BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001O10

Length=560
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AFV46216.1|  hypothetical protein                                    322   1e-108   Scutellaria baicalensis [Baikal skullcap]
emb|CDY02235.1|  BnaA03g39320D                                          315   1e-106   
emb|CDX89754.1|  BnaC03g46680D                                          316   2e-106   
emb|CDY53148.1|  BnaAnng12070D                                          317   3e-106   Brassica napus [oilseed rape]
ref|XP_008447699.1|  PREDICTED: heat shock cognate 70 kDa protein 2     329   8e-106   Cucumis melo [Oriental melon]
ref|XP_010553033.1|  PREDICTED: probable mediator of RNA polymera...    329   8e-106   Tarenaya hassleriana [spider flower]
gb|EYU41710.1|  hypothetical protein MIMGU_mgv1a022248mg                320   9e-106   Erythranthe guttata [common monkey flower]
emb|CDY16175.1|  BnaA09g29090D                                          316   1e-105   Brassica napus [oilseed rape]
ref|XP_002532297.1|  heat shock protein, putative                       328   1e-105   Ricinus communis
ref|XP_009592776.1|  PREDICTED: heat shock cognate 70 kDa protein...    328   1e-105   Nicotiana tomentosiformis
sp|P09189.1|HSP7C_PETHY  RecName: Full=Heat shock cognate 70 kDa ...    328   1e-105   Petunia x hybrida [garden petunia]
emb|CDP09040.1|  unnamed protein product                                328   2e-105   Coffea canephora [robusta coffee]
ref|XP_010558317.1|  PREDICTED: probable mediator of RNA polymera...    328   2e-105   Tarenaya hassleriana [spider flower]
ref|XP_006350760.1|  PREDICTED: heat shock cognate 70 kDa protein...    328   2e-105   Solanum tuberosum [potatoes]
emb|CCA29120.1|  heat shock protein 70 isoform 1                        328   2e-105   Solanum lycopersicum
gb|AFU34347.1|  70-kDa heat shock protein                               327   4e-105   Ipomoea batatas [batate]
ref|XP_011094842.1|  PREDICTED: heat shock cognate 70 kDa protein 2     327   4e-105   Sesamum indicum [beniseed]
gb|EAY81899.1|  hypothetical protein OsI_37065                          320   4e-105   Oryza sativa Indica Group [Indian rice]
ref|NP_001234491.1|  heat shock cognate 70 kDa protein 1                327   5e-105   
ref|XP_004142076.1|  PREDICTED: probable mediator of RNA polymera...    327   5e-105   
gb|KDO72893.1|  hypothetical protein CISIN_1g036208mg                   315   5e-105   Citrus sinensis [apfelsine]
emb|CDX85038.1|  BnaC05g20170D                                          313   1e-104   
gb|KJB16980.1|  hypothetical protein B456_002G258500                    325   1e-104   Gossypium raimondii
emb|CDY31804.1|  BnaC01g27600D                                          319   1e-104   Brassica napus [oilseed rape]
ref|XP_007027053.1|  Heat shock cognate protein 70-1 isoform 2          320   1e-104   
emb|CDY36723.1|  BnaC02g31440D                                          311   1e-104   Brassica napus [oilseed rape]
ref|XP_011077460.1|  PREDICTED: heat shock cognate 70 kDa protein...    326   1e-104   Sesamum indicum [beniseed]
ref|XP_004249574.1|  PREDICTED: heat shock cognate 70 kDa protein 2     325   1e-104   
ref|XP_004142749.1|  PREDICTED: heat shock cognate 70 kDa protein...    325   2e-104   Cucumis sativus [cucumbers]
gb|KJB55903.1|  hypothetical protein B456_009G100400                    325   2e-104   Gossypium raimondii
ref|XP_006349514.1|  PREDICTED: heat shock cognate 70 kDa protein...    325   2e-104   Solanum tuberosum [potatoes]
gb|KDP44975.1|  hypothetical protein JCGZ_01475                         325   2e-104   Jatropha curcas
ref|XP_003521330.1|  PREDICTED: probable mediator of RNA polymera...    326   2e-104   Glycine max [soybeans]
ref|XP_004250958.1|  PREDICTED: heat shock cognate 70 kDa protein...    325   2e-104   Solanum lycopersicum
gb|AAR17080.1|  heat shock protein 70-3                                 325   2e-104   Nicotiana tabacum [American tobacco]
ref|XP_009622753.1|  PREDICTED: heat shock cognate 70 kDa protein...    325   2e-104   Nicotiana tomentosiformis
ref|XP_009620324.1|  PREDICTED: heat shock cognate 70 kDa protein...    325   2e-104   Nicotiana tomentosiformis
ref|XP_006348998.1|  PREDICTED: heat shock cognate 70 kDa protein...    325   2e-104   Solanum tuberosum [potatoes]
ref|XP_009785159.1|  PREDICTED: heat shock cognate 70 kDa protein...    325   2e-104   Nicotiana sylvestris
ref|XP_002284008.1|  PREDICTED: heat shock cognate 70 kDa protein 2     325   2e-104   
ref|XP_009777579.1|  PREDICTED: heat shock cognate 70 kDa protein...    325   3e-104   Nicotiana sylvestris
gb|EEC76425.1|  hypothetical protein OsI_14101                          318   4e-104   Oryza sativa Indica Group [Indian rice]
ref|XP_010030977.1|  PREDICTED: heat shock cognate 70 kDa protein 2     325   4e-104   Eucalyptus grandis [rose gum]
ref|XP_009604213.1|  PREDICTED: heat shock cognate 70 kDa protein       324   5e-104   Nicotiana tomentosiformis
gb|KJB16979.1|  hypothetical protein B456_002G258500                    324   5e-104   Gossypium raimondii
emb|CCA29121.1|  heat shock protein 70 isoform 2                        324   5e-104   Solanum lycopersicum
gb|KJB46580.1|  hypothetical protein B456_007G375600                    324   5e-104   Gossypium raimondii
gb|ACJ11741.1|  heat shock protein 70                                   324   6e-104   Gossypium hirsutum [American cotton]
ref|XP_010253202.1|  PREDICTED: heat shock cognate 70 kDa protein 2     324   6e-104   Nelumbo nucifera [Indian lotus]
ref|XP_008223372.1|  PREDICTED: probable mediator of RNA polymera...    320   7e-104   
ref|XP_004492118.1|  PREDICTED: heat shock cognate 70 kDa protein...    324   7e-104   Cicer arietinum [garbanzo]
ref|XP_007009362.1|  Heat shock cognate protein 70-1                    324   7e-104   
gb|ABP35942.1|  heat shock protein 70                                   324   7e-104   Cyclamen persicum
ref|XP_006664117.1|  PREDICTED: heat shock cognate 70 kDa protein...    323   8e-104   Oryza brachyantha
ref|XP_010253827.1|  PREDICTED: heat shock cognate 70 kDa protein...    323   9e-104   Nelumbo nucifera [Indian lotus]
ref|XP_006341042.1|  PREDICTED: heat shock cognate 70 kDa protein...    323   9e-104   Solanum tuberosum [potatoes]
ref|XP_009784009.1|  PREDICTED: heat shock cognate 70 kDa protein       323   1e-103   Nicotiana sylvestris
gb|KDP44981.1|  hypothetical protein JCGZ_01481                         323   1e-103   Jatropha curcas
ref|XP_003539680.2|  PREDICTED: heat shock cognate 70 kDa protein 2     323   1e-103   
ref|XP_011091460.1|  PREDICTED: heat shock cognate 70 kDa protein...    323   1e-103   Sesamum indicum [beniseed]
ref|XP_009409520.1|  PREDICTED: heat shock cognate 70 kDa protein 2     323   1e-103   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAJ34054.1|  unnamed protein product                                323   2e-103   Eutrema halophilum
ref|XP_006407676.1|  hypothetical protein EUTSA_v10020258mg             323   2e-103   Eutrema salsugineum [saltwater cress]
ref|XP_008458892.1|  PREDICTED: heat shock cognate 70 kDa protein       323   2e-103   Cucumis melo [Oriental melon]
gb|AGR45355.1|  HSP70                                                   323   2e-103   Dendrobium officinale
ref|XP_002527736.1|  heat shock protein, putative                       322   2e-103   Ricinus communis
gb|KCW50223.1|  hypothetical protein EUGRSUZ_J00023                     322   2e-103   Eucalyptus grandis [rose gum]
gb|KCW50226.1|  hypothetical protein EUGRSUZ_J00025                     325   2e-103   Eucalyptus grandis [rose gum]
gb|AAN86276.1|  cell-autonomous heat shock cognate protein 70           322   2e-103   Cucurbita maxima [Boston marrow]
sp|P27322.1|HSP72_SOLLC  RecName: Full=Heat shock cognate 70 kDa ...    322   2e-103   Solanum lycopersicum
gb|KCW50224.1|  hypothetical protein EUGRSUZ_J00023                     322   2e-103   Eucalyptus grandis [rose gum]
gb|KCW50227.1|  hypothetical protein EUGRSUZ_J00025                     325   3e-103   Eucalyptus grandis [rose gum]
ref|XP_010253221.1|  PREDICTED: heat shock cognate 70 kDa protein...    322   3e-103   Nelumbo nucifera [Indian lotus]
ref|XP_010030975.1|  PREDICTED: heat shock cognate 70 kDa protein...    322   3e-103   Eucalyptus grandis [rose gum]
gb|KDP35613.1|  hypothetical protein JCGZ_09051                         322   3e-103   Jatropha curcas
gb|ADD71975.1|  heat shock protein 70                                   322   3e-103   Rhododendron calophytum
emb|CDP00073.1|  unnamed protein product                                322   3e-103   Coffea canephora [robusta coffee]
emb|CAB72130.1|  heat shock protein 70                                  322   4e-103   Cucumis sativus [cucumbers]
gb|AAN86275.1|  non-cell-autonomous heat shock cognate protein 70       322   4e-103   Cucurbita maxima [Boston marrow]
gb|ABA95501.2|  Heat shock cognate 70 kDa protein, putative, expr...    321   4e-103   Oryza sativa Japonica Group [Japonica rice]
gb|EPS60056.1|  heat shock protein 70                                   322   4e-103   Genlisea aurea
ref|XP_007016460.1|  Heat shock cognate protein 70-1                    322   4e-103   
ref|XP_009786102.1|  PREDICTED: heat shock cognate 70 kDa protein 2     322   4e-103   Nicotiana sylvestris
ref|XP_009597695.1|  PREDICTED: heat shock cognate 70 kDa protein 2     322   4e-103   Nicotiana tomentosiformis
gb|AIZ68155.1|  heat shock protein 70                                   322   5e-103   Ornithogalum longebracteatum [sea-onion]
ref|XP_010095013.1|  Heat shock 70 kDa protein 4                        322   5e-103   Morus notabilis
gb|KFK38330.1|  hypothetical protein AALP_AA3G100200                    322   6e-103   Arabis alpina [alpine rockcress]
ref|XP_003554320.2|  PREDICTED: probable mediator of RNA polymera...    323   6e-103   
ref|XP_006833219.1|  hypothetical protein AMTR_s00072p00181720          322   6e-103   Amborella trichopoda
ref|NP_001068540.1|  Os11g0703900                                       321   7e-103   
ref|XP_006663128.1|  PREDICTED: heat shock cognate 70 kDa protein...    321   7e-103   Oryza brachyantha
gb|EAY89450.1|  hypothetical protein OsI_10982                          315   7e-103   Oryza sativa Indica Group [Indian rice]
ref|XP_006349004.1|  PREDICTED: heat shock cognate 70 kDa protein...    321   8e-103   Solanum tuberosum [potatoes]
ref|XP_006349005.1|  PREDICTED: heat shock cognate 70 kDa protein...    321   8e-103   Solanum tuberosum [potatoes]
ref|XP_002263599.1|  PREDICTED: heat shock cognate 70 kDa protein 2     321   8e-103   Vitis vinifera
ref|XP_007139240.1|  hypothetical protein PHAVU_008G013000g             321   1e-102   Phaseolus vulgaris [French bean]
gb|ACJ11740.1|  heat shock protein 70                                   321   1e-102   Gossypium hirsutum [American cotton]
ref|XP_008370710.1|  PREDICTED: heat shock cognate 70 kDa protein 2     321   1e-102   
ref|XP_004250959.1|  PREDICTED: heat shock cognate 70 kDa protein       321   1e-102   Solanum lycopersicum
ref|XP_008784530.1|  PREDICTED: heat shock cognate 70 kDa protein 2     321   1e-102   Phoenix dactylifera
ref|XP_010558794.1|  PREDICTED: probable mediator of RNA polymera...    320   1e-102   Tarenaya hassleriana [spider flower]
ref|XP_010555208.1|  PREDICTED: heat shock cognate 70 kDa protein...    320   2e-102   Tarenaya hassleriana [spider flower]
ref|XP_010922357.1|  PREDICTED: heat shock cognate 70 kDa protein 2     320   2e-102   Elaeis guineensis
gb|KJB36734.1|  hypothetical protein B456_006G174000                    320   2e-102   Gossypium raimondii
ref|XP_004246402.1|  PREDICTED: heat shock cognate 70 kDa protein...    320   2e-102   Solanum lycopersicum
ref|XP_004142745.1|  PREDICTED: heat shock cognate 70 kDa protein...    320   2e-102   
ref|XP_010520113.1|  PREDICTED: heat shock cognate 70 kDa protein...    320   3e-102   Tarenaya hassleriana [spider flower]
ref|XP_002284063.1|  PREDICTED: heat shock cognate 70 kDa protein 2     320   3e-102   Vitis vinifera
ref|XP_008223380.1|  PREDICTED: heat shock cognate 70 kDa protein...    320   3e-102   Prunus mume [ume]
ref|XP_010937646.1|  PREDICTED: heat shock cognate 70 kDa protein...    320   3e-102   Elaeis guineensis
gb|AGL07711.1|  heat shock protein 70                                   320   3e-102   Ziziphus jujuba [Chinese jujube]
ref|XP_002312089.1|  heat shock protein 70 cognate                      320   3e-102   
gb|KHN02428.1|  Heat shock cognate 70 kDa protein                       320   3e-102   Glycine soja [wild soybean]
ref|XP_009388623.1|  PREDICTED: heat shock cognate 70 kDa protein...    320   3e-102   Musa acuminata subsp. malaccensis [pisang utan]
gb|EAY98319.1|  hypothetical protein OsI_20227                          312   4e-102   Oryza sativa Indica Group [Indian rice]
ref|XP_007207204.1|  hypothetical protein PRUPE_ppa002646mg             319   4e-102   Prunus persica
ref|XP_003537997.1|  PREDICTED: heat shock cognate 70 kDa protein 2     319   4e-102   Glycine max [soybeans]
ref|XP_010095022.1|  Heat shock 70 kDa protein 4                        319   4e-102   Morus notabilis
gb|ACV52590.1|  heat shock protein 70-like protein                      304   4e-102   Nicotiana benthamiana
gb|KHN21966.1|  Heat shock cognate 70 kDa protein                       319   5e-102   Glycine soja [wild soybean]
gb|KHN27222.1|  Heat shock cognate 70 kDa protein 2                     319   5e-102   Glycine soja [wild soybean]
ref|XP_007132076.1|  hypothetical protein PHAVU_011G065000g             319   5e-102   Phaseolus vulgaris [French bean]
gb|AAA86903.1|  heat shock protein cognate 70                           305   6e-102   Sorghum bicolor [broomcorn]
gb|AFA51946.1|  heat shock protein 70                                   319   6e-102   Paeonia suffruticosa [moutan peony]
gb|EEC71767.1|  hypothetical protein OsI_04375                          312   6e-102   Oryza sativa Indica Group [Indian rice]
ref|XP_008660826.1|  PREDICTED: probable mediator of RNA polymera...    319   6e-102   Zea mays [maize]
ref|XP_008812042.1|  PREDICTED: heat shock cognate 70 kDa protein...    319   6e-102   Phoenix dactylifera
gb|AEK70336.1|  heat shock protein 70                                   319   7e-102   Paeonia lactiflora [common garden peony]
ref|XP_006365705.1|  PREDICTED: heat shock cognate 70 kDa protein...    319   7e-102   Solanum tuberosum [potatoes]
gb|KHN13891.1|  Heat shock cognate 70 kDa protein 2                     319   7e-102   Glycine soja [wild soybean]
ref|NP_001051724.1|  Os03g0821100                                       319   7e-102   
ref|XP_009102555.1|  PREDICTED: probable mediator of RNA polymera...    318   7e-102   Brassica rapa
ref|XP_010685795.1|  PREDICTED: heat shock cognate 70 kDa protein 2     318   7e-102   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008233611.1|  PREDICTED: heat shock cognate 70 kDa protein 2     318   7e-102   Prunus mume [ume]
gb|AAB42159.1|  Hsc70                                                   319   7e-102   Solanum lycopersicum
ref|XP_004505872.1|  PREDICTED: heat shock cognate 70 kDa protein...    318   7e-102   Cicer arietinum [garbanzo]
ref|XP_003552691.1|  PREDICTED: heat shock cognate 70 kDa protein...    318   8e-102   Glycine max [soybeans]
gb|AAP04522.1|  heat shock protein 70                                   318   8e-102   Nicotiana tabacum [American tobacco]
ref|XP_002311161.1|  heat shock protein 70                              318   8e-102   Populus trichocarpa [western balsam poplar]
ref|XP_009419750.1|  PREDICTED: heat shock cognate 70 kDa protein...    318   8e-102   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010319122.1|  PREDICTED: heat shock protein 70 isoform 3 i...    318   8e-102   Solanum lycopersicum
ref|XP_011028442.1|  PREDICTED: heat shock cognate 70 kDa protein...    318   9e-102   Populus euphratica
ref|NP_001266213.1|  heat shock protein 70 isoform 3                    318   9e-102   Solanum lycopersicum
gb|AAS09825.1|  heat shock cognate protein 70                           318   9e-102   Eutrema halophilum
ref|XP_011027580.1|  PREDICTED: heat shock cognate 70 kDa protein...    318   9e-102   Populus euphratica
ref|XP_004287404.1|  PREDICTED: heat shock cognate 70 kDa protein...    318   1e-101   Fragaria vesca subsp. vesca
gb|AAN86274.1|  non-cell-autonomous heat shock cognate protein 70       318   1e-101   Cucurbita maxima [Boston marrow]
ref|XP_009606077.1|  PREDICTED: heat shock cognate 70 kDa protein...    318   1e-101   Nicotiana tomentosiformis
ref|XP_007027052.1|  Heat shock cognate protein 70-1 isoform 1          318   1e-101   
ref|XP_006398709.1|  hypothetical protein EUTSA_v10012922mg             318   1e-101   Eutrema salsugineum [saltwater cress]
emb|CAB72129.1|  heat shock protein 70                                  318   1e-101   Cucumis sativus [cucumbers]
ref|NP_001183165.1|  uncharacterized protein LOC100501536               318   1e-101   Zea mays [maize]
gb|ACJ11742.1|  heat shock protein 70                                   318   1e-101   Gossypium hirsutum [American cotton]
emb|CAA31663.1|  hsp70 (AA 6 - 651)                                     318   1e-101   Petunia x hybrida [garden petunia]
gb|ACJ11745.1|  heat shock protein 70                                   318   1e-101   Gossypium hirsutum [American cotton]
ref|XP_007162654.1|  hypothetical protein PHAVU_001G169000g             318   1e-101   Phaseolus vulgaris [French bean]
ref|XP_008784528.1|  PREDICTED: heat shock cognate 70 kDa protein...    318   1e-101   Phoenix dactylifera
ref|XP_011016414.1|  PREDICTED: heat shock cognate 70 kDa protein 2     318   1e-101   Populus euphratica
ref|XP_007009369.1|  Heat shock protein 70                              318   1e-101   
gb|KCW74480.1|  hypothetical protein EUGRSUZ_E03189                     314   1e-101   Eucalyptus grandis [rose gum]
gb|AAS57913.1|  70 kDa heat shock cognate protein 2                     318   1e-101   Vigna radiata [mung bean]
ref|XP_009353696.1|  PREDICTED: probable mediator of RNA polymera...    314   1e-101   
gb|EYU26579.1|  hypothetical protein MIMGU_mgv1a002667mg                318   2e-101   Erythranthe guttata [common monkey flower]
gb|KFK24738.1|  hypothetical protein AALP_AA8G018100                    317   2e-101   Arabis alpina [alpine rockcress]
ref|XP_002283532.2|  PREDICTED: heat shock cognate 70 kDa protein 2     317   3e-101   Vitis vinifera
ref|XP_008241192.1|  PREDICTED: probable mediator of RNA polymera...    317   3e-101   Prunus mume [ume]
gb|AAS57912.1|  70 kDa heat shock cognate protein 1                     317   3e-101   Vigna radiata [mung bean]
ref|XP_011027667.1|  PREDICTED: probable mediator of RNA polymera...    313   3e-101   Populus euphratica
ref|XP_009778799.1|  PREDICTED: heat shock cognate 70 kDa protein...    317   3e-101   Nicotiana sylvestris
gb|KDP44987.1|  hypothetical protein JCGZ_01487                         317   4e-101   Jatropha curcas
ref|XP_007220208.1|  hypothetical protein PRUPE_ppa002641mg             317   4e-101   Prunus persica
ref|XP_008674843.1|  PREDICTED: heat shock 70 kDa protein-like          317   4e-101   Zea mays [maize]
gb|AAS57914.1|  70 kDa heat shock cognate protein 3                     317   4e-101   Vigna radiata [mung bean]
gb|EMT11425.1|  Heat shock cognate 70 kDa protein 1                     317   4e-101   
gb|AAA62445.1|  heat shock protein                                      316   6e-101   Spinacia oleracea
gb|KEH30132.1|  heat shock cognate 70 kDa protein                       314   6e-101   Medicago truncatula
ref|XP_006436010.1|  hypothetical protein CICLE_v10030928mg             316   6e-101   Citrus clementina [clementine]
ref|XP_004962705.1|  PREDICTED: probable mediator of RNA polymera...    316   7e-101   Setaria italica
ref|XP_002442353.1|  hypothetical protein SORBIDRAFT_08g018750          316   7e-101   Sorghum bicolor [broomcorn]
ref|XP_001759874.1|  predicted protein                                  316   7e-101   
gb|ACB70177.1|  70 kDa heat shock protein                               316   8e-101   Capparis spinosa [caper]
ref|XP_006488297.1|  PREDICTED: heat shock cognate 70 kDa protein...    316   8e-101   Citrus sinensis [apfelsine]
ref|XP_003564580.1|  PREDICTED: heat shock cognate 70 kDa protein       316   8e-101   Brachypodium distachyon [annual false brome]
ref|XP_006424799.1|  hypothetical protein CICLE_v10027981mg             316   8e-101   Citrus clementina [clementine]
ref|XP_007207158.1|  hypothetical protein PRUPE_ppa024477mg             315   8e-101   
gb|KEH30131.1|  heat shock cognate 70 kDa protein                       316   9e-101   Medicago truncatula
ref|XP_009115390.1|  PREDICTED: probable mediator of RNA polymera...    316   9e-101   Brassica rapa
gb|EPS68565.1|  hypothetical protein M569_06198                         316   9e-101   Genlisea aurea
ref|XP_009112006.1|  PREDICTED: probable mediator of RNA polymera...    312   1e-100   Brassica rapa
ref|XP_001767839.1|  predicted protein                                  316   1e-100   
gb|AIA22210.1|  heat shock protein 70                                   316   1e-100   Chrysanthemum indicum
ref|XP_009122772.1|  PREDICTED: LOW QUALITY PROTEIN: probable med...    315   1e-100   Brassica rapa
ref|XP_009357717.1|  PREDICTED: heat shock cognate 70 kDa protein...    315   1e-100   Pyrus x bretschneideri [bai li]
ref|XP_008674324.1|  PREDICTED: probable mediator of RNA polymera...    315   1e-100   
ref|XP_008458906.1|  PREDICTED: heat shock cognate 70 kDa protein...    316   1e-100   Cucumis melo [Oriental melon]
ref|XP_006429028.1|  hypothetical protein CICLE_v10011260mg             315   1e-100   Citrus clementina [clementine]
ref|XP_010669896.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    328   1e-100   Beta vulgaris subsp. vulgaris [field beet]
gb|AAB88009.1|  heat shock cognate protein HSC70                        315   1e-100   Brassica napus [oilseed rape]
ref|NP_001049712.1|  Os03g0276500                                       315   1e-100   
emb|CDP09035.1|  unnamed protein product                                315   1e-100   Coffea canephora [robusta coffee]
ref|WP_039310754.1|  molecular chaperone DnaK                           315   1e-100   Paenibacillus sp. IHB B 3415
gb|ACR38891.1|  heat shock protein 70                                   315   1e-100   Apopellia endiviifolia (species B)
ref|XP_006287234.1|  hypothetical protein CARUB_v10000420mg             315   1e-100   Capsella rubella
ref|XP_002456611.1|  hypothetical protein SORBIDRAFT_03g039360          315   2e-100   Sorghum bicolor [broomcorn]
gb|KEH30133.1|  heat shock cognate 70 kDa protein                       315   2e-100   Medicago truncatula
gb|ACM42161.1|  heat shock protein 70.58                                315   2e-100   Ageratina adenophora
ref|XP_006297174.1|  hypothetical protein CARUB_v10013178mg             315   2e-100   Capsella rubella
ref|XP_004307527.1|  PREDICTED: heat shock cognate 70 kDa protein 2     315   2e-100   Fragaria vesca subsp. vesca
ref|XP_009407484.1|  PREDICTED: probable mediator of RNA polymera...    315   2e-100   
ref|XP_004970526.1|  PREDICTED: probable mediator of RNA polymera...    315   2e-100   Setaria italica
ref|XP_001751923.1|  predicted protein                                  315   2e-100   
gb|EYU19900.1|  hypothetical protein MIMGU_mgv1a002641mg                315   2e-100   Erythranthe guttata [common monkey flower]
ref|XP_009414320.1|  PREDICTED: probable mediator of RNA polymera...    315   2e-100   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAB97316.1|  cytosolic heat shock 70 protein                         315   2e-100   Spinacia oleracea
ref|XP_008802761.1|  PREDICTED: heat shock cognate 70 kDa protein...    315   2e-100   Phoenix dactylifera
emb|CAA47948.2|  heat shock protein 70                                  315   3e-100   Oryza sativa Indica Group [Indian rice]
ref|XP_010534306.1|  PREDICTED: probable mediator of RNA polymera...    315   3e-100   Tarenaya hassleriana [spider flower]
ref|XP_002528432.1|  heat shock protein, putative                       315   3e-100   Ricinus communis
gb|AIU34470.1|  putative heat shock protein                             314   3e-100   Taraxacum brevicorniculatum
ref|NP_001119156.1|  heat shock cognate protein 70-1                    311   3e-100   Arabidopsis thaliana [mouse-ear cress]
dbj|BAP90755.1|  heat shock protein 70                                  314   3e-100   Chrysanthemum x morifolium [florist's chrysanthemum]
gb|AAC84134.1|  heat shock protein                                      298   3e-100   Cichorium intybus [radicchio]
ref|XP_008371627.1|  PREDICTED: heat shock cognate 70 kDa protein...    314   3e-100   
ref|XP_011027182.1|  PREDICTED: heat shock cognate 70 kDa protein...    314   3e-100   Populus euphratica
ref|XP_008776699.1|  PREDICTED: probable mediator of RNA polymera...    314   4e-100   Phoenix dactylifera
ref|XP_004981251.1|  PREDICTED: heat shock cognate 70 kDa protein...    314   4e-100   Setaria italica
gb|AGZ15406.1|  heat shock cognate 70 kDa protein                       314   5e-100   Phaseolus vulgaris [French bean]
