|AGH32502.1|  translation elongation factor-1 alpha                   292   4e-94   Stylosanthes guianensis [stylo]
gb|EYU18869.1|  hypothetical protein MIMGU_mgv1a010191mg                288   4e-94   Erythranthe guttata [common monkey flower]
ref|XP_006646939.1|  PREDICTED: elongation factor 1-alpha-like          292   4e-94   Oryza brachyantha
ref|XP_004138964.1|  PREDICTED: elongation factor 1-alpha-like          292   4e-94   Cucumis sativus [cucumbers]
gb|AIZ68131.1|  translation elongation factor 1-alpha                   292   4e-94   Ornithogalum longebracteatum [sea-onion]
gb|ABA12218.1|  translation elongation factor 1A-2                      292   4e-94   Gossypium hirsutum [American cotton]
ref|XP_008463920.1|  PREDICTED: elongation factor 1-alpha               292   5e-94   Cucumis melo [Oriental melon]
gb|KJB09231.1|  hypothetical protein B456_001G130700                    292   5e-94   Gossypium raimondii
ref|XP_003553292.1|  PREDICTED: elongation factor 1-alpha isoform 1     292   5e-94   Glycine max [soybeans]
ref|XP_006424633.1|  hypothetical protein CICLE_v10028443mg             292   5e-94   Citrus clementina [clementine]
gb|KJB76528.1|  hypothetical protein B456_012G093800                    292   5e-94   Gossypium raimondii
dbj|BAO57272.1|  elongation factor 1-alpha                              292   5e-94   Ipomoea nil [qian niu]
gb|KHN14872.1|  Elongation factor 1-alpha                               292   5e-94   Glycine soja [wild soybean]
ref|XP_006424629.1|  hypothetical protein CICLE_v10028446mg             292   5e-94   Citrus clementina [clementine]
gb|AFP44110.1|  elongation factor 1-alpha                               292   5e-94   Lycoris longituba
gb|KHG15275.1|  Elongation factor 1-alpha                               291   5e-94   Gossypium arboreum [tree cotton]
ref|XP_003558459.1|  PREDICTED: elongation factor 1-alpha               292   5e-94   Brachypodium distachyon [annual false brome]
gb|AAD27590.1|AF121261_1  elongation factor 1-alpha 1                   292   5e-94   Lilium longiflorum [Easter lily]
sp|Q03033.1|EF1A_WHEAT  RecName: Full=Elongation factor 1-alpha; ...    292   5e-94   Triticum aestivum [Canadian hard winter wheat]
gb|KHG27341.1|  Elongation factor 1-alpha                               292   5e-94   Gossypium arboreum [tree cotton]
ref|NP_001152668.1|  LOC100286309                                       292   6e-94   Zea mays [maize]
gb|ADI24333.1|  elongation factor 1-alpha                               291   6e-94   Miscanthus sinensis
gb|ABU63160.1|  elongation factor                                       291   6e-94   Saccharum officinarum [noble cane]
ref|XP_004163381.1|  PREDICTED: LOW QUALITY PROTEIN: elongation f...    292   6e-94   
gb|EMS52529.1|  Elongation factor 1-alpha                               291   6e-94   Triticum urartu
ref|XP_001753059.1|  predicted protein                                  291   6e-94   
ref|XP_011004182.1|  PREDICTED: elongation factor 1-alpha-like          291   6e-94   Populus euphratica
ref|NP_001105587.1|  elongation factor 1-alpha                          291   6e-94   Zea mays [maize]
gb|ABB16977.1|  elongation factor 1-alpha-like protein                  287   6e-94   Solanum tuberosum [potatoes]
ref|XP_009421379.1|  PREDICTED: elongation factor 1-alpha-like          291   6e-94   
ref|XP_004149547.1|  PREDICTED: elongation factor 1-alpha-like          291   6e-94   Cucumis sativus [cucumbers]
ref|NP_001105933.1|  elongation factor alpha2                           291   7e-94   
ref|XP_008656153.1|  PREDICTED: elongation factor 1-alpha-like          291   7e-94   Zea mays [maize]
gb|AFC88830.1|  putative elongation factor 1-alpha                      291   7e-94   Miscanthus sinensis
gb|AGT16893.1|  elongation factor 1-alpha                               291   7e-94   Saccharum hybrid cultivar R570
ref|XP_009380678.1|  PREDICTED: elongation factor 1-alpha-like          291   7e-94   
ref|NP_001288465.1|  elongation factor 1-alpha-like                     291   7e-94   Zea mays [maize]
sp|Q41803.1|EF1A_MAIZE  RecName: Full=Elongation factor 1-alpha; ...    291   7e-94   Zea mays [maize]
gb|ACR38047.1|  unknown                                                 291   7e-94   Zea mays [maize]
gb|AAY56337.1|  elongation factor-1 alpha                               291   7e-94   Musa acuminata [banana]
ref|XP_011026991.1|  PREDICTED: elongation factor 1-alpha isoform X1    291   7e-94   Populus euphratica
gb|ACG31866.1|  elongation factor 1-alpha                               291   7e-94   Zea mays [maize]
ref|XP_008656156.1|  PREDICTED: elongation factor 1-alpha-like is...    291   7e-94   Zea mays [maize]
ref|XP_004157309.1|  PREDICTED: elongation factor 1-alpha-like          291   7e-94   
gb|ACG34498.1|  elongation factor 1-alpha                               291   7e-94   Zea mays [maize]
ref|XP_004962249.1|  PREDICTED: elongation factor 1-alpha-like          291   7e-94   
ref|NP_001105934.1|  elongation factor alpha7                           291   7e-94   
gb|AEQ75495.1|  elongation factor 1-alpha                               291   7e-94   Rosa multiflora [Japanese rose]
ref|XP_006417745.1|  hypothetical protein EUTSA_v10007619mg             291   7e-94   Eutrema salsugineum [saltwater cress]
ref|NP_001288407.1|  elongation factor 1-alpha-like                     291   7e-94   Zea mays [maize]
ref|NP_001105617.1|  elongation factor alpha3                           291   7e-94   Zea mays [maize]
gb|AIZ74328.1|  translation elongation factor 1-alpha                   291   7e-94   Pinus massoniana [Chinese red pine]
ref|XP_007143679.1|  hypothetical protein PHAVU_007G092500g             291   7e-94   Phaseolus vulgaris [French bean]
gb|KHG20498.1|  Elongation factor 1-alpha                               291   7e-94   Gossypium arboreum [tree cotton]
ref|XP_007205199.1|  hypothetical protein PRUPE_ppa005718mg             291   7e-94   Prunus persica
ref|XP_009783256.1|  PREDICTED: elongation factor 1-alpha               291   7e-94   Nicotiana sylvestris
ref|XP_001766482.1|  predicted protein                                  291   7e-94   
ref|NP_200847.1|  elongation factor 1-alpha 4                           291   7e-94   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009148045.1|  PREDICTED: elongation factor 1-alpha 1             291   7e-94   Brassica rapa
ref|XP_004962277.1|  PREDICTED: elongation factor 1-alpha-like is...    291   8e-94   Setaria italica
ref|XP_004489551.1|  PREDICTED: elongation factor 1-alpha-like          291   8e-94   Cicer arietinum [garbanzo]
gb|AFW77593.1|  putative translation elongation factor Tu family ...    291   8e-94   
gb|ACS68200.1|  elongation factor 1 alpha                               291   8e-94   Brassica napus [oilseed rape]
ref|XP_008358325.1|  PREDICTED: elongation factor 1-alpha               291   8e-94   Malus domestica [apple tree]
ref|XP_009144204.1|  PREDICTED: elongation factor 1-alpha 1-like        291   8e-94   Brassica rapa
dbj|BAH19898.1|  AT1G07930                                              291   8e-94   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007015463.1|  GTP binding Elongation factor Tu family protein    291   8e-94   
gb|AAL32631.1|  putative elongation factor 1-a                          291   8e-94   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006436251.1|  hypothetical protein CICLE_v10033471mg             291   8e-94   Citrus clementina [clementine]
ref|XP_004309880.1|  PREDICTED: elongation factor 1-alpha               291   8e-94   Fragaria vesca subsp. vesca
gb|AAN31833.1|  putative translation elongation factor eEF-1 alph...    291   8e-94   Arabidopsis thaliana [mouse-ear cress]
gb|KDO48480.1|  hypothetical protein CISIN_1g0132372mg                  291   8e-94   Citrus sinensis [apfelsine]
ref|XP_004984833.1|  PREDICTED: elongation factor 1-alpha-like          291   8e-94   Setaria italica
gb|AAL57653.1|  At1g07930/T6D22_3                                       291   8e-94   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001105565.1|  elongation factor alpha5                           291   8e-94   
ref|XP_006280459.1|  hypothetical protein CARUB_v10026391mg             291   8e-94   Capsella rubella
ref|XP_008380545.1|  PREDICTED: elongation factor 1-alpha-like          291   8e-94   Malus domestica [apple tree]
ref|XP_009126611.1|  PREDICTED: elongation factor 1-alpha 1-like        291   8e-94   Brassica rapa
ref|XP_007015466.1|  GTP binding Elongation factor Tu family prot...    291   8e-94   Theobroma cacao [chocolate]
ref|XP_006858667.1|  hypothetical protein AMTR_s00066p00072310          291   8e-94   Amborella trichopoda
ref|XP_008224543.1|  PREDICTED: elongation factor 1-alpha               291   8e-94   Prunus mume [ume]
ref|XP_010032225.1|  PREDICTED: elongation factor 1-alpha-like          291   9e-94   Eucalyptus grandis [rose gum]
sp|P43643.1|EF1A_TOBAC  RecName: Full=Elongation factor 1-alpha; ...    291   9e-94   Nicotiana tabacum [American tobacco]
dbj|BAM13877.1|  elongation factor 1 alpha                              291   9e-94   Arum maculatum [cuckoo-pint]
ref|XP_001753167.1|  predicted protein                                  291   9e-94   
gb|EMS59091.1|  Elongation factor 1-alpha                               293   9e-94   Triticum urartu
ref|XP_009392715.1|  PREDICTED: elongation factor 1-alpha-like          291   9e-94   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009793830.1|  PREDICTED: elongation factor 1-alpha-like          291   9e-94   Nicotiana sylvestris
ref|XP_011040946.1|  PREDICTED: elongation factor 1-alpha-like is...    291   9e-94   Populus euphratica
ref|XP_009420035.1|  PREDICTED: elongation factor 1-alpha               291   9e-94   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAF99703.1|  elongation factor                                       291   9e-94   Saccharum officinarum [noble cane]
ref|XP_007222129.1|  hypothetical protein PRUPE_ppa005702mg             291   9e-94   Prunus persica
ref|XP_001763194.1|  predicted protein                                  291   9e-94   
ref|XP_004309883.1|  PREDICTED: elongation factor 1-alpha-like          291   1e-93   Fragaria vesca subsp. vesca
ref|XP_004307410.1|  PREDICTED: elongation factor 1-alpha               291   1e-93   Fragaria vesca subsp. vesca
ref|XP_009131916.1|  PREDICTED: elongation factor 1-alpha 1-like        291   1e-93   Brassica rapa
gb|EYU18863.1|  hypothetical protein MIMGU_mgv1a006280mg                291   1e-93   Erythranthe guttata [common monkey flower]
ref|XP_011031783.1|  PREDICTED: elongation factor 1-alpha-like          291   1e-93   Populus euphratica
gb|KDP29086.1|  hypothetical protein JCGZ_16475                         291   1e-93   Jatropha curcas
ref|XP_001753181.1|  predicted protein                                  291   1e-93   
gb|AFQ37422.1|  translation elongation factor-1 alpha 1                 291   1e-93   Larix kaempferi [karamatsu]
ref|NP_001032107.1|  elongation factor 1-alpha 4                        290   1e-93   
gb|ABR17675.1|  unknown                                                 291   1e-93   Picea sitchensis
gb|ACI96243.1|  elongation factor 1-alpha                               291   1e-93   Prunus persica
ref|XP_010032223.1|  PREDICTED: elongation factor 1-alpha isoform X2    291   1e-93   Eucalyptus grandis [rose gum]
ref|XP_011026992.1|  PREDICTED: elongation factor 1-alpha isoform X2    291   1e-93   Populus euphratica
ref|XP_001763201.1|  predicted protein                                  291   1e-93   
ref|XP_008385284.1|  PREDICTED: elongation factor 1-alpha-like          291   1e-93   
ref|XP_006378755.1|  hypothetical protein POPTR_0010s22560g             291   1e-93   
gb|ACN40740.1|  unknown                                                 291   1e-93   Picea sitchensis
ref|XP_008224492.1|  PREDICTED: elongation factor 1-alpha               291   1e-93   Prunus mume [ume]
gb|ABF00115.1|  elongation factor 1-alpha                               291   1e-93   Litchi chinensis [litchi]
gb|AGC94754.1|  elongation factor 1 alpha                               291   1e-93   Euphorbia lathyris
ref|XP_002315287.1|  hypothetical protein POPTR_0010s22620g             291   1e-93   
ref|XP_007207457.1|  hypothetical protein PRUPE_ppa005717mg             291   1e-93   Prunus persica
ref|XP_010456376.1|  PREDICTED: elongation factor 1-alpha 1 isofo...    289   1e-93   
ref|XP_008349743.1|  PREDICTED: elongation factor 1-alpha isoform X2    289   1e-93   
ref|XP_007218005.1|  hypothetical protein PRUPE_ppa005706mg             291   1e-93   Prunus persica
sp|P34823.1|EF1A2_DAUCA  RecName: Full=Elongation factor 1-alpha;...    291   1e-93   Daucus carota [carrots]
gb|ABV26710.1|  elongation factor 1 alpha                               291   1e-93   Gerbera hybrid cultivar
gb|ABB72813.1|  elongation factor 1-alpha-like protein                  291   1e-93   Solanum tuberosum [potatoes]
ref|XP_008233357.1|  PREDICTED: elongation factor 1-alpha-like          291   1e-93   Prunus mume [ume]
ref|XP_006387491.1|  hypothetical protein POPTR_0966s00200g             291   2e-93   Populus trichocarpa [western balsam poplar]
ref|XP_008790814.1|  PREDICTED: elongation factor 1-alpha-like          291   2e-93   Phoenix dactylifera
gb|AEN79476.1|  elongation factor 1-alpha                               290   2e-93   Ziziphus jujuba [Chinese jujube]
ref|XP_002518073.1|  elongation factor 1-alpha, putative                291   2e-93   Ricinus communis
ref|NP_001234035.1|  elongation factor 1-alpha                          290   2e-93   Solanum lycopersicum
ref|NP_001280807.1|  elongation factor 1-alpha-like                     290   2e-93   Malus domestica [apple tree]
gb|AID52924.1|  elongation factor 1-alpha                               290   2e-93   Carthamus tinctorius
gb|AHB86963.1|  elongation factor 1-alpha                               290   2e-93   Sedum alfredii
gb|AAN77897.1|  elongation factor 1 alpha                               290   2e-93   Stevia rebaudiana
ref|XP_010939624.1|  PREDICTED: elongation factor 1-alpha-like          290   2e-93   Elaeis guineensis
ref|XP_006600131.1|  PREDICTED: elongation factor-1A isoform X1         290   2e-93   
dbj|BAC23049.1|  Elongation factor 1-alpha                              290   2e-93   Solanum tuberosum [potatoes]
gb|AAL69396.1|  elongation factor 1-alpha                               290   2e-93   Elaeis oleifera
ref|XP_007151789.1|  hypothetical protein PHAVU_004G075100g             290   2e-93   Phaseolus vulgaris [French bean]
gb|ABB86283.1|  elongation factor-1 alpha-like                          290   2e-93   Solanum tuberosum [potatoes]
gb|ADD71925.1|  translation elongation factor 1 alpha                   289   2e-93   Actaea racemosa
ref|NP_001274875.1|  elongation factor 1-alpha-like protein             290   2e-93   Solanum tuberosum [potatoes]
gb|KHN18669.1|  Elongation factor 1-alpha                               290   2e-93   Glycine soja [wild soybean]
sp|P25698.2|EF1A_SOYBN  RecName: Full=Elongation factor 1-alpha; ...    290   2e-93   Glycine max [soybeans]
ref|NP_001237425.1|  elongation factor-1A                               290   2e-93   
ref|XP_006343452.1|  PREDICTED: elongation factor 1-alpha-like          290   2e-93   Solanum tuberosum [potatoes]
sp|P29521.1|EF1A1_DAUCA  RecName: Full=Elongation factor 1-alpha;...    290   2e-93   Daucus carota [carrots]
emb|CDX95108.1|  BnaC05g05630D                                          291   2e-93   
gb|AGV54713.1|  elongation factor 1-alpha                               290   2e-93   Phaseolus vulgaris [French bean]
ref|XP_009342345.1|  PREDICTED: elongation factor 1-alpha-like          290   2e-93   Pyrus x bretschneideri [bai li]
gb|AIX10769.1|  elongation factor 1 alpha                               290   2e-93   Panax notoginseng [san-qi]
gb|AAR82894.1|  elongation factor 1-alpha                               290   2e-93   Cichorium intybus [radicchio]
gb|AGJ50595.1|  EF1alpha                                                290   2e-93   Pericallis cruenta
dbj|BAL14665.1|  elongation factor 1-alpha                              290   2e-93   Chrysanthemum seticuspe f. boreale
gb|AHE76183.1|  elongation factor 1-alpha                               290   2e-93   Chrysanthemum indicum
gb|AAK32834.1|AF361822_1  At1g07930/T6D22_3                             290   2e-93   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001105935.1|  elongation factor alpha8                           290   3e-93   
emb|CAA34456.1|  elongation factor 1-alpha                              290   3e-93   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009126609.1|  PREDICTED: elongation factor 1-alpha 1-like        290   3e-93   Brassica rapa
gb|AFQ37423.1|  translation elongation factor-1 alpha 2                 290   3e-93   Larix kaempferi [karamatsu]
ref|XP_002311107.1|  ADR12-2 family protein                             290   3e-93   Populus trichocarpa [western balsam poplar]
gb|AAK25877.1|AF360167_1  putative translation elongation factor ...    290   3e-93   
ref|XP_008380544.1|  PREDICTED: elongation factor 1-alpha-like          290   3e-93   
ref|XP_002312029.1|  ADR12-2 family protein                             290   3e-93   
gb|AGI78242.1|  elongation factor 1 alpha                               290   3e-93   
ref|XP_002311106.1|  ADR12-2 family protein                             290   3e-93   
dbj|BAM13874.1|  elongation factor 1 alpha                              290   3e-93   
gb|ABK25072.1|  unknown                                                 290   4e-93   
gb|ACN41180.1|  unknown                                                 290   4e-93   
gb|ABK24843.1|  unknown                                                 290   4e-93   
gb|ABK24265.1|  unknown                                                 290   4e-93   
ref|XP_007027265.1|  GTP binding Elongation factor Tu family protein    293   4e-93   
gb|ABD66517.1|  EF-1 alpha                                              289   5e-93   
