BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001O08

Length=558
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009613493.1|  PREDICTED: probable aquaporin TIP1-1               250   4e-80   Nicotiana tomentosiformis
dbj|BAF95576.1|  tonoplast intrinsic protein                            248   5e-79   Nicotiana tabacum [American tobacco]
ref|XP_009800738.1|  PREDICTED: probable aquaporin TIP1-1               246   2e-78   Nicotiana sylvestris
gb|AAG44946.1|AF290619_1  putative gamma TIP                            243   3e-77   Nicotiana glauca [glaucous tobacco]
gb|ACY74345.1|  aquaporin-like protein                                  241   2e-76   Capsicum annuum
ref|XP_009592994.1|  PREDICTED: probable aquaporin TIP1-1               241   3e-76   Nicotiana tomentosiformis
ref|NP_001234103.1|  aquaporin-like                                     239   1e-75   Solanum lycopersicum
ref|XP_006347203.1|  PREDICTED: aquaporin TIP1-1-like                   239   1e-75   Solanum tuberosum [potatoes]
ref|NP_001048956.2|  Os03g0146100                                       235   8e-75   
gb|AAL49753.1|AF452015_1  aquaporin-like protein                        235   3e-74   Petunia x hybrida [garden petunia]
sp|P50156.1|TIP11_ORYSJ  RecName: Full=Probable aquaporin TIP1-1;...    234   5e-74   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006649396.1|  PREDICTED: probable aquaporin TIP1-1-like          233   2e-73   Oryza brachyantha
ref|XP_002465859.1|  hypothetical protein SORBIDRAFT_01g047140          233   4e-73   Sorghum bicolor [broomcorn]
gb|EMS45815.1|  putative aquaporin TIP1-1                               231   5e-73   Triticum urartu
ref|NP_001104896.1|  aquaporin TIP1-1                                   230   3e-72   Zea mays [maize]
gb|AAD10494.1|  gamma-type tonoplast intrinsic protein                  229   5e-72   Triticum aestivum [Canadian hard winter wheat]
gb|EMT13047.1|  Putative aquaporin TIP1-1                               228   7e-72   
gb|ABB29477.1|  tonoplast intrinsic protein                             229   7e-72   Panax ginseng [Asiatic ginseng]
ref|XP_004985722.1|  PREDICTED: aquaporin TIP1-1-like                   229   1e-71   Setaria italica
dbj|BAP33938.1|  aquaporin                                              228   1e-71   Triticum aestivum [Canadian hard winter wheat]
ref|NP_001241727.1|  aquaporin TIP1.1                                   228   3e-71   
ref|XP_003558815.1|  PREDICTED: aquaporin TIP1-1                        226   9e-71   Brachypodium distachyon [annual false brome]
emb|CAA56553.1|  gamma-TIP-like protein                                 226   1e-70   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ACV52008.1|  tonoplast aquaporin 1;1                                 224   7e-70   Daucus carota [carrots]
ref|XP_008801219.1|  PREDICTED: probable aquaporin TIP1-1               224   1e-69   Phoenix dactylifera
ref|XP_009411359.1|  PREDICTED: probable aquaporin TIP1-1               223   2e-69   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009382161.1|  PREDICTED: probable aquaporin TIP1-1               221   8e-69   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010933183.1|  PREDICTED: probable aquaporin TIP1-1               219   4e-68   Elaeis guineensis
ref|XP_006837956.1|  hypothetical protein AMTR_s00102p00061000          219   5e-68   Amborella trichopoda
ref|XP_002519456.1|  tonoplast intrinsic protein, putative              219   7e-68   
ref|XP_010911210.1|  PREDICTED: probable aquaporin TIP1-1               218   1e-67   Elaeis guineensis
ref|XP_010253312.1|  PREDICTED: aquaporin TIP1-3-like                   218   2e-67   Nelumbo nucifera [Indian lotus]
gb|AGD98716.1|  aquaporin protein 13                                    218   2e-67   Camellia sinensis [black tea]
ref|XP_009397029.1|  PREDICTED: probable aquaporin TIP1-1               218   2e-67   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010243206.1|  PREDICTED: aquaporin TIP1-1-like                   218   3e-67   Nelumbo nucifera [Indian lotus]
ref|XP_010267262.1|  PREDICTED: aquaporin TIP1-1                        218   3e-67   Nelumbo nucifera [Indian lotus]
gb|ACX37451.1|  tonoplast intrinsic protein                             217   5e-67   Hevea brasiliensis [jebe]
gb|ADO17795.1|  tonoplast intrinsic protein                             216   7e-67   Jatropha curcas
gb|KDP29188.1|  hypothetical protein JCGZ_16577                         216   1e-66   Jatropha curcas
gb|ADB93067.1|  aquaporin                                               216   1e-66   Jatropha curcas
ref|XP_009401846.1|  PREDICTED: probable aquaporin TIP1-1               216   2e-66   Musa acuminata subsp. malaccensis [pisang utan]
tpg|DAA33867.1|  TPA: aquaporin TIP1;4                                  215   2e-66   Gossypium hirsutum [American cotton]
ref|XP_010920700.1|  PREDICTED: probable aquaporin TIP1-2               215   2e-66   
emb|CAE53881.1|  aquaporin                                              215   2e-66   Ricinus communis
ref|XP_008794805.1|  PREDICTED: LOW QUALITY PROTEIN: probable aqu...    215   3e-66   Phoenix dactylifera
gb|KJB46503.1|  hypothetical protein B456_007G372700                    215   3e-66   Gossypium raimondii
gb|AAT08702.1|  mitochondrial tonoplast intrinsic protein               213   5e-66   Hyacinthus orientalis [common hyacinth]
emb|CAN69323.1|  hypothetical protein VITISV_032929                     214   5e-66   Vitis vinifera
ref|XP_010037134.1|  PREDICTED: aquaporin TIP1-1                        214   7e-66   Eucalyptus grandis [rose gum]
ref|XP_010096653.1|  Aquaporin TIP1-3                                   214   7e-66   Morus notabilis
ref|XP_007218847.1|  hypothetical protein PRUPE_ppa010364mg             214   9e-66   Prunus persica
ref|XP_009404620.1|  PREDICTED: aquaporin TIP1-1-like                   213   1e-65   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008788358.1|  PREDICTED: probable aquaporin TIP1-1               218   1e-65   
ref|XP_007009482.1|  Tonoplast intrinsic protein 1,3                    213   2e-65   Theobroma cacao [chocolate]
ref|XP_011088796.1|  PREDICTED: aquaporin TIP1-1-like                   213   2e-65   Sesamum indicum [beniseed]
gb|AAN40746.1|  tonoplast intrinsic protein                             213   2e-65   Kandelia candel
gb|EYU18933.1|  hypothetical protein MIMGU_mgv1a012390mg                213   2e-65   Erythranthe guttata [common monkey flower]
ref|XP_007027468.1|  Aquaporin TIP1,6                                   212   3e-65   Theobroma cacao [chocolate]
ref|XP_008233574.1|  PREDICTED: aquaporin TIP1-3                        212   4e-65   Prunus mume [ume]
gb|ACJ53709.1|  tonoplast intrinsic protein 1-2                         211   8e-65   Lolium perenne [perennial ryegrass]
dbj|BAD90702.1|  tonoplast intrinsic protein 1;1                        211   8e-65   Mimosa pudica [sensitive-plant]
gb|KDP29873.1|  hypothetical protein JCGZ_18448                         211   1e-64   Jatropha curcas
gb|AGG39699.1|  aquaporin protein AQU21                                 211   1e-64   Camellia sinensis [black tea]
ref|XP_011089965.1|  PREDICTED: aquaporin TIP1-1-like                   211   1e-64   Sesamum indicum [beniseed]
ref|XP_008343557.1|  PREDICTED: aquaporin TIP1-3                        211   1e-64   
gb|AGD98711.1|  aquaporin protein 8                                     211   1e-64   Camellia sinensis [black tea]
gb|ACP28878.1|  tonoplast intrinsic protein                             210   2e-64   Gossypium hirsutum [American cotton]
ref|XP_011089824.1|  PREDICTED: aquaporin TIP1-3-like                   210   2e-64   Sesamum indicum [beniseed]
gb|AHA50083.1|  tonoplast intrinsic protein                             210   2e-64   Eleutherococcus senticosus
emb|CBI31728.3|  unnamed protein product                                210   2e-64   Vitis vinifera
gb|AFU51578.1|  aquaporin                                               210   2e-64   Gladiolus hybrid cultivar
ref|XP_002322910.1|  gamma-tonoplast intrinsic protein 2                210   2e-64   Populus trichocarpa [western balsam poplar]
gb|AIK66517.1|  putative aquaporin                                      210   2e-64   Vitis vinifera
emb|CDX10339.1|  aquaporin                                              210   2e-64   Coffea arabica [arabica coffee]