ref|XP_009353695.1|  PREDICTED: heat shock cognate 70 kDa protein...    314   5e-100   Pyrus x bretschneideri [bai li]
ref|XP_002316294.1|  heat shock protein 70                              314   5e-100   Populus trichocarpa [western balsam poplar]
gb|EAY89457.1|  hypothetical protein OsI_10990                          307   5e-100   Oryza sativa Indica Group [Indian rice]
ref|XP_006436017.1|  hypothetical protein CICLE_v10033622mg             314   5e-100   Citrus clementina [clementine]
ref|XP_002441219.1|  hypothetical protein SORBIDRAFT_09g022580          314   6e-100   Sorghum bicolor [broomcorn]
ref|XP_002312090.1|  heat shock protein 70 cognate                      314   6e-100   Populus trichocarpa [western balsam poplar]
gb|EMT06830.1|  Heat shock cognate 70 kDa protein                       313   6e-100   
ref|XP_004961848.1|  PREDICTED: probable mediator of RNA polymera...    313   6e-100   Setaria italica
gb|ADZ46371.1|  HSP70                                                   313   7e-100   Malus hupehensis
ref|NP_176036.1|  heat shock protein ERD2                               312   8e-100   Arabidopsis thaliana [mouse-ear cress]
gb|ACD93209.1|  heat shock protein 70                                   314   9e-100   Camellia sinensis [black tea]
gb|KJB73858.1|  hypothetical protein B456_011G256600                    313   1e-99    Gossypium raimondii
ref|NP_001044757.1|  Os01g0840100                                       313   1e-99    
ref|XP_001783048.1|  predicted protein                                  313   1e-99    
ref|NP_001055754.1|  Os05g0460000                                       313   1e-99    
ref|XP_003621869.1|  Heat shock protein                                 313   1e-99    Medicago truncatula
gb|EMS51135.1|  Heat shock cognate 70 kDa protein                       312   1e-99    Triticum urartu
ref|XP_011027172.1|  PREDICTED: probable mediator of RNA polymera...    313   1e-99    Populus euphratica
ref|XP_006378715.1|  hypothetical protein POPTR_0010s21280g             313   1e-99    Populus trichocarpa [western balsam poplar]
ref|XP_003558228.1|  PREDICTED: heat shock cognate 70 kDa protein...    313   1e-99    Brachypodium distachyon [annual false brome]
ref|XP_010106444.1|  Heat shock cognate 70 kDa protein                  313   1e-99    Morus notabilis
gb|AAV97978.1|  heat shock protein hsp70                                313   2e-99    Saussurea medusa
ref|XP_008656365.1|  PREDICTED: probable mediator of RNA polymera...    313   2e-99    
ref|XP_004493886.1|  PREDICTED: probable mediator of RNA polymera...    312   2e-99    Cicer arietinum [garbanzo]
ref|XP_010918390.1|  PREDICTED: heat shock cognate 70 kDa protein...    312   2e-99    Elaeis guineensis
ref|XP_004156718.1|  PREDICTED: heat shock cognate 70 kDa protein...    313   2e-99    
gb|EMT07406.1|  Heat shock cognate 70 kDa protein 1                     312   2e-99    
dbj|BAJ91305.1|  predicted protein                                      312   2e-99    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EPS64948.1|  hypothetical protein M569_09829                         311   2e-99    Genlisea aurea
gb|AIU40169.1|  heat shock protein 70                                   312   3e-99    Saccharum arundinaceum
ref|XP_006644983.1|  PREDICTED: probable mediator of RNA polymera...    312   3e-99    
ref|XP_002891955.1|  early-responsive to dehydration 2                  311   3e-99    
ref|XP_006378714.1|  heat shock protein 70 cognate                      312   3e-99    Populus trichocarpa [western balsam poplar]
gb|KFK38606.1|  hypothetical protein AALP_AA3G135800                    303   3e-99    Arabis alpina [alpine rockcress]
ref|XP_004493999.1|  PREDICTED: heat shock cognate 70 kDa protein...    312   3e-99    
gb|AAB99745.1|  HSP70                                                   312   3e-99    Triticum aestivum [Canadian hard winter wheat]
ref|XP_008776656.1|  PREDICTED: heat shock cognate 70 kDa protein...    312   3e-99    Phoenix dactylifera
gb|EMT11692.1|  Heat shock cognate 70 kDa protein                       312   3e-99    
ref|XP_010473075.1|  PREDICTED: heat shock 70 kDa protein 3-like        311   4e-99    Camelina sativa [gold-of-pleasure]
ref|XP_011027180.1|  PREDICTED: heat shock cognate 70 kDa protein...    311   4e-99    Populus euphratica
gb|EYU33210.1|  hypothetical protein MIMGU_mgv1a002616mg                311   4e-99    Erythranthe guttata [common monkey flower]
ref|XP_010452093.1|  PREDICTED: probable mediator of RNA polymera...    311   4e-99    Camelina sativa [gold-of-pleasure]
ref|XP_010486515.1|  PREDICTED: heat shock 70 kDa protein 3-like        311   4e-99    Camelina sativa [gold-of-pleasure]
ref|XP_010423853.1|  PREDICTED: probable mediator of RNA polymera...    311   4e-99    Camelina sativa [gold-of-pleasure]
gb|EMS52605.1|  Heat shock cognate 70 kDa protein 1                     311   5e-99    Triticum urartu
dbj|BAK00257.1|  predicted protein                                      311   5e-99    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009380663.1|  PREDICTED: heat shock cognate 70 kDa protein...    311   5e-99    Musa acuminata subsp. malaccensis [pisang utan]
gb|EMS68426.1|  Heat shock cognate 70 kDa protein 4                     311   6e-99    Triticum urartu
ref|XP_004307259.1|  PREDICTED: probable mediator of RNA polymera...    311   6e-99    Fragaria vesca subsp. vesca
gb|ABX76301.1|  heat shock protein 70                                   311   6e-99    Ageratina adenophora
gb|ACD45076.1|  heat-shock protein 70                                   311   6e-99    Dactylis glomerata [cocksfoot]
gb|ABD32895.1|  Heat shock protein Hsp70                                311   7e-99    Medicago truncatula
ref|XP_003578898.1|  PREDICTED: heat shock cognate 70 kDa protein 2     311   7e-99    
gb|EMS65159.1|  Heat shock cognate 70 kDa protein                       312   8e-99    
emb|CCD74508.1|  early-responsive to dehydration 2                      310   9e-99    
ref|XP_009414319.1|  PREDICTED: heat shock cognate 70 kDa protein...    310   9e-99    
ref|XP_010231300.1|  PREDICTED: probable mediator of RNA polymera...    310   1e-98    
ref|NP_195870.1|  heat shock cognate protein 70-1                       310   1e-98    
ref|NP_187555.1|  heat shock protein 70-3                               310   1e-98    
emb|CAA52684.1|  heat shock protein 70 cognate                          310   1e-98    
gb|KHN13890.1|  Heat shock cognate 70 kDa protein 2                     312   1e-98    
ref|XP_001785822.1|  predicted protein                                  310   2e-98    
ref|XP_008369876.1|  PREDICTED: probable mediator of RNA polymera...    310   2e-98    
ref|XP_009338761.1|  PREDICTED: probable mediator of RNA polymera...    310   2e-98    
ref|XP_004984743.1|  PREDICTED: heat shock cognate 70 kDa protein...    310   2e-98    
dbj|BAK07857.1|  predicted protein                                      313   2e-98    
ref|XP_010464591.1|  PREDICTED: heat shock 70 kDa protein 3             309   3e-98    
ref|XP_002873056.1|  HSC70-1                                            310   3e-98    
ref|XP_008658250.1|  PREDICTED: uncharacterized protein LOC100272...    310   3e-98    
ref|XP_007144450.1|  hypothetical protein PHAVU_007G157200g             308   3e-98    
gb|AAM48131.1|AF509336_1  heat shock protein 70                         309   3e-98    
ref|XP_001767221.1|  predicted protein                                  309   5e-98    
ref|XP_008384260.1|  PREDICTED: heat shock 70 kDa protein isoform X1    309   5e-98    
ref|XP_003552695.1|  PREDICTED: heat shock cognate 70 kDa protein...    308   6e-98    
ref|XP_007144451.1|  hypothetical protein PHAVU_007G157200g             308   6e-98    
ref|XP_008802766.1|  PREDICTED: probable mediator of RNA polymera...    308   6e-98    
dbj|BAJ86014.1|  predicted protein                                      308   6e-98    
ref|XP_002465468.1|  hypothetical protein SORBIDRAFT_01g039390          308   6e-98    
emb|CDY50531.1|  BnaA01g30490D                                          308   7e-98    
ref|XP_004492128.1|  PREDICTED: heat shock cognate 70 kDa protein...    308   8e-98    
ref|XP_009120551.1|  PREDICTED: probable mediator of RNA polymera...    308   9e-98    
ref|XP_008812036.1|  PREDICTED: probable mediator of RNA polymera...    308   1e-97    
ref|XP_003625487.1|  Heat shock protein                                 310   1e-97    
ref|XP_004302715.1|  PREDICTED: probable mediator of RNA polymera...    308   1e-97    
ref|XP_009366205.1|  PREDICTED: heat shock 70 kDa protein               308   1e-97    
ref|XP_009135236.1|  PREDICTED: probable mediator of RNA polymera...    308   1e-97    
ref|XP_006649853.1|  PREDICTED: heat shock cognate 70 kDa protein...    308   1e-97    
emb|CDY00784.1|  BnaC03g37680D                                          308   1e-97    
ref|NP_001148198.1|  heat shock cognate 70 kDa protein 2                308   1e-97    
ref|NP_001167696.1|  heat shock cognate 70 kDa protein 2                307   1e-97    
emb|CDX73815.1|  BnaA03g32320D                                          308   2e-97    
gb|ACJ54890.1|  heat shock protein 70                                   307   2e-97    
ref|XP_010931247.1|  PREDICTED: heat shock cognate 70 kDa protein...    307   2e-97    
gb|ABF95267.1|  Heat shock cognate 70 kDa protein, putative, expr...    307   2e-97    
ref|XP_002468097.1|  hypothetical protein SORBIDRAFT_01g039530          307   2e-97    
gb|EYU19903.1|  hypothetical protein MIMGU_mgv1a002628mg                307   2e-97    
gb|EMS45385.1|  Heat shock cognate 70 kDa protein 1                     310   2e-97    
ref|XP_004307529.1|  PREDICTED: heat shock cognate 70 kDa protein...    307   2e-97    
gb|ACJ85522.1|  unknown                                                 307   2e-97    
ref|XP_003621886.1|  Heat shock protein                                 307   2e-97    
ref|XP_006407319.1|  hypothetical protein EUTSA_v10020257mg             307   3e-97    
ref|XP_009374678.1|  PREDICTED: probable mediator of RNA polymera...    306   3e-97    
ref|XP_010423854.1|  PREDICTED: probable mediator of RNA polymera...    292   3e-97    
ref|XP_009122774.1|  PREDICTED: LOW QUALITY PROTEIN: heat shock 7...    305   3e-97    
ref|XP_003563611.1|  PREDICTED: heat shock cognate 70 kDa protein...    306   3e-97    
ref|XP_006424798.1|  hypothetical protein CICLE_v10028007mg             306   3e-97    
gb|AFW88810.1|  hypothetical protein ZEAMMB73_832667                    310   4e-97    
sp|P29357.3|HSP7E_SPIOL  RecName: Full=Chloroplast envelope membr...    306   4e-97    
ref|XP_007203774.1|  hypothetical protein PRUPE_ppa002595mg             306   4e-97    
ref|XP_008458071.1|  PREDICTED: heat shock cognate 70 kDa protein...    291   5e-97    
emb|CDY52661.1|  BnaC01g38510D                                          306   5e-97    
ref|XP_010937656.1|  PREDICTED: probable mediator of RNA polymera...    306   6e-97    
ref|XP_007016452.1|  Heat shock cognate protein 70-1                    306   6e-97    
gb|ABR18415.1|  unknown                                                 306   6e-97    
ref|XP_004984739.1|  PREDICTED: probable mediator of RNA polymera...    306   7e-97    
ref|XP_002976219.1|  hypothetical protein SELMODRAFT_443120             305   1e-96    
ref|XP_002987127.1|  hypothetical protein SELMODRAFT_446858             305   1e-96    
gb|AAV98051.1|  heat shock protein 70                                   305   1e-96    
ref|XP_002873055.1|  predicted protein                                  305   1e-96    
ref|XP_010495044.1|  PREDICTED: probable mediator of RNA polymera...    304   1e-96    
dbj|BAK02194.1|  predicted protein                                      305   2e-96    
ref|XP_006368489.1|  heat shock protein 70 cognate                      305   2e-96    
ref|XP_010423825.1|  PREDICTED: LOW QUALITY PROTEIN: probable med...    305   2e-96    
gb|EMT17408.1|  Heat shock cognate 70 kDa protein                       305   2e-96    
ref|NP_195869.1|  heat shock protein 70                                 304   3e-96    
ref|XP_010484430.1|  PREDICTED: probable mediator of RNA polymera...    304   3e-96    
gb|KDP41951.1|  hypothetical protein JCGZ_26969                         304   3e-96    
ref|XP_010423858.1|  PREDICTED: probable mediator of RNA polymera...    304   3e-96    
gb|EMS65063.1|  Heat shock cognate 70 kDa protein                       304   4e-96    
ref|XP_010463615.1|  PREDICTED: probable mediator of RNA polymera...    304   4e-96    
ref|XP_007139236.1|  hypothetical protein PHAVU_008G012600g             303   6e-96    
ref|XP_011034570.1|  PREDICTED: heat shock 70 kDa protein isoform X1    303   7e-96    
ref|XP_003558220.1|  PREDICTED: heat shock cognate 70 kDa protein...    303   7e-96    
ref|XP_010490742.1|  PREDICTED: probable mediator of RNA polymera...    303   7e-96    
ref|XP_007216987.1|  hypothetical protein PRUPE_ppa002598mg             303   1e-95    
gb|ACT34017.1|  heat shock cognate 70 kDa protein                       302   1e-95    
ref|XP_007216991.1|  hypothetical protein PRUPE_ppa002591mg             302   2e-95    
ref|XP_004287145.1|  PREDICTED: heat shock 70 kDa protein               302   2e-95    
ref|XP_010265523.1|  PREDICTED: heat shock 70 kDa protein-like          302   2e-95    
ref|NP_187864.1|  heat shock protein 70-4                               302   2e-95    
ref|XP_007013854.1|  Heat shock protein 70B                             301   4e-95    
ref|XP_002884912.1|  hypothetical protein ARALYDRAFT_897465             301   5e-95    
gb|KJB20862.1|  hypothetical protein B456_003G169700                    301   5e-95    
ref|XP_008228833.1|  PREDICTED: heat shock 70 kDa protein               301   6e-95    
emb|CAA83548.1|  PsHSC71.0                                              300   8e-95    
ref|XP_010486980.1|  PREDICTED: probable mediator of RNA polymera...    300   9e-95    
ref|XP_010465032.1|  PREDICTED: probable mediator of RNA polymera...    300   9e-95    
ref|XP_010499184.1|  PREDICTED: probable mediator of RNA polymera...    300   9e-95    
gb|ACC93947.1|  heat-shock protein 70                                   300   9e-95    
ref|XP_007023492.1|  Heat shock protein 70B                             300   1e-94    
gb|KJB20110.1|  hypothetical protein B456_003G133400                    300   2e-94    
ref|XP_011034569.1|  PREDICTED: heat shock 70 kDa protein-like          299   2e-94    
ref|XP_010094064.1|  Heat shock cognate 70 kDa protein                  299   3e-94    
gb|EMT15100.1|  Heat shock cognate 70 kDa protein 1                     309   3e-94    
ref|XP_010456365.1|  PREDICTED: probable mediator of RNA polymera...    305   4e-94    
ref|XP_006297173.1|  hypothetical protein CARUB_v10013177mg             298   6e-94    
ref|XP_002968525.1|  hypothetical protein SELMODRAFT_440382             298   7e-94    
ref|XP_010273662.1|  PREDICTED: heat shock 70 kDa protein               298   7e-94    
ref|XP_009358419.1|  PREDICTED: heat shock 70 kDa protein-like          298   7e-94    
ref|XP_009354217.1|  PREDICTED: heat shock 70 kDa protein-like          298   8e-94    
ref|XP_006427662.1|  hypothetical protein CICLE_v10025114mg             298   8e-94    
gb|KDP41952.1|  hypothetical protein JCGZ_26970                         298   8e-94    
ref|XP_006486093.1|  PREDICTED: probable mediator of RNA polymera...    306   8e-94    
ref|XP_001781229.1|  predicted protein                                  298   9e-94    
gb|KJB83911.1|  hypothetical protein B456_013G270600                    298   1e-93    
gb|KJB49429.1|  hypothetical protein B456_008G119200                    296   1e-93    
emb|CAA05547.1|  heat shock protein 70                                  297   1e-93    
ref|XP_010273661.1|  PREDICTED: heat shock 70 kDa protein-like          297   1e-93    
ref|XP_008342822.1|  PREDICTED: heat shock 70 kDa protein-like          297   2e-93    
ref|XP_010094065.1|  Heat shock 70 kDa protein                          297   2e-93    
ref|XP_006427666.1|  hypothetical protein CICLE_v10025102mg             297   2e-93    
gb|KFK37144.1|  hypothetical protein AALP_AA4G218800                    295   3e-93    
ref|XP_002512742.1|  heat shock protein, putative                       296   3e-93    
ref|XP_002512741.1|  heat shock protein, putative                       296   3e-93    
ref|XP_008353760.1|  PREDICTED: heat shock 70 kDa protein isoform X4    296   3e-93    
ref|XP_008353758.1|  PREDICTED: heat shock 70 kDa protein isoform X2    296   4e-93    
ref|XP_008342821.1|  PREDICTED: heat shock 70 kDa protein-like          296   4e-93    
ref|XP_009615698.1|  PREDICTED: heat shock 70 kDa protein               296   4e-93    
ref|XP_009357719.1|  PREDICTED: heat shock cognate 70 kDa protein...    296   5e-93    
ref|XP_008353759.1|  PREDICTED: heat shock 70 kDa protein isoform X3    296   6e-93    
ref|XP_010063598.1|  PREDICTED: heat shock 70 kDa protein               295   8e-93    
ref|XP_008353757.1|  PREDICTED: heat shock 70 kDa protein isoform X1    295   8e-93    
ref|XP_004507753.1|  PREDICTED: heat shock 70 kDa protein-like          295   1e-92    
ref|XP_011082530.1|  PREDICTED: heat shock 70 kDa protein-like          295   1e-92    
ref|XP_006368490.1|  heat shock protein 70 cognate                      295   1e-92    
gb|KDO55354.1|  hypothetical protein CISIN_1g043296mg                   295   1e-92    
ref|XP_006493389.1|  PREDICTED: heat shock 70 kDa protein-like          295   1e-92    
ref|XP_006341414.1|  PREDICTED: heat shock cognate 70 kDa protein...    295   2e-92    
gb|EYU21748.1|  hypothetical protein MIMGU_mgv1a020843mg                295   2e-92    
ref|XP_010318701.1|  PREDICTED: heat shock 70 kDa protein 5             294   2e-92    
ref|XP_003549537.1|  PREDICTED: heat shock 70 kDa protein-like is...    294   2e-92    
gb|AAA82975.1|  PsHSP71.2                                               294   2e-92    
ref|XP_009354216.1|  PREDICTED: heat shock 70 kDa protein-like          294   2e-92    
gb|KFK32679.1|  hypothetical protein AALP_AA6G274700                    293   3e-92    
emb|CDO98244.1|  unnamed protein product                                293   4e-92    
ref|XP_008365320.1|  PREDICTED: heat shock 70 kDa protein               293   5e-92    
ref|XP_003610287.1|  Heat-shock protein                                 293   6e-92    
ref|XP_009789460.1|  PREDICTED: heat shock 70 kDa protein               293   7e-92    
ref|XP_008450536.1|  PREDICTED: heat shock 70 kDa protein               293   8e-92    
dbj|BAA04848.1|  HSP70                                                  293   8e-92    
ref|XP_011073307.1|  PREDICTED: heat shock 70 kDa protein-like          292   1e-91    
gb|KCW70839.1|  hypothetical protein EUGRSUZ_F03980                     295   1e-91    
ref|XP_008342826.1|  PREDICTED: heat shock 70 kDa protein-like          292   1e-91    
ref|XP_003519161.1|  PREDICTED: heat shock 70 kDa protein-like          292   2e-91    
sp|P11143.2|HSP70_MAIZE  RecName: Full=Heat shock 70 kDa protein        291   2e-91    
ref|XP_010678398.1|  PREDICTED: heat shock 70 kDa protein-like          291   2e-91    
ref|XP_006346613.1|  PREDICTED: heat shock 70 kDa protein-like          291   4e-91    
ref|XP_008354483.1|  PREDICTED: heat shock cognate 70 kDa protein...    283   4e-91    
ref|XP_004152854.1|  PREDICTED: heat shock 70 kDa protein-like          290   6e-91    
ref|XP_007154870.1|  hypothetical protein PHAVU_003G154800g             290   6e-91    
ref|XP_006290203.1|  hypothetical protein CARUB_v10003889mg             290   7e-91    
ref|XP_010063602.1|  PREDICTED: probable mediator of RNA polymera...    286   1e-90    
ref|XP_002277050.1|  PREDICTED: heat shock 70 kDa protein               289   3e-90    
gb|KDP38702.1|  hypothetical protein JCGZ_04055                         288   3e-90    
prf||1205208A  heat shock protein hsp70                                 288   5e-90 
ref|XP_009399566.1|  PREDICTED: heat shock 70 kDa protein-like          287   1e-89    
emb|CBI31691.3|  unnamed protein product                                281   1e-89    
ref|XP_010063601.1|  PREDICTED: probable mediator of RNA polymera...    285   1e-89    
ref|XP_002987209.1|  hypothetical protein SELMODRAFT_125427             286   2e-89    
ref|XP_002976367.1|  hypothetical protein SELMODRAFT_443126             286   2e-89    
gb|ABK25453.1|  unknown                                                 286   2e-89    
ref|XP_010063600.1|  PREDICTED: heat shock 70 kDa protein 5-like ...    286   2e-89    
ref|XP_010063599.1|  PREDICTED: heat shock 70 kDa protein-like is...    286   3e-89    
emb|CDP02832.1|  unnamed protein product                                286   3e-89    
sp|P26413.1|HSP70_SOYBN  RecName: Full=Heat shock 70 kDa protein        286   3e-89    
ref|XP_002884737.1|  heat shock cognate 70 kDa protein 3                286   4e-89    
ref|XP_010537859.1|  PREDICTED: LOW QUALITY PROTEIN: heat shock 7...    285   6e-89    
gb|KHN14134.1|  Heat shock 70 kDa protein                               285   8e-89    
gb|KDO67637.1|  hypothetical protein CISIN_1g041815mg                   279   1e-88    
gb|AGT97046.1|  heat shock protein 70                                   284   2e-88    
ref|XP_008794364.1|  PREDICTED: heat shock 70 kDa protein-like          284   2e-88    
emb|CAN66715.1|  hypothetical protein VITISV_041184                     283   3e-88    
ref|XP_011079384.1|  PREDICTED: heat shock 70 kDa protein               283   3e-88    
gb|KCW53915.1|  hypothetical protein EUGRSUZ_J03127                     282   8e-88    
ref|XP_002279097.1|  PREDICTED: heat shock cognate 70 kDa protein       282   8e-88    
ref|XP_010929169.1|  PREDICTED: heat shock 70 kDa protein-like          282   9e-88    
ref|XP_010091163.1|  Heat shock 70 kDa protein                          282   1e-87    
ref|XP_010905019.1|  PREDICTED: heat shock 70 kDa protein               282   1e-87    
ref|XP_006416851.1|  hypothetical protein EUTSA_v10007031mg             281   1e-87    
emb|CAA54419.1|  heat shock cognate 70-1                                281   2e-87    
ref|XP_004292167.1|  PREDICTED: heat shock cognate 70 kDa protein...    278   2e-87    
ref|XP_002303859.2|  heat shock protein 70 cognate                      281   3e-87    
ref|XP_010034044.1|  PREDICTED: heat shock 70 kDa protein-like          281   3e-87    
ref|XP_006826662.1|  hypothetical protein AMTR_s00137p00032560          281   3e-87    
dbj|BAJ34597.1|  unnamed protein product                                280   6e-87    
ref|XP_008864395.1|  hsp70-like protein                                 269   2e-86    
gb|ETL43818.1|  hsp70-like protein                                      264   2e-86    
ref|XP_006392363.1|  hypothetical protein EUTSA_v10023343mg             278   2e-86    
ref|XP_006436005.1|  hypothetical protein CICLE_v10033341mg             272   2e-86    
ref|XP_006343624.1|  PREDICTED: heat shock 70 kDa protein-like          278   3e-86    
ref|XP_009771888.1|  PREDICTED: heat shock 70 kDa protein-like          278   5e-86    
gb|ETM50132.1|  hsp70-like protein                                      263   5e-86    
ref|NP_173055.1|  heat shock protein 70B                                277   6e-86    
ref|XP_010687621.1|  PREDICTED: heat shock 70 kDa protein-like          277   8e-86    
dbj|BAM44861.1|  heat shock protein                                     267   8e-86    
ref|XP_004242612.1|  PREDICTED: heat shock 70 kDa protein-like          277   1e-85    
gb|AAL68968.1|  heat shock protein 70                                   276   1e-85    
ref|XP_009149047.1|  PREDICTED: heat shock 70 kDa protein 5             276   1e-85    
gb|EYU34331.1|  hypothetical protein MIMGU_mgv1a021436mg                276   1e-85    
gb|EPS69582.1|  heat shock protein hsp70                                275   2e-85    
ref|XP_009622824.1|  PREDICTED: heat shock 70 kDa protein-like          276   2e-85    
dbj|BAE48223.1|  heat shock protein 70                                  276   2e-85    
gb|AAM94003.1|  heat shock protein 70                                   262   3e-85    
ref|XP_008931816.1|  PREDICTED: heat shock cognate 71 kDa protein...    261   3e-85    
sp|P26791.1|HSP70_DAUCA  RecName: Full=Heat shock 70 kDa protein        276   3e-85    
ref|XP_010476705.1|  PREDICTED: heat shock 70 kDa protein 5             275   3e-85    
ref|XP_005843891.1|  heat shock protein 70                              275   3e-85    
ref|XP_004292156.2|  PREDICTED: probable mediator of RNA polymera...    273   4e-85    
gb|AFP57558.1|  heat shock cognate protein 70                           264   5e-85    
ref|XP_010497610.1|  PREDICTED: heat shock 70 kDa protein 5-like        275   5e-85    
ref|XP_006436009.1|  hypothetical protein CICLE_v10030893mg             275   7e-85    
ref|XP_010459142.1|  PREDICTED: heat shock 70 kDa protein 5-like        275   7e-85    
ref|XP_008891371.1|  hsp70-like protein                                 261   9e-85    