dbj|BAC66180.1|  elongation factor 1A                                   289   5e-93   
gb|AES59072.2|  GTP-binding elongation factor Tu family protein         290   6e-93   
ref|XP_003588821.1|  Elongation factor 1-alpha                          290   6e-93   
gb|AGV54654.1|  elongation factor 1-alpha                               289   6e-93   
ref|XP_002968422.1|  hypothetical protein SELMODRAFT_169717             289   7e-93   
ref|XP_002968419.1|  hypothetical protein SELMODRAFT_270693             289   8e-93   
dbj|BAF02151.1|  elongation factor 1-alpha                              288   1e-92   
ref|XP_003591959.1|  Elongation factor 1-alpha                          292   1e-92   
gb|KJB76560.1|  hypothetical protein B456_012G094600                    287   1e-92   
ref|XP_002970583.1|  hypothetical protein SELMODRAFT_171512             288   2e-92   
ref|XP_002970579.1|  hypothetical protein SELMODRAFT_270852             288   2e-92   
gb|EMS49772.1|  Elongation factor 1-alpha                               288   2e-92   
gb|EMT12343.1|  Elongation factor 1-alpha                               288   2e-92   
dbj|BAC22127.1|  eukaryotic elongation factor 1A                        288   2e-92   
gb|ABX82323.1|  elongation factor 1 subunit alpha                       280   2e-92   
ref|XP_010669657.1|  PREDICTED: elongation factor 1-alpha               287   3e-92   
ref|XP_010669658.1|  PREDICTED: elongation factor 1-alpha-like          287   3e-92   
ref|XP_010669660.1|  PREDICTED: elongation factor 1-alpha-like          287   3e-92   
gb|AEE98364.1|  elongation factor 1-alpha                               287   3e-92   
gb|ABF94276.1|  Elongation factor 1-alpha, putative, expressed          287   3e-92   
dbj|BAC22126.1|  eukaryotic elongation factor 1A                        287   5e-92   
gb|AER42621.1|  elongation factor 1 alpha                               286   7e-92   
ref|NP_001104939.1|  elongation factor alpha6                           286   7e-92   
dbj|BAK08744.1|  elongation factor 1-alpha                              286   7e-92   
dbj|BAK08818.1|  elongation factor 1-alpha                              286   8e-92   
dbj|BAK08819.1|  elongation factor 1-alpha                              286   9e-92   
gb|AAL79774.1|AF331849_1  elongation factor 1 alpha                     286   9e-92   
gb|EMS65134.1|  Elongation factor 1-alpha                               291   1e-91   
ref|XP_005650451.1|  translation elongation factor                      285   2e-91   
sp|Q40034.1|EF1A2_HORVU  RecName: Full=Elongation factor 1-alpha;...    285   2e-91   
gb|ACN40081.1|  unknown                                                 285   2e-91   
gb|AAK82537.1|  At1g07930/T6D22_3                                       285   3e-91   
gb|AGD99674.1|  eukaryotic elongation factor 1A                         284   7e-91   
gb|AGF25313.1|  elongation factor 1-alpha                               275   9e-91   
dbj|BAG80668.1|  elongation factor 1 alpha                              281   1e-90   
sp|P34824.1|EF1A1_HORVU  RecName: Full=Elongation factor 1-alpha;...    283   1e-90   
gb|ACN59918.1|  translation elongation factor-1 alpha                   275   1e-90   
gb|AAL79775.1|  elongation factor 1 alpha                               282   3e-90   
ref|XP_003618775.1|  Elongation factor 1-alpha                          293   7e-90   
ref|XP_002892424.1|  T6D22.2                                            293   9e-90   
gb|EMT09703.1|  Elongation factor 1-alpha                               288   1e-89   
emb|CAC27139.1|  translation elongation factor-1 alpha                  280   1e-89   
ref|XP_004143833.1|  PREDICTED: uncharacterized protein LOC101220517    291   2e-89   
emb|CAA65798.1|  EF1-alpha                                              271   2e-89   
gb|AAQ15281.1|  elongation factor 1 alpha                               272   3e-89   
ref|XP_011031813.1|  PREDICTED: LOW QUALITY PROTEIN: HBS1-like pr...    292   4e-89   
emb|CAA68246.1|  factor 1-alpha                                         272   5e-89   
gb|AAF79822.1|AC026875_2  T6D22.2                                       290   8e-89   
gb|AAQ15280.1|  elongation factor 1 alpha                               271   1e-88   
gb|ABC74971.1|  elongation factor 1 alpha                               270   2e-88   
gb|AAR89627.1|  elongation factor 1 alpha                               270   2e-88   
dbj|BAK23239.1|  eukaryotic translation elongation factor 1 alpha       277   3e-88   
ref|XP_002488910.1|  hypothetical protein SORBIDRAFT_2002s002020        268   8e-88   
sp|Q41011.1|EF1A_PEA  RecName: Full=Elongation factor 1-alpha; Sh...    276   9e-88   
gb|AAV71174.1|  elongation factor 1-alpha                               268   1e-87   
gb|AIM48895.1|  elongation factor 1-alpha                               274   2e-87   
ref|XP_004172806.1|  PREDICTED: elongation factor 1-alpha-like          261   2e-86   
gb|AHL28542.1|  elongation factor 1-alpha                               264   4e-86   
ref|XP_009792731.1|  PREDICTED: elongation factor 1-alpha-like          263   9e-86   
gb|AHY22512.1|  elongation factor-1 alpha                               260   1e-85   
ref|NP_001104938.1|  elongation factor 1 alpha                          270   1e-85   
dbj|BAI52945.1|  elongation factor-1 alpha                              259   4e-85   
ref|NP_001275481.1|  elongation factor 1-alpha-like                     269   4e-85   
gb|ADG23121.1|  elongation factor 1-alpha                               258   5e-85   
gb|AFW76433.1|  putative translation elongation factor Tu family ...    258   6e-85   
ref|XP_009793886.1|  PREDICTED: elongation factor 1-alpha-like          261   2e-84   
ref|XP_004413149.1|  PREDICTED: elongation factor 1-alpha 1             257   3e-84   
emb|CAF89665.1|  unnamed protein product                                261   3e-84   
ref|XP_009760439.1|  PREDICTED: elongation factor 1-alpha-like          259   3e-84   
ref|XP_006835853.1|  PREDICTED: elongation factor 1-alpha 1             257   4e-84   
gb|ELK00147.1|  Elongation factor 1-alpha 1                             258   5e-84   
dbj|BAC56481.1|  similar to elongation factor 1 alpha                   256   5e-84   
gb|ABE01138.1|  elongation factor 1-alpha                               261   8e-84   
gb|AAX81595.1|  elongation factor elF1-alpha                            258   8e-84   
gb|AGH70141.1|  eukaryotic translation elongation factor 1 alpha        258   9e-84   
gb|EDL77726.1|  rCG25445, isoform CRA_g                                 258   9e-84   
ref|XP_009490089.1|  PREDICTED: elongation factor 1-alpha 2-like        257   1e-83   
dbj|GAN00818.1|  hypothetical protein MAM1_0002c00242                   257   2e-83   
dbj|BAA76426.1|  translation elongation factor                          254   2e-83   
ref|XP_009435907.1|  PREDICTED: elongation factor 1-alpha 2             258   2e-83   
gb|AAY56745.1|  elongation factor 1-alpha                               256   2e-83   
emb|CAF89666.1|  unnamed protein product                                261   3e-83   
gb|AHL28535.1|  elongation factor 1-alpha                               256   3e-83   
gb|EDL26406.1|  mCG15232, isoform CRA_g                                 258   4e-83   
dbj|BAE48211.1|  elongation factor 1 alpha                              256   4e-83   
ref|XP_855343.2|  PREDICTED: spidroin-2-like                            266   4e-83   
ref|NP_872243.1|  Protein EEF-1A.2, isoform c                           258   5e-83   
gb|ELW50063.1|  Putative elongation factor 1-alpha-like 3               257   5e-83   
ref|XP_003781883.1|  PREDICTED: elongation factor 1-alpha 1-like        255   5e-83   
emb|CCJ09439.1|  elongation factor 1 alpha                              264   6e-83   
gb|AAW65785.1|  translation elongation factor 1 alpha                   254   6e-83   
gb|ACA24136.1|  eukaryotic elongation factor 1-alpha                    261   8e-83   
gb|EDL77725.1|  rCG25445, isoform CRA_f                                 258   8e-83   
gb|EDL77722.1|  rCG25445, isoform CRA_c                                 258   8e-83   
ref|XP_002604722.1|  hypothetical protein BRAFLDRAFT_122567             263   8e-83   
dbj|GAA97923.1|  hypothetical protein E5Q_04603                         265   8e-83   
ref|XP_008329250.1|  PREDICTED: elongation factor 1-alpha-like          263   1e-82   
gb|EDL26403.1|  mCG15232, isoform CRA_d                                 258   1e-82   
ref|XP_011270658.1|  hypothetical protein CAOG_08980                    256   1e-82   
gb|AGM32286.1|  elongation factor 1-alpha                               257   1e-82   
gb|AEE61578.1|  unknown                                                 263   1e-82   
gb|AJC52484.1|  translation elongation factor ef-1 alpha                253   1e-82   
gb|ADN94290.1|  elongation factor 1                                     261   1e-82   
ref|XP_001951287.3|  PREDICTED: elongation factor 1-alpha 2-like        260   1e-82   
ref|XP_008072606.1|  PREDICTED: putative elongation factor 1-alph...    255   2e-82   
ref|XP_011213301.1|  PREDICTED: elongation factor 1-alpha 1             263   2e-82   
dbj|BAJ07356.1|  elongation factor 1                                    254   2e-82   
dbj|BAD35019.1|  elongation factor 1 alpha                              263   2e-82   
ref|XP_002026026.1|  GL10091                                            261   2e-82   
ref|XP_004360206.1|  elongation factor 1 alpha                          262   2e-82   
ref|XP_004074126.1|  PREDICTED: elongation factor 1-alpha               263   2e-82   
ref|XP_006078264.1|  PREDICTED: elongation factor 1-alpha 1-like        256   2e-82   
gb|ADJ18333.1|  elongation factor 1 alpha                               263   2e-82   
gb|ADJ18332.1|  elongation factor 1 alpha                               263   2e-82   
gb|AAL78750.1|  elongation factor-1 alpha                               262   2e-82   
gb|ADI60310.1|  elongation factor 1-alpha                               262   2e-82   
emb|CDP93911.1|  Protein Bm5195, isoform b                              255   2e-82   
gb|ADJ18334.1|  elongation factor 1 alpha                               262   2e-82   
ref|XP_008329251.1|  PREDICTED: elongation factor 1-alpha               262   2e-82   
ref|XP_003284439.1|  elongation factor 1 alpha                          262   2e-82   
gb|EUN23392.1|  hypothetical protein COCVIDRAFT_40940                   262   2e-82   
ref|XP_003968867.1|  PREDICTED: elongation factor 1-alpha-like          262   2e-82   
gb|AAD03711.1|  elongation translation factor 1 alpha                   262   2e-82   
gb|EDL26401.1|  mCG15232, isoform CRA_b                                 258   3e-82   
gb|ELR44723.1|  Elongation factor 1-alpha 2                             262   3e-82   
gb|KFQ31255.1|  Elongation factor 1-alpha 2                             262   3e-82   
dbj|GAM88379.1|  hypothetical protein ANO11243_064120                   262   3e-82   
ref|XP_011194365.1|  PREDICTED: elongation factor 1-alpha 1             262   3e-82   
ref|XP_011502849.1|  PREDICTED: elongation factor 1-alpha               262   3e-82   
ref|NP_001166227.1|  elongation factor 1-alpha                          262   3e-82   
gb|EDL77724.1|  rCG25445, isoform CRA_e                                 258   3e-82   
gb|ESZ89813.1|  elongation factor 1-alpha                               262   3e-82   
gb|AFQ55278.1|  elongation factor 1 alpha                               262   3e-82   
gb|AIY54298.1|  elongation factor 1-alpha                               262   3e-82   
gb|EJW71788.1|  elongation factor 1-alpha                               254   3e-82   
gb|KFM79139.1|  Elongation factor 1-alpha                               255   3e-82   
gb|AAT91089.1|  elongation factor 1-alpha                               262   3e-82   
ref|XP_007703566.1|  hypothetical protein COCSADRAFT_29782              262   3e-82   
gb|AAV84215.1|  elongation factor 1 alpha                               262   3e-82   
ref|XP_004520688.1|  PREDICTED: elongation factor 1-alpha 1-like        262   3e-82   
dbj|BAM18878.1|  elongation factor 1 alpha                              262   3e-82   
dbj|GAM23387.1|  hypothetical protein SAMD00019534_065620               261   3e-82   
gb|ACN10382.1|  Elongation factor 1-alpha, oocyte form                  254   3e-82   
emb|CAA51936.1|  TEF1                                                   254   3e-82   
gb|EWC48307.1|  elongation factor 1-alpha                               262   4e-82   
ref|XP_003696535.1|  PREDICTED: elongation factor 1-alpha-like          262   4e-82   
gb|ABQ81941.1|  elongation factor 1-alpha                               256   4e-82   
ref|XP_011125707.1|  hypothetical protein AOL_s00169g48                 262   4e-82   
ref|NP_524611.1|  elongation factor 1alpha100E, isoform A               262   4e-82   
ref|XP_001930631.1|  elongation factor 1-alpha                          261   4e-82   
gb|EPY50565.1|  translation elongation factor 1-alpha                   258   4e-82   
gb|AJN91132.1|  elongation factor 1-alpha                               261   4e-82   
ref|XP_008182369.1|  PREDICTED: elongation factor 1-alpha               261   4e-82   
ref|XP_002081092.1|  GD10821                                            261   4e-82   
gb|AFK49795.1|  elongation factor 1-alpha                               261   4e-82   
tpg|DAA16277.1|  TPA: EF1a-like protein-like                            257   4e-82   
gb|EGA80598.1|  Tef1p                                                   254   4e-82   
gb|AFO66284.1|  elongation factor-1a                                    261   4e-82   
ref|XP_001948740.2|  PREDICTED: elongation factor 1-alpha-like          261   4e-82   
ref|XP_007295240.1|  putative translation elongation factor 1 alpha     261   4e-82   
ref|XP_003705350.1|  PREDICTED: elongation factor 1-alpha-like          261   5e-82   
ref|NP_001037510.1|  elongation factor 1-alpha                          261   5e-82   
gb|AFQ55277.1|  elongation factor 1 alpha                               261   5e-82   
gb|KDR17161.1|  Elongation factor 1-alpha                               261   5e-82   
ref|XP_006235797.1|  PREDICTED: elongation factor 1-alpha 2 isofo...    262   5e-82   
dbj|BAJ15871.1|  elongation factor 1 alpha                              261   5e-82   
ref|XP_001118614.1|  PREDICTED: elongation factor 1-alpha 1-like        254   5e-82   
ref|XP_003835133.1|  similar to translation elongation factor 1 a...    261   5e-82   
gb|KIW01140.1|  elongation factor 1-alpha                               261   5e-82   
ref|XP_002059330.1|  GJ17887                                            261   5e-82   
ref|XP_011159441.1|  PREDICTED: elongation factor 1-alpha               261   5e-82   
ref|NP_477375.1|  elongation factor 1alpha48D, isoform A                261   5e-82   
ref|XP_006569953.1|  PREDICTED: elongation factor 1-alpha isoform X1    261   5e-82   
dbj|BAJ15870.1|  elongation factor 1 alpha                              261   5e-82   
ref|XP_002091158.1|  GE12389                                            261   5e-82   
ref|NP_001014993.1|  elongation factor 1-alpha                          261   5e-82   
ref|XP_007778858.1|  elongation factor 1-alpha                          261   6e-82   
ref|XP_001594091.1|  elongation factor 1-alpha                          261   6e-82   
ref|XP_001551786.1|  elongation factor 1-alpha                          261   6e-82   
ref|XP_004572773.1|  PREDICTED: elongation factor 1-alpha-like          261   6e-82   
ref|XP_001361821.2|  GA20951                                            261   6e-82   
ref|XP_006639575.1|  PREDICTED: elongation factor 1-alpha 2-like        261   6e-82   
gb|EHL01016.1|  putative Elongation factor 1-alpha                      261   6e-82   
ref|XP_003492701.1|  PREDICTED: elongation factor 1-alpha 1 isofo...    261   6e-82   
ref|XP_002066234.1|  GK22048                                            261   6e-82   
ref|XP_002004478.1|  GI19955                                            261   6e-82   
ref|XP_006872109.1|  PREDICTED: elongation factor 1-alpha 1-like        255   6e-82   
ref|XP_001959909.1|  GF13105                                            261   6e-82   
ref|NP_001098132.1|  elongation factor 1-alpha                          261   6e-82   
ref|XP_006268032.1|  PREDICTED: elongation factor 1-alpha, oocyte...    261   6e-82   
gb|AEO51761.1|  EF-1a                                                   261   6e-82   
gb|EME49524.1|  translation elongation factor 1 alpha-like protein      261   6e-82   
ref|XP_007921049.1|  hypothetical protein MYCFIDRAFT_209593             261   7e-82   
gb|ACV83782.1|  elongation factor 1 alpha                               261   7e-82   
ref|XP_001986652.1|  GH21478                                            261   7e-82   
ref|XP_003401992.1|  PREDICTED: elongation factor 1-alpha 1             261   7e-82   
gb|EMD90278.1|  hypothetical protein COCHEDRAFT_1139445                 261   7e-82   
ref|XP_010351233.1|  PREDICTED: elongation factor 1-alpha               261   7e-82   
dbj|BAE91879.1|  elongation factor 1-alpha                              261   7e-82   
ref|XP_010736036.1|  PREDICTED: elongation factor 1-alpha               261   7e-82   
ref|NP_001032962.1|  elongation factor 1 alpha                          261   7e-82   
ref|XP_011217823.1|  PREDICTED: putative elongation factor 1-alph...    257   7e-82   
ref|XP_006130557.1|  PREDICTED: elongation factor 1-alpha, oocyte...    261   7e-82   
gb|KIV89190.1|  elongation factor 1-alpha                               261   7e-82   
ref|XP_645839.1|  elongation factor 1 alpha                             261   7e-82   
gb|AJG43843.1|  translation elongation factor EF-1 alpha subunit        261   7e-82   
dbj|BAE48214.1|  elongation factor 1 alpha                              253   7e-82   
ref|XP_001964572.1|  GF22982                                            261   8e-82   
gb|KHJ34692.1|  putative elongation factor 1-alpha                      261   8e-82   