ref|XP_011004488.1|  PREDICTED: aquaporin TIP1-1-like                   210   2e-64   Populus euphratica
emb|CDP08994.1|  unnamed protein product                                210   3e-64   Coffea canephora [robusta coffee]
ref|XP_002316308.1|  Gamma-tonoplast intrinsic protein 3                210   3e-64   Populus trichocarpa [western balsam poplar]
gb|AAF78757.1|AF271660_1  putative aquaporin TIP3                       210   3e-64   Vitis cinerea var. helleri x Vitis rupestris
ref|XP_009421351.1|  PREDICTED: probable aquaporin TIP1-2               210   3e-64   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009780564.1|  PREDICTED: aquaporin TIP1-3                        210   3e-64   Nicotiana sylvestris
ref|XP_009624595.1|  PREDICTED: aquaporin TIP1-3                        210   3e-64   Nicotiana tomentosiformis
ref|NP_001267923.1|  aquaporin-like                                     209   4e-64   Vitis vinifera
ref|XP_004304478.1|  PREDICTED: aquaporin TIP1-1-like                   209   4e-64   Fragaria vesca subsp. vesca
ref|XP_011077300.1|  PREDICTED: aquaporin TIP1-1                        209   5e-64   Sesamum indicum [beniseed]
ref|XP_002531118.1|  tonoplast intrinsic protein, putative              209   5e-64   Ricinus communis
gb|ACI95283.1|  tonoplast intrinsic protein                             209   5e-64   Sinapis arvensis [charlock mustard]
ref|XP_011027129.1|  PREDICTED: aquaporin TIP1-3-like                   209   5e-64   Populus euphratica
gb|AAN05780.1|  tonoplast intrinsic protein bobTIP26-2                  209   6e-64   Brassica oleracea var. botrytis [cauliflower]
gb|AGD98709.1|  aquaporin protein 6                                     209   6e-64   Camellia sinensis [black tea]
gb|KHG11211.1|  Aquaporin TIP1-3 -like protein                          209   7e-64   Gossypium arboreum [tree cotton]
emb|CAN74049.1|  hypothetical protein VITISV_007330                     209   7e-64   Vitis vinifera
tpg|DAA33870.1|  TPA: aquaporin TIP1;8                                  209   7e-64   Gossypium hirsutum [American cotton]
gb|ADD59910.1|  aquaporin                                               209   7e-64   Chimonanthus praecox [wintersweet]
ref|XP_009141610.1|  PREDICTED: aquaporin TIP1-1                        208   1e-63   Brassica rapa
gb|AFH36344.1|  aquaporin TIP2;2                                        208   1e-63   Quercus petraea [durmast oak]
ref|XP_004497305.1|  PREDICTED: aquaporin TIP1-3-like                   208   1e-63   Cicer arietinum [garbanzo]
ref|XP_009337569.1|  PREDICTED: aquaporin TIP1-3                        208   1e-63   Pyrus x bretschneideri [bai li]
ref|XP_006436063.1|  hypothetical protein CICLE_v10032534mg             208   1e-63   Citrus clementina [clementine]
ref|XP_010031004.1|  PREDICTED: aquaporin TIP1-3-like                   208   1e-63   Eucalyptus grandis [rose gum]
ref|XP_010043596.1|  PREDICTED: aquaporin TIP1-3-like                   208   2e-63   Eucalyptus grandis [rose gum]
gb|ACB71282.1|  tonoplast intrinsic protein                             208   2e-63   Tamarix hispida
gb|AFQ23566.1|  aquaporin TIP1                                          208   2e-63   Hedychium coronarium
gb|KDP44188.1|  hypothetical protein JCGZ_05655                         208   2e-63   Jatropha curcas
gb|AAB51393.2|  tonoplast intrinsic protein bobTIP26-1                  208   2e-63   Brassica oleracea var. botrytis [cauliflower]
ref|XP_010098813.1|  Aquaporin TIP1-1                                   207   2e-63   Morus notabilis
dbj|BAM44345.1|  vacuolar aluminum transporter                          207   2e-63   Hydrangea macrophylla
ref|XP_011018806.1|  PREDICTED: aquaporin TIP1-1                        207   3e-63   Populus euphratica
emb|CDY53270.1|  BnaCnng24720D                                          207   3e-63   Brassica napus [oilseed rape]
gb|ADU25490.1|  tonoplastic intrinsic protein                           207   3e-63   Helianthemum almeriense
emb|CAB61841.1|  putative gamma tonoplast intrinsic protein (TIP)       207   3e-63   Sporobolus stapfianus [resurrection grass]
ref|XP_006428460.1|  hypothetical protein CICLE_v10012553mg             207   3e-63   Citrus clementina [clementine]
ref|NP_001267926.1|  aquaporin-like                                     207   3e-63   Vitis vinifera
emb|CDP07030.1|  unnamed protein product                                207   4e-63   Coffea canephora [robusta coffee]
ref|NP_001238026.1|  nodulin-26                                         207   4e-63   
gb|KDP43963.1|  hypothetical protein JCGZ_05430                         207   4e-63   Jatropha curcas
gb|KHN30200.1|  Aquaporin TIP1-3                                        207   4e-63   Glycine soja [wild soybean]
ref|XP_006381378.1|  gamma-tonoplast intrinsic protein 2                207   5e-63   Populus trichocarpa [western balsam poplar]
gb|ABR68795.1|  aquaporin gamma-TIP                                     206   6e-63   Gossypium hirsutum [American cotton]
gb|ABK96489.1|  unknown                                                 206   6e-63   Populus trichocarpa x Populus deltoides
tpg|DAA33869.1|  TPA: aquaporin TIP1;6                                  207   6e-63   Gossypium hirsutum [American cotton]
ref|XP_006410854.1|  hypothetical protein EUTSA_v10017134mg             206   8e-63   Eutrema salsugineum [saltwater cress]
ref|XP_009799741.1|  PREDICTED: aquaporin TIP1-1                        206   8e-63   Nicotiana sylvestris
ref|XP_002284411.1|  PREDICTED: aquaporin TIP1-1                        206   8e-63   Vitis vinifera
gb|KEH21895.1|  tonoplast intrinsic protein                             206   9e-63   Medicago truncatula
ref|XP_010505228.1|  PREDICTED: aquaporin TIP1-1                        206   9e-63   Camelina sativa [gold-of-pleasure]
ref|XP_004249473.1|  PREDICTED: aquaporin TIP1-1                        206   9e-63   Solanum lycopersicum
ref|XP_009617954.1|  PREDICTED: aquaporin TIP1-1                        206   9e-63   
ref|NP_181221.1|  aquaporin TIP1-1                                      206   1e-62   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006294859.1|  hypothetical protein CARUB_v10023912mg             206   1e-62   Capsella rubella
gb|AAM65100.1|  putative aquaporin (tonoplast intrinsic protein g...    206   1e-62   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002299893.1|  nodulin-26 family protein                          206   1e-62   Populus trichocarpa [western balsam poplar]
ref|NP_001284655.1|  aquaporin TIP1-1                                   206   1e-62   Cucumis melo [Oriental melon]
ref|XP_010556519.1|  PREDICTED: aquaporin TIP1-1                        206   1e-62   Tarenaya hassleriana [spider flower]
tpg|DAA33868.1|  TPA: aquaporin TIP1;5                                  205   1e-62   Gossypium hirsutum [American cotton]
ref|XP_002314201.1|  nodulin-26 family protein                          205   2e-62   Populus trichocarpa [western balsam poplar]
ref|XP_011000304.1|  PREDICTED: probable aquaporin TIP1-2               205   2e-62   Populus euphratica
dbj|BAD90703.1|  tonoplast intrinsic protein 1;2                        205   2e-62   Mimosa pudica [sensitive-plant]
ref|XP_002879627.1|  tonoplast intrinsic protein gamma                  205   2e-62   
gb|ABB76813.1|  tonoplast intrinsic protein                             205   2e-62   Olea europaea
gb|KJB16755.1|  hypothetical protein B456_002G245900                    205   2e-62   Gossypium raimondii
dbj|BAB12722.1|  gamma tonoplast intrinsic protein                      205   2e-62   Pyrus communis
gb|AJA04408.1|  tonoplast intrinsic protein                             205   2e-62   Chorispora bungeana
ref|XP_009349744.1|  PREDICTED: aquaporin TIP1-1-like                   205   2e-62   Pyrus x bretschneideri [bai li]
gb|KJB83802.1|  hypothetical protein B456_013G265400                    205   2e-62   Gossypium raimondii
ref|XP_002531978.1|  tonoplast intrinsic protein, putative              205   2e-62   Ricinus communis
gb|KFK36559.1|  hypothetical protein AALP_AA4G139100                    205   2e-62   Arabis alpina [alpine rockcress]
ref|XP_006339093.1|  PREDICTED: aquaporin TIP1-1-like                   205   2e-62   Solanum tuberosum [potatoes]
gb|KJB16756.1|  hypothetical protein B456_002G245900                    205   2e-62   Gossypium raimondii
gb|AJK93570.1|  tonoplast intrinsic protein                             205   2e-62   Suaeda glauca