>gb|AFV46216.1| hypothetical protein, partial [Scutellaria baicalensis]
Length=233

 Score =   322 bits (826),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 152/160 (95%), Positives = 157/160 (98%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNP NTVFDAKRLIGRRFSD SVQSD+KLWPFKVIPGPGDKPMIVVN+KGEEK+F+A
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPGDKPMIVVNHKGEEKQFSA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVLTKMKEIAEAYLGST+KNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLTKMKEIAEAYLGSTIKNAVVTVPAYFNDSQRQ  160



>emb|CDY02235.1| BnaA03g39320D [Brassica napus]
Length=185

 Score =   315 bits (808),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 147/160 (92%), Positives = 156/160 (98%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNPINTVFDAKRLIGRRFSD+SVQSD+KLWPFK+IPGP DKPMIVV+YKGEEK+FAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDMKLWPFKIIPGPADKPMIVVSYKGEEKQFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KM+EIAEAYLG T+KNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLIKMREIAEAYLGVTIKNAVVTVPAYFNDSQRQ  160



>emb|CDX89754.1| BnaC03g46680D [Brassica napus]
Length=224

 Score =   316 bits (810),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 147/160 (92%), Positives = 156/160 (98%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  40   MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  99

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNPINTVFDAKRLIGRRFSD+SVQSD+KLWPFK+IPGP DKPMIVV+YKGEEK+FAA
Sbjct  100  QVAMNPINTVFDAKRLIGRRFSDASVQSDMKLWPFKIIPGPADKPMIVVSYKGEEKQFAA  159

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KM+EIAEAYLG T+KNAVVTVPAYFNDSQRQ
Sbjct  160  EEISSMVLIKMREIAEAYLGVTIKNAVVTVPAYFNDSQRQ  199



>emb|CDY53148.1| BnaAnng12070D [Brassica napus]
Length=256

 Score =   317 bits (812),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 148/160 (93%), Positives = 156/160 (98%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNPINTVFDAKRLIGRRFSDSSVQSD+KLWPFK+IPGP DKPMIVV+YKGEEK+FAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDSSVQSDMKLWPFKIIPGPADKPMIVVSYKGEEKQFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KM+EIAEAYLG T+KNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLIKMREIAEAYLGVTIKNAVVTVPAYFNDSQRQ  160



>ref|XP_008447699.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Cucumis melo]
Length=647

 Score =   329 bits (843),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 156/160 (98%), Positives = 158/160 (99%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEK+FAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKQFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KM+EIAEAYLGSTVKNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQ  160



>ref|XP_010553033.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e [Tarenaya hassleriana]
Length=652

 Score =   329 bits (843),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 155/160 (97%), Positives = 159/160 (99%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEK+FAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKQFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KM+EIAEAYLG+T+KNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLIKMREIAEAYLGTTIKNAVVTVPAYFNDSQRQ  160



>gb|EYU41710.1| hypothetical protein MIMGU_mgv1a022248mg, partial [Erythranthe 
guttata]
Length=371

 Score =   320 bits (820),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 148/160 (93%), Positives = 159/160 (99%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD+ERLIGDAAKN
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNP+NTVFDAKRLIGRRF+D+SVQSDIKLWPFK+IPGPGDKP+IVVNYKGE+K+FAA
Sbjct  61   QVAMNPVNTVFDAKRLIGRRFNDASVQSDIKLWPFKLIPGPGDKPLIVVNYKGEDKQFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KM+EIAEA+LGSTVKNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLIKMREIAEAFLGSTVKNAVVTVPAYFNDSQRQ  160



>emb|CDY16175.1| BnaA09g29090D [Brassica napus]
Length=257

 Score =   316 bits (809),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 148/159 (93%), Positives = 155/159 (97%), Gaps = 0/159 (0%)
 Frame = +2

Query  83   AGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKNQ  262
            AGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKNQ
Sbjct  3    AGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQ  62

Query  263  VAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAAE  442
            VAMNPINTVFDAKRLIGRRFSDSSVQSD+KLWPFK+IPGP DKPMIVV+YKGEEK+FAAE
Sbjct  63   VAMNPINTVFDAKRLIGRRFSDSSVQSDMKLWPFKIIPGPADKPMIVVDYKGEEKQFAAE  122

Query  443  EISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EISSMVL KM+EIAEAYLG T+KNAVVTVPAYFNDSQRQ
Sbjct  123  EISSMVLIKMREIAEAYLGVTIKNAVVTVPAYFNDSQRQ  161



>ref|XP_002532297.1| heat shock protein, putative [Ricinus communis]
 gb|EEF30081.1| heat shock protein, putative [Ricinus communis]
Length=652

 Score =   328 bits (842),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 154/160 (96%), Positives = 159/160 (99%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNPINTVFDAKRLIGRRFSD+SVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEK+FAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKQFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KM+EIAEAYLG+T+KNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLIKMREIAEAYLGTTIKNAVVTVPAYFNDSQRQ  160



>ref|XP_009592776.1| PREDICTED: heat shock cognate 70 kDa protein 1-like [Nicotiana 
tomentosiformis]
Length=648

 Score =   328 bits (841),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 155/160 (97%), Positives = 158/160 (99%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNPINTVFDAKRLIGRRFSD+SVQ D+KLWPFKVIPGPGDKPMIVVNYKGEEK+FAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDTSVQGDMKLWPFKVIPGPGDKPMIVVNYKGEEKQFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  160



>sp|P09189.1|HSP7C_PETHY RecName: Full=Heat shock cognate 70 kDa protein [Petunia x hybrida]
 emb|CAA30018.1| heat shock protein 70 [Petunia x hybrida]
Length=651

 Score =   328 bits (841),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 155/160 (97%), Positives = 158/160 (99%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNPINTVFDAKRLIGRRFSD SVQSDIKLWPFKVIPGPGDKPMIVV YKGEEK+FAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDPSVQSDIKLWPFKVIPGPGDKPMIVVTYKGEEKQFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVLTKMKEIAEAYLG+T+KNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLTKMKEIAEAYLGTTIKNAVVTVPAYFNDSQRQ  160



>emb|CDP09040.1| unnamed protein product [Coffea canephora]
Length=649

 Score =   328 bits (841),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 154/160 (96%), Positives = 158/160 (99%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNP NTVFDAKRLIGRRFSD+SVQSDIKLWPFKVIPGPGDKPMI+VNYKGEEK+FAA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIIVNYKGEEKQFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EE+SSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ
Sbjct  121  EEVSSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  160



>ref|XP_010558317.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e [Tarenaya hassleriana]
Length=654

 Score =   328 bits (842),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 154/160 (96%), Positives = 159/160 (99%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEK+FAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKQFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KM+EIAEAYLG+T+KNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLIKMREIAEAYLGTTIKNAVVTVPAYFNDSQRQ  160



>ref|XP_006350760.1| PREDICTED: heat shock cognate 70 kDa protein 1-like [Solanum 
tuberosum]
Length=648

 Score =   328 bits (840),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 155/160 (97%), Positives = 158/160 (99%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNPINTVFDAKRLIGRRFSD+SVQ D+KLWPFKVIPGPGDKPMIVV YKGEEKEFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQEDMKLWPFKVIPGPGDKPMIVVTYKGEEKEFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVLTKMKEIAEA+LGSTVKNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQ  160



>emb|CCA29120.1| heat shock protein 70 isoform 1 [Solanum lycopersicum]
Length=648

 Score =   328 bits (840),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 155/160 (97%), Positives = 158/160 (99%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNPINTVFDAKRLIGRRFSD+SVQ D+KLWPFKVIPGPGDKPMIVV YKGEEKEFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQEDMKLWPFKVIPGPGDKPMIVVTYKGEEKEFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVLTKMKEIAEA+LGSTVKNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQ  160



>gb|AFU34347.1| 70-kDa heat shock protein [Ipomoea batatas]
 gb|AFU34348.1| 70-kDa heat shock protein [Ipomoea batatas]
 gb|AFU34349.1| 70-kDa heat shock protein [Ipomoea batatas]
 gb|AFU34350.1| 70-kDa heat shock protein [Ipomoea batatas]
Length=652

 Score =   327 bits (839),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 155/160 (97%), Positives = 158/160 (99%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNPINTVFDAKRLIGRRF+D+SVQSDIKLWPFKVIPGPGDKPMIVV YKGEEKEFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVIPGPGDKPMIVVTYKGEEKEFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  160



>ref|XP_011094842.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Sesamum indicum]
Length=646

 Score =   327 bits (838),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 154/160 (96%), Positives = 158/160 (99%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNP NTVFDAKRLIGRRF+D+SVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEK+FAA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFTDASVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKQFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KM+EIAEAYLGSTVKNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLMKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQ  160



>gb|EAY81899.1| hypothetical protein OsI_37065 [Oryza sativa Indica Group]
Length=434

 Score =   320 bits (821),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 151/160 (94%), Positives = 157/160 (98%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNPINTVFDAKRLIGRRFSD+SVQSDIKLWPFKVI GPGDKPMIVV YKGEEK+FAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDIKLWPFKVIAGPGDKPMIVVQYKGEEKQFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KM+EIAEAYLG+T+KNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLIKMREIAEAYLGTTIKNAVVTVPAYFNDSQRQ  160



>ref|NP_001234491.1| heat shock cognate 70 kDa protein 1 [Solanum lycopersicum]
 sp|P24629.1|HSP71_SOLLC RecName: Full=Heat shock cognate 70 kDa protein 1 [Solanum lycopersicum]
 emb|CAA37970.1| heat shock protein cognate 70 [Solanum lycopersicum]
Length=650

 Score =   327 bits (838),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 154/160 (96%), Positives = 158/160 (99%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVA+NPINTVFDAKRLIGRRFSD+SVQ D+KLWPFKVIPGPGDKPMIVV YKGEEKEFAA
Sbjct  61   QVALNPINTVFDAKRLIGRRFSDASVQEDMKLWPFKVIPGPGDKPMIVVTYKGEEKEFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVLTKMKEIAEA+LGSTVKNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQ  160



>ref|XP_004142076.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e-like [Cucumis sativus]
 ref|XP_004161675.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e-like [Cucumis sativus]
 gb|KGN54238.1| Heat shock protein 70 [Cucumis sativus]
Length=647

 Score =   327 bits (838),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 154/160 (96%), Positives = 158/160 (99%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMI+V+YKGEEK+FAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIIVSYKGEEKQFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KM+EIAEAYLGSTVKNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQ  160



>gb|KDO72893.1| hypothetical protein CISIN_1g036208mg, partial [Citrus sinensis]
Length=279

 Score =   315 bits (806),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 149/160 (93%), Positives = 154/160 (96%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNP NTVFDAKRLIGRRFSD SVQSD+KLWPFKVI G GDKPMIVVNYKGEEK+F+A
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIAGAGDKPMIVVNYKGEEKQFSA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KMKEIAEAYLG+T+KNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLNKMKEIAEAYLGTTIKNAVVTVPAYFNDSQRQ  160



>emb|CDX85038.1| BnaC05g20170D [Brassica napus]
Length=263

 Score =   313 bits (803),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 147/159 (92%), Positives = 154/159 (97%), Gaps = 0/159 (0%)
 Frame = +2

Query  83   AGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKNQ  262
             GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKNQ
Sbjct  3    GGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQ  62

Query  263  VAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAAE  442
            VAMNPINTVFDAKRLIGRRFSDSSVQSD+KLWPFK+IPGP DKPMIVV+YKGEEK+FAAE
Sbjct  63   VAMNPINTVFDAKRLIGRRFSDSSVQSDMKLWPFKIIPGPADKPMIVVSYKGEEKQFAAE  122

Query  443  EISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EISSMVL KM+EIAEAYLG T+KNAVVTVPAYFNDSQRQ
Sbjct  123  EISSMVLIKMREIAEAYLGVTIKNAVVTVPAYFNDSQRQ  161



>gb|KJB16980.1| hypothetical protein B456_002G258500 [Gossypium raimondii]
Length=613

 Score =   325 bits (833),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 154/160 (96%), Positives = 157/160 (98%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNPINTVFDAKRLIGRRF+DSSVQSDIKLWPFKVI GPGDKPMIVVNYKGEEK+FAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFTDSSVQSDIKLWPFKVIAGPGDKPMIVVNYKGEEKQFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KM+EIAEAYLG TVKNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLIKMREIAEAYLGFTVKNAVVTVPAYFNDSQRQ  160



>emb|CDY31804.1| BnaC01g27600D [Brassica napus]
Length=417

 Score =   319 bits (817),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 149/160 (93%), Positives = 156/160 (98%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNPINTVFDAKRLIGRRFSDSSVQSD+KLWPFK+IPGP DKPMIVVNYKGEEK+FAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDSSVQSDMKLWPFKIIPGPADKPMIVVNYKGEEKQFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KM+EIAEAYLG T+KNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLIKMREIAEAYLGVTIKNAVVTVPAYFNDSQRQ  160



>ref|XP_007027053.1| Heat shock cognate protein 70-1 isoform 2, partial [Theobroma 
cacao]
 gb|EOY07555.1| Heat shock cognate protein 70-1 isoform 2, partial [Theobroma 
cacao]
Length=457

 Score =   320 bits (820),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 150/161 (93%), Positives = 157/161 (98%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   IMAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAK  256
            +MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAK
Sbjct  16   VMAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAK  75

Query  257  NQVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFA  436
            NQVAMNP+NTVFDAKRLIGRRFSD+SVQSDIKLWPFKVI GPGDKPMIVV+YKGEEK+FA
Sbjct  76   NQVAMNPVNTVFDAKRLIGRRFSDASVQSDIKLWPFKVISGPGDKPMIVVSYKGEEKQFA  135

Query  437  AEEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            AEEISSMVL KM+EIAEA+LG  VKNAVVTVPAYFNDSQRQ
Sbjct  136  AEEISSMVLMKMREIAEAFLGFAVKNAVVTVPAYFNDSQRQ  176



>emb|CDY36723.1| BnaC02g31440D [Brassica napus]
Length=195

 Score =   311 bits (796),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 146/160 (91%), Positives = 155/160 (97%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDR+EIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRIEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNPINTVFDAKRLIGRRFSD+SVQSD+KLWPFK+IPGP DKPMIVV+YKGEEK+FAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDMKLWPFKIIPGPADKPMIVVSYKGEEKQFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KM+EIAEAYLG T+KN VVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLIKMREIAEAYLGVTIKNDVVTVPAYFNDSQRQ  160



>ref|XP_011077460.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Sesamum 
indicum]
Length=646

 Score =   326 bits (835),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 153/160 (96%), Positives = 158/160 (99%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNP NTVFDAKRLIGRRF+D+SVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEK+FAA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFTDASVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKQFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KM+EIAEAYLG+TVKNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLMKMREIAEAYLGATVKNAVVTVPAYFNDSQRQ  160



>ref|XP_004249574.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Solanum lycopersicum]
Length=644

 Score =   325 bits (834),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 152/160 (95%), Positives = 159/160 (99%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNPINTVFDAKRLIGRRFSD+SVQSD+KLWPFKVIPGPGDKPMIVVNYKGEEK+F+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDMKLWPFKVIPGPGDKPMIVVNYKGEEKQFSA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KMKEIAEA+LG+TVKNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLIKMKEIAEAFLGTTVKNAVVTVPAYFNDSQRQ  160



>ref|XP_004142749.1| PREDICTED: heat shock cognate 70 kDa protein-like isoform 1 [Cucumis 
sativus]
 ref|XP_004156712.1| PREDICTED: heat shock cognate 70 kDa protein-like isoform 1 [Cucumis 
sativus]
 gb|KGN51294.1| hypothetical protein Csa_5G514500 [Cucumis sativus]
Length=648

 Score =   325 bits (834),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 153/160 (96%), Positives = 158/160 (99%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNP+NTVFDAKRLIGRRFSD SVQSD+KLWPFKVIPGPGDKPMIVVNYKGEEK+FAA
Sbjct  61   QVAMNPLNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPGDKPMIVVNYKGEEKQFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVLTKM+EIAEAYLGS+VKNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLTKMREIAEAYLGSSVKNAVVTVPAYFNDSQRQ  160



>gb|KJB55903.1| hypothetical protein B456_009G100400 [Gossypium raimondii]
Length=650

 Score =   325 bits (834),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 154/160 (96%), Positives = 157/160 (98%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNP NTVFDAKRLIGRRFSDSSVQSD+KLWPFKVIPGPGDKPMIVV YKGEEK+FAA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDSSVQSDMKLWPFKVIPGPGDKPMIVVTYKGEEKQFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KMKEIAEAYLGST+KNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLMKMKEIAEAYLGSTIKNAVVTVPAYFNDSQRQ  160



>ref|XP_006349514.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Solanum 
tuberosum]
Length=647

 Score =   325 bits (834),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 152/160 (95%), Positives = 159/160 (99%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNPINTVFDAKRLIGRRFSD+SVQSD+KLWPFKVIPGPGDKPMIVVNYKGE+K+F+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDMKLWPFKVIPGPGDKPMIVVNYKGEDKQFSA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KMKEIAEA+LGSTVKNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLIKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQ  160



>gb|KDP44975.1| hypothetical protein JCGZ_01475 [Jatropha curcas]
Length=617

 Score =   325 bits (832),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 153/160 (96%), Positives = 157/160 (98%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNPINTVFDAKRLIGRRF+D+SVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEK+FAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFTDASVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKQFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KM+EIAEAYLG TVKNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLIKMREIAEAYLGITVKNAVVTVPAYFNDSQRQ  160



>ref|XP_003521330.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e [Glycine max]
 gb|KHN09419.1| Heat shock cognate 70 kDa protein [Glycine soja]
Length=653

 Score =   326 bits (835),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 155/160 (97%), Positives = 157/160 (98%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPG  DKPMIVVNYKGEEK+FAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGAADKPMIVVNYKGEEKQFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KM+EIAEAYLGSTVKNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQ  160



>ref|XP_004250958.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Solanum 
lycopersicum]
Length=649

 Score =   325 bits (834),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 153/160 (96%), Positives = 158/160 (99%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNPINTVFDAKRLIGRRFSD+SVQSDIKLWPFKV PGPGDKPMIVVNYKGEEK+F+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDIKLWPFKVTPGPGDKPMIVVNYKGEEKQFSA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KMKEIAEA+LGSTVKNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLIKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQ  160



>gb|AAR17080.1| heat shock protein 70-3 [Nicotiana tabacum]
Length=648

 Score =   325 bits (834),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 154/160 (96%), Positives = 158/160 (99%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNPINTVFDAKRLIGRRFSD+SVQSDIKLWPFKVI GPGDKPMIVVNYKGEEK+FAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDIKLWPFKVISGPGDKPMIVVNYKGEEKQFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KMKEIAEA+LGSTVKNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLIKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQ  160



>ref|XP_009622753.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Nicotiana 
tomentosiformis]
Length=649

 Score =   325 bits (834),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 153/160 (96%), Positives = 158/160 (99%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNPINTVFDAKRLIGRRF+D+SVQSDIK WPFKVIPGPGDKPMIVVNYKGEEK+FAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFADASVQSDIKHWPFKVIPGPGDKPMIVVNYKGEEKQFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KM+EIAEA+LGSTVKNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLIKMREIAEAFLGSTVKNAVVTVPAYFNDSQRQ  160



>ref|XP_009620324.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Nicotiana 
tomentosiformis]
Length=648

 Score =   325 bits (833),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 154/160 (96%), Positives = 158/160 (99%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNPINTVFDAKRLIGRRFSD+SVQSDIKLWPFKVI GPGDKPMIVVNYKGEEK+FAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDIKLWPFKVISGPGDKPMIVVNYKGEEKQFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KMKEIAEA+LGSTVKNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLIKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQ  160



>ref|XP_006348998.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Solanum 
tuberosum]
Length=649

 Score =   325 bits (833),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 153/160 (96%), Positives = 158/160 (99%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNPINTVFDAKRLIGRRFSD+SVQSDIKLWPFKV PGPGDKPMIVVNYKGEEK+F+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDIKLWPFKVTPGPGDKPMIVVNYKGEEKQFSA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KMKEIAEA+LGSTVKNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLIKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQ  160



>ref|XP_009785159.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Nicotiana 
sylvestris]
 dbj|BAM24707.1| Heat shock protein 70 [Nicotiana tabacum]
Length=649

 Score =   325 bits (833),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 153/160 (96%), Positives = 158/160 (99%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNPINTVFDAKRLIGRRF+D+SVQSDIK WPFKVIPGPGDKPMIVVNYKGEEK+FAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFADASVQSDIKHWPFKVIPGPGDKPMIVVNYKGEEKQFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KM+EIAEA+LGSTVKNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLIKMREIAEAFLGSTVKNAVVTVPAYFNDSQRQ  160