>gb|AGH32904.1| translation elongation factor 1-alpha, partial [Camellia oleifera]
Length=149

 Score =   290 bits (743),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 141/141 (100%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>gb|KJB73625.1| hypothetical protein B456_011G2412001, partial [Gossypium raimondii]
Length=144

 Score =   290 bits (742),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 141/141 (100%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>gb|KJB73629.1| hypothetical protein B456_011G2414002, partial [Gossypium raimondii]
Length=154

 Score =   288 bits (738),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGIS+DGQTREHALLAF
Sbjct  121  GGFEAGISRDGQTREHALLAF  141



>gb|EAY88762.1| hypothetical protein OsI_10238 [Oryza sativa Indica Group]
Length=156

 Score =   288 bits (738),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>ref|XP_002538495.1| elongation factor 1-alpha, putative [Ricinus communis]
 gb|EEF23888.1| elongation factor 1-alpha, putative [Ricinus communis]
Length=167

 Score =   289 bits (739),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 139/141 (99%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK+HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKIHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>gb|ACG70967.1| translation elongation factor 1, partial [Ziziphus jujuba]
Length=227

 Score =   290 bits (743),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 141/141 (100%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>emb|CDY09214.1| BnaA02g06400D [Brassica napus]
Length=160

 Score =   288 bits (736),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>ref|XP_006307727.1| hypothetical protein CARUB_v100096371mg, partial [Capsella rubella]
 gb|EOA40625.1| hypothetical protein CARUB_v100096371mg, partial [Capsella rubella]
Length=154

 Score =   288 bits (736),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>gb|AEQ94148.1| elongation factor 1 [Elaeis guineensis]
Length=221

 Score =   290 bits (742),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 141/141 (100%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>gb|AFW77598.1| putative translation elongation factor Tu family protein [Zea 
mays]
Length=167

 Score =   288 bits (736),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>gb|AEG78681.1| elongation factor 1 alpha [Erythroxylum coca]
Length=211

 Score =   290 bits (741),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 141/141 (100%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>emb|CDO98621.1| unnamed protein product [Coffea canephora]
Length=355

 Score =   292 bits (748),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 141/141 (100%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>ref|XP_007009762.1| GTP binding Elongation factor Tu family protein isoform 3, partial 
[Theobroma cacao]
 gb|EOY18572.1| GTP binding Elongation factor Tu family protein isoform 3, partial 
[Theobroma cacao]
Length=367