ref|XP_003565186.1|  PREDICTED: probable aquaporin TIP1-2               204   3e-62   Brachypodium distachyon [annual false brome]
gb|KJB73799.1|  hypothetical protein B456_011G253100                    204   3e-62   Gossypium raimondii
ref|XP_011041956.1|  PREDICTED: probable aquaporin TIP1-2               204   3e-62   Populus euphratica
gb|KHG06645.1|  putative aquaporin TIP1-2                               204   3e-62   Gossypium arboreum [tree cotton]
emb|CAA64952.1|  tonoplast intrinsic protein                            205   4e-62   Tulipa gesneriana
emb|CAA38633.1|  possible membrane channel protein                      204   4e-62   Arabidopsis thaliana [mouse-ear cress]
gb|KHG14163.1|  Aquaporin TIP1-3 -like protein                          204   4e-62   Gossypium arboreum [tree cotton]
ref|XP_010033163.1|  PREDICTED: aquaporin TIP1-3-like                   204   4e-62   Eucalyptus grandis [rose gum]
gb|KHG16987.1|  Aquaporin TIP1-3 -like protein                          204   5e-62   Gossypium arboreum [tree cotton]
ref|XP_007016527.1|  Tonoplast intrinsic protein 1,3                    204   6e-62   
ref|XP_008795635.1|  PREDICTED: probable aquaporin TIP1-1               204   8e-62   Phoenix dactylifera
gb|ABP35520.1|  tonoplast intrinsic protein                             203   9e-62   Ipomoea batatas [batate]
ref|XP_008463495.1|  PREDICTED: aquaporin TIP1-3-like isoform X3        202   1e-61   Cucumis melo [Oriental melon]
ref|XP_008463494.1|  PREDICTED: aquaporin TIP1-3-like isoform X2        202   1e-61   Cucumis melo [Oriental melon]
gb|AAD31847.1|AF133531_1  water channel protein MipI                    203   1e-61   Mesembryanthemum crystallinum
gb|ADE34283.1|  aquaporin TIP1;7                                        203   1e-61   Gossypium hirsutum [American cotton]
ref|XP_008350342.1|  PREDICTED: aquaporin TIP1-1-like                   203   2e-61   
ref|XP_008387528.1|  PREDICTED: LOW QUALITY PROTEIN: aquaporin TI...    202   2e-61   
ref|XP_007142715.1|  hypothetical protein PHAVU_007G010800g             202   2e-61   Phaseolus vulgaris [French bean]
ref|XP_004143284.1|  PREDICTED: aquaporin TIP1-1-like                   202   2e-61   Cucumis sativus [cucumbers]
ref|NP_001274695.1|  aquaporin TIP1-3-like                              202   2e-61   Solanum lycopersicum
ref|XP_010502579.1|  PREDICTED: aquaporin TIP1-2                        202   2e-61   Camelina sativa [gold-of-pleasure]
ref|XP_006350747.1|  PREDICTED: aquaporin TIP1-3-like                   202   2e-61   Solanum tuberosum [potatoes]
ref|XP_011089424.1|  PREDICTED: aquaporin TIP1-3-like                   202   2e-61   Sesamum indicum [beniseed]
gb|AAT65835.2|  tonoplast intrinsic protein gamma                       202   3e-61   Salicornia herbacea
ref|XP_006395549.1|  hypothetical protein EUTSA_v10004806mg             202   3e-61   Eutrema salsugineum [saltwater cress]
ref|XP_010696310.1|  PREDICTED: probable aquaporin TIP1-2               202   3e-61   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009152050.1|  PREDICTED: aquaporin TIP1-2                        202   3e-61   Brassica rapa
gb|AFQ98316.1|  MIP6                                                    202   3e-61   Eutrema halophilum
ref|XP_004307558.1|  PREDICTED: aquaporin TIP1-3                        202   4e-61   Fragaria vesca subsp. vesca
dbj|BAA12711.1|  VM23                                                   202   4e-61   Raphanus sativus
gb|AEF59492.1|  aquaporin-like protein                                  202   5e-61   Gardenia jasminoides
ref|XP_009129499.1|  PREDICTED: aquaporin TIP1-2                        201   5e-61   Brassica rapa
ref|XP_010425366.1|  PREDICTED: aquaporin TIP1-2-like                   201   6e-61   Camelina sativa [gold-of-pleasure]
gb|KEH44484.1|  tonoplast intrinsic protein                             201   6e-61   Medicago truncatula
ref|XP_008463493.1|  PREDICTED: aquaporin TIP1-3-like isoform X1        201   8e-61   Cucumis melo [Oriental melon]
gb|AFS50011.1|  hypothetical protein                                    201   1e-60   Dendrobium officinale
gb|AEQ29861.1|  aquaporin TIP1                                          201   1e-60   Malus prunifolia
ref|XP_004168293.1|  PREDICTED: LOW QUALITY PROTEIN: aquaporin TI...    200   1e-60   
gb|EPS67611.1|  aquaporin-like protein                                  201   1e-60   Genlisea aurea
ref|XP_002311146.1|  Gamma-tonoplast intrinsic protein 3                200   1e-60   Populus trichocarpa [western balsam poplar]
ref|XP_003518658.1|  PREDICTED: aquaporin TIP1-3-like                   200   2e-60   Glycine max [soybeans]
gb|KHN21988.1|  Aquaporin TIP1-3                                        200   2e-60   Glycine soja [wild soybean]
emb|CAC85291.1|  putative tonoplast intrinsic protein                   199   3e-60   Posidonia oceanica
ref|XP_002274538.1|  PREDICTED: aquaporin TIP1-1                        199   3e-60   Vitis vinifera
ref|XP_010514297.1|  PREDICTED: aquaporin TIP1-2-like                   199   3e-60   Camelina sativa [gold-of-pleasure]
ref|NP_001242707.1|  uncharacterized protein LOC100777419               199   3e-60   
ref|XP_003552678.1|  PREDICTED: aquaporin TIP1-3-like                   199   3e-60   Glycine max [soybeans]
ref|XP_006424746.1|  hypothetical protein CICLE_v10029134mg             199   4e-60   Citrus clementina [clementine]
ref|XP_010922400.1|  PREDICTED: aquaporin TIP1-3-like                   199   4e-60   Elaeis guineensis
gb|AHW81522.1|  ECFP-tagged gamma TIP                                   206   5e-60   Cloning vector pBullet-vac-c
gb|KHN13870.1|  Aquaporin TIP1-3                                        199   6e-60   Glycine soja [wild soybean]
ref|XP_008788076.1|  PREDICTED: aquaporin TIP1-3-like                   199   6e-60   Phoenix dactylifera
emb|CDX83623.1|  BnaC07g23630D                                          199   6e-60   
ref|XP_006488253.1|  PREDICTED: aquaporin TIP1-3-like                   199   7e-60   Citrus sinensis [apfelsine]
ref|NP_192056.1|  aquaporin TIP1-3                                      199   7e-60   Arabidopsis thaliana [mouse-ear cress]
gb|ABK25915.1|  unknown                                                 199   7e-60   Picea sitchensis
ref|XP_002876978.1|  hypothetical protein ARALYDRAFT_484417             199   7e-60   
ref|XP_011022886.1|  PREDICTED: aquaporin TIP1-3                        198   8e-60   Populus euphratica
gb|ABK28617.1|  unknown                                                 198   9e-60   Arabidopsis thaliana [mouse-ear cress]
gb|AAC62397.1|  gamma tonoplast intrinsic protein 2                     198   9e-60   Arabidopsis thaliana [mouse-ear cress]
gb|ACI95284.1|  tonoplast intrinsic protein                             198   1e-59   Tulipa gesneriana
gb|ABK23010.1|  unknown                                                 198   1e-59   Picea sitchensis
ref|XP_007205767.1|  hypothetical protein PRUPE_ppa010367mg             197   1e-59   Prunus persica
ref|XP_006291577.1|  hypothetical protein CARUB_v10017730mg             199   1e-59   
gb|AAD39372.1|AF118381_1  tonoplast intrinsic protein                   197   2e-59   Brassica napus [oilseed rape]
ref|XP_007139266.1|  hypothetical protein PHAVU_008G014900g             197   2e-59   Phaseolus vulgaris [French bean]
ref|NP_189283.1|  aquaporin TIP1-2                                      197   2e-59   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003536771.1|  PREDICTED: aquaporin TIP1-3-like                   197   2e-59   Glycine max [soybeans]
ref|XP_004971442.1|  PREDICTED: probable aquaporin TIP1-2-like          197   2e-59   Setaria italica
ref|XP_004492091.1|  PREDICTED: aquaporin TIP1-3-like                   197   2e-59   Cicer arietinum [garbanzo]
dbj|BAL41683.1|  tonoplast intrinsic protein                            197   2e-59   Tulipa gesneriana
ref|XP_010669827.1|  PREDICTED: aquaporin TIP1-3-like                   197   2e-59   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006645407.1|  PREDICTED: probable aquaporin TIP1-2-like          197   3e-59   Oryza brachyantha
gb|KFK30698.1|  hypothetical protein AALP_AA6G016000                    197   3e-59   Arabis alpina [alpine rockcress]
gb|EAZ15017.1|  hypothetical protein OsJ_04959                          197   3e-59   Oryza sativa Japonica Group [Japonica rice]