>ref|XP_002284008.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Vitis vinifera]
 emb|CAN81694.1| hypothetical protein VITISV_017873 [Vitis vinifera]
Length=648

 Score =   325 bits (833),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 155/160 (97%), Positives = 157/160 (98%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVV YKGEEK+FAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVVYKGEEKQFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KM+EIAEAYLGSTVKNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQ  160



>ref|XP_009777579.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Nicotiana 
sylvestris]
Length=648

 Score =   325 bits (833),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 154/160 (96%), Positives = 158/160 (99%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNPINTVFDAKRLIGRRFSD+SVQSDIKLWPFKVI GPGDKPMIVVNYKGEEK+FAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDIKLWPFKVISGPGDKPMIVVNYKGEEKQFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KMKEIAEA+LGSTVKNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLIKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQ  160



>gb|EEC76425.1| hypothetical protein OsI_14101 [Oryza sativa Indica Group]
Length=434

 Score =   318 bits (815),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 149/157 (95%), Positives = 155/157 (99%), Gaps = 0/157 (0%)
 Frame = +2

Query  89   KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKNQVA  268
            KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKNQVA
Sbjct  5    KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKNQVA  64

Query  269  MNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAAEEI  448
            MNPINTVFDAKRLIGRRFSD+SVQSDIK+WP+KVIPGPGDKPMIVV YKGEEK+F+AEEI
Sbjct  65   MNPINTVFDAKRLIGRRFSDASVQSDIKMWPYKVIPGPGDKPMIVVQYKGEEKQFSAEEI  124

Query  449  SSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            SSMVL KM+EIAEAYLGSTVKNAVVTVPAYFNDSQRQ
Sbjct  125  SSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQ  161



>ref|XP_010030977.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Eucalyptus grandis]
Length=649

 Score =   325 bits (832),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 152/160 (95%), Positives = 157/160 (98%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNPINTVFDAKRLIGRRF+D+SVQSDIK WPFKV PGPGDKPMIVVNYKGEEK+FAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFADASVQSDIKHWPFKVTPGPGDKPMIVVNYKGEEKQFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVLTKM+EIAEAYLGST+KNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLTKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQ  160



>ref|XP_009604213.1| PREDICTED: heat shock cognate 70 kDa protein [Nicotiana tomentosiformis]
Length=651

 Score =   324 bits (831),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 153/160 (96%), Positives = 157/160 (98%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNPINTVFDAKRLIGRRFSD SVQSD+KLWPFKVI GPGDKPMIVV YKGEEK+FAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIAGPGDKPMIVVTYKGEEKQFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVLTKMKEIAEAYLG+T+KNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLTKMKEIAEAYLGTTIKNAVVTVPAYFNDSQRQ  160



>gb|KJB16979.1| hypothetical protein B456_002G258500 [Gossypium raimondii]
Length=648

 Score =   324 bits (831),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 154/160 (96%), Positives = 157/160 (98%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNPINTVFDAKRLIGRRF+DSSVQSDIKLWPFKVI GPGDKPMIVVNYKGEEK+FAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFTDSSVQSDIKLWPFKVIAGPGDKPMIVVNYKGEEKQFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KM+EIAEAYLG TVKNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLIKMREIAEAYLGFTVKNAVVTVPAYFNDSQRQ  160



>emb|CCA29121.1| heat shock protein 70 isoform 2 [Solanum lycopersicum]
Length=644

 Score =   324 bits (831),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 151/160 (94%), Positives = 159/160 (99%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNPINTVFDAKRLIGRRFSD+SVQSD+KLWPFKVIPGPGDKPMIVVNYKGEEK+F+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDMKLWPFKVIPGPGDKPMIVVNYKGEEKQFSA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL +MKEIAEA+LG+TVKNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLIRMKEIAEAFLGTTVKNAVVTVPAYFNDSQRQ  160



>gb|KJB46580.1| hypothetical protein B456_007G375600 [Gossypium raimondii]
 gb|KJB46581.1| hypothetical protein B456_007G375600 [Gossypium raimondii]
 gb|KJB46582.1| hypothetical protein B456_007G375600 [Gossypium raimondii]
Length=647

 Score =   324 bits (831),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 152/160 (95%), Positives = 156/160 (98%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNPINTVFDAKRLIGRRFSD+SVQSD KLWPFKVIPGPGDKPMI V YKGEEK+FAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDTKLWPFKVIPGPGDKPMICVTYKGEEKQFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KM+EIAEAYLGST+KNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQ  160



>gb|ACJ11741.1| heat shock protein 70 [Gossypium hirsutum]
Length=648

 Score =   324 bits (830),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 154/160 (96%), Positives = 157/160 (98%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNPINTVFDAKRLIGRRF+DSSVQSDIKLWPFKVI GPGDKPMIVVNYKGEEK+FAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFTDSSVQSDIKLWPFKVIAGPGDKPMIVVNYKGEEKQFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KM+EIAEAYLG TVKNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLIKMREIAEAYLGFTVKNAVVTVPAYFNDSQRQ  160



>ref|XP_010253202.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Nelumbo nucifera]
Length=648

 Score =   324 bits (830),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 154/160 (96%), Positives = 157/160 (98%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNPINTVFDAKRLIGRRFSD+SVQSDIKLWPFKVI GPGDKPMIVV YKGEEK+FAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDIKLWPFKVIAGPGDKPMIVVTYKGEEKQFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KM+EIAEAYLGSTVKNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLMKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQ  160



>ref|XP_008223372.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e isoform X1 [Prunus mume]
Length=519

 Score =   320 bits (820),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 150/160 (94%), Positives = 156/160 (98%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MA KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGD+AKN
Sbjct  1    MAAKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDSAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNPINTVFDAKRLIGRRFSD+S+QSD+KLWPFKVIPG GDKP IVVNYKGEEK+FAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASIQSDMKLWPFKVIPGAGDKPTIVVNYKGEEKQFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVLTKM+EIAEAYLGS VKNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLTKMREIAEAYLGSAVKNAVVTVPAYFNDSQRQ  160



>ref|XP_004492118.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Cicer arietinum]
Length=649

 Score =   324 bits (830),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 152/160 (95%), Positives = 158/160 (99%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNP+NTVFDAKRLIGRR SD+SVQSD+KLWPFKVIPGP DKPMIVVNYKGE+K+FAA
Sbjct  61   QVAMNPVNTVFDAKRLIGRRISDASVQSDMKLWPFKVIPGPADKPMIVVNYKGEDKQFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVLTKM+EIAEAYLGSTVKNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLTKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQ  160



>ref|XP_007009362.1| Heat shock cognate protein 70-1 [Theobroma cacao]
 gb|EOY18172.1| Heat shock cognate protein 70-1 [Theobroma cacao]
Length=652

 Score =   324 bits (830),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 153/160 (96%), Positives = 157/160 (98%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNPINTVFDAKRLIGRRF+DSSVQSDIKLWPFKVI GPGDKPMIVVNYKGEEK+FAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFTDSSVQSDIKLWPFKVIAGPGDKPMIVVNYKGEEKQFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KM+EIAEAYLGST+KNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQ  160



>gb|ABP35942.1| heat shock protein 70 [Cyclamen persicum]
Length=650

 Score =   324 bits (830),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 153/160 (96%), Positives = 158/160 (99%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNPINTVFDAKRLIGRRF+D+SVQSDIKLWPFKVI GPGDKPMIVVNYKGEEK+FAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFTDASVQSDIKLWPFKVIAGPGDKPMIVVNYKGEEKQFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KMKEIAEA+LGSTVKNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLIKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQ  160



>ref|XP_006664117.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Oryza brachyantha]
Length=649

 Score =   323 bits (829),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 151/160 (94%), Positives = 158/160 (99%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKG+GPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN
Sbjct  1    MAGKGDGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNPINTVFDAKRLIGRRF+D+SVQSDIKLWPFKVIPGPGDKPMIVV YKGEEK+FAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFTDTSVQSDIKLWPFKVIPGPGDKPMIVVQYKGEEKQFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KM+EIAEAYLG+T+KNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLIKMREIAEAYLGTTIKNAVVTVPAYFNDSQRQ  160



>ref|XP_010253827.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Nelumbo 
nucifera]
Length=619

 Score =   323 bits (827),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 152/160 (95%), Positives = 157/160 (98%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNPINTVFDAKRLIGRRFSD+SVQSDIKLWPFKVI GPGDKPMI+V+YKGEEK+FAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDIKLWPFKVIAGPGDKPMIMVSYKGEEKQFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KM+EIAEAYLGSTVKNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLMKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQ  160



>ref|XP_006341042.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Solanum 
tuberosum]
Length=649

 Score =   323 bits (829),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 152/160 (95%), Positives = 158/160 (99%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNPINTVFDAKRLIGRRFSD++VQSDIK WPFKVIPGPGDKPMIVVNYKGEEK+FAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDATVQSDIKHWPFKVIPGPGDKPMIVVNYKGEEKQFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KM+EIAEA+LGSTVKNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLIKMREIAEAFLGSTVKNAVVTVPAYFNDSQRQ  160



>ref|XP_009784009.1| PREDICTED: heat shock cognate 70 kDa protein [Nicotiana sylvestris]
Length=651

 Score =   323 bits (829),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 152/160 (95%), Positives = 157/160 (98%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNPINTVFDAKRLIGRRFSD SVQSD+KLWPFKVI GPGDKPMIVV YKGEEK+F+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIAGPGDKPMIVVTYKGEEKQFSA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVLTKMKEIAEAYLG+T+KNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLTKMKEIAEAYLGTTIKNAVVTVPAYFNDSQRQ  160



>gb|KDP44981.1| hypothetical protein JCGZ_01481 [Jatropha curcas]
Length=648

 Score =   323 bits (828),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 152/160 (95%), Positives = 158/160 (99%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNPINTVFDAKRLIGRRFSD+SVQSDIKLWPFKVIPGPGDKPMIVV+YKGE+K+FAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIVVSYKGEDKQFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KM+EIAEAYLG+TVKNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLIKMREIAEAYLGTTVKNAVVTVPAYFNDSQRQ  160



>ref|XP_003539680.2| PREDICTED: heat shock cognate 70 kDa protein 2 [Glycine max]
 gb|KHN32117.1| Heat shock cognate 70 kDa protein [Glycine soja]
Length=649

 Score =   323 bits (828),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 151/160 (94%), Positives = 157/160 (98%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNPINTVFDAKRLIGRRFSD+SVQSD+KLWPFKVIPGP DKPMIVVNYKG+EK+F+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDMKLWPFKVIPGPADKPMIVVNYKGDEKQFSA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KMKEIAEAYLGST+KNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLIKMKEIAEAYLGSTIKNAVVTVPAYFNDSQRQ  160



>ref|XP_011091460.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Sesamum 
indicum]
Length=649

 Score =   323 bits (828),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 153/160 (96%), Positives = 156/160 (98%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNP NTVFDAKRLIGRRFSD SVQSD+KLWPFKVIPGPGDKPMIVV+YKGEEK+FAA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPGDKPMIVVSYKGEEKQFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  160



>ref|XP_009409520.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Musa acuminata 
subsp. malaccensis]
Length=648

 Score =   323 bits (828),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 153/160 (96%), Positives = 156/160 (98%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVV YKGE+K+FAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVQYKGEDKQFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KMKEIAEAYLGS VKNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLIKMKEIAEAYLGSVVKNAVVTVPAYFNDSQRQ  160



>dbj|BAJ34054.1| unnamed protein product [Thellungiella halophila]
Length=650

 Score =   323 bits (828),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 150/160 (94%), Positives = 157/160 (98%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNPINTVFDAKRLIGRRFSDSSVQSD+KLWPFK+IPGP DKPMIVVNYKGE+KEFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDSSVQSDMKLWPFKIIPGPADKPMIVVNYKGEDKEFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSM+L KM+EIAEAYLGST+KNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMILIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQ  160



>ref|XP_006407676.1| hypothetical protein EUTSA_v10020258mg [Eutrema salsugineum]
 gb|ESQ49129.1| hypothetical protein EUTSA_v10020258mg [Eutrema salsugineum]
Length=650

 Score =   323 bits (828),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 150/160 (94%), Positives = 157/160 (98%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNPINTVFDAKRLIGRRFSDSSVQSD+KLWPFK+IPGP DKPMIVVNYKGE+KEFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDSSVQSDMKLWPFKIIPGPADKPMIVVNYKGEDKEFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSM+L KM+EIAEAYLGST+KNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMILIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQ  160



>ref|XP_008458892.1| PREDICTED: heat shock cognate 70 kDa protein [Cucumis melo]
Length=648

 Score =   323 bits (827),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 152/160 (95%), Positives = 157/160 (98%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNP+NTVFDAKRLIGRRFSD SVQSD+KLWPFKVI GPGDKPMIVVNYKGEEK+FAA
Sbjct  61   QVAMNPLNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIAGPGDKPMIVVNYKGEEKQFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVLTKM+EIAEAYLGS+VKNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLTKMREIAEAYLGSSVKNAVVTVPAYFNDSQRQ  160



>gb|AGR45355.1| HSP70 [Dendrobium catenatum]
Length=647

 Score =   323 bits (827),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 152/160 (95%), Positives = 157/160 (98%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNPINTVFDAKRLIGRRFSD+SVQSDIKLWPFKVIPGPGDKPMIVV YKGE+K+FAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIVVQYKGEDKQFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KM+EIAEAYLG+TVKNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLIKMREIAEAYLGATVKNAVVTVPAYFNDSQRQ  160



>ref|XP_002527736.1| heat shock protein, putative [Ricinus communis]
 gb|EEF34649.1| heat shock protein, putative [Ricinus communis]
Length=647

 Score =   322 bits (826),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 150/160 (94%), Positives = 158/160 (99%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNP+NTVFDAKRLIGRRF+D+SVQSDIKLWPFKVIPGPGDKPMI+V+YKGE+K+FAA
Sbjct  61   QVAMNPVNTVFDAKRLIGRRFTDASVQSDIKLWPFKVIPGPGDKPMIIVSYKGEDKQFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KM+EIAEAYLGSTVKNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQ  160



>gb|KCW50223.1| hypothetical protein EUGRSUZ_J00023 [Eucalyptus grandis]
Length=615

 Score =   322 bits (824),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 150/160 (94%), Positives = 157/160 (98%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNPINTVFDAKRLIGRRF+DSSVQSDIKLWPFKVIPGPG+KPMI+V YKGEEK+FAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFNDSSVQSDIKLWPFKVIPGPGEKPMIIVTYKGEEKQFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KM+EIAEAYLG+T+KNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQ  160



>gb|KCW50226.1| hypothetical protein EUGRSUZ_J00025 [Eucalyptus grandis]
Length=742

 Score =   325 bits (833),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 152/160 (95%), Positives = 157/160 (98%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  94   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  153

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNPINTVFDAKRLIGRRF+D+SVQSDIK WPFKV PGPGDKPMIVVNYKGEEK+FAA
Sbjct  154  QVAMNPINTVFDAKRLIGRRFADASVQSDIKHWPFKVTPGPGDKPMIVVNYKGEEKQFAA  213

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVLTKM+EIAEAYLGST+KNAVVTVPAYFNDSQRQ
Sbjct  214  EEISSMVLTKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQ  253



>gb|AAN86276.1| cell-autonomous heat shock cognate protein 70 [Cucurbita maxima]
Length=650

 Score =   322 bits (826),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 153/160 (96%), Positives = 156/160 (98%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIG+AAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGNAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMI VNYKGEEK+FAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIEVNYKGEEKQFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KM+EIAEAYLG  VKNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLIKMREIAEAYLGFNVKNAVVTVPAYFNDSQRQ  160



>sp|P27322.1|HSP72_SOLLC RecName: Full=Heat shock cognate 70 kDa protein 2 [Solanum lycopersicum]
 emb|CAA37971.1| heat shock protein cognate 70 [Solanum lycopersicum]
Length=644

 Score =   322 bits (826),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 151/160 (94%), Positives = 158/160 (99%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNPINTVFDAKRLIGRRFSD+SVQSD+KLWPFKVIPGPGDKPMIVVNYKGEEK+F+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDMKLWPFKVIPGPGDKPMIVVNYKGEEKQFSA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KMKEIAEA+LG+TVKNAVVTVPAY NDSQRQ
Sbjct  121  EEISSMVLIKMKEIAEAFLGTTVKNAVVTVPAYSNDSQRQ  160



>gb|KCW50224.1| hypothetical protein EUGRSUZ_J00023 [Eucalyptus grandis]
Length=632

 Score =   322 bits (825),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 150/160 (94%), Positives = 157/160 (98%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNPINTVFDAKRLIGRRF+DSSVQSDIKLWPFKVIPGPG+KPMI+V YKGEEK+FAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFNDSSVQSDIKLWPFKVIPGPGEKPMIIVTYKGEEKQFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KM+EIAEAYLG+T+KNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQ  160



>gb|KCW50227.1| hypothetical protein EUGRSUZ_J00025 [Eucalyptus grandis]
Length=735

 Score =   325 bits (832),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 152/160 (95%), Positives = 157/160 (98%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  94   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  153

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNPINTVFDAKRLIGRRF+D+SVQSDIK WPFKV PGPGDKPMIVVNYKGEEK+FAA
Sbjct  154  QVAMNPINTVFDAKRLIGRRFADASVQSDIKHWPFKVTPGPGDKPMIVVNYKGEEKQFAA  213

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVLTKM+EIAEAYLGST+KNAVVTVPAYFNDSQRQ
Sbjct  214  EEISSMVLTKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQ  253



>ref|XP_010253221.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Nelumbo 
nucifera]
Length=648

 Score =   322 bits (826),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 152/160 (95%), Positives = 157/160 (98%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNP+NTVFDAKRLIGRRFSD+SVQSDIKLWPFKVI GPGDKPMIVV YKGE+K+FAA
Sbjct  61   QVAMNPVNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIAGPGDKPMIVVTYKGEDKQFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KM+EIAEAYLGSTVKNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLMKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQ  160



>ref|XP_010030975.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Eucalyptus 
grandis]
 gb|KCW50222.1| hypothetical protein EUGRSUZ_J00023 [Eucalyptus grandis]
Length=649

 Score =   322 bits (826),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 150/160 (94%), Positives = 157/160 (98%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNPINTVFDAKRLIGRRF+DSSVQSDIKLWPFKVIPGPG+KPMI+V YKGEEK+FAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFNDSSVQSDIKLWPFKVIPGPGEKPMIIVTYKGEEKQFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KM+EIAEAYLG+T+KNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQ  160



>gb|KDP35613.1| hypothetical protein JCGZ_09051 [Jatropha curcas]
Length=648

 Score =   322 bits (826),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 152/160 (95%), Positives = 157/160 (98%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNPINTVFDAKRLIGRRF+D+SVQSDIKLWPFKVI GPGDKPMIVV+YKGEEK+FAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFTDASVQSDIKLWPFKVISGPGDKPMIVVSYKGEEKQFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KM+EIAEAYLGSTVKNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQ  160



>gb|ADD71975.1| heat shock protein 70 [Rhododendron calophytum]
Length=651

 Score =   322 bits (826),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 152/160 (95%), Positives = 158/160 (99%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNPINTVFDAKRLIGRRF+D+SVQSDIKLWPFKVI GPG+KPMIVVNYKGEEK+FAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFNDASVQSDIKLWPFKVIAGPGEKPMIVVNYKGEEKQFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KMKEIAEA+LGSTVKNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLVKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQ  160



>emb|CDP00073.1| unnamed protein product [Coffea canephora]
Length=634

 Score =   322 bits (824),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 151/160 (94%), Positives = 157/160 (98%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNP+NTVFDAKRLIGRRFSDSSVQSD+KLWPFKVI G GDKPMIVVNYKGEEK+FAA
Sbjct  61   QVAMNPLNTVFDAKRLIGRRFSDSSVQSDMKLWPFKVIAGAGDKPMIVVNYKGEEKQFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KMKEIAEAYLG+++KNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLNKMKEIAEAYLGTSIKNAVVTVPAYFNDSQRQ  160



>emb|CAB72130.1| heat shock protein 70 [Cucumis sativus]
Length=647

 Score =   322 bits (825),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 152/160 (95%), Positives = 156/160 (98%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QV MNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMI+V+YKG EK+FAA
Sbjct  61   QVTMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIIVSYKGGEKQFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KM+EIAEAYLGSTVKNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQ  160



>gb|AAN86275.1| non-cell-autonomous heat shock cognate protein 70 [Cucurbita 
maxima]
Length=652

 Score =   322 bits (825),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 152/160 (95%), Positives = 156/160 (98%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDNERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVI GPGDKPMIVVNYKGEEK+F+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIAGPGDKPMIVVNYKGEEKQFSA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EE+SSMVL KMKEIAEAYLG+TVKNAVVTVPAYFNDSQRQ
Sbjct  121  EEVSSMVLIKMKEIAEAYLGTTVKNAVVTVPAYFNDSQRQ  160



>gb|ABA95501.2| Heat shock cognate 70 kDa protein, putative, expressed [Oryza 
sativa Japonica Group]
Length=615

 Score =   321 bits (823),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 151/160 (94%), Positives = 157/160 (98%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNPINTVFDAKRLIGRRFSD+SVQSDIKLWPFKVI GPGDKPMIVV YKGEEK+FAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDIKLWPFKVIAGPGDKPMIVVQYKGEEKQFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KM+EIAEAYLG+T+KNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLIKMREIAEAYLGTTIKNAVVTVPAYFNDSQRQ  160



>gb|EPS60056.1| heat shock protein 70 [Genlisea aurea]
Length=653

 Score =   322 bits (825),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 151/160 (94%), Positives = 158/160 (99%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNP+NTVFDAKRLIGRR+SD+SVQSDI+LWPFKVIPGPGDKPMIVV+YKGE+K+FAA
Sbjct  61   QVAMNPVNTVFDAKRLIGRRYSDASVQSDIQLWPFKVIPGPGDKPMIVVSYKGEDKQFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  160



>ref|XP_007016460.1| Heat shock cognate protein 70-1 [Theobroma cacao]
 gb|EOY34079.1| Heat shock cognate protein 70-1 [Theobroma cacao]
Length=650

 Score =   322 bits (825),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 152/160 (95%), Positives = 156/160 (98%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNP NTVFDAKRLIGRRFSD+SVQSD+KLWPFKVI GPGDKPMIVV YKGEEK+FAA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDASVQSDMKLWPFKVIAGPGDKPMIVVTYKGEEKQFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVLTKMKEIAEAYLGST+KNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLTKMKEIAEAYLGSTIKNAVVTVPAYFNDSQRQ  160



>ref|XP_009786102.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Nicotiana sylvestris]
Length=648

 Score =   322 bits (825),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 151/160 (94%), Positives = 157/160 (98%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNP NTVFDAKRLIGRRFSD+SVQSD+KLWPFKVIPG GDKPMIVVNYKGEEK+FAA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDASVQSDMKLWPFKVIPGAGDKPMIVVNYKGEEKQFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KMKEIAEA+LG+TVKNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLIKMKEIAEAFLGTTVKNAVVTVPAYFNDSQRQ  160



>ref|XP_009597695.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Nicotiana tomentosiformis]
Length=648

 Score =   322 bits (825),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 151/160 (94%), Positives = 157/160 (98%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNP NTVFDAKRLIGRRFSD+SVQSD+KLWPFKVIPG GDKPMIVVNYKGEEK+FAA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDASVQSDMKLWPFKVIPGAGDKPMIVVNYKGEEKQFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KMKEIAEA+LG+TVKNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLIKMKEIAEAFLGTTVKNAVVTVPAYFNDSQRQ  160



>gb|AIZ68155.1| heat shock protein 70 [Ornithogalum saundersiae]
Length=648

 Score =   322 bits (824),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 151/160 (94%), Positives = 156/160 (98%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNPINTVFDAKRLIGRRF+D+SVQSDIKLWPFK+I GPGDKPMIVV YKGEEK+FAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFTDASVQSDIKLWPFKLISGPGDKPMIVVQYKGEEKQFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KM+EIAEAYLGSTVKNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQ  160



>ref|XP_010095013.1| Heat shock 70 kDa protein 4 [Morus notabilis]
 gb|EXB58119.1| Heat shock 70 kDa protein 4 [Morus notabilis]
Length=648

 Score =   322 bits (824),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 152/160 (95%), Positives = 156/160 (98%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNPINTVFDAKRLIGRRF+D SVQSDIKLWPFKVI GPGDKPMIVVNYKGEEK+FAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFNDPSVQSDIKLWPFKVISGPGDKPMIVVNYKGEEKQFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KM+EIAEAYLGST+KNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQ  160



>gb|KFK38330.1| hypothetical protein AALP_AA3G100200 [Arabis alpina]
Length=650

 Score =   322 bits (824),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 149/160 (93%), Positives = 157/160 (98%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNPINTVFDAKRLIGRRFSDSSVQSD+KLWPFK+IPGP DKPMI+VNYKGE+KEFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDSSVQSDMKLWPFKIIPGPADKPMIIVNYKGEDKEFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSM+L KM+EIAEAYLGST+KNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMILIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQ  160