 Score =   292 bits (747),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 141/141 (100%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>gb|AFW87115.1| putative translation elongation factor Tu family protein isoform 
1 [Zea mays]
 gb|AFW87116.1| putative translation elongation factor Tu family protein isoform 
2 [Zea mays]
 gb|AFW87117.1| putative translation elongation factor Tu family protein isoform 
3 [Zea mays]
 gb|AFW87118.1| putative translation elongation factor Tu family protein isoform 
4 [Zea mays]
 gb|AFW87119.1| putative translation elongation factor Tu family protein isoform 
5 [Zea mays]
Length=255

 Score =   288 bits (737),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>ref|XP_010248287.1| PREDICTED: elongation factor 1-alpha, partial [Nelumbo nucifera]
Length=382

 Score =   292 bits (748),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 141/141 (100%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>gb|AFO67216.1| putative elongation factor 1-alpha, partial [Aralia elata]
Length=287

 Score =   289 bits (739),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>gb|KDP29085.1| hypothetical protein JCGZ_16474 [Jatropha curcas]
Length=418

 Score =   293 bits (751),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 141/141 (100%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>gb|KCW51623.1| hypothetical protein EUGRSUZ_J01112 [Eucalyptus grandis]
Length=330

 Score =   290 bits (743),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>ref|XP_010542596.1| PREDICTED: elongation factor 1-alpha-like [Tarenaya hassleriana]
Length=449

 Score =   294 bits (753),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 141/141 (100%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>gb|ABA12220.1| translation elongation factor 1A-4 [Gossypium hirsutum]
 gb|KJB62497.1| hypothetical protein B456_009G420000 [Gossypium raimondii]
 gb|KJB62498.1| hypothetical protein B456_009G420000 [Gossypium raimondii]
 gb|KJB62499.1| hypothetical protein B456_009G420100 [Gossypium raimondii]
 gb|KJB62500.1| hypothetical protein B456_009G420100 [Gossypium raimondii]
Length=447

 Score =   294 bits (752),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 141/141 (100%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>ref|XP_008783722.1| PREDICTED: elongation factor 1-alpha isoform X1 [Phoenix dactylifera]
Length=447

 Score =   294 bits (752),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 141/141 (100%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>gb|ABA12217.1| translation elongation factor 1A-1 [Gossypium hirsutum]
Length=447

 Score =   294 bits (752),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 141/141 (100%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>ref|XP_010557310.1| PREDICTED: elongation factor 1-alpha-like [Tarenaya hassleriana]
 ref|XP_010557311.1| PREDICTED: elongation factor 1-alpha-like [Tarenaya hassleriana]
Length=449

 Score =   294 bits (752),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 141/141 (100%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>ref|XP_010521772.1| PREDICTED: elongation factor 1-alpha-like [Tarenaya hassleriana]
Length=449

 Score =   294 bits (752),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 141/141 (100%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>ref|XP_010535587.1| PREDICTED: elongation factor 1-alpha [Tarenaya hassleriana]
Length=449

 Score =   294 bits (752),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 141/141 (100%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>gb|AGY80449.1| elongation factor 1-alpha [Dendrocalamus latiflorus]
Length=447

 Score =   294 bits (752),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 141/141 (100%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>ref|XP_001763198.1| predicted protein [Physcomitrella patens]
 gb|EDQ72075.1| predicted protein [Physcomitrella patens]
Length=352

 Score =   291 bits (744),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFET KYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETMKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>ref|NP_001290506.1| elongation factor 1-alpha [Elaeis guineensis]
 ref|XP_010922532.1| PREDICTED: elongation factor 1-alpha [Elaeis guineensis]
 gb|AAT45847.1| elongation factor 1-alpha 1 [Elaeis guineensis]
Length=447

 Score =   294 bits (752),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 141/141 (100%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>ref|XP_009358244.1| PREDICTED: elongation factor 1-alpha-like [Pyrus x bretschneideri]
 ref|XP_009338285.1| PREDICTED: elongation factor 1-alpha-like [Pyrus x bretschneideri]
Length=447

 Score =   294 bits (752),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 141/141 (100%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>ref|XP_010542598.1| PREDICTED: elongation factor 1-alpha-like [Tarenaya hassleriana]
Length=449

 Score =   294 bits (752),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 141/141 (100%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>gb|KHG28979.1| Elongation factor 1-alpha [Gossypium arboreum]
Length=447

 Score =   294 bits (752),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 141/141 (100%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>ref|XP_003547695.1| PREDICTED: elongation factor 1-alpha isoform 2 [Glycine max]
 gb|KHN27573.1| Elongation factor 1-alpha [Glycine soja]
Length=447

 Score =   294 bits (752),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 141/141 (100%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>ref|XP_008792073.1| PREDICTED: elongation factor 1-alpha-like [Phoenix dactylifera]
Length=447

 Score =   294 bits (752),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 141/141 (100%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>gb|AEK98799.1| translation elongation factor 1 alfa [Carthamus tinctorius]
Length=248

 Score =   287 bits (734),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 139/141 (99%), Positives = 139/141 (99%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFET KYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDS T
Sbjct  61   DKLKAERERGITIDIALWKFETNKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSAT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>ref|XP_010916901.1| PREDICTED: elongation factor 1-alpha [Elaeis guineensis]
 ref|XP_010910504.1| PREDICTED: elongation factor 1-alpha [Elaeis guineensis]
Length=447

 Score =   293 bits (751),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 141/141 (100%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>gb|KHN42761.1| Elongation factor 1-alpha [Glycine soja]
Length=447

 Score =   293 bits (751),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 141/141 (100%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>gb|ABA12225.1| translation elongation factor 1A-9 [Gossypium hirsutum]
Length=448

 Score =   294 bits (752),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 141/141 (100%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>ref|XP_003536362.1| PREDICTED: elongation factor 1-alpha-like isoformX2 [Glycine 
max]
 ref|XP_006589439.1| PREDICTED: elongation factor 1-alpha-like isoform X3 [Glycine 
max]
 ref|XP_006589440.1| PREDICTED: elongation factor 1-alpha-like isoform X4 [Glycine 
max]
 gb|KHN17117.1| Elongation factor 1-alpha [Glycine soja]
Length=448

 Score =   293 bits (751),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 141/141 (100%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>gb|KHG01531.1| Elongation factor 1-alpha [Gossypium arboreum]
 gb|KJB63252.1| hypothetical protein B456_010G2044001 [Gossypium raimondii]
Length=447

 Score =   293 bits (751),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 141/141 (100%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>ref|NP_001151074.1| elongation factor 1-alpha [Zea mays]
 gb|ACG41520.1| elongation factor 1-alpha [Zea mays]
 tpg|DAA63136.1| TPA: putative translation elongation factor Tu family protein 
[Zea mays]
Length=447

 Score =   293 bits (751),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 141/141 (100%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>dbj|BAA34348.1| elongation factor-1 alpha [Nicotiana paniculata]
Length=447

 Score =   293 bits (751),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 141/141 (100%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>ref|XP_010541344.1| PREDICTED: elongation factor 1-alpha [Tarenaya hassleriana]
Length=449

 Score =   294 bits (752),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 141/141 (100%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>gb|KHG26926.1| Elongation factor 1-alpha [Gossypium arboreum]
Length=448

 Score =   293 bits (751),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 141/141 (100%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>gb|ABF94275.1| Elongation factor 1-alpha, putative, expressed [Oryza sativa 
Japonica Group]
Length=347

 Score =   290 bits (743),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>gb|AHA84124.1| elongation factor 1-alpha [Phaseolus vulgaris]
Length=447

 Score =   293 bits (751),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 141/141 (100%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>emb|CDP07148.1| unnamed protein product [Coffea canephora]
Length=413

 Score =   292 bits (748),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 141/141 (100%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>gb|ABA12219.1| translation elongation factor 1A-3 [Gossypium hirsutum]
Length=448

 Score =   293 bits (751),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 141/141 (100%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>ref|XP_009762748.1| PREDICTED: elongation factor 1-alpha-like [Nicotiana sylvestris]
Length=447

 Score =   293 bits (751),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 141/141 (100%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>ref|XP_008789061.1| PREDICTED: elongation factor 1-alpha-like [Phoenix dactylifera]
 ref|XP_008789062.1| PREDICTED: elongation factor 1-alpha-like [Phoenix dactylifera]
 ref|XP_008789063.1| PREDICTED: elongation factor 1-alpha-like [Phoenix dactylifera]
Length=447

 Score =   293 bits (751),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 141/141 (100%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>ref|XP_007151593.1| hypothetical protein PHAVU_004G060000g [Phaseolus vulgaris]
 gb|ESW23587.1| hypothetical protein PHAVU_004G060000g [Phaseolus vulgaris]
Length=447

 Score =   293 bits (751),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 141/141 (100%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>gb|AGI15328.1| elongation factor 1 [Aegiceras corniculatum]
Length=449

 Score =   293 bits (751),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 141/141 (100%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>gb|KCW65375.1| hypothetical protein EUGRSUZ_G02807 [Eucalyptus grandis]
Length=428

 Score =   293 bits (750),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 141/141 (100%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>ref|XP_010920912.1| PREDICTED: elongation factor 1-alpha-like [Elaeis guineensis]
Length=447

 Score =   293 bits (751),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 141/141 (100%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>ref|XP_008792062.1| PREDICTED: elongation factor 1-alpha [Phoenix dactylifera]
Length=447

 Score =   293 bits (751),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 141/141 (100%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>gb|KHG23927.1| Elongation factor 1-alpha [Gossypium arboreum]
Length=449

 Score =   293 bits (751),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 141/141 (100%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>ref|XP_010032224.1| PREDICTED: elongation factor 1-alpha isoform X3 [Eucalyptus grandis]
Length=447

 Score =   293 bits (751),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 141/141 (100%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>gb|ABA12221.1| translation elongation factor 1A-5 [Gossypium hirsutum]
Length=448

 Score =   293 bits (751),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 141/141 (100%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>ref|XP_011089874.1| PREDICTED: elongation factor 1-alpha [Sesamum indicum]
Length=449

 Score =   293 bits (751),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 141/141 (100%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>ref|XP_003604587.1| Elongation factor 1-alpha [Medicago truncatula]
 gb|AES86784.1| GTP-binding elongation factor Tu family protein [Medicago truncatula]
Length=447

 Score =   293 bits (751),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 141/141 (100%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>ref|XP_011091454.1| PREDICTED: elongation factor 1-alpha-like [Sesamum indicum]
Length=449

 Score =   293 bits (751),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 141/141 (100%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>ref|XP_011089339.1| PREDICTED: elongation factor 1-alpha isoform X1 [Sesamum indicum]
 ref|XP_011089346.1| PREDICTED: elongation factor 1-alpha-like [Sesamum indicum]
Length=449

 Score =   293 bits (751),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 141/141 (100%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>gb|ABA12223.1| translation elongation factor 1A-7 [Gossypium hirsutum]
Length=448

 Score =   293 bits (751),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 141/141 (100%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>gb|AAX54511.1| elongation factor 1 alpha [Actinidia deliciosa]
Length=447

 Score =   293 bits (751),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 141/141 (100%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>ref|XP_009381507.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009381508.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009381509.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
Length=447

 Score =   293 bits (751),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 141/141 (100%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>ref|XP_009403064.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
Length=447

 Score =   293 bits (751),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 141/141 (100%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>ref|XP_002528028.1| elongation factor 1-alpha, putative [Ricinus communis]
 gb|EEF34346.1| elongation factor 1-alpha, putative [Ricinus communis]
Length=449

 Score =   293 bits (751),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 141/141 (100%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>gb|ABA12224.1| translation elongation factor 1A-8 [Gossypium hirsutum]
Length=449

 Score =   293 bits (751),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 141/141 (100%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>ref|XP_009613861.1| PREDICTED: elongation factor 1-alpha-like [Nicotiana tomentosiformis]
 ref|XP_009626606.1| PREDICTED: elongation factor 1-alpha-like [Nicotiana tomentosiformis]
 ref|XP_009597916.1| PREDICTED: elongation factor 1-alpha-like [Nicotiana tomentosiformis]
Length=447

 Score =   293 bits (751),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 141/141 (100%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>gb|EPS66069.1| elongation factor 1-alpha, partial [Genlisea aurea]
Length=446

 Score =   293 bits (751),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 141/141 (100%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>ref|XP_010067278.1| PREDICTED: elongation factor 1-alpha-like [Eucalyptus grandis]
Length=447

 Score =   293 bits (751),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 141/141 (100%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>sp|O49169.1|EF1A_MANES RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha [Manihot 
esculenta]
 gb|AAC39447.1| elongation factor 1-alpha [Manihot esculenta]
Length=449

 Score =   293 bits (751),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 141/141 (100%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>ref|XP_006340223.1| PREDICTED: elongation factor 1-alpha-like [Solanum tuberosum]
Length=447

 Score =   293 bits (751),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 141/141 (100%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>ref|XP_002277159.1| PREDICTED: elongation factor 1-alpha [Vitis vinifera]
 ref|XP_010658430.1| PREDICTED: elongation factor 1-alpha [Vitis vinifera]
 emb|CAN76417.1| hypothetical protein VITISV_018410 [Vitis vinifera]
 emb|CAN69000.1| hypothetical protein VITISV_022484 [Vitis vinifera]
Length=447

 Score =   293 bits (751),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 141/141 (100%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>ref|XP_010937512.1| PREDICTED: elongation factor 1-alpha [Elaeis guineensis]
Length=447

 Score =   293 bits (751),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 141/141 (100%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>ref|XP_009593325.1| PREDICTED: elongation factor 1-alpha [Nicotiana tomentosiformis]
Length=447