gb|KHN32099.1|  Aquaporin TIP1-1                                        197   3e-59   Glycine soja [wild soybean]
ref|XP_010685836.1|  PREDICTED: aquaporin TIP1-3-like                   197   3e-59   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_001045562.1|  Os01g0975900                                       197   3e-59   
gb|KFK33580.1|  hypothetical protein AALP_AA5G032300                    197   4e-59   Arabis alpina [alpine rockcress]
ref|XP_004294610.1|  PREDICTED: probable aquaporin TIP1-2               197   4e-59   Fragaria vesca subsp. vesca
dbj|BAI66439.1|  tonoplast intrinsic protein                            197   4e-59   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ98454.1|  predicted protein                                      196   4e-59   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007202475.1|  hypothetical protein PRUPE_ppa010365mg             196   5e-59   Prunus persica
ref|XP_010428353.1|  PREDICTED: aquaporin TIP1-3                        196   6e-59   Camelina sativa [gold-of-pleasure]
ref|XP_010422715.1|  PREDICTED: aquaporin TIP1-3-like                   196   6e-59   Camelina sativa [gold-of-pleasure]
ref|XP_008222876.1|  PREDICTED: probable aquaporin TIP1-2               196   7e-59   Prunus mume [ume]
ref|XP_002872891.1|  GAMMA-TIP3/TIP1_3                                  196   8e-59   Arabidopsis lyrata subsp. lyrata
ref|XP_002523724.1|  tonoplast intrinsic protein, putative              196   9e-59   Ricinus communis
ref|XP_010554597.1|  PREDICTED: aquaporin TIP1-3                        196   9e-59   Tarenaya hassleriana [spider flower]
ref|XP_006286822.1|  hypothetical protein CARUB_v10003767mg             196   1e-58   Capsella rubella
dbj|BAL41684.1|  tonoplast intrinsic protein                            195   1e-58   Tulipa gesneriana
ref|XP_008241379.1|  PREDICTED: aquaporin TIP1-1                        195   1e-58   Prunus mume [ume]
ref|XP_008357781.1|  PREDICTED: aquaporin TIP1-3-like                   195   2e-58   Malus domestica [apple tree]
dbj|BAD04010.1|  tonoplast intrinsic protein                            194   3e-58   Prunus persica
ref|XP_009799587.1|  PREDICTED: probable aquaporin TIP1-1               191   3e-58   Nicotiana sylvestris
gb|AGV54720.1|  water-selective transport intrinsic membrane prot...    193   3e-58   Phaseolus vulgaris [French bean]
gb|AGV54343.1|  tonoplast intrinsic protein                             194   3e-58   Phaseolus vulgaris [French bean]
ref|XP_009358317.1|  PREDICTED: aquaporin TIP1-3-like                   194   4e-58   Pyrus x bretschneideri [bai li]
ref|XP_006396348.1|  hypothetical protein EUTSA_v10028907mg             194   5e-58   Eutrema salsugineum [saltwater cress]
gb|ADE76384.1|  unknown                                                 194   5e-58   Picea sitchensis
gb|ABI96817.1|  tonoplast intrinsic protein                             194   6e-58   Triticum aestivum [Canadian hard winter wheat]
dbj|BAP33939.1|  tonoplast intrinsic protein                            193   8e-58   Triticum aestivum [Canadian hard winter wheat]
gb|AEW46426.1|  putative tonoplast intrinsic protein 1.2                192   9e-58   Populus deltoides x Populus x canadensis
gb|EMT32480.1|  Putative aquaporin TIP1-2                               193   1e-57   
ref|XP_007162793.1|  hypothetical protein PHAVU_001G181100g             192   2e-57   Phaseolus vulgaris [French bean]
gb|AHA84270.1|  nodulin-26                                              192   2e-57   Phaseolus vulgaris [French bean]
emb|CDP00041.1|  unnamed protein product                                192   2e-57   Coffea canephora [robusta coffee]
gb|ACJ53708.1|  tonoplast intrinsic protein 1-1                         192   3e-57   Lolium perenne [perennial ryegrass]
ref|XP_004307108.1|  PREDICTED: probable aquaporin TIP1-2               192   3e-57   Fragaria vesca subsp. vesca
gb|AEV54105.1|  putative tonoplast intrinsic protein 1.5                191   3e-57   Populus deltoides x Populus x canadensis
ref|NP_001237062.1|  uncharacterized protein LOC100527509               192   3e-57   
ref|XP_004494087.1|  PREDICTED: probable aquaporin TIP-type-like        191   4e-57   Cicer arietinum [garbanzo]
ref|NP_001105029.1|  aquaporin TIP1-2                                   191   5e-57   Zea mays [maize]
ref|XP_004149825.1|  PREDICTED: aquaporin TIP1-3-like                   191   6e-57   Cucumis sativus [cucumbers]
gb|AHI54565.1|  tonoplastic intrinsic protein                           191   7e-57   Camellia japonica [common camellia]
gb|ABX79969.1|  aquaporin                                               186   9e-57   Triticum aestivum [Canadian hard winter wheat]
gb|EPS60922.1|  hypothetical protein M569_13880                         190   1e-56   Genlisea aurea
ref|XP_009338345.1|  PREDICTED: aquaporin TIP1-3-like                   190   1e-56   Pyrus x bretschneideri [bai li]
gb|AHJ09607.1|  aquaporin protein 26                                    190   2e-56   Camellia sinensis [black tea]
gb|AFK41698.1|  unknown                                                 190   2e-56   Medicago truncatula
sp|Q9FY14.1|TIP1_MEDTR  RecName: Full=Probable aquaporin TIP-type...    190   2e-56   Medicago truncatula
ref|XP_009111380.1|  PREDICTED: aquaporin TIP1-3                        190   2e-56   Brassica rapa
gb|ACF78734.1|  unknown                                                 190   2e-56   Zea mays [maize]
gb|AAF82790.1|AF275315_1  water-selective transport intrinsic mem...    189   2e-56   Lotus japonicus
gb|AEV54104.1|  putative tonoplast intrinsic protein 1.6                188   2e-56   Populus deltoides x Populus x canadensis
gb|AAB17284.1|  tonoplast intrinsic protein                             189   2e-56   Mesembryanthemum crystallinum
ref|XP_010112915.1|  Aquaporin TIP1-3                                   189   3e-56   Morus notabilis
gb|ACG35910.1|  aquaporin TIP1.2                                        189   3e-56   Zea mays [maize]
gb|ABX79970.1|  aquaporin                                               185   4e-56   Triticum aestivum [Canadian hard winter wheat]
ref|XP_008366336.1|  PREDICTED: probable aquaporin TIP1-2               188   6e-56   
gb|AEW46425.1|  putative tonoplast intrinsic protein 1.1                187   1e-55   
gb|ACJ83265.1|  unknown                                                 186   2e-55   
ref|XP_004505892.1|  PREDICTED: aquaporin TIP1-3-like                   187   2e-55   
ref|XP_002459183.1|  hypothetical protein SORBIDRAFT_03g047470          187   3e-55   
gb|AFK34456.1|  unknown                                                 186   5e-55   
gb|ACU16456.1|  unknown                                                 185   1e-54   
ref|XP_003606614.1|  Aquaporin TIP1-1                                   185   1e-54   
ref|XP_010456993.1|  PREDICTED: aquaporin TIP1-3-like                   185   1e-54   
gb|AAB62692.1|  salt-stress induced tonoplast intrinsic protein         186   1e-54   
emb|CAB45653.1|  putative tonoplast intrinsic protein                   184   2e-54   
sp|P42067.2|TIP1_MEDSA  RecName: Full=Probable aquaporin TIP-type...    182   2e-53   
emb|CCI55669.1|  EaTIP1,1                                               182   2e-53   
ref|XP_002314305.2|  nodulin-26 family protein                          182   2e-53   
gb|ABK22410.1|  unknown                                                 181   7e-53   
ref|XP_011010727.1|  PREDICTED: aquaporin TIP1-1-like                   180   1e-52   
ref|XP_003555811.1|  PREDICTED: aquaporin TIP1-3-like isoform X1        179   4e-52   
ref|XP_007150288.1|  hypothetical protein PHAVU_005G141100g             178   4e-52   
gb|ABK22242.1|  unknown                                                 178   6e-52   
ref|XP_006384960.1|  nodulin-26 family protein                          178   6e-52   
emb|CAB39758.1|  major intrinsic protein                                177   1e-51   
emb|CAA06335.1|  aquaporin-like protein                                 177   1e-51   
ref|XP_006605823.1|  PREDICTED: aquaporin TIP1-3-like isoform X2        177   2e-51   
ref|XP_011028266.1|  PREDICTED: aquaporin TIP1-1-like                   177   2e-51   
gb|AEV54107.1|  putative tonoplast intrinsic protein 1.7                176   3e-51   
ref|XP_004137844.1|  PREDICTED: aquaporin TIP1-1-like                   176   5e-51   
ref|XP_010527951.1|  PREDICTED: LOW QUALITY PROTEIN: aquaporin TI...    176   5e-51   