>ref|XP_003554320.2| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e [Glycine max]
Length=721

 Score =   323 bits (829),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 154/160 (96%), Positives = 156/160 (98%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN
Sbjct  68   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  127

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVI G  DKPMIVVNYKGEEK+FAA
Sbjct  128  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIAGAADKPMIVVNYKGEEKQFAA  187

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KM+EIAEAYLGSTVKNAVVTVPAYFNDSQRQ
Sbjct  188  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQ  227



>ref|XP_006833219.1| hypothetical protein AMTR_s00072p00181720 [Amborella trichopoda]
 gb|ERM98497.1| hypothetical protein AMTR_s00072p00181720 [Amborella trichopoda]
Length=657

 Score =   322 bits (824),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 151/160 (94%), Positives = 156/160 (98%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNP+NTVFDAKRLIGRRFSD+SVQSDIKLWPFKVIPGPGDKPMIVV YKGE+K+FAA
Sbjct  61   QVAMNPVNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIVVQYKGEDKQFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KM+EIAEAYLGS VKNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLMKMREIAEAYLGSAVKNAVVTVPAYFNDSQRQ  160



>ref|NP_001068540.1| Os11g0703900 [Oryza sativa Japonica Group]
 gb|AAX95352.1| dnaK-type molecular chaperone hsp70 - rice (fragment) [Oryza 
sativa Japonica Group]
 gb|ABA95500.1| Heat shock cognate 70 kDa protein, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF28903.1| Os11g0703900 [Oryza sativa Japonica Group]
Length=649

 Score =   321 bits (823),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 151/160 (94%), Positives = 157/160 (98%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNPINTVFDAKRLIGRRFSD+SVQSDIKLWPFKVI GPGDKPMIVV YKGEEK+FAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDIKLWPFKVIAGPGDKPMIVVQYKGEEKQFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KM+EIAEAYLG+T+KNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLIKMREIAEAYLGTTIKNAVVTVPAYFNDSQRQ  160



>ref|XP_006663128.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Oryza brachyantha]
Length=649

 Score =   321 bits (823),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 151/160 (94%), Positives = 157/160 (98%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNPINTVFDAKRLIGRRFSD+SVQSDIKLWPFKVI GPGDKPMIVV YKGEEK+FAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDIKLWPFKVIAGPGDKPMIVVQYKGEEKQFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KM+EIAEAYLG+T+KNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLIKMREIAEAYLGTTIKNAVVTVPAYFNDSQRQ  160



>gb|EAY89450.1| hypothetical protein OsI_10982 [Oryza sativa Indica Group]
Length=438

 Score =   315 bits (807),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 148/160 (93%), Positives = 154/160 (96%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKG+GPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGDGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNPINTVFDAKRLIGRRFSD+SVQSD KLWPFKV+PGPGDKPMI V YKGEEK+F+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDTSVQSDAKLWPFKVLPGPGDKPMIGVQYKGEEKQFSA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KMKE AEAYLGSTVKNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLNKMKETAEAYLGSTVKNAVVTVPAYFNDSQRQ  160



>ref|XP_006349004.1| PREDICTED: heat shock cognate 70 kDa protein-like [Solanum tuberosum]
Length=652

 Score =   321 bits (823),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 150/160 (94%), Positives = 156/160 (98%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNP+NTVFDAKRLIGRRFSD SVQSD+KLWPFKVIPGP DKPMIVV YKGEEK+F+A
Sbjct  61   QVAMNPVNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPADKPMIVVTYKGEEKQFSA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVLTKMKEIAEAYLG+T+KNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLTKMKEIAEAYLGTTIKNAVVTVPAYFNDSQRQ  160



>ref|XP_006349005.1| PREDICTED: heat shock cognate 70 kDa protein-like [Solanum tuberosum]
Length=652

 Score =   321 bits (823),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 150/160 (94%), Positives = 156/160 (98%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNP+NTVFDAKRLIGRRFSD SVQSD+KLWPFKVIPGP DKPMIVV YKGEEK+F+A
Sbjct  61   QVAMNPVNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPADKPMIVVTYKGEEKQFSA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVLTKMKEIAEAYLG+T+KNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLTKMKEIAEAYLGTTIKNAVVTVPAYFNDSQRQ  160



>ref|XP_002263599.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Vitis vinifera]
Length=649

 Score =   321 bits (823),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 150/160 (94%), Positives = 156/160 (98%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERL+GDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLVGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNPINTVFDAKRLIGRRFSD++VQSDIKLWPFKV+ GPGDKPMIVVNYKGEEK+FAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDATVQSDIKLWPFKVVAGPGDKPMIVVNYKGEEKQFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KM+EIAEAYLGS VKNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLMKMREIAEAYLGSAVKNAVVTVPAYFNDSQRQ  160



>ref|XP_007139240.1| hypothetical protein PHAVU_008G013000g [Phaseolus vulgaris]
 gb|ESW11234.1| hypothetical protein PHAVU_008G013000g [Phaseolus vulgaris]
Length=649

 Score =   321 bits (822),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 149/160 (93%), Positives = 157/160 (98%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKG+GPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD+ERLIGDAAKN
Sbjct  1    MAGKGDGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNPINTVFDAKRLIGRRFSD++VQSD+KLWPFKV+PGP DKPMIVVNYKGEEK+FAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDTTVQSDVKLWPFKVVPGPADKPMIVVNYKGEEKQFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KM+EIAEAYLGS VKNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLMKMREIAEAYLGSAVKNAVVTVPAYFNDSQRQ  160



>gb|ACJ11740.1| heat shock protein 70 [Gossypium hirsutum]
Length=647

 Score =   321 bits (822),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 152/160 (95%), Positives = 155/160 (97%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNPINTVFDAKRLIGRRFSD+SVQSD KLWPFKVI GPGDKPMI V YKGEEK+FAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDTKLWPFKVIAGPGDKPMICVAYKGEEKQFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KM+EIAEAYLGSTVKNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQ  160



>ref|XP_008370710.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Malus domestica]
Length=649

 Score =   321 bits (822),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 151/160 (94%), Positives = 156/160 (98%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNP+NTVFDAKRLIGRRFSD SVQSD+KLWPFKVIPGPGDKPMIVV YKGEEK+FAA
Sbjct  61   QVAMNPVNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPGDKPMIVVXYKGEEKQFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KM+EIAEAYLGS+VKNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLIKMREIAEAYLGSSVKNAVVTVPAYFNDSQRQ  160



>ref|XP_004250959.1| PREDICTED: heat shock cognate 70 kDa protein [Solanum lycopersicum]
Length=654

 Score =   321 bits (822),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 150/159 (94%), Positives = 156/159 (98%), Gaps = 0/159 (0%)
 Frame = +2

Query  83   AGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKNQ  262
            AGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKNQ
Sbjct  4    AGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ  63

Query  263  VAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAAE  442
            VAMNP+NTVFDAKRLIGRRFSD SVQSD+KLWPFKVIPGPGDKPMIVV YKGEEK+F+AE
Sbjct  64   VAMNPVNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPGDKPMIVVTYKGEEKQFSAE  123

Query  443  EISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EISSMVLTKMKEIAEAYLG+T+KNAVVTVPAYFNDSQRQ
Sbjct  124  EISSMVLTKMKEIAEAYLGTTIKNAVVTVPAYFNDSQRQ  162



>ref|XP_008784530.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Phoenix dactylifera]
Length=649

 Score =   321 bits (822),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 151/160 (94%), Positives = 155/160 (97%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNPINTVFDAKRLIGRRFSD+SVQSD+KLWPFKV+ GPGDKPMIVV YKGEEK+FAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDVKLWPFKVVAGPGDKPMIVVQYKGEEKQFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KMKE AEAYLGSTVKNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLIKMKETAEAYLGSTVKNAVVTVPAYFNDSQRQ  160



>ref|XP_010558794.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Tarenaya hassleriana]
Length=649

 Score =   320 bits (821),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 150/160 (94%), Positives = 157/160 (98%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNPINTVFDAKRLIGRR+SD SVQ+D+KLWPFKVIPGPGDKPMIVVNYKGEEK+FAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRYSDPSVQADMKLWPFKVIPGPGDKPMIVVNYKGEEKQFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KM+EIAEAYLG++VKNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLIKMREIAEAYLGTSVKNAVVTVPAYFNDSQRQ  160



>ref|XP_010555208.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Tarenaya 
hassleriana]
Length=652

 Score =   320 bits (821),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 149/160 (93%), Positives = 157/160 (98%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNPINTVFDAKRLIGRRFSD+SVQSD KLWPFKVIPGPGDKPMIVVNYKGE+K+F+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDAKLWPFKVIPGPGDKPMIVVNYKGEDKQFSA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KM+EIAEAYLG+T+KNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLIKMREIAEAYLGTTIKNAVVTVPAYFNDSQRQ  160



>ref|XP_010922357.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Elaeis guineensis]
Length=648

 Score =   320 bits (821),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 151/160 (94%), Positives = 155/160 (97%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNP NTVFDAKRLIGRRFSD+SVQSDIKLWPFKVIPGPGDKPMIVV YKGE+K+FAA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGDKPMIVVQYKGEDKQFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KM+EIAEAYLG TVKNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLMKMREIAEAYLGYTVKNAVVTVPAYFNDSQRQ  160



>gb|KJB36734.1| hypothetical protein B456_006G174000 [Gossypium raimondii]
Length=646

 Score =   320 bits (821),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 151/160 (94%), Positives = 157/160 (98%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNP+NTVFDAKRLIGRRFSD++VQSDIKLWPFKVIPG GDKPMIVV+YKGEEK+FAA
Sbjct  61   QVAMNPLNTVFDAKRLIGRRFSDAAVQSDIKLWPFKVIPGSGDKPMIVVSYKGEEKQFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KM+EIAEAYLG TVKNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLIKMREIAEAYLGFTVKNAVVTVPAYFNDSQRQ  160



>ref|XP_004246402.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Solanum 
lycopersicum]
Length=649

 Score =   320 bits (821),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 151/160 (94%), Positives = 157/160 (98%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNPINTVFDAKRLIGRRFSD++VQSDIK WPFKVI GPGDKPMIVVNYKGEEK+FAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDATVQSDIKHWPFKVIAGPGDKPMIVVNYKGEEKQFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KM+EIAEA+LGSTVKNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLIKMREIAEAFLGSTVKNAVVTVPAYFNDSQRQ  160



>ref|XP_004142745.1| PREDICTED: heat shock cognate 70 kDa protein-like [Cucumis sativus]
 gb|KGN51286.1| Heat shock protein 70 [Cucumis sativus]
Length=652

 Score =   320 bits (820),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 151/160 (94%), Positives = 156/160 (98%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNPINTVFDAKRLIGRRFSD+SVQSDIKLWPFKVI GP DKPMIVVNYKGEEK+F+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDIKLWPFKVIAGPSDKPMIVVNYKGEEKQFSA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KMKEIAEAYLG+TVKNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLIKMKEIAEAYLGTTVKNAVVTVPAYFNDSQRQ  160



>ref|XP_010520113.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Tarenaya 
hassleriana]
Length=650

 Score =   320 bits (820),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 150/160 (94%), Positives = 155/160 (97%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MA KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAAKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNPINTVFDAKRLIGRRFSDSSVQ DIKLWPFKVIPGP DKPMIVVNYKGEEK+F+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDSSVQGDIKLWPFKVIPGPADKPMIVVNYKGEEKQFSA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KM+EIAEAYLG++VKNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLVKMREIAEAYLGTSVKNAVVTVPAYFNDSQRQ  160



>ref|XP_002284063.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Vitis vinifera]
Length=652

 Score =   320 bits (820),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 149/160 (93%), Positives = 157/160 (98%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKG+GPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGDGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVI GPGDKPMIVVNY+GEEK+F+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIAGPGDKPMIVVNYRGEEKQFSA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KM+EIAEAYLG+++KNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLIKMREIAEAYLGTSIKNAVVTVPAYFNDSQRQ  160



>ref|XP_008223380.1| PREDICTED: heat shock cognate 70 kDa protein 2-like isoform X2 
[Prunus mume]
Length=648

 Score =   320 bits (819),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 150/160 (94%), Positives = 156/160 (98%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MA KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGD+AKN
Sbjct  1    MAAKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDSAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNPINTVFDAKRLIGRRFSD+S+QSD+KLWPFKVIPG GDKP IVVNYKGEEK+FAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASIQSDMKLWPFKVIPGAGDKPTIVVNYKGEEKQFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVLTKM+EIAEAYLGS VKNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLTKMREIAEAYLGSAVKNAVVTVPAYFNDSQRQ  160



>ref|XP_010937646.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Elaeis guineensis]
Length=648

 Score =   320 bits (819),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 152/160 (95%), Positives = 154/160 (96%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNP NTVFDAKRLIGRRFSD SVQSDIKLWPFKV+ GPGDKPMIVV YKGEEK+FAA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDVSVQSDIKLWPFKVVAGPGDKPMIVVQYKGEEKQFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLMKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  160



>gb|AGL07711.1| heat shock protein 70 [Ziziphus jujuba]
Length=654

 Score =   320 bits (819),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 150/160 (94%), Positives = 156/160 (98%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNPINTV DAKRLIGRR+SD+SVQSDIKLWPFKVIPG GDKPMIVVNYKGEEK+FAA
Sbjct  61   QVAMNPINTVLDAKRLIGRRYSDASVQSDIKLWPFKVIPGAGDKPMIVVNYKGEEKQFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KM+EIAEAYLGST+KNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQ  160



>ref|XP_002312089.1| heat shock protein 70 cognate [Populus trichocarpa]
 gb|EEE89456.1| heat shock protein 70 cognate [Populus trichocarpa]
Length=648

 Score =   320 bits (819),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 149/160 (93%), Positives = 156/160 (98%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNPINTVFDAKRLIGRR+SD+SVQSDIKLWPFKVIPGP +KPMIVV YKGEEK+FAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRYSDASVQSDIKLWPFKVIPGPAEKPMIVVTYKGEEKQFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KM+EIAEAYLG+T+KNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLIKMREIAEAYLGTTIKNAVVTVPAYFNDSQRQ  160



>gb|KHN02428.1| Heat shock cognate 70 kDa protein [Glycine soja]
Length=654

 Score =   320 bits (819),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 153/160 (96%), Positives = 156/160 (98%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQ+DRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVI G  DKPMIVVNYKGEEK+FAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIAGAADKPMIVVNYKGEEKQFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KM+EIAEAYLGSTVKNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQ  160



>ref|XP_009388623.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Musa acuminata 
subsp. malaccensis]
Length=649

 Score =   320 bits (819),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 150/160 (94%), Positives = 156/160 (98%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNPINTVFDAKRLIGRR+SDSSVQSDIKLWPFKVI GPGDKPMIVV YKGEEK+F+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRYSDSSVQSDIKLWPFKVIAGPGDKPMIVVQYKGEEKQFSA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KM+EIAEAYLG+T+KNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLIKMREIAEAYLGTTIKNAVVTVPAYFNDSQRQ  160



>gb|EAY98319.1| hypothetical protein OsI_20227 [Oryza sativa Indica Group]
Length=410

 Score =   312 bits (800),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 146/158 (92%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = +2

Query  86   GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKNQV  265
             KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKNQV
Sbjct  2    AKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV  61

Query  266  AMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAAEE  445
            AMNP NTVFDAKRLIGRRFSD SVQSD+KLWPFKV+PGPGDKPMIVV YKGEEK+FAAEE
Sbjct  62   AMNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVVPGPGDKPMIVVQYKGEEKQFAAEE  121

Query  446  ISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            ISSMVL KM+EIAEAYLGS++KNAVVTVPAYFNDSQRQ
Sbjct  122  ISSMVLIKMREIAEAYLGSSIKNAVVTVPAYFNDSQRQ  159



>ref|XP_007207204.1| hypothetical protein PRUPE_ppa002646mg [Prunus persica]
 gb|EMJ08403.1| hypothetical protein PRUPE_ppa002646mg [Prunus persica]
Length=649

 Score =   319 bits (818),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 150/160 (94%), Positives = 156/160 (98%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MA KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGD+AKN
Sbjct  1    MAAKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDSAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNPINTVFDAKRLIGRRFSD+S+QSD+KLWPFKVIPG GDKP IVVNYKGEEK+FAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASIQSDMKLWPFKVIPGAGDKPTIVVNYKGEEKQFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVLTKM+EIAEAYLGS VKNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLTKMREIAEAYLGSAVKNAVVTVPAYFNDSQRQ  160



>ref|XP_003537997.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Glycine max]
Length=649

 Score =   319 bits (818),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 149/160 (93%), Positives = 155/160 (97%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNP NTVFDAKRLIGRRFSD+SVQ D+KLWPFKVIPGP +KPMIVVNYKGEEK+F+A
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIPGPAEKPMIVVNYKGEEKQFSA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KMKEIAEAYLGST+KNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLMKMKEIAEAYLGSTIKNAVVTVPAYFNDSQRQ  160



>ref|XP_010095022.1| Heat shock 70 kDa protein 4 [Morus notabilis]
 gb|EXB58128.1| Heat shock 70 kDa protein 4 [Morus notabilis]
Length=651

 Score =   319 bits (818),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 151/160 (94%), Positives = 155/160 (97%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNP NTVFDAKRLIGRRFSD SVQSDIKLWPFKVI GPGDKPMIVVNYKGEEK+FAA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDPSVQSDIKLWPFKVIAGPGDKPMIVVNYKGEEKQFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KM+EIAEAYLGST+KNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQ  160



>gb|ACV52590.1| heat shock protein 70-like protein, partial [Nicotiana benthamiana]
Length=181

 Score =   304 bits (778),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 144/151 (95%), Positives = 149/151 (99%), Gaps = 0/151 (0%)
 Frame = +2

Query  107  IGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKNQVAMNPINT  286
            IGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKNQVAMNPINT
Sbjct  1    IGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKNQVAMNPINT  60

Query  287  VFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAAEEISSMVLT  466
            VFDAKRLIGRRF+D+SVQSDIK WPFKVIPGPGDKPMIVVNYKGEEK+FAAEEISSMVL 
Sbjct  61   VFDAKRLIGRRFADASVQSDIKHWPFKVIPGPGDKPMIVVNYKGEEKQFAAEEISSMVLI  120

Query  467  KMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            KM+EIAEA+LGSTVKNAVVTVPAYFNDSQRQ
Sbjct  121  KMREIAEAFLGSTVKNAVVTVPAYFNDSQRQ  151



>gb|KHN21966.1| Heat shock cognate 70 kDa protein [Glycine soja]
Length=646

 Score =   319 bits (818),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 149/160 (93%), Positives = 155/160 (97%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNP NTVFDAKRLIGRRFSD+SVQ D+KLWPFKVIPGP +KPMIVVNYKGEEK+F+A
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIPGPAEKPMIVVNYKGEEKQFSA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KMKEIAEAYLGST+KNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLMKMKEIAEAYLGSTIKNAVVTVPAYFNDSQRQ  160



>gb|KHN27222.1| Heat shock cognate 70 kDa protein 2 [Glycine soja]
Length=649

 Score =   319 bits (818),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 149/160 (93%), Positives = 157/160 (98%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKG+GPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD+ERLIGDAAKN
Sbjct  1    MAGKGDGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNP+NTVFDAKRLIGRR SD+SVQSD+KLWPFKVIPGP DKPMIVVNYKGE+K+FAA
Sbjct  61   QVAMNPVNTVFDAKRLIGRRISDASVQSDMKLWPFKVIPGPADKPMIVVNYKGEDKQFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KM+EIAEAYLGSTVKNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLMKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQ  160



>ref|XP_007132076.1| hypothetical protein PHAVU_011G065000g [Phaseolus vulgaris]
 gb|ESW04070.1| hypothetical protein PHAVU_011G065000g [Phaseolus vulgaris]
Length=649

 Score =   319 bits (817),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 149/160 (93%), Positives = 157/160 (98%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNPINTVFDAKRLIGRRF+D++VQSD+KLWPFKVI GPGDKPMIVVNYKGEEK+F+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFTDAAVQSDMKLWPFKVIAGPGDKPMIVVNYKGEEKQFSA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KMKEIAEA+LGSTVKNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLIKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQ  160



>gb|AAA86903.1| heat shock protein cognate 70, partial [Sorghum bicolor]
Length=209

 Score =   305 bits (780),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 144/160 (90%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKG+GP+IGIDLGTTYSCVGVWQ DRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGDGPSIGIDLGTTYSCVGVWQRDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNPINTVFDAKRLIGRRFSD+SVQSDIKLWPFK I GPG+KPMIVV +KGEEK+FAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDIKLWPFKGISGPGEKPMIVVQHKGEEKQFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KM+E AEAYLGST+KNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLIKMRETAEAYLGSTIKNAVVTVPAYFNDSQRQ  160



>gb|AFA51946.1| heat shock protein 70 [Paeonia suffruticosa]
Length=650

 Score =   319 bits (817),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 149/160 (93%), Positives = 156/160 (98%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNP NTVFDAKRLIGRRFSD+SVQSDIKLWPFK+IPGP +KPMIVVNYKGEEK+FAA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKLIPGPAEKPMIVVNYKGEEKQFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KM+EIAEA+LGSTVKNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLMKMREIAEAFLGSTVKNAVVTVPAYFNDSQRQ  160



>gb|EEC71767.1| hypothetical protein OsI_04375 [Oryza sativa Indica Group]
Length=423

 Score =   312 bits (799),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 146/158 (92%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = +2

Query  86   GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKNQV  265
             KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKNQV
Sbjct  2    AKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQV  61

Query  266  AMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAAEE  445
            AMNPINTVFDAKRLIGRRFSD SVQSD+KLWPFKVIPGPGDKPMIVV YKGEEK+F+AEE
Sbjct  62   AMNPINTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPGDKPMIVVQYKGEEKQFSAEE  121

Query  446  ISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            ISSMVL KM+EIAEAYLGS +KNAVVTVPAYFNDSQRQ
Sbjct  122  ISSMVLIKMREIAEAYLGSNIKNAVVTVPAYFNDSQRQ  159



>ref|XP_008660826.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Zea mays]
 tpg|DAA47114.1| TPA: heat shock protein 70 [Zea mays]
Length=649

 Score =   319 bits (817),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 149/160 (93%), Positives = 157/160 (98%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKG+GPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGDGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNPINTVFDAKRLIGRRFSD+SVQSDIKLWPFKVIPGPG+KPMIVV +KGEEK+FAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDIKLWPFKVIPGPGEKPMIVVQHKGEEKQFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KM+EIAEAYLGST+KNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQ  160



>ref|XP_008812042.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Phoenix 
dactylifera]
Length=648

 Score =   319 bits (817),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 150/160 (94%), Positives = 154/160 (96%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNPINTVFDAKRLIGRRFSD+ VQSD+KLWPFKV+ GPGDKPMIVV YKGEEK+FAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDACVQSDVKLWPFKVVAGPGDKPMIVVQYKGEEKQFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KMKEIAEAYLGSTVKN VVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLMKMKEIAEAYLGSTVKNGVVTVPAYFNDSQRQ  160



>gb|AEK70336.1| heat shock protein 70 [Paeonia lactiflora]
Length=650

 Score =   319 bits (817),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 149/160 (93%), Positives = 156/160 (98%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNP NTVFDAKRLIGRRFSD+SVQSDIKLWPFK+IPGP +KPMIVVNYKGEEK+FAA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKLIPGPAEKPMIVVNYKGEEKQFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KM+EIAEA+LGSTVKNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLMKMREIAEAFLGSTVKNAVVTVPAYFNDSQRQ  160



>ref|XP_006365705.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Solanum 
tuberosum]
Length=649

 Score =   319 bits (817),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 150/160 (94%), Positives = 154/160 (96%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNP NTVFDAKRLIGRRFSD SVQSD+KLWPFKVIPGP DKPMIVVNYKGEEKEF+A
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPADKPMIVVNYKGEEKEFSA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KMKEIAEA+LG T+KNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLIKMKEIAEAFLGITIKNAVVTVPAYFNDSQRQ  160



>gb|KHN13891.1| Heat shock cognate 70 kDa protein 2 [Glycine soja]
Length=649

 Score =   319 bits (817),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 148/160 (93%), Positives = 157/160 (98%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKG+GPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGDGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNP+NTVFDAKRLIGRRFSD+SVQSD+KLWPFKVIPGP DKPMIVVNYKGE+K+F+A
Sbjct  61   QVAMNPVNTVFDAKRLIGRRFSDASVQSDMKLWPFKVIPGPADKPMIVVNYKGEDKQFSA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KM+EIAEAYLGSTVKNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLMKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQ  160



>ref|NP_001051724.1| Os03g0821100 [Oryza sativa Japonica Group]
 gb|AAO65876.1| heat shock protein cognate 70 [Oryza sativa Japonica Group]
 gb|ABF99592.1| Heat shock cognate 70 kDa protein 2, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF13638.1| Os03g0821100 [Oryza sativa Japonica Group]
 gb|EAZ29089.1| hypothetical protein OsJ_13143 [Oryza sativa Japonica Group]
 dbj|BAG91581.1| unnamed protein product [Oryza sativa Japonica Group]
Length=649