 Score =   293 bits (751),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 141/141 (100%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>ref|XP_011089340.1| PREDICTED: elongation factor 1-alpha isoform X2 [Sesamum indicum]
 ref|XP_011089341.1| PREDICTED: elongation factor 1-alpha isoform X3 [Sesamum indicum]
 ref|XP_011089342.1| PREDICTED: elongation factor 1-alpha isoform X4 [Sesamum indicum]
 ref|XP_011089875.1| PREDICTED: elongation factor 1-alpha [Sesamum indicum]
Length=449

 Score =   293 bits (751),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 141/141 (100%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>ref|XP_007009760.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
 ref|XP_007009761.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
 gb|EOY18570.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
 gb|EOY18571.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
Length=449

 Score =   293 bits (751),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 141/141 (100%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>ref|XP_010244958.1| PREDICTED: elongation factor 1-alpha-like [Nelumbo nucifera]
 ref|XP_010244959.1| PREDICTED: elongation factor 1-alpha-like [Nelumbo nucifera]
Length=449

 Score =   293 bits (751),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 141/141 (100%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>ref|XP_010937806.1| PREDICTED: elongation factor 1-alpha-like [Elaeis guineensis]
Length=447

 Score =   293 bits (751),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 141/141 (100%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>ref|XP_004251154.1| PREDICTED: elongation factor 1-alpha-like [Solanum lycopersicum]
Length=447

 Score =   293 bits (751),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 141/141 (100%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>ref|XP_010032221.1| PREDICTED: elongation factor 1-alpha isoform X1 [Eucalyptus grandis]
 ref|XP_010032222.1| PREDICTED: elongation factor 1-alpha isoform X1 [Eucalyptus grandis]
Length=449

 Score =   293 bits (751),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 141/141 (100%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>ref|XP_003604823.1| Elongation factor 1-alpha [Medicago truncatula]
Length=448

 Score =   293 bits (751),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 141/141 (100%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>ref|XP_009388387.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
Length=447

 Score =   293 bits (751),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 141/141 (100%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>gb|AES62210.2| GTP-binding elongation factor Tu family protein [Medicago truncatula]
 gb|KEH43534.1| GTP-binding elongation factor Tu family protein [Medicago truncatula]
Length=448

 Score =   293 bits (751),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 141/141 (100%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>gb|KDP29083.1| hypothetical protein JCGZ_16472 [Jatropha curcas]
Length=447

 Score =   293 bits (751),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 141/141 (100%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>ref|XP_002460859.1| hypothetical protein SORBIDRAFT_02g036420 [Sorghum bicolor]
 gb|EER97380.1| hypothetical protein SORBIDRAFT_02g036420 [Sorghum bicolor]
Length=447

 Score =   293 bits (751),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 141/141 (100%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>ref|XP_006846237.1| hypothetical protein AMTR_s00012p00237190 [Amborella trichopoda]
 gb|ERN07912.1| hypothetical protein AMTR_s00012p00237190 [Amborella trichopoda]
Length=447

 Score =   293 bits (750),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 141/141 (100%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>ref|XP_010937804.1| PREDICTED: elongation factor 1-alpha-like [Elaeis guineensis]
 ref|XP_010937805.1| PREDICTED: elongation factor 1-alpha-like [Elaeis guineensis]
Length=447

 Score =   293 bits (750),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 141/141 (100%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>gb|EPS66340.1| elongation factor 1-alpha, partial [Genlisea aurea]
Length=441

 Score =   293 bits (750),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 141/141 (100%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>ref|XP_004512426.1| PREDICTED: elongation factor 1-alpha-like [Cicer arietinum]
 ref|XP_004512427.1| PREDICTED: elongation factor 1-alpha-like [Cicer arietinum]
Length=448

 Score =   293 bits (751),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 141/141 (100%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>gb|ADR70874.1| eukaryotic translation elongation factor 1-alpha [Hevea brasiliensis]
Length=449

 Score =   293 bits (751),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 141/141 (100%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>gb|ADR70875.1| eukaryotic translation elongation factor 1-alpha [Hevea brasiliensis]
Length=449

 Score =   293 bits (751),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 141/141 (100%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>ref|XP_009403341.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
Length=447

 Score =   293 bits (750),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 141/141 (100%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>gb|KEH43536.1| GTP-binding elongation factor Tu family protein [Medicago truncatula]
Length=448

 Score =   293 bits (750),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 141/141 (100%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>gb|AFJ04514.1| elongation factor 1-alpha, partial [Vernicia fordii]
Length=438

 Score =   293 bits (750),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 141/141 (100%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>ref|XP_007009751.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
 ref|XP_007009752.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
 gb|EOY18561.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
 gb|EOY18562.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
Length=449

 Score =   293 bits (750),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 141/141 (100%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>emb|CDP08919.1| unnamed protein product [Coffea canephora]
Length=432

 Score =   293 bits (749),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 141/141 (100%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>ref|XP_006856244.1| hypothetical protein AMTR_s00059p00216110 [Amborella trichopoda]
 gb|ERN17711.1| hypothetical protein AMTR_s00059p00216110 [Amborella trichopoda]
Length=447

 Score =   293 bits (750),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 141/141 (100%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>gb|AHZ58493.1| translation elongation factor alpha [Syntrichia caninervis]
Length=447

 Score =   293 bits (750),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 141/141 (100%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>gb|AFW90638.1| elongation factor 1-alpha-like protein [Solanum tuberosum]
Length=309

 Score =   288 bits (738),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 139/141 (99%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK+HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKIHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>ref|XP_010043711.1| PREDICTED: elongation factor 1-alpha [Eucalyptus grandis]
 gb|KCW85696.1| hypothetical protein EUGRSUZ_B02473 [Eucalyptus grandis]
Length=449

 Score =   293 bits (750),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 141/141 (100%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>gb|AAD56019.1|AF181491_1 elongation factor-1 alpha 2 [Lilium longiflorum]
Length=447

 Score =   293 bits (750),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCA+LIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAILIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>ref|XP_010032227.1| PREDICTED: elongation factor 1-alpha-like [Eucalyptus grandis]
 gb|KCW51630.1| hypothetical protein EUGRSUZ_J01121 [Eucalyptus grandis]
Length=447

 Score =   293 bits (750),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCA+LIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAILIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>dbj|BAC22125.1| eukaryotic elongation factor 1A [Bruguiera sexangula]
Length=449

 Score =   293 bits (750),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK+HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKIHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>ref|XP_010521578.1| PREDICTED: elongation factor 1-alpha [Tarenaya hassleriana]
Length=449

 Score =   293 bits (750),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 141/141 (100%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>gb|ABA12222.1| translation elongation factor 1A-6 [Gossypium hirsutum]
 gb|KHG08414.1| Elongation factor 1-alpha [Gossypium arboreum]
 gb|KJB16823.1| hypothetical protein B456_002G249600 [Gossypium raimondii]
 gb|KJB16824.1| hypothetical protein B456_002G249600 [Gossypium raimondii]
 gb|KJB16825.1| hypothetical protein B456_002G249600 [Gossypium raimondii]
Length=447

 Score =   293 bits (749),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHIN+VVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINLVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>gb|AAD56020.1|AF181492_1 elongation factor-1 alpha 3 [Lilium longiflorum]
Length=447

 Score =   293 bits (749),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCA+LIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAILIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>gb|AES74993.2| GTP-binding elongation factor Tu family protein [Medicago truncatula]
 gb|KEH25376.1| GTP-binding elongation factor Tu family protein [Medicago truncatula]
Length=447

 Score =   293 bits (749),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK+HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKIHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>ref|XP_002279598.1| PREDICTED: elongation factor 1-alpha [Vitis vinifera]
 emb|CAN66350.1| hypothetical protein VITISV_044270 [Vitis vinifera]
Length=447

 Score =   293 bits (749),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 141/141 (100%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>gb|EEE58429.1| hypothetical protein OsJ_09630 [Oryza sativa Japonica Group]
Length=427

 Score =   292 bits (747),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>ref|XP_002284964.1| PREDICTED: elongation factor 1-alpha [Vitis vinifera]
 ref|XP_002284924.1| PREDICTED: elongation factor 1-alpha [Vitis vinifera]
 ref|XP_010651131.1| PREDICTED: elongation factor 1-alpha [Vitis vinifera]
 emb|CAN64511.1| hypothetical protein VITISV_035691 [Vitis vinifera]
Length=447

 Score =   293 bits (749),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETT+YYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTRYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>ref|NP_001077483.1| elongation factor 1-alpha 2 [Arabidopsis thaliana]
 gb|AEE28214.1| Elongation factor 1-alpha [Arabidopsis thaliana]
Length=372

 Score =   290 bits (742),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>gb|EYU36203.1| hypothetical protein MIMGU_mgv1a006301mg [Erythranthe guttata]
Length=449

 Score =   293 bits (749),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 141/141 (100%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>ref|XP_009342341.1| PREDICTED: elongation factor 1-alpha [Pyrus x bretschneideri]
Length=447

 Score =   292 bits (748),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETT+YYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTRYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>ref|XP_009617039.1| PREDICTED: elongation factor 1-alpha [Nicotiana tomentosiformis]
Length=447

 Score =   292 bits (748),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETT+YYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTRYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>sp|O24534.1|EF1A_VICFA RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha [Vicia 
faba]
 emb|CAA10847.1| elongation factor 1-alpha (EF1-a) [Vicia faba]
Length=447

 Score =   292 bits (748),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFET+KYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETSKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>ref|NP_001049145.1| Os03g0177400 [Oryza sativa Japonica Group]
 ref|NP_001049146.1| Os03g0177500 [Oryza sativa Japonica Group]
 ref|NP_001049147.1| Os03g0177900 [Oryza sativa Japonica Group]
 ref|NP_001049148.1| Os03g0178000 [Oryza sativa Japonica Group]
 ref|XP_006649493.1| PREDICTED: elongation factor 1-alpha-like [Oryza brachyantha]
 ref|XP_006649494.1| PREDICTED: elongation factor 1-alpha-like [Oryza brachyantha]
 sp|O64937.2|EF1A_ORYSJ RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha [Oryza 
sativa Japonica Group]
 dbj|BAA23657.1| EF-1 alpha [Oryza sativa]
 dbj|BAA23659.1| EF-1 alpha [Oryza sativa]
 dbj|BAA23660.1| EF-1 alpha [Oryza sativa]
 gb|ABF94269.1| Elongation factor 1-alpha, putative [Oryza sativa Japonica Group]
 gb|ABF94270.1| Elongation factor 1-alpha, putative, expressed [Oryza sativa 
Japonica Group]
 gb|ABF94273.1| Elongation factor 1-alpha, putative, expressed [Oryza sativa 
Japonica Group]
 gb|ABF94274.1| Elongation factor 1-alpha, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF11059.1| Os03g0177400 [Oryza sativa Japonica Group]
 dbj|BAF11060.1| Os03g0177500 [Oryza sativa Japonica Group]
 dbj|BAF11061.1| Os03g0177900 [Oryza sativa Japonica Group]
 dbj|BAF11062.1| Os03g0178000 [Oryza sativa Japonica Group]
 gb|EAZ25788.1| hypothetical protein OsJ_09631 [Oryza sativa Japonica Group]
 gb|EAZ25791.1| hypothetical protein OsJ_09634 [Oryza sativa Japonica Group]
 gb|EAZ25792.1| hypothetical protein OsJ_09635 [Oryza sativa Japonica Group]
 dbj|BAG87945.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG93078.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97075.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC74621.1| hypothetical protein OsI_10237 [Oryza sativa Indica Group]
 gb|EEC74622.1| hypothetical protein OsI_10241 [Oryza sativa Indica Group]
 gb|EEC74623.1| hypothetical protein OsI_10242 [Oryza sativa Indica Group]
 gb|ADM86871.1| elongation factor-1 alpha [Oryza sativa Japonica Group]
 gb|ADM86885.1| elongation factor-1 alpha [Oryza sativa Japonica Group]
 gb|ADM86886.1| elongation factor-1 alpha [Oryza sativa Japonica Group]
 gb|ADM86887.1| elongation factor-1 alpha [Oryza sativa Japonica Group]
Length=447

 Score =   292 bits (748),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>dbj|BAA23658.1| EF-1 alpha [Oryza sativa]
Length=447

 Score =   292 bits (748),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>ref|XP_006381487.1| hypothetical protein POPTR_0006s13310g [Populus trichocarpa]
 gb|ABK95720.1| unknown [Populus trichocarpa]
 gb|ERP59284.1| hypothetical protein POPTR_0006s13310g [Populus trichocarpa]
Length=447

 Score =   292 bits (748),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETT+YYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTRYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>ref|XP_008457229.1| PREDICTED: elongation factor 1-alpha [Cucumis melo]
Length=447

 Score =   292 bits (748),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>gb|AAC15413.1| translation elongation factor-1 alpha [Oryza sativa Japonica 
Group]
Length=447

 Score =   292 bits (748),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>gb|AGH32502.1| translation elongation factor-1 alpha [Stylosanthes guianensis]
Length=447

 Score =   292 bits (748),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>gb|EYU18869.1| hypothetical protein MIMGU_mgv1a010191mg [Erythranthe guttata]
 gb|EYU18870.1| hypothetical protein MIMGU_mgv1a010191mg [Erythranthe guttata]
Length=319