ref|XP_008442728.1|  PREDICTED: aquaporin TIP1-1-like                   176   5e-51   
gb|AEV54106.1|  putative tonoplast intrinsic protein 1.8                174   1e-50   
emb|CAA82843.1|  gamma-TIP-like protein                                 174   2e-50   
ref|NP_001236728.1|  nodulin-26                                         174   3e-50   
gb|ADF32096.1|  aquaporin                                               174   3e-50   
ref|XP_007132109.1|  hypothetical protein PHAVU_011G067200g             173   6e-50   
emb|CDY67380.1|  BnaAnng24130D                                          171   2e-49   
gb|ADE34286.1|  aquaporin TIP1;11                                       162   2e-46   
gb|ADE34284.1|  aquaporin TIP1;9                                        159   2e-45   
gb|EPS62187.1|  nodulin-26                                              160   3e-45   
gb|ADE34285.1|  aquaporin TIP1;10                                       157   1e-44   
gb|ADE34287.1|  aquaporin TIP1;12                                       157   1e-44   
gb|ADE34288.1|  aquaporin TIP1;13                                       156   2e-44   
gb|AAF78758.1|AF271661_1  putative aquaporin TIP1                       156   1e-43   
ref|NP_001267958.1|  aquaporin TIP2;1                                   156   1e-43   
gb|ABH09331.1|  putative aquaporin                                      156   2e-43   
gb|AEW46427.1|  putative tonoplast intrinsic protein 1.3                151   5e-43   
emb|CAB95746.2|  putative aquaporin                                     155   7e-43   
ref|XP_007099759.1|  Beta-tonoplast intrinsic protein                   155   7e-43   
gb|AAD31848.1|AF133532_1  water channel protein MipK                    154   9e-43   
ref|XP_008222886.1|  PREDICTED: aquaporin TIP1-1-like                   149   3e-42   
gb|AFK47280.1|  unknown                                                 152   5e-42   
gb|KJB73800.1|  hypothetical protein B456_011G253100                    150   1e-41   
emb|CAA65185.1|  aquaporin                                              151   2e-41   
ref|XP_008797218.1|  PREDICTED: aquaporin TIP3-1-like                   151   2e-41   
ref|NP_001104907.1|  aquaporin TIP2-3                                   150   2e-41   
gb|ACG44020.1|  aquaporin TIP2.1                                        150   3e-41   
gb|AAO86710.1|  tonoplast water channel                                 150   3e-41   
emb|CAB55837.1|  delta tonoplast intrinsic protein                      150   3e-41   
ref|XP_003542571.1|  PREDICTED: aquaporin TIP1-1-like                   150   3e-41   
gb|KHN33410.1|  Aquaporin TIP1-3                                        147   4e-41   
ref|XP_010254028.1|  PREDICTED: aquaporin TIP2-1                        150   4e-41   
ref|XP_009146158.1|  PREDICTED: aquaporin TIP2-1                        151   4e-41   
dbj|BAH56913.1|  AT3G16240                                              148   4e-41   
emb|CDX82410.1|  BnaA03g34110D                                          150   5e-41   
ref|XP_006369013.1|  aquaporin TIP2.3 family protein                    150   6e-41   
ref|XP_004169489.1|  PREDICTED: aquaporin TIP1-3-like                   146   6e-41   
ref|XP_009135480.1|  PREDICTED: aquaporin TIP2-1-like                   149   7e-41   
gb|KJB83801.1|  hypothetical protein B456_013G265400                    148   9e-41   
ref|XP_002298233.1|  delta-tonoplast intrinsic family protein           149   1e-40   
gb|ADE34289.1|  aquaporin TIP2;3                                        149   1e-40   
gb|AEW46428.1|  putative tonoplast intrinsic protein 1.4                145   1e-40   
gb|AAC49992.1|  delta tonoplast integral protein                        147   1e-40   
ref|XP_011004925.1|  PREDICTED: aquaporin TIP2-1                        149   1e-40   
gb|KJB30272.1|  hypothetical protein B456_005G135200                    149   1e-40   
gb|AAB04557.1|  delta-tonoplast intrinsic protein                       149   1e-40   
gb|KHG26174.1|  Aquaporin TIP2-1 -like protein                          149   1e-40   
ref|XP_004516306.1|  PREDICTED: aquaporin TIP2-1-like                   149   1e-40   
ref|XP_007210530.1|  hypothetical protein PRUPE_ppa010285mg             149   2e-40   
ref|XP_011014558.1|  PREDICTED: aquaporin TIP2-1-like                   148   2e-40   
emb|CDY20190.1|  BnaA01g28120D                                          148   2e-40   
emb|CDY63821.1|  BnaC01g44580D                                          148   2e-40   
gb|KDP39884.1|  hypothetical protein JCGZ_03415                         148   2e-40   
gb|ABK94373.1|  unknown                                                 148   2e-40   
emb|CDY30146.1|  BnaC05g37160D                                          148   2e-40   
emb|CDX97733.1|  BnaA05g23460D                                          148   2e-40   
ref|XP_006848638.1|  hypothetical protein AMTR_s00171p00047680          148   3e-40   
ref|XP_006406857.1|  hypothetical protein EUTSA_v10021303mg             149   3e-40   
ref|XP_002515999.1|  tonoplast intrinsic protein, putative              148   3e-40   
emb|CDX75873.1|  BnaC03g39560D                                          149   3e-40   
ref|XP_008342659.1|  PREDICTED: aquaporin TIP2-1                        147   3e-40   
ref|XP_009377878.1|  PREDICTED: aquaporin TIP2-1                        147   3e-40   
ref|XP_003626979.1|  Aquaporin TIP2-1                                   147   4e-40   
gb|AFK48554.1|  unknown                                                 147   4e-40   
ref|XP_003597702.1|  Aquaporin                                          147   5e-40   
ref|XP_006298401.1|  hypothetical protein CARUB_v10014472mg             147   5e-40   
gb|AFK49181.1|  unknown                                                 147   6e-40   
gb|KHG24233.1|  putative aquaporin TIP3-2 -like protein                 147   6e-40   
ref|XP_007215863.1|  hypothetical protein PRUPE_ppa010472mg             147   6e-40   
ref|XP_008228469.1|  PREDICTED: aquaporin TIP2-1                        147   7e-40   
ref|XP_009786545.1|  PREDICTED: aquaporin TIP2-1-like                   147   9e-40   
ref|XP_008240429.1|  PREDICTED: probable aquaporin TIP3-2               147   1e-39   
ref|XP_009614306.1|  PREDICTED: aquaporin TIP2-1-like                   146   1e-39   
ref|XP_009353577.1|  PREDICTED: aquaporin TIP2-1                        146   1e-39   
gb|AAL38357.1|  delta tonoplast intrinsic protein                       146   1e-39   
dbj|BAA31452.1|  delta-VM23                                             146   1e-39   
ref|XP_009389231.1|  PREDICTED: aquaporin TIP3-1-like                   146   1e-39   
ref|XP_010504014.1|  PREDICTED: aquaporin TIP2-1-like                   146   1e-39   
ref|NP_188245.1|  aquaporin TIP2-1                                      146   1e-39   
ref|XP_010691368.1|  PREDICTED: aquaporin TIP2-1                        146   1e-39   
ref|XP_011001477.1|  PREDICTED: probable aquaporin TIP-type             146   1e-39   
ref|XP_010933649.1|  PREDICTED: probable aquaporin TIP2-1               146   1e-39   
ref|XP_004302879.1|  PREDICTED: aquaporin TIP2-1                        146   1e-39   
ref|XP_008380900.1|  PREDICTED: aquaporin TIP2-1-like                   146   2e-39   
ref|XP_009761134.1|  PREDICTED: probable aquaporin TIP-type RB7-18C     146   2e-39   
emb|CBI37360.3|  unnamed protein product                                145   2e-39   
ref|XP_010465638.1|  PREDICTED: aquaporin TIP2-1                        145   2e-39   
ref|XP_006304972.1|  hypothetical protein CARUB_v10011466mg             145   2e-39   
ref|XP_006833430.1|  hypothetical protein AMTR_s00109p00145780          145   2e-39   
gb|AAG44945.1|AF290618_1  putative delta TIP                            145   2e-39   
emb|CDP09981.1|  unnamed protein product                                145   2e-39   
ref|XP_002303300.1|  delta-tonoplast intrinsic family protein           145   2e-39   
gb|KJB20908.1|  hypothetical protein B456_003G171800                    145   2e-39   
ref|XP_010322694.1|  PREDICTED: LOW QUALITY PROTEIN: aquaporin TI...    145   2e-39   
gb|KDP37268.1|  hypothetical protein JCGZ_06324                         145   3e-39   
ref|XP_009397951.1|  PREDICTED: aquaporin TIP3-1-like                   145   3e-39   
ref|XP_010487476.1|  PREDICTED: aquaporin TIP2-1-like                   145   3e-39   