 Score =   319 bits (817),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 149/157 (95%), Positives = 155/157 (99%), Gaps = 0/157 (0%)
 Frame = +2

Query  89   KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKNQVA  268
            KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKNQVA
Sbjct  5    KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKNQVA  64

Query  269  MNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAAEEI  448
            MNPINTVFDAKRLIGRRFSD+SVQSDIK+WP+KVIPGPGDKPMIVV YKGEEK+F+AEEI
Sbjct  65   MNPINTVFDAKRLIGRRFSDASVQSDIKMWPYKVIPGPGDKPMIVVQYKGEEKQFSAEEI  124

Query  449  SSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            SSMVL KM+EIAEAYLGSTVKNAVVTVPAYFNDSQRQ
Sbjct  125  SSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQ  161



>ref|XP_009102555.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e [Brassica rapa]
Length=647

 Score =   318 bits (816),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 148/160 (93%), Positives = 155/160 (97%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTP YV FTD+ERLIGDAAKN
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPPYVAFTDSERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNPINTVFDAKRLIGRRFSDSSVQSD+KLWPFK+IPGP DKPMIVVNYKGEEK+FAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDSSVQSDMKLWPFKIIPGPADKPMIVVNYKGEEKQFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KM+EIAEAYLG T+KNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLIKMREIAEAYLGVTIKNAVVTVPAYFNDSQRQ  160



>ref|XP_010685795.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Beta vulgaris 
subsp. vulgaris]
Length=648

 Score =   318 bits (816),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 148/160 (93%), Positives = 156/160 (98%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNP NTVFDAKRLIGRRFSD SVQSD+KLWPFKVIPGP DKPMIVVN+KGEEK+F+A
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPADKPMIVVNHKGEEKQFSA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EE+SSMVLTKMKEIAEAYLG+T+KNAVVTVPAYFNDSQRQ
Sbjct  121  EEVSSMVLTKMKEIAEAYLGTTIKNAVVTVPAYFNDSQRQ  160



>ref|XP_008233611.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Prunus mume]
Length=649

 Score =   318 bits (816),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 148/160 (93%), Positives = 156/160 (98%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNP+NTVFDAKRLIGRRFSD SVQSD+KLWPFKVIPGPGDKPMIVV YKGEE++FAA
Sbjct  61   QVAMNPVNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPGDKPMIVVTYKGEERQFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KM+EIAEAYLG++VKNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLIKMREIAEAYLGASVKNAVVTVPAYFNDSQRQ  160



>gb|AAB42159.1| Hsc70 [Solanum lycopersicum]
Length=651

 Score =   319 bits (817),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 149/160 (93%), Positives = 155/160 (97%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNP NTVFDAKRLIGRRFSD SVQSD+KLWPFKVIPGP DKPMIVVNYKGEEK+F+A
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPADKPMIVVNYKGEEKQFSA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KMKEIAEA+LG+T+KNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLIKMKEIAEAFLGTTIKNAVVTVPAYFNDSQRQ  160



>ref|XP_004505872.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Cicer arietinum]
Length=649

 Score =   318 bits (816),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 150/160 (94%), Positives = 155/160 (97%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNP NTVFDAKRLIGRR SD+SVQSD+KLWPFKVIPGP +KPMIVVNYKGEEK+F+A
Sbjct  61   QVAMNPTNTVFDAKRLIGRRISDASVQSDMKLWPFKVIPGPAEKPMIVVNYKGEEKQFSA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLMKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  160



>ref|XP_003552691.1| PREDICTED: heat shock cognate 70 kDa protein 2 isoform 1 [Glycine 
max]
Length=649

 Score =   318 bits (816),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 148/160 (93%), Positives = 157/160 (98%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKG+GPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGDGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNP+NTVFDAKRLIGRRFSD+SVQSD+KLWPFKVIPGP DKPMIVVNYKGE+K+F+A
Sbjct  61   QVAMNPVNTVFDAKRLIGRRFSDASVQSDMKLWPFKVIPGPADKPMIVVNYKGEDKQFSA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KM+EIAEAYLGSTVKNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLMKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQ  160



>gb|AAP04522.1| heat shock protein 70 [Nicotiana tabacum]
Length=648

 Score =   318 bits (816),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 151/160 (94%), Positives = 156/160 (98%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNPINTVFDAKRLIGRRFSD+SVQSDIKLWPFK I GPGDKPMIVVNYKGEEK+FAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDIKLWPFKGISGPGDKPMIVVNYKGEEKQFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSM L KMKE+AEA+LGSTVKNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMGLIKMKEMAEAFLGSTVKNAVVTVPAYFNDSQRQ  160



>ref|XP_002311161.1| heat shock protein 70 [Populus trichocarpa]
 gb|EEE88528.1| heat shock protein 70 [Populus trichocarpa]
Length=648

 Score =   318 bits (816),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 149/160 (93%), Positives = 155/160 (97%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNP+NTVFDAKRLIGRRFSD SVQSD+KLWPFKVI GPGDKPMIVV YKGEEK+FAA
Sbjct  61   QVAMNPVNTVFDAKRLIGRRFSDPSVQSDVKLWPFKVIAGPGDKPMIVVTYKGEEKQFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KM+EIAEAYLG+T+KNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLIKMREIAEAYLGTTIKNAVVTVPAYFNDSQRQ  160



>ref|XP_009419750.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Musa acuminata 
subsp. malaccensis]
Length=648

 Score =   318 bits (816),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 147/160 (92%), Positives = 156/160 (98%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNP NTVFDAKRLIGRR+SD+SVQSDIKLWPFKV+PGPGDKPMI+V Y+GE+K+F+A
Sbjct  61   QVAMNPTNTVFDAKRLIGRRYSDASVQSDIKLWPFKVVPGPGDKPMIIVQYRGEDKQFSA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KMKEIAEAYLGST+KNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLIKMKEIAEAYLGSTIKNAVVTVPAYFNDSQRQ  160



>ref|XP_010319122.1| PREDICTED: heat shock protein 70 isoform 3 isoform X1 [Solanum 
lycopersicum]
Length=652

 Score =   318 bits (816),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 149/160 (93%), Positives = 155/160 (97%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNP NTVFDAKRLIGRRFSD SVQSD+KLWPFKVIPGP DKPMIVVNYKGEEK+F+A
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPADKPMIVVNYKGEEKQFSA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KMKEIAEA+LG+T+KNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLIKMKEIAEAFLGTTIKNAVVTVPAYFNDSQRQ  160



>ref|XP_011028442.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Populus 
euphratica]
Length=648

 Score =   318 bits (816),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 148/160 (93%), Positives = 156/160 (98%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNPINTVFDAKRLIGRR++D+SVQSDIKLWPFKVIPGP +KPMIVV YKGEEK+FAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRYTDTSVQSDIKLWPFKVIPGPAEKPMIVVTYKGEEKQFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KM+EIAEAYLG+T+KNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLIKMREIAEAYLGTTIKNAVVTVPAYFNDSQRQ  160



>ref|NP_001266213.1| heat shock protein 70 isoform 3 [Solanum lycopersicum]
 emb|CCA29122.1| heat shock protein 70 isoform 3 [Solanum lycopersicum]
Length=651

 Score =   318 bits (816),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 149/160 (93%), Positives = 155/160 (97%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNP NTVFDAKRLIGRRFSD SVQSD+KLWPFKVIPGP DKPMIVVNYKGEEK+F+A
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPADKPMIVVNYKGEEKQFSA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KMKEIAEA+LG+T+KNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLIKMKEIAEAFLGTTIKNAVVTVPAYFNDSQRQ  160



>gb|AAS09825.1| heat shock cognate protein 70 [Eutrema halophilum]
Length=651

 Score =   318 bits (816),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 147/160 (92%), Positives = 156/160 (98%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNPINTVFDAKRLIGRRFSDSSVQSD+KLWPFK+IPGP DKPMI+VNYKGEEK+FAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDSSVQSDMKLWPFKIIPGPADKPMIIVNYKGEEKQFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KM+EIAEAYLG ++KNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLIKMREIAEAYLGVSIKNAVVTVPAYFNDSQRQ  160



>ref|XP_011027580.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Populus 
euphratica]
Length=648

 Score =   318 bits (816),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 149/160 (93%), Positives = 155/160 (97%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNP+NTVFDAKRLIGRRFSD SVQSD+KLWPFKVI GPGDKPMIVV YKGEEK+FAA
Sbjct  61   QVAMNPVNTVFDAKRLIGRRFSDPSVQSDVKLWPFKVIAGPGDKPMIVVTYKGEEKQFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KM+EIAEAYLG+T+KNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLIKMREIAEAYLGTTIKNAVVTVPAYFNDSQRQ  160



>ref|XP_004287404.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Fragaria 
vesca subsp. vesca]
Length=649

 Score =   318 bits (816),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 149/160 (93%), Positives = 156/160 (98%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNP+NTVFDAKRLIGRRFSDSSVQ D+KLWPFKV+ GPGDKPMIVV+YKGE+K+FAA
Sbjct  61   QVAMNPVNTVFDAKRLIGRRFSDSSVQGDMKLWPFKVVAGPGDKPMIVVSYKGEDKQFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KM+EIAEAYLGSTVKNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLVKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQ  160



>gb|AAN86274.1| non-cell-autonomous heat shock cognate protein 70 [Cucurbita 
maxima]
Length=647

 Score =   318 bits (815),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 150/160 (94%), Positives = 156/160 (98%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNPINTVFDAKRLIGRRFSD+ VQSDIKLWPFKVI GPGDKPMIVV+YKGE+K+FAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDAPVQSDIKLWPFKVIAGPGDKPMIVVSYKGEDKQFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KM+EIAEAYLGSTVKNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQ  160



>ref|XP_009606077.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Nicotiana 
tomentosiformis]
Length=648

 Score =   318 bits (815),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 149/160 (93%), Positives = 155/160 (97%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNP NTVFDAKRLIGRRFSD SVQSD+KLWPFKVIPGP DKPMIVVNYKGEEK+F+A
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPADKPMIVVNYKGEEKQFSA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KMKEIAEA+LG+T+KNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLVKMKEIAEAFLGTTIKNAVVTVPAYFNDSQRQ  160



>ref|XP_007027052.1| Heat shock cognate protein 70-1 isoform 1 [Theobroma cacao]
 gb|EOY07554.1| Heat shock cognate protein 70-1 isoform 1 [Theobroma cacao]
Length=646

 Score =   318 bits (815),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 150/160 (94%), Positives = 156/160 (98%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNP+NTVFDAKRLIGRRFSD+SVQSDIKLWPFKVI GPGDKPMIVV+YKGEEK+FAA
Sbjct  61   QVAMNPVNTVFDAKRLIGRRFSDASVQSDIKLWPFKVISGPGDKPMIVVSYKGEEKQFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KM+EIAEA+LG  VKNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLMKMREIAEAFLGFAVKNAVVTVPAYFNDSQRQ  160



>ref|XP_006398709.1| hypothetical protein EUTSA_v10012922mg [Eutrema salsugineum]
 gb|ESQ40162.1| hypothetical protein EUTSA_v10012922mg [Eutrema salsugineum]
Length=651

 Score =   318 bits (815),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 147/160 (92%), Positives = 156/160 (98%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNPINTVFDAKRLIGRRFSDSSVQSD+KLWPFK+IPGP DKPMI+VNYKGEEK+FAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDSSVQSDMKLWPFKIIPGPADKPMIIVNYKGEEKQFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KM+EIAEAYLG ++KNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLIKMREIAEAYLGVSIKNAVVTVPAYFNDSQRQ  160



>emb|CAB72129.1| heat shock protein 70 [Cucumis sativus]
Length=652

 Score =   318 bits (816),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 150/160 (94%), Positives = 155/160 (97%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEI ANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIFANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNPINTVFDAKRLIGRRFSD+SVQSDIKLWPFKVI GP DKPMIVVNYKGEEK+F+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDIKLWPFKVIAGPSDKPMIVVNYKGEEKQFSA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KMKEIAEAYLG+TVKNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLIKMKEIAEAYLGTTVKNAVVTVPAYFNDSQRQ  160



>ref|NP_001183165.1| uncharacterized protein LOC100501536 [Zea mays]
 gb|ACR35910.1| unknown [Zea mays]
 gb|AFW84633.1| heat shock protein1 [Zea mays]
Length=648

 Score =   318 bits (815),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 150/158 (95%), Positives = 153/158 (97%), Gaps = 0/158 (0%)
 Frame = +2

Query  86   GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKNQV  265
             K EGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKNQV
Sbjct  2    AKSEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKNQV  61

Query  266  AMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAAEE  445
            AMNP NTVFDAKRLIGRRFSD SVQSD+KLWPFKVIPGPGDKPMIVVNYKGEEK+FAAEE
Sbjct  62   AMNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPGDKPMIVVNYKGEEKQFAAEE  121

Query  446  ISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            ISSMVL KMKEIAEAYLGST+KNAVVTVPAYFNDSQRQ
Sbjct  122  ISSMVLIKMKEIAEAYLGSTIKNAVVTVPAYFNDSQRQ  159



>gb|ACJ11742.1| heat shock protein 70 [Gossypium hirsutum]
 gb|KJB67650.1| hypothetical protein B456_010G202100 [Gossypium raimondii]
Length=648

 Score =   318 bits (815),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 149/160 (93%), Positives = 156/160 (98%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNPINTVFDAKRLIGRR+SDSSVQSD+KLWPFKVI GPGDKPMIVV YKGEEK+FAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRYSDSSVQSDMKLWPFKVIAGPGDKPMIVVTYKGEEKQFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KM+EIAEAYLG+T+KNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQ  160



>emb|CAA31663.1| hsp70 (AA 6 - 651) [Petunia x hybrida]
Length=646

 Score =   318 bits (815),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 150/155 (97%), Positives = 153/155 (99%), Gaps = 0/155 (0%)
 Frame = +2

Query  95   EGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKNQVAMN  274
            EGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKNQVAMN
Sbjct  1    EGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKNQVAMN  60

Query  275  PINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAAEEISS  454
            PINTVFDAKRLIGRRFSD SVQSDIKLWPFKVIPGPGDKPMIVV YKGEEK+FAAEEISS
Sbjct  61   PINTVFDAKRLIGRRFSDPSVQSDIKLWPFKVIPGPGDKPMIVVTYKGEEKQFAAEEISS  120

Query  455  MVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            MVLTKMKEIAEAYLG+T+KNAVVTVPAYFNDSQRQ
Sbjct  121  MVLTKMKEIAEAYLGTTIKNAVVTVPAYFNDSQRQ  155



>gb|ACJ11745.1| heat shock protein 70 [Gossypium hirsutum]
Length=648

 Score =   318 bits (815),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 149/160 (93%), Positives = 156/160 (98%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNPINTVFDAKRLIGRR+SDSSVQSD+KLWPFKVI GPGDKPMIVV YKGEEK+FAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRYSDSSVQSDMKLWPFKVIAGPGDKPMIVVTYKGEEKQFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KM+EIAEAYLG+T+KNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQ  160



>ref|XP_007162654.1| hypothetical protein PHAVU_001G169000g [Phaseolus vulgaris]
 gb|ESW34648.1| hypothetical protein PHAVU_001G169000g [Phaseolus vulgaris]
Length=651

 Score =   318 bits (815),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 151/160 (94%), Positives = 155/160 (97%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNPINTVFDAKRLIGRRF+D+ VQSDIKLWPFKVI GP DKP IVVNYKGEEK+FAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFTDAPVQSDIKLWPFKVIAGPADKPTIVVNYKGEEKQFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KM+EIAEAYLGSTVKNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLMKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQ  160



>ref|XP_008784528.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Phoenix 
dactylifera]
Length=648

 Score =   318 bits (815),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 147/160 (92%), Positives = 156/160 (98%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERL+GDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLVGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNP NTVFDAKRLIGRRFSD+SVQSD++LWPFKVIPGPGDKP+IVV YKGEEK+FAA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDTSVQSDMRLWPFKVIPGPGDKPLIVVQYKGEEKQFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KM+EIAEAYLGS++KNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLMKMREIAEAYLGSSIKNAVVTVPAYFNDSQRQ  160



>ref|XP_011016414.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Populus euphratica]
Length=648

 Score =   318 bits (815),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 147/160 (92%), Positives = 156/160 (98%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSC+GVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCIGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNPINTVFDAKRLIGRR++D+SVQSDIKLWPFKVIPGP +KPMIVV YKGEEK+FAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRYTDTSVQSDIKLWPFKVIPGPAEKPMIVVTYKGEEKQFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KM+EIAEAYLG+T+KNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLIKMREIAEAYLGTTIKNAVVTVPAYFNDSQRQ  160



>ref|XP_007009369.1| Heat shock protein 70 [Theobroma cacao]
 gb|EOY18179.1| Heat shock protein 70 [Theobroma cacao]
Length=649

 Score =   318 bits (815),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 149/160 (93%), Positives = 156/160 (98%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNPINTVFDAKRLIGRRF+D++VQSDIKLWPFKVI GP DKPMIVVNYKGEEK+FAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFTDATVQSDIKLWPFKVIAGPADKPMIVVNYKGEEKQFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KM+EIAEAYLGST+KNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQ  160



>gb|KCW74480.1| hypothetical protein EUGRSUZ_E03189 [Eucalyptus grandis]
Length=522

 Score =   314 bits (805),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 148/160 (93%), Positives = 155/160 (97%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQ+DRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQYDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            Q AMNPINTVF+AKRLIGRRFSD+S+QSDIK WPFKVIPGPGDKPMIVVNYKGEE++FAA
Sbjct  61   QFAMNPINTVFNAKRLIGRRFSDASLQSDIKFWPFKVIPGPGDKPMIVVNYKGEEEQFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KM+EIAEAYLGS VKNAVVTVPA FNDSQRQ
Sbjct  121  EEISSMVLMKMREIAEAYLGSAVKNAVVTVPAAFNDSQRQ  160



>gb|AAS57913.1| 70 kDa heat shock cognate protein 2 [Vigna radiata]
Length=648

 Score =   318 bits (814),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 149/160 (93%), Positives = 156/160 (98%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNPINTVFDAKRLIGRRF+D+SVQSDIKLWPFKV  GPGDKPMI VNYKGE+K+F+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFTDASVQSDIKLWPFKVFSGPGDKPMIQVNYKGEDKQFSA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KM+EIAEAYLG+TVKNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLMKMREIAEAYLGTTVKNAVVTVPAYFNDSQRQ  160



>ref|XP_009353696.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e isoform X2 [Pyrus x bretschneideri]
Length=520

 Score =   314 bits (805),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 146/160 (91%), Positives = 156/160 (98%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MA KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN
Sbjct  1    MAAKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNP+NTVFDAKRLIGRRF+D+++QSD+KLWPFKVI G GDKP IVVNYKGE+K+FAA
Sbjct  61   QVAMNPVNTVFDAKRLIGRRFTDATIQSDMKLWPFKVIAGAGDKPTIVVNYKGEDKQFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVLTKM+EIAEAYLGSTVKN+VVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLTKMREIAEAYLGSTVKNSVVTVPAYFNDSQRQ  160



>gb|EYU26579.1| hypothetical protein MIMGU_mgv1a002667mg [Erythranthe guttata]
Length=648

 Score =   318 bits (814),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 148/160 (93%), Positives = 156/160 (98%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNP NTVFDAKRLIGRRFSD+ VQ D+K+WPFKVIPGPG+KPMIVVNYKGE+K+FAA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDAPVQGDMKMWPFKVIPGPGEKPMIVVNYKGEDKQFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KM+EIAEAYLGSTVKNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLMKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQ  160



>gb|KFK24738.1| hypothetical protein AALP_AA8G018100 [Arabis alpina]
Length=650

 Score =   317 bits (813),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 146/160 (91%), Positives = 156/160 (98%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNP+NTVFDAKRLIGRRFSDSSVQSD+KLWPFK+IPGP DKPMI+VNYKGEEK+FAA
Sbjct  61   QVAMNPVNTVFDAKRLIGRRFSDSSVQSDMKLWPFKIIPGPADKPMIIVNYKGEEKQFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KM+EIAEAYLG ++KNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLIKMREIAEAYLGVSIKNAVVTVPAYFNDSQRQ  160



>ref|XP_002283532.2| PREDICTED: heat shock cognate 70 kDa protein 2 [Vitis vinifera]
Length=650

 Score =   317 bits (813),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 149/160 (93%), Positives = 154/160 (96%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNPINTVFDAKRLIGRRFSD+SVQSDIK W FKV+PGPGDKPMI V YKGE+K+FAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDIKHWSFKVVPGPGDKPMITVTYKGEDKQFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KM+EIAEAYLGSTVKNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQ  160



>ref|XP_008241192.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e [Prunus mume]
Length=647

 Score =   317 bits (812),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 150/160 (94%), Positives = 155/160 (97%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNPINTVFDAKRLIGRRFSD+SVQSD+KLWPFKV PGPGDKPMI V+YKGEEK FAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDMKLWPFKVTPGPGDKPMIGVSYKGEEKVFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KM+EIAEAYLGST+KNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQ  160



>gb|AAS57912.1| 70 kDa heat shock cognate protein 1 [Vigna radiata]
Length=649

 Score =   317 bits (812),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 150/160 (94%), Positives = 155/160 (97%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNP NTVFDAKRLIGRRFSD+SVQSDIKLWPFKVI G GDKPMIVVNYKGEEK+F+A
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVISGAGDKPMIVVNYKGEEKQFSA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KMKEIAEA+LGSTVKNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLIKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQ  160



>ref|XP_011027667.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Populus euphratica]
Length=515

 Score =   313 bits (802),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 147/160 (92%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNPINTVFDAKRLIGRRFSD+SVQ DIK WPFKV PG GDKPMI VNYKGEEK+F+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQGDIKHWPFKVTPGAGDKPMISVNYKGEEKQFSA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KM+EIAEAYLG+T+KNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLIKMREIAEAYLGTTIKNAVVTVPAYFNDSQRQ  160



>ref|XP_009778799.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Nicotiana 
sylvestris]
Length=650

 Score =   317 bits (812),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 148/160 (93%), Positives = 155/160 (97%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNP NTVFDAKRLIGRRF+D SVQSD+KLWPFKVIPGP DKPMIVVNYKGEEK+F+A
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFNDPSVQSDMKLWPFKVIPGPADKPMIVVNYKGEEKQFSA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KMKEIAEA+LG+T+KNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLVKMKEIAEAFLGTTIKNAVVTVPAYFNDSQRQ  160



>gb|KDP44987.1| hypothetical protein JCGZ_01487 [Jatropha curcas]
Length=648

 Score =   317 bits (812),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 149/160 (93%), Positives = 155/160 (97%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNPINTVFDAKRLIGRRFSD SVQ D+KLWPFKVI GPGDKPMIVV+YKGEEK+F+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDPSVQGDMKLWPFKVIAGPGDKPMIVVSYKGEEKQFSA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KM+EIAEAYLGST+KNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQ  160



>ref|XP_007220208.1| hypothetical protein PRUPE_ppa002641mg [Prunus persica]
 gb|EMJ21407.1| hypothetical protein PRUPE_ppa002641mg [Prunus persica]
Length=649

 Score =   317 bits (812),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 148/160 (93%), Positives = 155/160 (97%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNP+NTVFDAKRLIGRRFSD SVQSD+KLWPFKVIPGPGDKPMIVV YKGEE++FAA
Sbjct  61   QVAMNPVNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPGDKPMIVVTYKGEERQFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KM+EIAEAYLG +VKNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLIKMREIAEAYLGLSVKNAVVTVPAYFNDSQRQ  160



>ref|XP_008674843.1| PREDICTED: heat shock 70 kDa protein-like [Zea mays]
 tpg|DAA56909.1| TPA: hypothetical protein ZEAMMB73_648566 [Zea mays]
Length=648

 Score =   317 bits (811),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 149/158 (94%), Positives = 153/158 (97%), Gaps = 0/158 (0%)
 Frame = +2

Query  86   GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKNQV  265
             KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKNQV
Sbjct  2    AKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV  61

Query  266  AMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAAEE  445
            AMNP NTVFDAKRLIGRRFSD SVQSD+KLWPFKVIPGPGDKPMIVV+YKGEEK+FAAEE
Sbjct  62   AMNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPGDKPMIVVSYKGEEKQFAAEE  121

Query  446  ISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            ISSMVL KMKEIAEAYLGST+KNAVVTVPAYFNDSQRQ
Sbjct  122  ISSMVLIKMKEIAEAYLGSTIKNAVVTVPAYFNDSQRQ  159



>gb|AAS57914.1| 70 kDa heat shock cognate protein 3 [Vigna radiata]
Length=650

 Score =   317 bits (812),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 151/160 (94%), Positives = 154/160 (96%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQ NRTTPSYVGFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQSNRTTPSYVGFTDTERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNPINTVFDAKRLIGRRFSD+ VQSDIKLWPFKVI GP DKP IVVNYKGEEK+FAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDAPVQSDIKLWPFKVIAGPADKPTIVVNYKGEEKQFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KM+EIAEAYLGSTVKNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLMKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQ  160



>gb|EMT11425.1| Heat shock cognate 70 kDa protein 1 [Aegilops tauschii]
Length=648