 Score =   288 bits (737),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>ref|XP_006646939.1| PREDICTED: elongation factor 1-alpha-like [Oryza brachyantha]
Length=447

 Score =   292 bits (748),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>ref|XP_004138964.1| PREDICTED: elongation factor 1-alpha-like [Cucumis sativus]
 ref|XP_004162426.1| PREDICTED: elongation factor 1-alpha-like [Cucumis sativus]
Length=447

 Score =   292 bits (747),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>gb|AIZ68131.1| translation elongation factor 1-alpha [Ornithogalum saundersiae]
Length=447

 Score =   292 bits (747),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>gb|ABA12218.1| translation elongation factor 1A-2 [Gossypium hirsutum]
 gb|KHG05237.1| Elongation factor 1-alpha [Gossypium arboreum]
 gb|KJB14364.1| hypothetical protein B456_002G121500 [Gossypium raimondii]
Length=447

 Score =   292 bits (747),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>ref|XP_008463920.1| PREDICTED: elongation factor 1-alpha [Cucumis melo]
Length=448

 Score =   292 bits (747),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKAHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>gb|KJB09231.1| hypothetical protein B456_001G130700 [Gossypium raimondii]
 gb|KJB09232.1| hypothetical protein B456_001G130700 [Gossypium raimondii]
Length=447

 Score =   292 bits (747),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>ref|XP_003553292.1| PREDICTED: elongation factor 1-alpha isoform 1 [Glycine max]
Length=447

 Score =   292 bits (747),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>ref|XP_006424633.1| hypothetical protein CICLE_v10028443mg [Citrus clementina]
 ref|XP_006488149.1| PREDICTED: elongation factor 1-alpha-like [Citrus sinensis]
 gb|ESR37873.1| hypothetical protein CICLE_v10028443mg [Citrus clementina]
Length=447

 Score =   292 bits (747),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>gb|KJB76528.1| hypothetical protein B456_012G093800 [Gossypium raimondii]
Length=449

 Score =   292 bits (747),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>dbj|BAO57272.1| elongation factor 1-alpha [Ipomoea nil]
Length=447

 Score =   292 bits (747),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>gb|KHN14872.1| Elongation factor 1-alpha [Glycine soja]
Length=447

 Score =   292 bits (747),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>ref|XP_006424629.1| hypothetical protein CICLE_v10028446mg [Citrus clementina]
 ref|XP_006424632.1| hypothetical protein CICLE_v10028445mg [Citrus clementina]
 ref|XP_006488147.1| PREDICTED: elongation factor 1-alpha isoform X1 [Citrus sinensis]
 ref|XP_006488148.1| PREDICTED: elongation factor 1-alpha-like [Citrus sinensis]
 gb|ESR37869.1| hypothetical protein CICLE_v10028446mg [Citrus clementina]
 gb|ESR37872.1| hypothetical protein CICLE_v10028445mg [Citrus clementina]
Length=447

 Score =   292 bits (747),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>gb|AFP44110.1| elongation factor 1-alpha [Lycoris longituba]
Length=447

 Score =   292 bits (747),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>gb|KHG15275.1| Elongation factor 1-alpha [Gossypium arboreum]
Length=431

 Score =   291 bits (745),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>ref|XP_003558459.1| PREDICTED: elongation factor 1-alpha [Brachypodium distachyon]
 ref|XP_003577316.1| PREDICTED: elongation factor 1-alpha [Brachypodium distachyon]
 ref|XP_003581689.1| PREDICTED: elongation factor 1-alpha [Brachypodium distachyon]
 ref|XP_010228997.1| PREDICTED: elongation factor 1-alpha [Brachypodium distachyon]
 ref|XP_010228998.1| PREDICTED: elongation factor 1-alpha [Brachypodium distachyon]
Length=447

 Score =   292 bits (747),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>gb|AAD27590.1|AF121261_1 elongation factor 1-alpha 1 [Lilium longiflorum]
Length=447

 Score =   292 bits (747),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETT+YYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTRYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>sp|Q03033.1|EF1A_WHEAT RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha [Triticum 
aestivum]
 gb|AAA34306.1| translation elongation factor 1 alpha-subunit [Triticum aestivum]
 emb|CAA90651.1| elongation factor 1-alpha [Hordeum vulgare subsp. vulgare]
 dbj|BAJ85443.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ87634.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gb|EMT04563.1| Elongation factor 1-alpha [Aegilops tauschii]
 gb|EMT21642.1| Elongation factor 1-alpha [Aegilops tauschii]
 gb|EMT30905.1| Elongation factor 1-alpha [Aegilops tauschii]
Length=447

 Score =   292 bits (747),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>gb|KHG27341.1| Elongation factor 1-alpha [Gossypium arboreum]
Length=449

 Score =   292 bits (747),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>ref|NP_001152668.1| LOC100286309 [Zea mays]
 ref|XP_008647989.1| PREDICTED: LOC100286309 isoform X1 [Zea mays]
 gb|ACG48827.1| elongation factor 1-alpha [Zea mays]
 gb|AFW76430.1| putative translation elongation factor Tu family protein isoform 
1 [Zea mays]
 gb|AFW76431.1| putative translation elongation factor Tu family protein isoform 
2 [Zea mays]
 gb|AFW76432.1| putative translation elongation factor Tu family protein isoform 
3 [Zea mays]
Length=447

 Score =   292 bits (747),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>gb|ADI24333.1| elongation factor 1-alpha [Miscanthus sinensis]
Length=447

 Score =   291 bits (746),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>gb|ABU63160.1| elongation factor [Saccharum officinarum]
 gb|AGT15989.1| elongation factor 1-alpha [Saccharum hybrid cultivar R570]
 gb|AGT15990.1| elongation factor 1-alpha [Saccharum hybrid cultivar R570]
 gb|AGT16629.1| elongation factor 1 alpha [Saccharum hybrid cultivar R570]
Length=447

 Score =   291 bits (746),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>ref|XP_004163381.1| PREDICTED: LOW QUALITY PROTEIN: elongation factor 1-alpha-like 
[Cucumis sativus]
Length=449

 Score =   292 bits (747),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>gb|EMS52529.1| Elongation factor 1-alpha [Triticum urartu]
 gb|EMS55225.1| Elongation factor 1-alpha [Triticum urartu]
Length=447

 Score =   291 bits (746),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>ref|XP_001753059.1| predicted protein [Physcomitrella patens]
 gb|EDQ82100.1| predicted protein [Physcomitrella patens]
Length=447

 Score =   291 bits (746),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFET KYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETVKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>ref|XP_011004182.1| PREDICTED: elongation factor 1-alpha-like [Populus euphratica]
 ref|XP_011010862.1| PREDICTED: elongation factor 1-alpha-like [Populus euphratica]
Length=447

 Score =   291 bits (746),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>ref|NP_001105587.1| elongation factor 1-alpha [Zea mays]
 gb|AAB64207.1| elongation factor 1-alpha [Zea mays]
 gb|ACG32939.1| elongation factor 1-alpha [Zea mays]
 gb|AFW87114.1| LOW QUALITY PROTEIN: putative translation elongation factor Tu 
family protein [Zea mays]
Length=447

 Score =   291 bits (746),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>gb|ABB16977.1| elongation factor 1-alpha-like protein [Solanum tuberosum]
Length=319

 Score =   287 bits (735),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 139/141 (99%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK+HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKIHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>ref|XP_009421379.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
Length=447

 Score =   291 bits (746),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>ref|XP_004149547.1| PREDICTED: elongation factor 1-alpha-like [Cucumis sativus]
Length=449

 Score =   291 bits (746),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>ref|NP_001105933.1| elongation factor alpha2 [Zea mays]
 gb|AAF42976.1| elongation factor 1 alpha [Zea mays]
Length=447

 Score =   291 bits (746),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>ref|XP_008656153.1| PREDICTED: elongation factor 1-alpha-like [Zea mays]
 ref|XP_008656154.1| PREDICTED: elongation factor 1-alpha-like [Zea mays]
 gb|AFW81463.1| putative translation elongation factor Tu family protein isoform 
1 [Zea mays]
 gb|AFW81464.1| putative translation elongation factor Tu family protein isoform 
2 [Zea mays]
 gb|AFW81465.1| putative translation elongation factor Tu family protein isoform 
3 [Zea mays]
Length=447

 Score =   291 bits (746),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>gb|AFC88830.1| putative elongation factor 1-alpha [Miscanthus sinensis]
Length=447

 Score =   291 bits (746),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>gb|AGT16893.1| elongation factor 1-alpha [Saccharum hybrid cultivar R570]
Length=447

 Score =   291 bits (746),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>ref|XP_009380678.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009380679.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009380680.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
Length=447

 Score =   291 bits (746),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>ref|NP_001288465.1| elongation factor 1-alpha-like [Zea mays]
 ref|XP_008647262.1| PREDICTED: elongation factor alpha2 isoform X1 [Zea mays]
 gb|ACG25290.1| elongation factor 1-alpha [Zea mays]
 gb|AFW77596.1| putative translation elongation factor Tu family protein [Zea 
mays]
 gb|AFW77599.1| putative translation elongation factor Tu family protein isoform 
1 [Zea mays]
 gb|AFW77600.1| putative translation elongation factor Tu family protein isoform 
2 [Zea mays]
Length=447

 Score =   291 bits (746),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>sp|Q41803.1|EF1A_MAIZE RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha [Zea 
mays]
 dbj|BAA08249.1| alpha subunit of tlanslation elongation factor 1 [Zea mays]
Length=447

 Score =   291 bits (746),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>gb|ACR38047.1| unknown [Zea mays]
 gb|AFW77623.1| elongation factor alpha1 [Zea mays]
Length=447

 Score =   291 bits (746),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>gb|AAY56337.1| elongation factor-1 alpha [Musa acuminata]
Length=447

 Score =   291 bits (746),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDST 
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTA  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>ref|XP_011026991.1| PREDICTED: elongation factor 1-alpha isoform X1 [Populus euphratica]
 ref|XP_011026997.1| PREDICTED: elongation factor 1-alpha [Populus euphratica]
 ref|XP_011040951.1| PREDICTED: elongation factor 1-alpha [Populus euphratica]
Length=449

 Score =   291 bits (746),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>gb|ACG31866.1| elongation factor 1-alpha [Zea mays]
Length=447

 Score =   291 bits (746),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>ref|XP_008656156.1| PREDICTED: elongation factor 1-alpha-like isoform X2 [Zea mays]
 gb|AFW81467.1| putative translation elongation factor Tu family protein isoform 
1 [Zea mays]
 gb|AFW81468.1| putative translation elongation factor Tu family protein isoform 
2 [Zea mays]
 gb|AFW81469.1| putative translation elongation factor Tu family protein isoform 
3 [Zea mays]
Length=447

 Score =   291 bits (746),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>ref|XP_004157309.1| PREDICTED: elongation factor 1-alpha-like [Cucumis sativus]
Length=449

 Score =   291 bits (746),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFET KYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETAKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>gb|ACG34498.1| elongation factor 1-alpha [Zea mays]
Length=447

 Score =   291 bits (746),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>ref|XP_004962249.1| PREDICTED: elongation factor 1-alpha-like [Setaria italica]
 ref|XP_004962250.1| PREDICTED: elongation factor 1-alpha-like [Setaria italica]
 ref|XP_004962268.1| PREDICTED: elongation factor 1-alpha-like [Setaria italica]
 ref|XP_004962269.1| PREDICTED: elongation factor 1-alpha-like [Setaria italica]
 ref|XP_004962270.1| PREDICTED: elongation factor 1-alpha-like isoform X1 [Setaria 
italica]
 ref|XP_004962271.1| PREDICTED: elongation factor 1-alpha-like isoform X2 [Setaria 
italica]
Length=447

 Score =   291 bits (746),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>ref|NP_001105934.1| elongation factor alpha7 [Zea mays]
 gb|AAF42981.1| elongation factor 1 alpha [Zea mays]
Length=447

 Score =   291 bits (746),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>gb|AEQ75495.1| elongation factor 1-alpha [Rosa multiflora]
Length=447

 Score =   291 bits (746),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>ref|XP_006417745.1| hypothetical protein EUTSA_v10007619mg [Eutrema salsugineum]
 ref|XP_006417746.1| hypothetical protein EUTSA_v10007619mg [Eutrema salsugineum]
 ref|XP_006417749.1| hypothetical protein EUTSA_v10007620mg [Eutrema salsugineum]
 ref|XP_006417750.1| hypothetical protein EUTSA_v10007618mg [Eutrema salsugineum]
 ref|XP_006417751.1| hypothetical protein EUTSA_v10007618mg [Eutrema salsugineum]
 ref|XP_006400853.1| hypothetical protein EUTSA_v10013526mg [Eutrema salsugineum]
 dbj|BAJ33644.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ36098.1| hypothetical protein EUTSA_v10007619mg [Eutrema salsugineum]
 gb|ESQ36099.1| hypothetical protein EUTSA_v10007619mg [Eutrema salsugineum]
 gb|ESQ36102.1| hypothetical protein EUTSA_v10007620mg [Eutrema salsugineum]
 gb|ESQ36103.1| hypothetical protein EUTSA_v10007618mg [Eutrema salsugineum]
 gb|ESQ36104.1| hypothetical protein EUTSA_v10007618mg [Eutrema salsugineum]
 gb|ESQ42306.1| hypothetical protein EUTSA_v10013526mg [Eutrema salsugineum]
Length=449