ref|XP_006356145.1|  PREDICTED: aquaporin TIP2-1-like                   145   3e-39   
ref|XP_007024239.1|  Delta tonoplast integral protein                   145   3e-39   
ref|XP_008796116.1|  PREDICTED: aquaporin TIP2-3                        145   3e-39   
ref|XP_004976439.1|  PREDICTED: aquaporin TIP2-3-like                   145   3e-39   
dbj|BAP33940.1|  tonoplast intrinsic protein                            145   3e-39   
gb|ACJ86062.1|  unknown                                                 145   4e-39   
ref|XP_009114826.1|  PREDICTED: LOW QUALITY PROTEIN: aquaporin TI...    145   4e-39   
ref|XP_010104889.1|  Aquaporin TIP2-3                                   145   4e-39   
ref|XP_009604878.1|  PREDICTED: probable aquaporin TIP-type RB7-18C     145   4e-39   
ref|XP_010062508.1|  PREDICTED: aquaporin TIP2-1                        145   5e-39   
ref|XP_010521513.1|  PREDICTED: aquaporin TIP2-1-like                   144   5e-39   
gb|AFK36325.1|  unknown                                                 144   5e-39   
gb|ACN30999.1|  unknown                                                 143   5e-39   
ref|XP_009382435.1|  PREDICTED: probable aquaporin TIP2-1               144   5e-39   
gb|AAB67881.1|  membrane channel protein                                144   6e-39   
ref|XP_006426918.1|  hypothetical protein CICLE_v10026351mg             144   6e-39   
ref|XP_002277904.2|  PREDICTED: probable aquaporin TIP-type             144   7e-39   
ref|XP_006465649.1|  PREDICTED: aquaporin TIP2-1-like                   144   7e-39   
tpg|DAA33871.1|  TPA: aquaporin TIP2;2                                  144   7e-39   
emb|CAA65184.1|  aquaporin                                              144   8e-39   
gb|AIK66518.1|  putative aquaporin                                      144   8e-39   
ref|NP_001242116.1|  uncharacterized protein LOC100803901               144   8e-39   
ref|XP_003570028.1|  PREDICTED: probable aquaporin TIP2-1               144   8e-39   
ref|NP_001274703.1|  TIP protein                                        144   9e-39   
emb|CAC39085.2|  putative aquaporin                                     143   9e-39   
gb|ABA56492.1|  putative tonoplast intrinsic protein                    144   9e-39   
gb|AAB53329.1|  Rb7                                                     144   1e-38   
ref|XP_010248450.1|  PREDICTED: aquaporin TIP3-1-like                   144   1e-38   
ref|XP_007039804.1|  Tonoplast intrinsic protein 2,3                    144   1e-38   
ref|XP_010545684.1|  PREDICTED: aquaporin TIP2-1                        144   1e-38   
gb|KHG09483.1|  putative aquaporin TIP-type                             144   1e-38   
ref|XP_010258877.1|  PREDICTED: probable aquaporin TIP-type RB7-5A      144   1e-38   
ref|XP_010098111.1|  Aquaporin TIP2-1                                   144   1e-38   
ref|XP_010500811.1|  PREDICTED: aquaporin TIP2-1-like                   144   1e-38   
emb|CAA65187.1|  aquaporin                                              143   1e-38   
emb|CDY59296.1|  BnaA06g40020D                                          144   1e-38   
gb|AFH36343.1|  aquaporin TIP2;1                                        143   1e-38   
ref|XP_006584589.1|  PREDICTED: uncharacterized protein LOC100803...    143   1e-38   
ref|XP_010479718.1|  PREDICTED: aquaporin TIP2-1-like                   144   2e-38   
ref|XP_008669054.1|  PREDICTED: aquaporin TIP2-3-like                   143   2e-38   
ref|XP_002882988.1|  delta tonoplast intrinsic protein                  143   2e-38   
dbj|BAO18637.1|  tonoplast intrinsic protein 2;5                        143   2e-38   
ref|XP_009617337.1|  PREDICTED: aquaporin TIP2-1                        143   2e-38   
ref|XP_006582836.1|  PREDICTED: uncharacterized protein LOC100306...    143   2e-38   
ref|XP_010462056.1|  PREDICTED: aquaporin TIP2-1-like                   143   2e-38   
ref|XP_006441499.1|  hypothetical protein CICLE_v10021799mg             143   2e-38   
ref|XP_008437066.1|  PREDICTED: probable aquaporin TIP2-2               143   2e-38   
gb|KFK38977.1|  hypothetical protein AALP_AA3G184100                    143   2e-38   
ref|NP_001237401.1|  uncharacterized protein LOC100306092               143   2e-38   
ref|XP_006478158.1|  PREDICTED: probable aquaporin TIP3-2-like          143   2e-38   
ref|XP_011031897.1|  PREDICTED: probable aquaporin TIP2-2               143   2e-38   
ref|XP_011072095.1|  PREDICTED: probable aquaporin TIP3-2               143   2e-38   
ref|XP_009611581.1|  PREDICTED: aquaporin TIP2-1-like                   143   3e-38   
gb|EYU24713.1|  hypothetical protein MIMGU_mgv1a012474mg                143   3e-38   
gb|AGQ46837.1|  aquaporin-like protein                                  142   3e-38   
ref|XP_009419322.1|  PREDICTED: probable aquaporin TIP2-2               142   3e-38   
gb|AAB41809.1|  membrane channel protein                                139   3e-38   
dbj|BAG15863.1|  aquaporin                                              142   3e-38   
gb|AGD98715.1|  aquaporin protein 12                                    142   4e-38   
gb|AEQ29859.1|  aquaporin TIP2                                          138   4e-38   
ref|XP_010687268.1|  PREDICTED: aquaporin TIP3-1-like                   142   4e-38   
ref|NP_001289845.1|  aquaporin TIP2-1                                   142   4e-38   
gb|AAC39480.1|  aquaporin                                               142   4e-38   
gb|KJB25557.1|  hypothetical protein B456_004G197600                    142   4e-38   
ref|NP_001105030.1|  aquaporin TIP2-1                                   142   5e-38   
ref|NP_001047632.1|  Os02g0658100                                       142   5e-38   
gb|ABK21457.1|  unknown                                                 142   5e-38   
ref|XP_003517415.1|  PREDICTED: probable aquaporin TIP-type RB7-5A      142   5e-38   
gb|ACZ06860.1|  tonoplast intrinsic protein                             142   5e-38   
emb|CDO98003.1|  unnamed protein product                                142   5e-38   
gb|ABK26146.1|  unknown                                                 142   5e-38   
ref|XP_009772297.1|  PREDICTED: probable aquaporin TIP3-2               142   6e-38   
gb|ABK22530.1|  unknown                                                 142   6e-38   
gb|ACG38813.1|  aquaporin TIP2.1                                        142   6e-38   
ref|XP_004299427.1|  PREDICTED: probable aquaporin TIP2-2               142   7e-38   
ref|XP_004486769.1|  PREDICTED: aquaporin TIP2-1-like isoform X2        142   7e-38   
ref|XP_008375083.1|  PREDICTED: probable aquaporin TIP3-2               142   7e-38   
gb|ABD64981.1|  tonoplast intrinsic protein, putative                   141   8e-38   
gb|AFK35772.1|  unknown                                                 141   9e-38   
ref|NP_001238338.1|  uncharacterized protein LOC100527333               141   9e-38   
gb|ABI96816.1|  tonoplast intrinsic protein                             141   9e-38   
emb|CDX77768.1|  BnaC07g20220D                                          141   9e-38   
gb|ACU16412.1|  unknown                                                 142   1e-37   
gb|KDP46476.1|  hypothetical protein JCGZ_08448                         141   1e-37   
ref|XP_010918027.1|  PREDICTED: aquaporin TIP3-1-like                   141   1e-37   
ref|XP_008800430.1|  PREDICTED: aquaporin TIP3-1-like                   141   1e-37   
gb|KFK35805.1|  hypothetical protein AALP_AA4G039000                    141   1e-37   
ref|XP_009625471.1|  PREDICTED: probable aquaporin TIP3-2               141   1e-37   
ref|XP_002303357.2|  aquaporin TIP2.3 family protein                    141   1e-37   
gb|EYU21481.1|  hypothetical protein MIMGU_mgv1a010922mg                142   1e-37   
ref|XP_002448289.1|  hypothetical protein SORBIDRAFT_06g024590          141   1e-37   
ref|XP_004299448.1|  PREDICTED: probable aquaporin TIP3-2               141   1e-37   
ref|XP_009355907.1|  PREDICTED: probable aquaporin TIP3-2               141   2e-37   
gb|KHG25791.1|  putative aquaporin TIP-type                             140   2e-37   
dbj|BAI66435.1|  tonoplast intrinsic protein                            140   2e-37   
ref|XP_010102791.1|  putative aquaporin TIP3-2                          141   2e-37   
dbj|BAD90704.1|  tonoplast intrinsic protein 2;1                        140   2e-37   