 Score =   317 bits (811),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 149/160 (93%), Positives = 154/160 (96%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNP+NTVFDAKRLIGRR SD SVQSD+KLWPFKVI GPGDKPMIVV YKGEEKEFAA
Sbjct  61   QVAMNPVNTVFDAKRLIGRRVSDPSVQSDMKLWPFKVIAGPGDKPMIVVQYKGEEKEFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KM+EIAEAYLGST+KNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQ  160



>gb|AAA62445.1| heat shock protein [Spinacia oleracea]
 gb|AAB88134.1| cytosolic heat shock 70 protein [Spinacia oleracea]
Length=647

 Score =   316 bits (810),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 149/160 (93%), Positives = 156/160 (98%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNPINTVFDAKRLIGRRFSD+SVQ+D+K WPFKV+ GPG+KPMI VNYKGEEK+FAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQADMKHWPFKVVSGPGEKPMIGVNYKGEEKQFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  160



>gb|KEH30132.1| heat shock cognate 70 kDa protein [Medicago truncatula]
Length=578

 Score =   314 bits (805),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 148/160 (93%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNP NTVFDAKRLIGRR SD SVQSD+KLWPFKVIPGP DKPMIVVNYK EEK+F+A
Sbjct  61   QVAMNPTNTVFDAKRLIGRRISDVSVQSDMKLWPFKVIPGPADKPMIVVNYKAEEKQFSA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KMKEIAEAYLG+T+KNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLMKMKEIAEAYLGTTIKNAVVTVPAYFNDSQRQ  160



>ref|XP_006436010.1| hypothetical protein CICLE_v10030928mg [Citrus clementina]
 gb|ESR49250.1| hypothetical protein CICLE_v10030928mg [Citrus clementina]
Length=648

 Score =   316 bits (810),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 149/160 (93%), Positives = 154/160 (96%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNP NTVFDAKRLIGRRFSD+SVQ D+KLWPFKVI GP DKPMI VNYKGEEK+FAA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KM+EIAEAYLGST+KNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQ  160



>ref|XP_004962705.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c-like [Setaria italica]
Length=649

 Score =   316 bits (810),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 148/160 (93%), Positives = 156/160 (98%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKG+GPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGDGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNPINTVFDAKRLIGRRFSD+SVQSDIKLWPFKVI GPG+KPMIVV +KGEEK+FAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDIKLWPFKVISGPGEKPMIVVQHKGEEKQFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KM+EIAEAYLGST+KNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQ  160



>ref|XP_002442353.1| hypothetical protein SORBIDRAFT_08g018750 [Sorghum bicolor]
 gb|EES16191.1| hypothetical protein SORBIDRAFT_08g018750 [Sorghum bicolor]
 gb|AHV91025.1| Hsp70 [Saccharum hybrid cultivar]
Length=649

 Score =   316 bits (810),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 148/160 (93%), Positives = 156/160 (98%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKG+GPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGDGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNPINTVFDAKRLIGRRFSD+SVQSDIKLWPFKVI GPG+KPMIVV +KGEEK+FAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDIKLWPFKVISGPGEKPMIVVQHKGEEKQFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KM+EIAEAYLGST+KNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQ  160



>ref|XP_001759874.1| predicted protein [Physcomitrella patens]
 gb|EDQ75378.1| predicted protein [Physcomitrella patens]
Length=648

 Score =   316 bits (810),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 149/160 (93%), Positives = 154/160 (96%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNPINTVFDAKRLIGRRFSD+SVQSD+KLWPFK+ PGPG+KPMI V YKGEEK FAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDMKLWPFKITPGPGEKPMISVQYKGEEKTFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  160



>gb|ACB70177.1| 70 kDa heat shock protein [Capparis spinosa]
Length=649

 Score =   316 bits (810),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 147/160 (92%), Positives = 155/160 (97%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNPINTVFDAKRLIGRR+SDSSVQ+D+KLWPFKV+PG GDKPMIVVNYKGEEK+FAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRYSDSSVQADMKLWPFKVVPGSGDKPMIVVNYKGEEKQFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KM+EIAEA+LG T+KN VVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLIKMREIAEAFLGCTIKNGVVTVPAYFNDSQRQ  160



>ref|XP_006488297.1| PREDICTED: heat shock cognate 70 kDa protein-like [Citrus sinensis]
Length=649

 Score =   316 bits (810),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 149/160 (93%), Positives = 154/160 (96%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNP NTVFDAKRLIGRRFSD SVQSD+KLWPFKVI G GDKPMIVVNYKGEEK+F+A
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIAGAGDKPMIVVNYKGEEKQFSA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KMKEIAEAYLG+T+KNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLNKMKEIAEAYLGTTIKNAVVTVPAYFNDSQRQ  160



>ref|XP_003564580.1| PREDICTED: heat shock cognate 70 kDa protein [Brachypodium distachyon]
Length=654

 Score =   316 bits (810),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 149/160 (93%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MA  GEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN
Sbjct  1    MAKGGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNP NTVFDAKRLIGRRFSD SVQSD+KLWPFKVIPGPGDKPMIVV YKGEEK+FAA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPGDKPMIVVQYKGEEKQFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KMKEI EAYLG+T+KNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLIKMKEIGEAYLGTTIKNAVVTVPAYFNDSQRQ  160



>ref|XP_006424799.1| hypothetical protein CICLE_v10027981mg [Citrus clementina]
 gb|ESR38039.1| hypothetical protein CICLE_v10027981mg [Citrus clementina]
Length=649

 Score =   316 bits (809),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 149/160 (93%), Positives = 154/160 (96%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNP NTVFDAKRLIGRRFSD SVQSD+KLWPFKVI G GDKPMIVVNYKGEEK+F+A
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIAGAGDKPMIVVNYKGEEKQFSA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KMKEIAEAYLG+T+KNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLNKMKEIAEAYLGTTIKNAVVTVPAYFNDSQRQ  160



>ref|XP_007207158.1| hypothetical protein PRUPE_ppa024477mg [Prunus persica]
 gb|EMJ08357.1| hypothetical protein PRUPE_ppa024477mg [Prunus persica]
Length=635

 Score =   315 bits (808),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 149/160 (93%), Positives = 155/160 (97%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNPINTVFDAKRLIGRRFSD+SVQSD+KLWPFKV PGPGDKPMI V+YKGE+K FAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDMKLWPFKVTPGPGDKPMIGVSYKGEDKVFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KM+EIAEAYLGST+KNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQ  160



>gb|KEH30131.1| heat shock cognate 70 kDa protein [Medicago truncatula]
Length=649

 Score =   316 bits (809),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 148/160 (93%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNP NTVFDAKRLIGRRF D SVQSD+KLWPFKVIPGP DKPMIVVNYK EEK+F+A
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFGDVSVQSDMKLWPFKVIPGPADKPMIVVNYKAEEKQFSA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KMKEIAEAYLG+T+KNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLMKMKEIAEAYLGTTIKNAVVTVPAYFNDSQRQ  160



>ref|XP_009115390.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e [Brassica rapa]
Length=649

 Score =   316 bits (809),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 147/158 (93%), Positives = 154/158 (97%), Gaps = 0/158 (0%)
 Frame = +2

Query  86   GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKNQV  265
            GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKNQV
Sbjct  4    GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQV  63

Query  266  AMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAAEE  445
            AMNPINTVFDAKRLIGRRFSDSSVQSD+KLWPFK+IPGP DKPMIVV+YKGEEK+FAAEE
Sbjct  64   AMNPINTVFDAKRLIGRRFSDSSVQSDMKLWPFKIIPGPADKPMIVVDYKGEEKQFAAEE  123

Query  446  ISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            ISSMVL KM+EIAEAYLG T+KNAVVTVPAYFNDSQRQ
Sbjct  124  ISSMVLIKMREIAEAYLGVTIKNAVVTVPAYFNDSQRQ  161



>gb|EPS68565.1| hypothetical protein M569_06198 [Genlisea aurea]
Length=650

 Score =   316 bits (809),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 150/160 (94%), Positives = 156/160 (98%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNPINTVFDAKRLIGRRFSD+SVQSDIKLWPFKVI G GDKPMIVV+YKGE+K+FAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDIKLWPFKVIAGVGDKPMIVVSYKGEDKQFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KMKEIA+AYLG+TVKNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLIKMKEIADAYLGTTVKNAVVTVPAYFNDSQRQ  160



>ref|XP_009112006.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e [Brassica rapa]
Length=517

 Score =   312 bits (799),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 146/160 (91%), Positives = 154/160 (96%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNPINTVFDAKRLIGRRFSDSSVQSD+KLW FK+I GP +KPMIVVNYKGEEK+FAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDSSVQSDMKLWLFKIIAGPAEKPMIVVNYKGEEKQFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KM+EIAEAYLG T+KNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLIKMREIAEAYLGVTIKNAVVTVPAYFNDSQRQ  160



>ref|XP_001767839.1| predicted protein [Physcomitrella patens]
 gb|EDQ67353.1| predicted protein [Physcomitrella patens]
Length=649

 Score =   316 bits (809),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 148/160 (93%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNP NTVFDAKRLIGRRFSD+SVQSD+KLWPFK+ PGPG+KPMI V YKGEEK FAA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDASVQSDMKLWPFKITPGPGEKPMISVQYKGEEKTFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EE+SSMVL KMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ
Sbjct  121  EEVSSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  160



>gb|AIA22210.1| heat shock protein 70 [Chrysanthemum indicum]
Length=647

 Score =   316 bits (809),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 149/160 (93%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNP NTVFDAKRLIGRRFSD+SVQSDIKLWPFKV PGP +KPMI VNYKGEEK FAA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVTPGPAEKPMIAVNYKGEEKTFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KMKEIAEA+LGSTVKNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLIKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQ  160



>ref|XP_009122772.1| PREDICTED: LOW QUALITY PROTEIN: probable mediator of RNA polymerase 
II transcription subunit 37e [Brassica rapa]
Length=646

 Score =   315 bits (808),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 147/160 (92%), Positives = 155/160 (97%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNPINTVFDAKRLIGRRFSDSSVQSD+KLWPFK+I GP +KPMIVVNYKGEEK+FAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDSSVQSDMKLWPFKIIAGPAEKPMIVVNYKGEEKQFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KM+EIAEAYLG T+KNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLIKMREIAEAYLGVTIKNAVVTVPAYFNDSQRQ  160



>ref|XP_009357717.1| PREDICTED: heat shock cognate 70 kDa protein 2 isoform X1 [Pyrus 
x bretschneideri]
Length=650

 Score =   315 bits (808),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 148/160 (93%), Positives = 154/160 (96%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNP+NTVFDAKRLIGRRFSD SVQ D+K WPFKVIPGPGDKPMIVV YKGEEK+FAA
Sbjct  61   QVAMNPVNTVFDAKRLIGRRFSDPSVQGDMKHWPFKVIPGPGDKPMIVVIYKGEEKQFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KM+EIAEAYLGS++KNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLVKMREIAEAYLGSSIKNAVVTVPAYFNDSQRQ  160



>ref|XP_008674324.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Zea mays]
 gb|ACL53191.1| unknown [Zea mays]
 tpg|DAA55191.1| TPA: heat shock protein70-4 isoform 1 [Zea mays]
 tpg|DAA55192.1| TPA: heat shock protein70-4 isoform 2 [Zea mays]
 tpg|DAA55193.1| TPA: heat shock protein70-4 isoform 3 [Zea mays]
Length=649

 Score =   315 bits (808),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 148/160 (93%), Positives = 156/160 (98%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKG+GPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGDGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNPINTVFDAKRLIGRRFSD+SVQSDIKLWPFKVI GPG+KPMIVV +KGEEK+FAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDIKLWPFKVISGPGEKPMIVVQHKGEEKQFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KM+EIAEAYLGST+KNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQ  160



>ref|XP_008458906.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Cucumis 
melo]
Length=652

 Score =   316 bits (809),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 150/160 (94%), Positives = 154/160 (96%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEG AIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGTAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNPINTVFDAKRLIGRRFSD SVQSDIKLWPFKVI GP DKPMIVVNYKGEEK+F+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDPSVQSDIKLWPFKVIAGPSDKPMIVVNYKGEEKQFSA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KMKEIAEAYLG+TVKNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLIKMKEIAEAYLGTTVKNAVVTVPAYFNDSQRQ  160



>ref|XP_006429028.1| hypothetical protein CICLE_v10011260mg [Citrus clementina]
 ref|XP_006480766.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37e-like [Citrus sinensis]
 gb|ESR42268.1| hypothetical protein CICLE_v10011260mg [Citrus clementina]
 gb|KDO41235.1| hypothetical protein CISIN_1g006381mg [Citrus sinensis]
Length=647

 Score =   315 bits (808),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 149/160 (93%), Positives = 154/160 (96%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNPINTVFDAKRLIGRRFSD++VQSD KLWPFKVI G GDKPMIVV YKGEEK+FAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDATVQSDTKLWPFKVIAGAGDKPMIVVTYKGEEKQFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KM+EIAEAYLGSTVKNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQ  160



>ref|XP_010669896.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104887018 
[Beta vulgaris subsp. vulgaris]
Length=1526

 Score =   328 bits (840),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 154/160 (96%), Positives = 159/160 (99%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNPINTVFDAKRLIGRRFSD+SVQ+DIKLWPFKVIPGPG+KPMIVVNYKGEEK+FAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQADIKLWPFKVIPGPGEKPMIVVNYKGEEKQFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  160


 Score =   151 bits (381),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 75/100 (75%), Positives = 84/100 (84%), Gaps = 3/100 (3%)
 Frame = +2

Query  269   MNPINTVFDAKRLIGR---RFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
             + PI+ V    R   R    F D+SVQSD+KLWPFKVIPGPGDKPMIVV+YKGE+K+FAA
Sbjct  936   LQPISIVILFLRFFLRVITSFFDASVQSDMKLWPFKVIPGPGDKPMIVVSYKGEDKQFAA  995

Query  440   EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
             EEISSMVL KMKEIA+A+LG TVKNAVVTVPAYFNDSQRQ
Sbjct  996   EEISSMVLIKMKEIADAFLGITVKNAVVTVPAYFNDSQRQ  1035



>gb|AAB88009.1| heat shock cognate protein HSC70 [Brassica napus]
Length=645

 Score =   315 bits (808),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 147/160 (92%), Positives = 155/160 (97%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNPINTVFDAKRLIGRRFSDSSVQSD+KLWPFK+I GP +KPMIVVNYKGEEK+FAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDSSVQSDMKLWPFKIIAGPAEKPMIVVNYKGEEKQFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KM+EIAEAYLG T+KNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLIKMREIAEAYLGVTIKNAVVTVPAYFNDSQRQ  160



>ref|NP_001049712.1| Os03g0276500 [Oryza sativa Japonica Group]
 gb|ABF95258.1| Heat shock cognate 70 kDa protein, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF11626.1| Os03g0276500 [Oryza sativa Japonica Group]
 gb|EAZ26443.1| hypothetical protein OsJ_10329 [Oryza sativa Japonica Group]
 dbj|BAG93163.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|ADR66978.1| 70 kDa heat shock protein [Oryza sativa Japonica Group]
Length=650

 Score =   315 bits (808),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 148/160 (93%), Positives = 154/160 (96%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKG+GPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGDGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNPINTVFDAKRLIGRRFSD+SVQSD KLWPFKV+PGPGDKPMI V YKGEEK+F+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDTSVQSDAKLWPFKVLPGPGDKPMIGVQYKGEEKQFSA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KMKE AEAYLGSTVKNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLNKMKETAEAYLGSTVKNAVVTVPAYFNDSQRQ  160



>emb|CDP09035.1| unnamed protein product [Coffea canephora]
Length=650

 Score =   315 bits (808),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 147/160 (92%), Positives = 154/160 (96%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKG+GPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGDGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNP NTVFDAKRLIGRR SDSSVQ+DIKLWPFKVI GPGDKPMI VNYKGEEK+FAA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRLSDSSVQNDIKLWPFKVIAGPGDKPMIAVNYKGEEKQFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KMKE+AEAYLG+T+KNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLIKMKEVAEAYLGTTIKNAVVTVPAYFNDSQRQ  160



>ref|WP_039310754.1| molecular chaperone DnaK [Paenibacillus sp. IHB B 3415]
 gb|AHL69785.1| heat shock protein [Camellia sinensis]
 gb|KHL91223.1| molecular chaperone DnaK [Paenibacillus sp. IHB B 3415]
Length=650

 Score =   315 bits (808),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 149/160 (93%), Positives = 154/160 (96%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNP NTVFDAKRLIGRRF+D+SVQSD+KLWPFKVI GPGDKPMI VNYKGEEK FAA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFTDASVQSDMKLWPFKVIAGPGDKPMIGVNYKGEEKLFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KM+EIAEAYLGSTVKNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQ  160



>gb|ACR38891.1| heat shock protein 70 [Pellia endiviifolia (species B)]
 gb|ACR38900.1| heat shock protein 70 [Pellia endiviifolia (species B)]
Length=651

 Score =   315 bits (808),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 149/160 (93%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNP NTVFDAKRLIGRRFSD SVQ D+KLWPFKV PGPGDKPMI V YKGEEK+FAA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDGSVQDDMKLWPFKVTPGPGDKPMIGVQYKGEEKQFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KMKEIAEAYLGST+KNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLIKMKEIAEAYLGSTIKNAVVTVPAYFNDSQRQ  160



>ref|XP_006287234.1| hypothetical protein CARUB_v10000420mg [Capsella rubella]
 gb|EOA20132.1| hypothetical protein CARUB_v10000420mg [Capsella rubella]
Length=651

 Score =   315 bits (808),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 145/160 (91%), Positives = 155/160 (97%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNP+NTVFDAKRLIGRRFSDSSVQSD+KLWPFK++PGP DKPMI VNYKGEEK+FAA
Sbjct  61   QVAMNPVNTVFDAKRLIGRRFSDSSVQSDMKLWPFKILPGPADKPMIYVNYKGEEKQFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KM+EIAEAYLG ++KNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLIKMREIAEAYLGVSIKNAVVTVPAYFNDSQRQ  160



>ref|XP_002456611.1| hypothetical protein SORBIDRAFT_03g039360 [Sorghum bicolor]
 gb|EES01731.1| hypothetical protein SORBIDRAFT_03g039360 [Sorghum bicolor]
Length=648

 Score =   315 bits (807),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 148/158 (94%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = +2

Query  86   GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKNQV  265
             K EGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKNQV
Sbjct  2    AKSEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV  61

Query  266  AMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAAEE  445
            AMNP NTVFDAKRLIGRRFSD SVQSD+KLWPFKVIPGPGDKPMIVVNYKGEEK+FAAEE
Sbjct  62   AMNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPGDKPMIVVNYKGEEKQFAAEE  121

Query  446  ISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            ISSMVL KM+EIAEAYLGST+KNAVVTVPAYFNDSQRQ
Sbjct  122  ISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQ  159



>gb|KEH30133.1| heat shock cognate 70 kDa protein [Medicago truncatula]
Length=649

 Score =   315 bits (807),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 148/160 (93%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNP NTVFDAKRLIGRR SD SVQSD+KLWPFKVIPGP DKPMIVVNYK EEK+F+A
Sbjct  61   QVAMNPTNTVFDAKRLIGRRISDVSVQSDMKLWPFKVIPGPADKPMIVVNYKAEEKQFSA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KMKEIAEAYLG+T+KNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLMKMKEIAEAYLGTTIKNAVVTVPAYFNDSQRQ  160



>gb|ACM42161.1| heat shock protein 70.58 [Ageratina adenophora]
Length=645

 Score =   315 bits (807),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 147/160 (92%), Positives = 155/160 (97%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNP NTVFDAKRLIGRRFSD+SVQSDIKLWPFKV PGPG+KPMI VNYKGEEK+F+A
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVTPGPGEKPMISVNYKGEEKQFSA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KMKEIAEA+LG+TVKNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLIKMKEIAEAFLGTTVKNAVVTVPAYFNDSQRQ  160



>ref|XP_006297174.1| hypothetical protein CARUB_v10013178mg [Capsella rubella]
 gb|EOA30072.1| hypothetical protein CARUB_v10013178mg [Capsella rubella]
Length=649

 Score =   315 bits (807),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 147/160 (92%), Positives = 155/160 (97%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNPINTVFDAKRLIGRRFSDSSVQSD  LWPFK+I GPG+KPMIVVNYKGE+KEF+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDSSVQSDRALWPFKIISGPGEKPMIVVNYKGEDKEFSA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSM+L KM+EIAEAYLG+T+KNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMILIKMREIAEAYLGTTIKNAVVTVPAYFNDSQRQ  160



>ref|XP_004307527.1| PREDICTED: heat shock cognate 70 kDa protein 2 [Fragaria vesca 
subsp. vesca]
Length=651

 Score =   315 bits (807),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 148/160 (93%), Positives = 155/160 (97%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNPINTVFDAKRLIGRRFSD+SVQ D+KLWPFKV+ GPGDKPMI V+YKGEEK+FAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQGDMKLWPFKVVAGPGDKPMINVSYKGEEKQFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KM+EIAEAYLG+TVKNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLVKMREIAEAYLGTTVKNAVVTVPAYFNDSQRQ  160



>ref|XP_009407484.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Musa acuminata subsp. malaccensis]
 ref|XP_009407485.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Musa acuminata subsp. malaccensis]
Length=649

 Score =   315 bits (807),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 149/161 (93%), Positives = 154/161 (96%), Gaps = 0/161 (0%)
 Frame = +2

Query  77   IMAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAK  256
            +  GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAK
Sbjct  1    MAGGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  60

Query  257  NQVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFA  436
            NQVAMNPINTVFDAKRLIGRR+SD SVQSDIKLWPFKVI GPGDKPMIVV YKGEEK+F+
Sbjct  61   NQVAMNPINTVFDAKRLIGRRYSDPSVQSDIKLWPFKVIAGPGDKPMIVVQYKGEEKQFS  120

Query  437  AEEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            AEEISSMVL KMKEIAEAYLG+TVKNAVVTVPAYFNDSQRQ
Sbjct  121  AEEISSMVLIKMKEIAEAYLGTTVKNAVVTVPAYFNDSQRQ  161



>ref|XP_004970526.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c-like [Setaria italica]
Length=648

 Score =   315 bits (807),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 148/158 (94%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = +2

Query  86   GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKNQV  265
             K EGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKNQV
Sbjct  2    AKSEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV  61

Query  266  AMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAAEE  445
            AMNP NTVFDAKRLIGRRFSD SVQSD+KLWPFKVIPGPGDKPMIVVNYKGEEK+FAAEE
Sbjct  62   AMNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPGDKPMIVVNYKGEEKQFAAEE  121

Query  446  ISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            ISSMVL KM+EIAEAYLGST+KNAVVTVPAYFNDSQRQ
Sbjct  122  ISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQ  159



>ref|XP_001751923.1| predicted protein [Physcomitrella patens]
 gb|EDQ83358.1| predicted protein [Physcomitrella patens]
Length=648

 Score =   315 bits (807),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 148/160 (93%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNP NTVFDAKRLIGRRFSD+SVQSD+KLWPFK+ PGPG+KPMI V YKGEEK FAA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDASVQSDMKLWPFKITPGPGEKPMISVMYKGEEKTFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EE+SSMVL KMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ
Sbjct  121  EEVSSMVLIKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  160



>gb|EYU19900.1| hypothetical protein MIMGU_mgv1a002641mg [Erythranthe guttata]
Length=651

 Score =   315 bits (807),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 146/160 (91%), Positives = 155/160 (97%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNP+NTVFDAKRLIGRRFSD SVQ+D+KLWPFKVIPGP +KPMIVV+YKGEEK+FAA
Sbjct  61   QVAMNPVNTVFDAKRLIGRRFSDPSVQADMKLWPFKVIPGPAEKPMIVVSYKGEEKQFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KM+EIAEAYLG T+KNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLIKMREIAEAYLGKTIKNAVVTVPAYFNDSQRQ  160



>ref|XP_009414320.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Musa acuminata subsp. malaccensis]
Length=648

 Score =   315 bits (807),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 148/160 (93%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKG+GPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGDGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNPINTVFDAKRLIGRRF+D+SVQSDIKLWPFKV  GPGDKPMI V YKGEEK+F+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFTDASVQSDIKLWPFKVTSGPGDKPMIAVQYKGEEKQFSA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KMKEIAEAYLGS VKNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLMKMKEIAEAYLGSVVKNAVVTVPAYFNDSQRQ  160



>gb|AAB97316.1| cytosolic heat shock 70 protein [Spinacia oleracea]
 gb|AAB88132.1| cytosolic heat shock 70 protein [Spinacia oleracea]
 gb|AAB88133.1| cytosolic heat shock 70 protein [Spinacia oleracea]
Length=651

 Score =   315 bits (806),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 147/160 (92%), Positives = 156/160 (98%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNPINTVFDAKRLIGRRFSD+SVQSD+KLWPFKVIPG GDKPMIVV+YKGE+KEFAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDMKLWPFKVIPGAGDKPMIVVSYKGEDKEFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KM+EIAEA+LG T+KNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLIKMREIAEAFLGLTIKNAVVTVPAYFNDSQRQ  160