 Score =   291 bits (746),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>ref|NP_001288407.1| elongation factor 1-alpha-like [Zea mays]
 gb|ACF87009.1| unknown [Zea mays]
Length=447

 Score =   291 bits (746),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>ref|NP_001105617.1| elongation factor alpha3 [Zea mays]
 gb|AAF42977.1| elongation factor 1 alpha [Zea mays]
Length=447

 Score =   291 bits (746),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>gb|AIZ74328.1| translation elongation factor 1-alpha [Pinus massoniana]
Length=448

 Score =   291 bits (746),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>ref|XP_007143679.1| hypothetical protein PHAVU_007G092500g [Phaseolus vulgaris]
 gb|ESW15673.1| hypothetical protein PHAVU_007G092500g [Phaseolus vulgaris]
Length=448

 Score =   291 bits (746),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>gb|KHG20498.1| Elongation factor 1-alpha [Gossypium arboreum]
Length=447

 Score =   291 bits (746),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>ref|XP_007205199.1| hypothetical protein PRUPE_ppa005718mg [Prunus persica]
 gb|EMJ06398.1| hypothetical protein PRUPE_ppa005718mg [Prunus persica]
Length=447

 Score =   291 bits (746),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>ref|XP_009783256.1| PREDICTED: elongation factor 1-alpha [Nicotiana sylvestris]
 dbj|BAA09709.1| elongation factor-1 alpha [Nicotiana tabacum]
Length=447

 Score =   291 bits (746),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>ref|XP_001766482.1| predicted protein [Physcomitrella patens]
 gb|EDQ68810.1| predicted protein [Physcomitrella patens]
Length=447

 Score =   291 bits (746),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFET KYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETVKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>ref|NP_200847.1| elongation factor 1-alpha 4 [Arabidopsis thaliana]
 ref|NP_563799.1| elongation factor 1-alpha 3 [Arabidopsis thaliana]
 ref|NP_563800.1| elongation factor 1-alpha 2 [Arabidopsis thaliana]
 ref|NP_563801.1| elongation factor 1-alpha 1 [Arabidopsis thaliana]
 ref|NP_001030993.1| elongation factor 1-alpha 1 [Arabidopsis thaliana]
 ref|NP_001119464.1| elongation factor 1-alpha 4 [Arabidopsis thaliana]
 ref|XP_002864684.1| elongation factor 1-alpha [Arabidopsis lyrata subsp. lyrata]
 ref|XP_002889674.1| elongation factor 1-alpha [Arabidopsis lyrata subsp. lyrata]
 sp|P0DH99.1|EF1A1_ARATH RecName: Full=Elongation factor 1-alpha 1; Short=EF-1-alpha 1; 
AltName: Full=eEF-1A1 [Arabidopsis thaliana]
 sp|Q8W4H7.2|EF1A2_ARATH RecName: Full=Elongation factor 1-alpha 2; Short=EF-1-alpha 2; 
AltName: Full=eEF-1A2 [Arabidopsis thaliana]
 sp|Q0WL56.2|EF1A3_ARATH RecName: Full=Elongation factor 1-alpha 3; Short=EF-1-alpha 3; 
AltName: Full=eEF-1A3 [Arabidopsis thaliana]
 sp|Q8GTY0.2|EF1A4_ARATH RecName: Full=Elongation factor 1-alpha 4; Short=EF-1-alpha 4; 
AltName: Full=eEF-1A4 [Arabidopsis thaliana]
 gb|AAF79847.1|AC026875_27 T6D22.3 [Arabidopsis thaliana]
 gb|AAL31918.1|AF419586_1 AT5g60390/muf9_40 [Arabidopsis thaliana]
 emb|CAA34453.1| elongation factor 1-alpha [Arabidopsis thaliana]
 emb|CAA34454.1| elongation factor 1-alpha [Arabidopsis thaliana]
 emb|CAA34455.1| elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AAB07882.1| EF-1alpha-A1 [Arabidopsis thaliana]
 gb|AAB07883.1| EF-1alpha-A2 [Arabidopsis thaliana]
 gb|AAB07884.1| EF-1alpha-A3 [Arabidopsis thaliana]
 dbj|BAB08224.1| elongation factor 1-alpha (EF-1-alpha) [Arabidopsis thaliana]
 gb|AAK62638.1| At1g07940/T6D22_14 [Arabidopsis thaliana]
 gb|AAL24386.1| elongation factor 1-alpha (EF-1-alpha) [Arabidopsis thaliana]
 gb|AAL31193.1| AT5g60390/muf9_40 [Arabidopsis thaliana]
 gb|AAL86336.1| putative elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AAM65897.1| elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AAM67562.1| putative elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AAM91202.1| elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AAM91362.1| At5g60390/muf9_40 [Arabidopsis thaliana]
 gb|AAM98236.1| unknown protein [Arabidopsis thaliana]
 gb|AAM98240.1| unknown protein [Arabidopsis thaliana]
 gb|AAN18164.1| At1g07940/T6D22_14 [Arabidopsis thaliana]
 gb|AAO00783.1| elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AAO00802.1| elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AAO00870.1| Unknown protein [Arabidopsis thaliana]
 gb|AAO29944.1| Unknown protein [Arabidopsis thaliana]
 gb|AAP21177.1| At5g60390/muf9_40 [Arabidopsis thaliana]
 dbj|BAE99963.1| elongation factor 1-alpha [Arabidopsis thaliana]
 dbj|BAE98497.1| translation elongation factor eEF-1 alpha chain [Arabidopsis 
thaliana]
 dbj|BAE98750.1| translation elongation factor eEF-1 alpha chain [Arabidopsis 
thaliana]
 gb|EFH40943.1| elongation factor 1-alpha [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65933.1| elongation factor 1-alpha [Arabidopsis lyrata subsp. lyrata]
 gb|AED97318.1| elongation factor 1-alpha 4 [Arabidopsis thaliana]
 gb|AED97320.1| elongation factor 1-alpha 4 [Arabidopsis thaliana]
 gb|AEE28212.1| elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AEE28213.1| Elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AEE28215.1| Elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AEE28216.1| Elongation factor 1-alpha [Arabidopsis thaliana]
Length=449

 Score =   291 bits (746),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>ref|XP_009148045.1| PREDICTED: elongation factor 1-alpha 1 [Brassica rapa]
 ref|XP_009110915.1| PREDICTED: elongation factor 1-alpha 1 [Brassica rapa]
 ref|XP_009118409.1| PREDICTED: elongation factor 1-alpha 1 isoform X1 [Brassica rapa]
 ref|XP_009118410.1| PREDICTED: elongation factor 1-alpha 1 isoform X2 [Brassica rapa]
 ref|XP_009118411.1| PREDICTED: elongation factor 1-alpha 1 isoform X3 [Brassica rapa]
 ref|XP_009120571.1| PREDICTED: elongation factor 1-alpha 1 [Brassica rapa]
 gb|ACS68201.1| elongation factor 1 alpha [Brassica napus]
 gb|AGK07381.1| elongation factor 1-alpha protein [Brassica oleracea var. botrytis]
Length=449

 Score =   291 bits (746),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>ref|XP_004962277.1| PREDICTED: elongation factor 1-alpha-like isoform X1 [Setaria 
italica]
 ref|XP_004962278.1| PREDICTED: elongation factor 1-alpha-like isoform X2 [Setaria 
italica]
 ref|XP_004962279.1| PREDICTED: elongation factor 1-alpha-like [Setaria italica]
Length=447

 Score =   291 bits (746),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>ref|XP_004489551.1| PREDICTED: elongation factor 1-alpha-like [Cicer arietinum]
 ref|XP_004489552.1| PREDICTED: elongation factor 1-alpha-like [Cicer arietinum]
Length=447

 Score =   291 bits (746),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>gb|AFW77593.1| putative translation elongation factor Tu family protein isoform 
1 [Zea mays]
 gb|AFW77594.1| putative translation elongation factor Tu family protein isoform 
2 [Zea mays]
Length=447

 Score =   291 bits (746),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>gb|ACS68200.1| elongation factor 1 alpha [Brassica napus]
Length=449

 Score =   291 bits (746),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>ref|XP_008358325.1| PREDICTED: elongation factor 1-alpha [Malus domestica]
 ref|XP_008385282.1| PREDICTED: elongation factor 1-alpha [Malus domestica]
Length=447

 Score =   291 bits (746),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>ref|XP_009144204.1| PREDICTED: elongation factor 1-alpha 1-like [Brassica rapa]
Length=449

 Score =   291 bits (746),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>dbj|BAH19898.1| AT1G07930 [Arabidopsis thaliana]
Length=449

 Score =   291 bits (746),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>ref|XP_007015463.1| GTP binding Elongation factor Tu family protein [Theobroma cacao]
 gb|EOY33082.1| GTP binding Elongation factor Tu family protein [Theobroma cacao]
Length=449

 Score =   291 bits (746),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>gb|AAL32631.1| putative elongation factor 1-a [Arabidopsis thaliana]
 gb|AAM47970.1| putative elongation factor 1-a [Arabidopsis thaliana]
Length=449

 Score =   291 bits (746),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>ref|XP_006436251.1| hypothetical protein CICLE_v10033471mg [Citrus clementina]
 ref|XP_006485903.1| PREDICTED: elongation factor 1-alpha 1-like [Citrus sinensis]
 gb|ESR49491.1| hypothetical protein CICLE_v10033471mg [Citrus clementina]
Length=447

 Score =   291 bits (746),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>ref|XP_004309880.1| PREDICTED: elongation factor 1-alpha [Fragaria vesca subsp. vesca]
Length=447

 Score =   291 bits (746),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>gb|AAN31833.1| putative translation elongation factor eEF-1 alpha chain (gene 
A4) [Arabidopsis thaliana]
Length=449

 Score =   291 bits (746),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>gb|KDO48480.1| hypothetical protein CISIN_1g0132372mg [Citrus sinensis]
Length=447

 Score =   291 bits (745),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>ref|XP_004984833.1| PREDICTED: elongation factor 1-alpha-like [Setaria italica]
 ref|XP_004984834.1| PREDICTED: elongation factor 1-alpha-like [Setaria italica]
Length=447

 Score =   291 bits (745),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>gb|AAL57653.1| At1g07930/T6D22_3 [Arabidopsis thaliana]
Length=449

 Score =   291 bits (746),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>ref|NP_001105565.1| elongation factor alpha5 [Zea mays]
 gb|AAF42979.1| elongation factor 1 alpha [Zea mays]
Length=447

 Score =   291 bits (745),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>ref|XP_006280459.1| hypothetical protein CARUB_v10026391mg [Capsella rubella]
 ref|XP_006304491.1| hypothetical protein CARUB_v10011249mg [Capsella rubella]
 ref|XP_010456336.1| PREDICTED: elongation factor 1-alpha 1 isoform X1 [Camelina sativa]
 ref|XP_010456344.1| PREDICTED: elongation factor 1-alpha 1 isoform X2 [Camelina sativa]
 ref|XP_010456350.1| PREDICTED: elongation factor 1-alpha 1 isoform X3 [Camelina sativa]
 ref|XP_010456355.1| PREDICTED: elongation factor 1-alpha 1 isoform X4 [Camelina sativa]
 ref|XP_010456361.1| PREDICTED: elongation factor 1-alpha 1 isoform X5 [Camelina sativa]
 ref|XP_010456369.1| PREDICTED: elongation factor 1-alpha 1 isoform X6 [Camelina sativa]
 ref|XP_010488164.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010488173.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010505603.1| PREDICTED: elongation factor 1-alpha 1 isoform X1 [Camelina sativa]
 ref|XP_010505604.1| PREDICTED: elongation factor 1-alpha 1 isoform X2 [Camelina sativa]
 ref|XP_010509026.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010517279.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010443836.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010443839.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010458006.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010458008.1| PREDICTED: elongation factor 1-alpha 1 isoform X1 [Camelina sativa]
 ref|XP_010458009.1| PREDICTED: elongation factor 1-alpha 1 isoform X1 [Camelina sativa]
 ref|XP_010475572.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010475573.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010475574.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010483684.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010483687.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 gb|EOA13357.1| hypothetical protein CARUB_v10026391mg [Capsella rubella]
 gb|EOA37389.1| hypothetical protein CARUB_v10011249mg [Capsella rubella]
Length=449

 Score =   291 bits (746),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>ref|XP_008380545.1| PREDICTED: elongation factor 1-alpha-like [Malus domestica]
 ref|XP_008365661.1| PREDICTED: elongation factor 1-alpha [Malus domestica]
 ref|XP_009374568.1| PREDICTED: elongation factor 1-alpha-like [Pyrus x bretschneideri]
 ref|XP_009374577.1| PREDICTED: elongation factor 1-alpha-like [Pyrus x bretschneideri]
Length=447

 Score =   291 bits (745),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>ref|XP_009126611.1| PREDICTED: elongation factor 1-alpha 1-like [Brassica rapa]
 ref|XP_009126612.1| PREDICTED: elongation factor 1-alpha 1-like [Brassica rapa]
Length=449

 Score =   291 bits (746),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>ref|XP_007015466.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
 gb|EOY33085.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
Length=449

 Score =   291 bits (746),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>ref|XP_006858667.1| hypothetical protein AMTR_s00066p00072310 [Amborella trichopoda]
 gb|ERN20134.1| hypothetical protein AMTR_s00066p00072310 [Amborella trichopoda]
Length=447

 Score =   291 bits (745),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>ref|XP_008224543.1| PREDICTED: elongation factor 1-alpha [Prunus mume]
Length=447