>ref|XP_009613493.1| PREDICTED: probable aquaporin TIP1-1 [Nicotiana tomentosiformis]
Length=251

 Score =   250 bits (639),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 143/164 (87%), Positives = 153/164 (93%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPIHQIA GSHEELRQPG LKAALAEFI TLIFVFAGQGSGMAF+KL+ DG +TPSGLI+
Sbjct  1    MPIHQIAVGSHEELRQPGTLKAALAEFICTLIFVFAGQGSGMAFNKLSVDGTATPSGLIS  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            A+IAHAF LFVAVSVGANISGGHVNPAVTFGAFVGGNIT FRG+LY+IAQLLGST ACFL
Sbjct  61   ASIAHAFGLFVAVSVGANISGGHVNPAVTFGAFVGGNITLFRGILYIIAQLLGSTVACFL  120

Query  428  LEFATGGMSTGAFGLS-GVSVWSALIFEIVMTFGLVYTVYATAV  556
            LEFATGGMSTGAF LS GVSVW+A +FEIVMTFGLVYTVYATA+
Sbjct  121  LEFATGGMSTGAFALSAGVSVWNAFVFEIVMTFGLVYTVYATAI  164



>dbj|BAF95576.1| tonoplast intrinsic protein [Nicotiana tabacum]
Length=251

 Score =   248 bits (632),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 142/164 (87%), Positives = 153/164 (93%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI+QIA GSHEELRQPG LKAALAEFI TLIFVFAGQGSGMAF+KL+ DG +TPSGLI+
Sbjct  1    MPINQIAVGSHEELRQPGTLKAALAEFICTLIFVFAGQGSGMAFNKLSVDGTATPSGLIS  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            A+IAHAF LFVAVSVGANISGGHVNPAVTFGAFVGGNIT FRG+LY+IAQLLGST ACFL
Sbjct  61   ASIAHAFGLFVAVSVGANISGGHVNPAVTFGAFVGGNITLFRGILYIIAQLLGSTVACFL  120

Query  428  LEFATGGMSTGAFGLS-GVSVWSALIFEIVMTFGLVYTVYATAV  556
            LEFATGGMSTGAF LS GVSVW+A +FEIVMTFGLVYTVYATA+
Sbjct  121  LEFATGGMSTGAFALSAGVSVWNAFVFEIVMTFGLVYTVYATAI  164



>ref|XP_009800738.1| PREDICTED: probable aquaporin TIP1-1 [Nicotiana sylvestris]
 emb|CAA69353.1| aquaporin 1 [Nicotiana tabacum]
Length=251

 Score =   246 bits (627),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 141/164 (86%), Positives = 152/164 (93%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPIHQIA GSHEELRQ G LKAALAEFI TLIFVFAGQGSGMAF+KL+ DG +TP+GLI+
Sbjct  1    MPIHQIAVGSHEELRQSGTLKAALAEFICTLIFVFAGQGSGMAFNKLSADGTATPAGLIS  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            A+IAHAF LFVAVSVGANISGGHVNPAVTFGAFVGGNIT FRG+LY++AQLLGST ACFL
Sbjct  61   ASIAHAFGLFVAVSVGANISGGHVNPAVTFGAFVGGNITLFRGILYIVAQLLGSTVACFL  120

Query  428  LEFATGGMSTGAFGLS-GVSVWSALIFEIVMTFGLVYTVYATAV  556
            LEFATGGMSTGAF LS GVSVW+A +FEIVMTFGLVYTVYATAV
Sbjct  121  LEFATGGMSTGAFALSAGVSVWNAFVFEIVMTFGLVYTVYATAV  164



>gb|AAG44946.1|AF290619_1 putative gamma TIP [Nicotiana glauca]
Length=251

 Score =   243 bits (620),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 140/164 (85%), Positives = 152/164 (93%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI+QIA GSHEELRQ G LKAALAEFI TLIFVFAGQGSGMAF+KL+ DG +TP+GLI+
Sbjct  1    MPINQIAVGSHEELRQSGTLKAALAEFICTLIFVFAGQGSGMAFNKLSADGVATPAGLIS  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            A+IAHAF LFVAVSVGANISGGHVNPAVTFGAFVGGNIT FRG+LY++AQLLGST ACFL
Sbjct  61   ASIAHAFGLFVAVSVGANISGGHVNPAVTFGAFVGGNITLFRGILYIVAQLLGSTVACFL  120

Query  428  LEFATGGMSTGAFGLS-GVSVWSALIFEIVMTFGLVYTVYATAV  556
            LEFATGGMSTGAF LS GVSVW+A +FEIVMTFGLVYTVYATAV
Sbjct  121  LEFATGGMSTGAFALSAGVSVWNAFVFEIVMTFGLVYTVYATAV  164



>gb|ACY74345.1| aquaporin-like protein [Capsicum annuum]
Length=250

 Score =   241 bits (615),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 139/163 (85%), Positives = 151/163 (93%), Gaps = 1/163 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI QIA GSHEELR PG LKAALAEFISTLIFVFAGQGSGMA++K+T DG +TP GLIA
Sbjct  1    MPIRQIAMGSHEELRHPGALKAALAEFISTLIFVFAGQGSGMAYNKIT-DGVTTPPGLIA  59

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            A+IAHA  LFVAV+VGANISGGHVNPAVTFGAFVGGNITFFRG+LY+IAQLLGSTAAC L
Sbjct  60   ASIAHALGLFVAVAVGANISGGHVNPAVTFGAFVGGNITFFRGLLYIIAQLLGSTAACAL  119

Query  428  LEFATGGMSTGAFGLSGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L FATGGMSTG+F +SGV+VWSAL+FEIVMTFGLVYTVYATAV
Sbjct  120  LVFATGGMSTGSFAVSGVTVWSALVFEIVMTFGLVYTVYATAV  162



>ref|XP_009592994.1| PREDICTED: probable aquaporin TIP1-1 [Nicotiana tomentosiformis]
Length=251

 Score =   241 bits (614),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 137/164 (84%), Positives = 152/164 (93%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPIHQI  G+HEELRQPG LKAALAEFISTLIFVFAGQGSGMAF+KLT+D  +TP+GLIA
Sbjct  1    MPIHQITIGTHEELRQPGALKAALAEFISTLIFVFAGQGSGMAFNKLTSDSTNTPAGLIA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            AA+AHAF LFVAVSV  NISGGHVNPAVTFGAF+GGNITFFRG+LY+IAQLLGST AC L
Sbjct  61   AAVAHAFGLFVAVSVSFNISGGHVNPAVTFGAFIGGNITFFRGILYIIAQLLGSTVACLL  120

Query  428  LEFATGGMSTGAFGL-SGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+FATGG+STGAF L SG+SVW+AL+FEIVMTFGLVYTVYATA+
Sbjct  121  LKFATGGLSTGAFALCSGLSVWNALVFEIVMTFGLVYTVYATAI  164



>ref|NP_001234103.1| aquaporin-like [Solanum lycopersicum]
 dbj|BAD95790.1| similar to aquaporin [Solanum lycopersicum]
 dbj|BAO18632.1| tonoplast intrinsic protein 1;1 [Solanum lycopersicum]
Length=250

 Score =   239 bits (610),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 141/164 (86%), Positives = 152/164 (93%), Gaps = 2/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI+QI  GSHEELR PG LKAALAEFISTLIFVFAGQGSGMAF+KLT DG +TP+GLI+
Sbjct  1    MPINQITIGSHEELRHPGALKAALAEFISTLIFVFAGQGSGMAFNKLT-DGVATPAGLIS  59

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            A+IAHAF LFVAVSVGANISGGHVNPAVTFGAFVGGNIT FRG+LY+IAQLLGSTAAC L
Sbjct  60   ASIAHAFGLFVAVSVGANISGGHVNPAVTFGAFVGGNITLFRGILYIIAQLLGSTAACAL  119