>ref|XP_008802761.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Phoenix 
dactylifera]
Length=648

 Score =   315 bits (806),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 148/160 (93%), Positives = 154/160 (96%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNP NTVFDAKRLIGRRFSD+SVQSDIKLWPFKVI GPGDKPMI V YKGE+K+F+A
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVIAGPGDKPMIGVQYKGEDKQFSA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EE+SSMVL KMKEIAEAYLGST+KNAVVTVPAYFNDSQRQ
Sbjct  121  EEVSSMVLMKMKEIAEAYLGSTIKNAVVTVPAYFNDSQRQ  160



>emb|CAA47948.2| heat shock protein 70 [Oryza sativa Indica Group]
Length=648

 Score =   315 bits (806),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 150/160 (94%), Positives = 156/160 (98%), Gaps = 1/160 (1%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNPINTVF AKRLIGRRFSD+SVQSDIKLWPFKVI GPGDKPMIVV YKGEEK+FAA
Sbjct  61   QVAMNPINTVF-AKRLIGRRFSDASVQSDIKLWPFKVIAGPGDKPMIVVQYKGEEKQFAA  119

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KM+EIAEAYLG+T+KNAVVTVPAYFNDSQRQ
Sbjct  120  EEISSMVLIKMREIAEAYLGTTIKNAVVTVPAYFNDSQRQ  159



>ref|XP_010534306.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Tarenaya hassleriana]
Length=653

 Score =   315 bits (806),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 147/160 (92%), Positives = 156/160 (98%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNP NTVFDAKRLIGRR+SD SV++D+KLWPFKVI GPGDKPMIVVNYKGEEK+F+A
Sbjct  61   QVAMNPTNTVFDAKRLIGRRYSDPSVKADMKLWPFKVISGPGDKPMIVVNYKGEEKQFSA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVLTKM+EIAEAYLG++VKNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLTKMREIAEAYLGTSVKNAVVTVPAYFNDSQRQ  160



>ref|XP_002528432.1| heat shock protein, putative [Ricinus communis]
 gb|EEF33915.1| heat shock protein, putative [Ricinus communis]
Length=649

 Score =   315 bits (806),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 147/160 (92%), Positives = 155/160 (97%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKG+GPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGDGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNP+NTVFDAKRLIGRR+SD+SVQSDIKLWPFKVI GPGDKPMIVV YKGEEK+F+A
Sbjct  61   QVAMNPVNTVFDAKRLIGRRYSDASVQSDIKLWPFKVIAGPGDKPMIVVAYKGEEKQFSA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KM+EIAEAYLG T+KNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLIKMREIAEAYLGLTIKNAVVTVPAYFNDSQRQ  160



>gb|AIU34470.1| putative heat shock protein, partial [Taraxacum brevicorniculatum]
Length=646

 Score =   314 bits (805),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 148/160 (93%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNP NTVFDAKRLIGRRFSD+SVQSDIKLWPFKV PGP +KPMI VNYKGEEK FAA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVTPGPAEKPMIAVNYKGEEKTFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KMKEIAEA+LG+TVKNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLIKMKEIAEAFLGNTVKNAVVTVPAYFNDSQRQ  160



>ref|NP_001119156.1| heat shock cognate protein 70-1 [Arabidopsis thaliana]
 gb|AED90481.1| heat shock cognate protein 70-1 [Arabidopsis thaliana]
Length=521

 Score =   311 bits (796),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 145/160 (91%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNP+NTVFDAKRLIGRRFSDSSVQSD+KLWPFK+  GP DKPMI V YKGEEKEFAA
Sbjct  61   QVAMNPVNTVFDAKRLIGRRFSDSSVQSDMKLWPFKIQAGPADKPMIYVEYKGEEKEFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KM+EIAEAYLG T+KNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLIKMREIAEAYLGVTIKNAVVTVPAYFNDSQRQ  160



>dbj|BAP90755.1| heat shock protein 70 [Chrysanthemum x morifolium]
Length=647

 Score =   314 bits (805),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 149/160 (93%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDPERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNP NTVFDAKRLIGRRFSD+SVQSDIKLWPFKV PGP +KPMI VNYKGEEK FAA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVTPGPAEKPMIAVNYKGEEKTFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KMKEIAEA+LGSTVKNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLIKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQ  160



>gb|AAC84134.1| heat shock protein [Cichorium intybus]
Length=153

 Score =   298 bits (763),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 142/153 (93%), Positives = 146/153 (95%), Gaps = 0/153 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNP NTVFDAKRLIGRRFSD+SVQSDIKLWPFKV PGP +KPMI VNYKGEEK FAA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVTPGPAEKPMIAVNYKGEEKTFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAY  538
            EEISSMVL KMKEIAEA+LGSTVKNAVVTVPAY
Sbjct  121  EEISSMVLIKMKEIAEAFLGSTVKNAVVTVPAY  153



>ref|XP_008371627.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Malus domestica]
 gb|AAF34134.1| high molecular weight heat shock protein [Malus domestica]
Length=650

 Score =   314 bits (805),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 147/160 (92%), Positives = 154/160 (96%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNP+NTVFDAKRLIGRR+SD SVQ D+K WPFKVIPGPGDKPMIVV YKGEEK+FAA
Sbjct  61   QVAMNPVNTVFDAKRLIGRRYSDPSVQGDMKHWPFKVIPGPGDKPMIVVIYKGEEKQFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KM+EIAEAYLGS++KNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLVKMREIAEAYLGSSIKNAVVTVPAYFNDSQRQ  160



>ref|XP_011027182.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Populus 
euphratica]
Length=648

 Score =   314 bits (805),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 148/160 (93%), Positives = 154/160 (96%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNPINTVFDAKRLIGRRFSD+SVQSDIK W FKV+PG GDKPMI VNYKGEEK+FAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDIKHWSFKVVPGAGDKPMIQVNYKGEEKQFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KM+EIAEAYLG+T+KNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLIKMREIAEAYLGTTIKNAVVTVPAYFNDSQRQ  160



>ref|XP_008776699.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Phoenix dactylifera]
Length=648

 Score =   314 bits (805),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 146/160 (91%), Positives = 155/160 (97%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVA+NPINTVFDAKRLIGRRFSD+SVQ+D+KLWPFKV+ GPGDKP+I V YKGEEK+FAA
Sbjct  61   QVAINPINTVFDAKRLIGRRFSDASVQNDMKLWPFKVVAGPGDKPLIAVQYKGEEKQFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KM+EIAEAYLGSTVKNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQ  160



>ref|XP_004981251.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Setaria 
italica]
Length=648

 Score =   314 bits (805),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 146/157 (93%), Positives = 154/157 (98%), Gaps = 0/157 (0%)
 Frame = +2

Query  89   KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKNQVA  268
            KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTD+ERLIGDAAKNQVA
Sbjct  5    KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKNQVA  64

Query  269  MNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAAEEI  448
            MNPINTVFDAKRLIGRRFSD+SVQSDIK+WP+KVIPGPGDKPMIVV YKGEEK+F+AEEI
Sbjct  65   MNPINTVFDAKRLIGRRFSDASVQSDIKMWPYKVIPGPGDKPMIVVQYKGEEKQFSAEEI  124

Query  449  SSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            SSMVL KM+EIAEAYLG T+KNAVVTVPAYFNDSQRQ
Sbjct  125  SSMVLIKMREIAEAYLGLTIKNAVVTVPAYFNDSQRQ  161



>gb|AGZ15406.1| heat shock cognate 70 kDa protein [Phaseolus vulgaris]
Length=651

 Score =   314 bits (804),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 150/160 (94%), Positives = 154/160 (96%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNPINTVFDAKRLIGRRF+D+ VQSDIKLWPFKVI GP DKP IVVNYKGEEK+FAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFTDAPVQSDIKLWPFKVIAGPADKPTIVVNYKGEEKQFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KM+EIAEAYLGST KNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLMKMREIAEAYLGSTEKNAVVTVPAYFNDSQRQ  160



>ref|XP_009353695.1| PREDICTED: heat shock cognate 70 kDa protein 2-like isoform X1 
[Pyrus x bretschneideri]
Length=649

 Score =   314 bits (804),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 146/160 (91%), Positives = 156/160 (98%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MA KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN
Sbjct  1    MAAKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNP+NTVFDAKRLIGRRF+D+++QSD+KLWPFKVI G GDKP IVVNYKGE+K+FAA
Sbjct  61   QVAMNPVNTVFDAKRLIGRRFTDATIQSDMKLWPFKVIAGAGDKPTIVVNYKGEDKQFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVLTKM+EIAEAYLGSTVKN+VVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLTKMREIAEAYLGSTVKNSVVTVPAYFNDSQRQ  160



>ref|XP_002316294.1| heat shock protein 70 [Populus trichocarpa]
 gb|EEF02465.1| heat shock protein 70 [Populus trichocarpa]
Length=648

 Score =   314 bits (804),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 147/160 (92%), Positives = 154/160 (96%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNPINTVFDAKRLIGRRFSD SVQSDIKLWPFKV+ GPGDKPMIVV YKGEEK+F+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDPSVQSDIKLWPFKVVAGPGDKPMIVVTYKGEEKQFSA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KM+EIAEA+LG++V NAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLIKMREIAEAFLGTSVNNAVVTVPAYFNDSQRQ  160



>gb|EAY89457.1| hypothetical protein OsI_10990 [Oryza sativa Indica Group]
Length=415

 Score =   307 bits (786),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 144/161 (89%), Positives = 154/161 (96%), Gaps = 1/161 (1%)
 Frame = +2

Query  80   MAG-KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAK  256
            MAG KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAK
Sbjct  1    MAGNKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  60

Query  257  NQVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFA  436
            NQVAMNP NTVFDAKRLIGRRFSD SVQ+D+K+WPFKV+PGP DKPMIVV YKGEEK+F+
Sbjct  61   NQVAMNPTNTVFDAKRLIGRRFSDPSVQADMKMWPFKVVPGPADKPMIVVTYKGEEKKFS  120

Query  437  AEEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            AEEISSMVLTKMKEIAEA+L +T+KNAV+TVPAYFNDSQRQ
Sbjct  121  AEEISSMVLTKMKEIAEAFLSTTIKNAVITVPAYFNDSQRQ  161



>ref|XP_006436017.1| hypothetical protein CICLE_v10033622mg [Citrus clementina]
 ref|XP_006486087.1| PREDICTED: heat shock cognate 70 kDa protein-like [Citrus sinensis]
 gb|ESR49257.1| hypothetical protein CICLE_v10033622mg [Citrus clementina]
Length=653

 Score =   314 bits (804),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 149/160 (93%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNP+NTVFDAKRLIGRRFSDSSVQ DIK WPFKVIPG GDKP IVV YKGEEK+F+A
Sbjct  61   QVAMNPLNTVFDAKRLIGRRFSDSSVQGDIKHWPFKVIPGAGDKPTIVVVYKGEEKQFSA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVLTKM+EIAEAYLGS VKNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLTKMREIAEAYLGSNVKNAVVTVPAYFNDSQRQ  160



>ref|XP_002441219.1| hypothetical protein SORBIDRAFT_09g022580 [Sorghum bicolor]
 gb|EES19649.1| hypothetical protein SORBIDRAFT_09g022580 [Sorghum bicolor]
Length=649

 Score =   314 bits (804),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 147/158 (93%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = +2

Query  86   GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKNQV  265
             KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKNQV
Sbjct  2    AKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV  61

Query  266  AMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAAEE  445
            AMNP NTVFDAKRLIGRRFSD SVQSD+KLWPFKV+ GP DKPMIVVNYKGEEK+F+AEE
Sbjct  62   AMNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVVAGPADKPMIVVNYKGEEKQFSAEE  121

Query  446  ISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            ISSMVLTKMKEIAEAYLGST+KNAVVTVPAYFNDSQRQ
Sbjct  122  ISSMVLTKMKEIAEAYLGSTIKNAVVTVPAYFNDSQRQ  159



>ref|XP_002312090.1| heat shock protein 70 cognate [Populus trichocarpa]
 gb|EEE89457.1| heat shock protein 70 cognate [Populus trichocarpa]
Length=648

 Score =   314 bits (804),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 147/160 (92%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNPINTVFDAKRLIGRRFSD+SVQ DIK WPFKV PG GDKPMI VNYKGEEK+F+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQGDIKHWPFKVTPGAGDKPMISVNYKGEEKQFSA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KM+EIAEAYLG+T+KNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLIKMREIAEAYLGTTIKNAVVTVPAYFNDSQRQ  160



>gb|EMT06830.1| Heat shock cognate 70 kDa protein [Aegilops tauschii]
Length=647

 Score =   313 bits (803),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 148/160 (93%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MA  GEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN
Sbjct  1    MAKGGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNP NTVFDAKRLIGRRFSD SVQSD+KLWPFKVIPGP DKPMIVV YKGEEK+FAA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPADKPMIVVQYKGEEKQFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KMKEI EAYLG+T+KNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLIKMKEIGEAYLGTTIKNAVVTVPAYFNDSQRQ  160



>ref|XP_004961848.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c-like [Setaria italica]
Length=649

 Score =   313 bits (803),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 147/158 (93%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = +2

Query  86   GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKNQV  265
             KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKNQV
Sbjct  2    AKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV  61

Query  266  AMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAAEE  445
            AMNP NTVFDAKRLIGRRFSD SVQSD+KLWPFKV+ GP DKPMIVVNYKGEEK+F+AEE
Sbjct  62   AMNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVVAGPADKPMIVVNYKGEEKQFSAEE  121

Query  446  ISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            ISSMVLTKMKEIAEAYLGST+KNAVVTVPAYFNDSQRQ
Sbjct  122  ISSMVLTKMKEIAEAYLGSTIKNAVVTVPAYFNDSQRQ  159



>gb|ADZ46371.1| HSP70 [Malus hupehensis]
Length=650

 Score =   313 bits (803),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 146/160 (91%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNP+NTVFDAKRLIGRR+SD SVQ D+K WPFK IPGPGDKPMIVV YKGEEK+FAA
Sbjct  61   QVAMNPVNTVFDAKRLIGRRYSDPSVQGDMKHWPFKAIPGPGDKPMIVVMYKGEEKQFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KM+EIAEAYLGS++KNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLVKMREIAEAYLGSSIKNAVVTVPAYFNDSQRQ  160



>ref|NP_176036.1| heat shock protein ERD2 [Arabidopsis thaliana]
 sp|Q9C7X7.1|HSP7N_ARATH RecName: Full=Heat shock 70 kDa protein 18; AltName: Full=Heat 
shock protein 70-18; Short=AtHsp70-18; AltName: Full=Heat-shock 
protein 70T-1 [Arabidopsis thaliana]
 gb|AAG51503.1|AC058785_6 heat shock protein, putative [Arabidopsis thaliana]
 gb|ABE65717.1| heat shock cognate 70 kDa protein/HSC70/HSP70 [Arabidopsis thaliana]
 gb|AEE33389.1| heat shock protein ERD2 [Arabidopsis thaliana]
Length=617

 Score =   312 bits (800),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 145/160 (91%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNP+NTVFDAKRLIGRRFSD+SVQSD+K WPFKV PG  DKPMI VNYKGEEK+FAA
Sbjct  61   QVAMNPVNTVFDAKRLIGRRFSDASVQSDMKFWPFKVTPGQADKPMIFVNYKGEEKQFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KM+EIAEAYLGS++KNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLIKMREIAEAYLGSSIKNAVVTVPAYFNDSQRQ  160



>gb|ACD93209.1| heat shock protein 70 [Camellia sinensis]
Length=677

 Score =   314 bits (804),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 149/160 (93%), Positives = 154/160 (96%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            M+GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MSGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNP NTVFDAKRLIGRRF+D+SVQSD+KLWPFKVI GPGDKPMI VNYKGEEK FAA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFTDASVQSDMKLWPFKVIAGPGDKPMIGVNYKGEEKLFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KM+EIAEAYLGSTVKNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQ  160



>gb|KJB73858.1| hypothetical protein B456_011G256600 [Gossypium raimondii]
Length=652

 Score =   313 bits (802),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 146/160 (91%), Positives = 156/160 (98%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MA KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAAKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNPINTVFDAKRLIGRRF+DSSVQSDIKLWP+KVI G GDKPMI+V+YKGE+K+F+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFTDSSVQSDIKLWPYKVIAGSGDKPMIIVSYKGEDKQFSA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVLTKM+EIAEAYLGST+KNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLTKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQ  160



>ref|NP_001044757.1| Os01g0840100 [Oryza sativa Japonica Group]
 dbj|BAB67894.1| putative HSP70 [Oryza sativa Japonica Group]
 dbj|BAB93214.1| putative HSP70 [Oryza sativa Japonica Group]
 dbj|BAF06671.1| Os01g0840100 [Oryza sativa Japonica Group]
 gb|EAZ14100.1| hypothetical protein OsJ_04024 [Oryza sativa Japonica Group]
 dbj|BAH01518.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|ADM86881.1| 70kDa heat shock protein [Oryza sativa Japonica Group]
 gb|ADR66969.1| 70 kDa heat shock protein [Oryza sativa Japonica Group]
Length=648

 Score =   313 bits (802),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 146/158 (92%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = +2

Query  86   GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKNQV  265
             KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKNQV
Sbjct  2    AKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQV  61

Query  266  AMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAAEE  445
            AMNPINTVFDAKRLIGRRFSD SVQSD+KLWPFKVIPGPGDKPMIVV YKGEEK+F+AEE
Sbjct  62   AMNPINTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPGDKPMIVVQYKGEEKQFSAEE  121

Query  446  ISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            ISSMVL KM+EIAEAYLGS +KNAVVTVPAYFNDSQRQ
Sbjct  122  ISSMVLIKMREIAEAYLGSNIKNAVVTVPAYFNDSQRQ  159



>ref|XP_001783048.1| predicted protein [Physcomitrella patens]
 gb|EDQ52117.1| predicted protein [Physcomitrella patens]
Length=650

 Score =   313 bits (802),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 148/160 (93%), Positives = 151/160 (94%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNP NTVFDAKRLIGRRFSD+SVQSD+KLWPFKV PG  DKPMI V YKGEEK FAA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDASVQSDMKLWPFKVTPGAADKPMISVQYKGEEKTFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KMKEIAEAYLGST+KNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLIKMKEIAEAYLGSTIKNAVVTVPAYFNDSQRQ  160



>ref|NP_001055754.1| Os05g0460000 [Oryza sativa Japonica Group]
 gb|AAT39165.1| putative hsp70 [Oryza sativa Japonica Group]
 dbj|BAF17668.1| Os05g0460000 [Oryza sativa Japonica Group]
 dbj|BAH01403.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE63984.1| hypothetical protein OsJ_18811 [Oryza sativa Japonica Group]
Length=646

 Score =   313 bits (802),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 146/157 (93%), Positives = 152/157 (97%), Gaps = 0/157 (0%)
 Frame = +2

Query  89   KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKNQVA  268
            KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKNQVA
Sbjct  3    KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA  62

Query  269  MNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAAEEI  448
            MNP NTVFDAKRLIGRRFSD SVQSD+KLWPFKV+PGPGDKPMIVV YKGEEK+FAAEEI
Sbjct  63   MNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVVPGPGDKPMIVVQYKGEEKQFAAEEI  122

Query  449  SSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            SSMVL KM+EIAEAYLGS++KNAVVTVPAYFNDSQRQ
Sbjct  123  SSMVLIKMREIAEAYLGSSIKNAVVTVPAYFNDSQRQ  159



>ref|XP_003621869.1| Heat shock protein [Medicago truncatula]
 gb|AES78087.1| heat shock cognate 70 kDa protein [Medicago truncatula]
Length=648

 Score =   313 bits (802),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 147/160 (92%), Positives = 155/160 (97%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNP+NTVFDAKRLIGRR SD+SVQSD+KLWPFKVI GPG+KPMI VNYKGE+K+FAA
Sbjct  61   QVAMNPVNTVFDAKRLIGRRISDASVQSDMKLWPFKVIAGPGEKPMIGVNYKGEDKQFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KM+EIAEAYLGSTVKNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQ  160



>gb|EMS51135.1| Heat shock cognate 70 kDa protein [Triticum urartu]
Length=610

 Score =   312 bits (799),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 149/161 (93%), Positives = 153/161 (95%), Gaps = 1/161 (1%)
 Frame = +2

Query  80   MAGKG-EGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAK  256
            MA KG EGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAK
Sbjct  1    MAKKGGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAK  60

Query  257  NQVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFA  436
            NQVAMNP NTVFDAKRLIGRRFSD SVQSD+KLWPFKVIPGP DKPMIVV YKGEEK+FA
Sbjct  61   NQVAMNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPADKPMIVVQYKGEEKQFA  120

Query  437  AEEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            AEEISSMVL KMKEI EAYLG+T+KNAVVTVPAYFNDSQRQ
Sbjct  121  AEEISSMVLIKMKEIGEAYLGTTIKNAVVTVPAYFNDSQRQ  161



>ref|XP_011027172.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c isoform X1 [Populus euphratica]
 ref|XP_011027173.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c isoform X2 [Populus euphratica]
Length=648

 Score =   313 bits (801),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 147/160 (92%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNPINTVFDAKRLIGRRFSD SVQ+DIKLWPFKV+ GPGDKPMIVV YKGEEK+FAA
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDPSVQNDIKLWPFKVVAGPGDKPMIVVTYKGEEKQFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KM+EIAEA+LG+ V NAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLIKMREIAEAFLGTAVNNAVVTVPAYFNDSQRQ  160



>ref|XP_006378715.1| hypothetical protein POPTR_0010s21280g [Populus trichocarpa]
 gb|ERP56512.1| hypothetical protein POPTR_0010s21280g [Populus trichocarpa]
Length=649

 Score =   313 bits (801),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 146/160 (91%), Positives = 154/160 (96%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNPINTVFDAKRLIGRRF+D+SVQSDIKLWPFKVI GPGDKPMI V YKGEEK+F+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFTDASVQSDIKLWPFKVISGPGDKPMIGVTYKGEEKQFSA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KM+EIAEAYLG+ +KNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLIKMREIAEAYLGTAIKNAVVTVPAYFNDSQRQ  160



>ref|XP_003558228.1| PREDICTED: heat shock cognate 70 kDa protein 2-like [Brachypodium 
distachyon]
Length=651

 Score =   313 bits (801),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 146/160 (91%), Positives = 154/160 (96%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKG+GPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGDGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNPINTVFDAKRLIGRRFSD+SVQSD KLWPFKVIPGPGDKPMI V Y+GE+K+F+A
Sbjct  61   QVAMNPINTVFDAKRLIGRRFSDASVQSDAKLWPFKVIPGPGDKPMIGVQYRGEDKQFSA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KMKE AEAYLG+T+KNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLNKMKETAEAYLGTTIKNAVVTVPAYFNDSQRQ  160



>ref|XP_010106444.1| Heat shock cognate 70 kDa protein [Morus notabilis]
 gb|EXC10620.1| Heat shock cognate 70 kDa protein [Morus notabilis]
Length=652

 Score =   313 bits (801),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 147/160 (92%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKG+GPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKN
Sbjct  1    MAGKGDGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNP NTVFDAKRLIGRRFSD SVQ+D+KLWPFKVI GPGDKPMIVVN+KGEEK+FAA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDPSVQNDMKLWPFKVIAGPGDKPMIVVNHKGEEKQFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KMKEIAEAYLG  +KNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLIKMKEIAEAYLGIAIKNAVVTVPAYFNDSQRQ  160



>gb|AAV97978.1| heat shock protein hsp70 [Saussurea medusa]
Length=647

 Score =   313 bits (801),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 148/160 (93%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = +2

Query  80   MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN  259
            MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTD+ERLIGDAAKN
Sbjct  1    MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  260  QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAA  439
            QVAMNP NTVFDAKRLIGRRFSD+SVQSDIKLWPFKV PGP +KPMI V YKGEEK FAA
Sbjct  61   QVAMNPTNTVFDAKRLIGRRFSDASVQSDIKLWPFKVTPGPAEKPMIAVMYKGEEKTFAA  120

Query  440  EEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            EEISSMVL KMKEIAEA+LGSTVKNAVVTVPAYFNDSQRQ
Sbjct  121  EEISSMVLIKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQ  160



>ref|XP_008656365.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37c [Zea mays]
 gb|AFW82225.1| hypothetical protein ZEAMMB73_366749 [Zea mays]
Length=649

 Score =   313 bits (801),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 146/158 (92%), Positives = 153/158 (97%), Gaps = 0/158 (0%)
 Frame = +2

Query  86   GKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKNQV  265
             KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYV FTDTERLIGDAAKNQV
Sbjct  2    AKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV  61

Query  266  AMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKEFAAEE  445
            AMNP NTVFDAKRLIGRRFSD SVQSD+KLWPFKV+ GPGDKPMIVV+YKGE+K+F+AEE
Sbjct  62   AMNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVVAGPGDKPMIVVSYKGEDKQFSAEE  121

Query  446  ISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQ  559
            ISSMVLTKMKEIAEAYLGST+KNAVVTVPAYFNDSQRQ
Sbjct  122  ISSMVLTKMKEIAEAYLGSTIKNAVVTVPAYFNDSQRQ  159



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 631248065840