 Score =   291 bits (745),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>ref|XP_010032225.1| PREDICTED: elongation factor 1-alpha-like [Eucalyptus grandis]
Length=448

 Score =   291 bits (745),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>sp|P43643.1|EF1A_TOBAC RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha; AltName: 
Full=Vitronectin-like adhesion protein 1; Short=PVN1 
[Nicotiana tabacum]
 gb|AAA20836.1| vitronectin-like adhesion protein [Nicotiana tabacum]
Length=447

 Score =   291 bits (745),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>dbj|BAM13877.1| elongation factor 1 alpha [Arum maculatum]
Length=447

 Score =   291 bits (745),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>ref|XP_001753167.1| predicted protein [Physcomitrella patens]
 gb|EDQ82208.1| predicted protein [Physcomitrella patens]
Length=447

 Score =   291 bits (745),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFET KYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETVKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>gb|EMS59091.1| Elongation factor 1-alpha [Triticum urartu]
Length=496

 Score =   293 bits (749),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 141/146 (97%), Positives = 143/146 (98%), Gaps = 0/146 (0%)
 Frame = +3

Query  78   ILLNRMGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFK  257
            + L+ MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFK
Sbjct  45   VSLSAMGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFK  104

Query  258  YAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLI  437
            YAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLI
Sbjct  105  YAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLI  164

Query  438  IDSTTGGFEAGISKDGQTREHALLAF  515
            IDSTTGGFEAGISKDGQTREHALLAF
Sbjct  165  IDSTTGGFEAGISKDGQTREHALLAF  190



>ref|XP_009392715.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009392716.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
Length=447

 Score =   291 bits (745),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>ref|XP_009793830.1| PREDICTED: elongation factor 1-alpha-like [Nicotiana sylvestris]
Length=447

 Score =   291 bits (745),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>ref|XP_011040946.1| PREDICTED: elongation factor 1-alpha-like isoform X2 [Populus 
euphratica]
Length=449

 Score =   291 bits (745),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>ref|XP_009420035.1| PREDICTED: elongation factor 1-alpha [Musa acuminata subsp. malaccensis]
 ref|XP_009420036.1| PREDICTED: elongation factor 1-alpha [Musa acuminata subsp. malaccensis]
Length=447

 Score =   291 bits (745),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>gb|AAF99703.1| elongation factor [Saccharum officinarum]
Length=448

 Score =   291 bits (745),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>ref|XP_007222129.1| hypothetical protein PRUPE_ppa005702mg [Prunus persica]
 ref|XP_008224523.1| PREDICTED: elongation factor 1-alpha-like [Prunus mume]
 gb|EMJ23328.1| hypothetical protein PRUPE_ppa005702mg [Prunus persica]
Length=447

 Score =   291 bits (745),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>ref|XP_001763194.1| predicted protein [Physcomitrella patens]
 ref|XP_001763195.1| predicted protein [Physcomitrella patens]
 ref|XP_001763196.1| predicted protein [Physcomitrella patens]
 gb|EDQ72071.1| predicted protein [Physcomitrella patens]
 gb|EDQ72072.1| predicted protein [Physcomitrella patens]
 gb|EDQ72073.1| predicted protein [Physcomitrella patens]
Length=447

 Score =   291 bits (745),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFET KYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETVKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>ref|XP_004309883.1| PREDICTED: elongation factor 1-alpha-like [Fragaria vesca subsp. 
vesca]
Length=447

 Score =   291 bits (745),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>ref|XP_004307410.1| PREDICTED: elongation factor 1-alpha [Fragaria vesca subsp. vesca]
Length=447

 Score =   291 bits (745),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>ref|XP_009131916.1| PREDICTED: elongation factor 1-alpha 1-like [Brassica rapa]
Length=449

 Score =   291 bits (745),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>gb|EYU18863.1| hypothetical protein MIMGU_mgv1a006280mg [Erythranthe guttata]
 gb|EYU18864.1| hypothetical protein MIMGU_mgv1a006280mg [Erythranthe guttata]
 gb|EYU18866.1| hypothetical protein MIMGU_mgv11b005172mg [Erythranthe guttata]
 gb|EYU18867.1| hypothetical protein MIMGU_mgv1a006307mg [Erythranthe guttata]
Length=449

 Score =   291 bits (745),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>ref|XP_011031783.1| PREDICTED: elongation factor 1-alpha-like [Populus euphratica]
 ref|XP_011040944.1| PREDICTED: elongation factor 1-alpha-like isoform X1 [Populus 
euphratica]
 ref|XP_011040945.1| PREDICTED: elongation factor 1-alpha-like isoform X1 [Populus 
euphratica]
Length=449

 Score =   291 bits (745),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>gb|KDP29086.1| hypothetical protein JCGZ_16475 [Jatropha curcas]
Length=447

 Score =   291 bits (745),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHIHIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>ref|XP_001753181.1| predicted protein [Physcomitrella patens]
 ref|XP_001753188.1| predicted protein [Physcomitrella patens]
 gb|EDQ82222.1| predicted protein [Physcomitrella patens]
 gb|EDQ82229.1| predicted protein [Physcomitrella patens]
Length=447

 Score =   291 bits (745),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFET KYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETVKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>gb|AFQ37422.1| translation elongation factor-1 alpha 1 [Larix kaempferi]
Length=447

 Score =   291 bits (745),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 139/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCA+LIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAILIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>ref|NP_001032107.1| elongation factor 1-alpha 4 [Arabidopsis thaliana]
 gb|AED97319.1| elongation factor 1-alpha 4 [Arabidopsis thaliana]
Length=400

 Score =   290 bits (741),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>gb|ABR17675.1| unknown [Picea sitchensis]
Length=448

 Score =   291 bits (745),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 139/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCA+LIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAILIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>gb|ACI96243.1| elongation factor 1-alpha [Prunus persica]
Length=447

 Score =   291 bits (745),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>ref|XP_010032223.1| PREDICTED: elongation factor 1-alpha isoform X2 [Eucalyptus grandis]
Length=447

 Score =   291 bits (744),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 139/141 (99%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK+HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKIHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>ref|XP_011026992.1| PREDICTED: elongation factor 1-alpha isoform X2 [Populus euphratica]
 ref|XP_011026993.1| PREDICTED: elongation factor 1-alpha isoform X2 [Populus euphratica]
 ref|XP_011026995.1| PREDICTED: elongation factor 1-alpha isoform X2 [Populus euphratica]
 ref|XP_011026996.1| PREDICTED: elongation factor 1-alpha isoform X3 [Populus euphratica]
Length=449

 Score =   291 bits (745),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>ref|XP_001763201.1| predicted protein [Physcomitrella patens]
 gb|EDQ72078.1| predicted protein [Physcomitrella patens]
Length=447

 Score =   291 bits (744),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFET KYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETMKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>ref|XP_008385284.1| PREDICTED: elongation factor 1-alpha-like [Malus domestica]
 ref|XP_009338279.1| PREDICTED: elongation factor 1-alpha-like [Pyrus x bretschneideri]
Length=447

 Score =   291 bits (744),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 139/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCA+LIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAILIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>ref|XP_006378755.1| hypothetical protein POPTR_0010s22560g [Populus trichocarpa]
 gb|ERP56552.1| hypothetical protein POPTR_0010s22560g [Populus trichocarpa]
Length=449

 Score =   291 bits (744),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>gb|ACN40740.1| unknown [Picea sitchensis]
 gb|ACN41072.1| unknown [Picea sitchensis]
Length=448

 Score =   291 bits (744),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 139/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCA+LIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAILIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>ref|XP_008224492.1| PREDICTED: elongation factor 1-alpha [Prunus mume]
Length=447

 Score =   291 bits (744),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 139/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCA+LIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAILIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>gb|ABF00115.1| elongation factor 1-alpha [Litchi chinensis]
Length=446

 Score =   291 bits (744),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 139/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFET +YYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETNRYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>gb|AGC94754.1| elongation factor 1 alpha [Euphorbia lathyris]
Length=447

 Score =   291 bits (744),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 139/141 (99%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK+HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKIHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>ref|XP_002315287.1| hypothetical protein POPTR_0010s22620g [Populus trichocarpa]
 ref|XP_002315285.2| hypothetical protein POPTR_0010s22570g [Populus trichocarpa]
 ref|XP_002316351.2| hypothetical protein POPTR_0010s22620g [Populus trichocarpa]
 gb|ABK95341.1| unknown [Populus trichocarpa]
 gb|ABK95876.1| unknown [Populus trichocarpa]
 gb|EEF01458.1| hypothetical protein POPTR_0010s22620g [Populus trichocarpa]
 gb|EEF01456.2| hypothetical protein POPTR_0010s22570g [Populus trichocarpa]
 gb|EEF02522.2| hypothetical protein POPTR_0010s22620g [Populus trichocarpa]
Length=449

 Score =   291 bits (744),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 139/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETT+YYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTRYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>ref|XP_007207457.1| hypothetical protein PRUPE_ppa005717mg [Prunus persica]
 gb|EMJ08656.1| hypothetical protein PRUPE_ppa005717mg [Prunus persica]
Length=447

 Score =   291 bits (744),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 139/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCA+LIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAILIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>ref|XP_010456376.1| PREDICTED: elongation factor 1-alpha 1 isoform X7 [Camelina sativa]
Length=400

 Score =   289 bits (740),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>ref|XP_008349743.1| PREDICTED: elongation factor 1-alpha isoform X2 [Malus domestica]
Length=397

 Score =   289 bits (740),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 139/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCA+LIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAILIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>ref|XP_007218005.1| hypothetical protein PRUPE_ppa005706mg [Prunus persica]
 gb|EMJ19204.1| hypothetical protein PRUPE_ppa005706mg [Prunus persica]
Length=447

 Score =   291 bits (744),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 139/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK+HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKIHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFET KYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETNKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>sp|P34823.1|EF1A2_DAUCA RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha [Daucus 
carota]
 dbj|BAA02205.1| elongation factor 1-alpha [Daucus carota]
Length=447

 Score =   291 bits (744),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 139/141 (99%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK+HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKIHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>gb|ABV26710.1| elongation factor 1 alpha [Gerbera hybrid cultivar]
Length=449

 Score =   291 bits (744),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 139/141 (99%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK+HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKIHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>gb|ABB72813.1| elongation factor 1-alpha-like protein [Solanum tuberosum]
Length=448

 Score =   291 bits (744),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 139/141 (99%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK+HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKIHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>ref|XP_008233357.1| PREDICTED: elongation factor 1-alpha-like [Prunus mume]
Length=447

 Score =   291 bits (744),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 139/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK+HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKIHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFET KYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETNKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>ref|XP_006387491.1| hypothetical protein POPTR_0966s00200g [Populus trichocarpa]
 ref|XP_006387492.1| hypothetical protein POPTR_0966s00200g [Populus trichocarpa]
 gb|ABK94386.1| unknown [Populus trichocarpa]
 gb|ERP46405.1| hypothetical protein POPTR_0966s00200g [Populus trichocarpa]
 gb|ERP46406.1| hypothetical protein POPTR_0966s00200g [Populus trichocarpa]
Length=449

 Score =   291 bits (744),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>ref|XP_008790814.1| PREDICTED: elongation factor 1-alpha-like [Phoenix dactylifera]
Length=447

 Score =   291 bits (744),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 139/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK H+NIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHLNIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>gb|AEN79476.1| elongation factor 1-alpha [Ziziphus jujuba]
Length=447

 Score =   290 bits (743),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 140/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITI IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIGIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>ref|XP_002518073.1| elongation factor 1-alpha, putative [Ricinus communis]
 ref|XP_002518074.1| elongation factor 1-alpha, putative [Ricinus communis]
 gb|EEF44206.1| elongation factor 1-alpha, putative [Ricinus communis]
 gb|EEF44207.1| elongation factor 1-alpha, putative [Ricinus communis]
Length=449

 Score =   291 bits (744),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 139/141 (99%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK+HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKIHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>ref|NP_001234035.1| elongation factor 1-alpha [Solanum lycopersicum]
 ref|XP_004240579.1| PREDICTED: elongation factor 1-alpha [Solanum lycopersicum]
 sp|P17786.1|EF1A_SOLLC RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha [Solanum 
lycopersicum]
 emb|CAA32618.1| unnamed protein product [Solanum lycopersicum]
 emb|CAA37212.1| elongation factor 1-alpha [Solanum lycopersicum]
Length=448

 Score =   290 bits (743),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 139/141 (99%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK+HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKIHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>ref|NP_001280807.1| elongation factor 1-alpha-like [Malus domestica]
 ref|XP_008349742.1| PREDICTED: elongation factor 1-alpha isoform X1 [Malus domestica]
 ref|XP_008366354.1| PREDICTED: elongation factor 1-alpha [Malus domestica]
 emb|CAA11705.1| elongation factor 1 alpha subunit [Malus domestica]
Length=447

 Score =   290 bits (743),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 139/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCA+LIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAILIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



>gb|AID52924.1| elongation factor 1-alpha [Carthamus tinctorius]
Length=449

 Score =   290 bits (743),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 139/141 (99%), Positives = 141/141 (100%), Gaps = 0/141 (0%)
 Frame = +3

Query  93   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK+HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKIHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  452
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  453  GGFEAGISKDGQTREHALLAF  515
            GGFEAGISKDGQTREHALLAF
Sbjct  121  GGFEAGISKDGQTREHALLAF  141



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 554939364720