Query  428  LEFATGGMSTGAFGLS-GVSVWSALIFEIVMTFGLVYTVYATAV  556
            LEFATGGMSTG+F LS GVSVW+A +FEIVMTFGLVYTVYATAV
Sbjct  120  LEFATGGMSTGSFALSAGVSVWNAFVFEIVMTFGLVYTVYATAV  163



>ref|XP_006347203.1| PREDICTED: aquaporin TIP1-1-like [Solanum tuberosum]
Length=250

 Score =   239 bits (610),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 141/164 (86%), Positives = 152/164 (93%), Gaps = 2/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI+QI  GSHEELR PG LKAALAEFISTLIFVFAGQGSGMAF+KLT DG +TP+GLI+
Sbjct  1    MPINQITIGSHEELRHPGALKAALAEFISTLIFVFAGQGSGMAFNKLT-DGVATPAGLIS  59

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            A+IAHAF LFVAVSVGANISGGHVNPAVTFGAFVGGNIT FRG+LY+IAQLLGSTAAC L
Sbjct  60   ASIAHAFGLFVAVSVGANISGGHVNPAVTFGAFVGGNITLFRGILYIIAQLLGSTAACAL  119

Query  428  LEFATGGMSTGAFGLS-GVSVWSALIFEIVMTFGLVYTVYATAV  556
            LEFATGGMSTG+F LS GVSVW+A +FEIVMTFGLVYTVYATAV
Sbjct  120  LEFATGGMSTGSFALSAGVSVWNAFVFEIVMTFGLVYTVYATAV  163



>ref|NP_001048956.2| Os03g0146100 [Oryza sativa Japonica Group]
 dbj|BAF10870.2| Os03g0146100 [Oryza sativa Japonica Group]
Length=196

 Score =   235 bits (599),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 137/163 (84%), Positives = 148/163 (91%), Gaps = 0/163 (0%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI  IA GSH+E+  PG LKAALAEFISTLIFVFAGQGSGMAFSKLT  GA+TP+GLIA
Sbjct  1    MPIRNIAVGSHQEVYHPGALKAALAEFISTLIFVFAGQGSGMAFSKLTGGGATTPAGLIA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            AA+AHAFALFVAVSVGANISGGHVNPAVTFGAFVGGNIT FRG+LY IAQLLGST ACFL
Sbjct  61   AAVAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGNITLFRGLLYWIAQLLGSTVACFL  120

Query  428  LEFATGGMSTGAFGLSGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L F+TGG++TG FGL+GVSVW AL+ EIVMTFGLVYTVYATAV
Sbjct  121  LRFSTGGLATGTFGLTGVSVWEALVLEIVMTFGLVYTVYATAV  163



>gb|AAL49753.1|AF452015_1 aquaporin-like protein [Petunia x hybrida]
Length=250

 Score =   235 bits (600),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 136/164 (83%), Positives = 153/164 (93%), Gaps = 2/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI+QI+ GSHEELR  G LKAALAEFISTLIFVFAGQGSGMA++KLT DGA++P+GLI+
Sbjct  1    MPINQISLGSHEELRHSGALKAALAEFISTLIFVFAGQGSGMAYNKLTADGAASPAGLIS  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            A++AHAF LFVAVSVGANISGGHVNPAVTFGAF+GGNITFFRG+LY+IAQLLGSTAACF+
Sbjct  61   ASLAHAFGLFVAVSVGANISGGHVNPAVTFGAFIGGNITFFRGILYIIAQLLGSTAACFI  120

Query  428  LEFATGGMSTGAFGLS-GVSVWSALIFEIVMTFGLVYTVYATAV  556
            LEF T GMSTG+F LS GV VW+AL+FEIVMTFGLVYTVYATAV
Sbjct  121  LEFTT-GMSTGSFALSDGVGVWNALVFEIVMTFGLVYTVYATAV  163



>sp|P50156.1|TIP11_ORYSJ RecName: Full=Probable aquaporin TIP1-1; AltName: Full=Tonoplast 
intrinsic protein 1-1; Short=OsTIP1;1; AltName: Full=rTIP1 
[Oryza sativa Japonica Group]
 gb|AAK98737.1|AC090485_16 Tonoplast intrinsic protein [Oryza sativa Japonica Group]
 dbj|BAA05017.1| gamma-Tip [Oryza sativa]
 gb|ABF93961.1| aquaporin TIP-type, putative, expressed [Oryza sativa Japonica 
Group]
 gb|EAY88537.1| hypothetical protein OsI_10010 [Oryza sativa Indica Group]
 gb|EAZ25574.1| hypothetical protein OsJ_09399 [Oryza sativa Japonica Group]
 gb|ABP48112.1| water channel protein [Oryza sativa Japonica Group]
 dbj|BAG96434.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG91198.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG86661.1| unnamed protein product [Oryza sativa Japonica Group]
Length=250

 Score =   234 bits (598),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 137/163 (84%), Positives = 148/163 (91%), Gaps = 0/163 (0%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI  IA GSH+E+  PG LKAALAEFISTLIFVFAGQGSGMAFSKLT  GA+TP+GLIA
Sbjct  1    MPIRNIAVGSHQEVYHPGALKAALAEFISTLIFVFAGQGSGMAFSKLTGGGATTPAGLIA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            AA+AHAFALFVAVSVGANISGGHVNPAVTFGAFVGGNIT FRG+LY IAQLLGST ACFL
Sbjct  61   AAVAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGNITLFRGLLYWIAQLLGSTVACFL  120

Query  428  LEFATGGMSTGAFGLSGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L F+TGG++TG FGL+GVSVW AL+ EIVMTFGLVYTVYATAV
Sbjct  121  LRFSTGGLATGTFGLTGVSVWEALVLEIVMTFGLVYTVYATAV  163



>ref|XP_006649396.1| PREDICTED: probable aquaporin TIP1-1-like [Oryza brachyantha]
Length=250

 Score =   233 bits (595),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 136/163 (83%), Positives = 147/163 (90%), Gaps = 0/163 (0%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI  IA GSH+E+  PG LKAA AEFISTLIFVFAGQGSGMAFSKLT  GA+TPSGLIA
Sbjct  1    MPIRNIAVGSHQEVYHPGALKAAFAEFISTLIFVFAGQGSGMAFSKLTGGGATTPSGLIA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            AA+AHAFALFVAVSVGANISGGHVNPAVTFGAFVGGNIT FRG+LY +AQLLGST ACFL
Sbjct  61   AAVAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGNITLFRGLLYWVAQLLGSTVACFL  120

Query  428  LEFATGGMSTGAFGLSGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L F+TGG++TG FGL+GVSVW AL+ EIVMTFGLVYTVYATAV
Sbjct  121  LRFSTGGLATGTFGLTGVSVWEALVLEIVMTFGLVYTVYATAV  163



>ref|XP_002465859.1| hypothetical protein SORBIDRAFT_01g047140 [Sorghum bicolor]
 gb|EER92857.1| hypothetical protein SORBIDRAFT_01g047140 [Sorghum bicolor]
Length=250

 Score =   233 bits (593),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 135/163 (83%), Positives = 149/163 (91%), Gaps = 0/163 (0%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI +IA G+H E+  PG LKAALAEFISTLIFVFAGQGSGMAFSKLT+ GA+TPSGLIA
Sbjct  1    MPISRIAVGTHHEVYHPGALKAALAEFISTLIFVFAGQGSGMAFSKLTSGGATTPSGLIA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            AA+AHAFALFVAVSVGANISGGHVNPAVTFGAFVGGNIT FRG+LY +AQLLGST ACFL
Sbjct  61   AAVAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGNITLFRGLLYWVAQLLGSTVACFL  120

Query  428  LEFATGGMSTGAFGLSGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L F+TGG++TG FGL+GVSVW A++ EIVMTFGLVYTVYATAV
Sbjct  121  LRFSTGGLATGTFGLTGVSVWEAVVMEIVMTFGLVYTVYATAV  163



>gb|EMS45815.1| putative aquaporin TIP1-1 [Triticum urartu]
Length=201

 Score =   231 bits (588),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 133/163 (82%), Positives = 147/163 (90%), Gaps = 0/163 (0%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MP+ +IA GSH E+ + G LKAALAEFISTLIFVFAGQGSGMAFSKL+ DGA+TP+GLI+
Sbjct  1    MPVSRIAVGSHREVYEVGALKAALAEFISTLIFVFAGQGSGMAFSKLSPDGAATPAGLIS  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            AAIAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGNIT FRG+LY IAQLLGSTAACFL
Sbjct  61   AAIAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGNITLFRGLLYWIAQLLGSTAACFL  120

Query  428  LEFATGGMSTGAFGLSGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L F+TGG+ TG FGLSG+  W A++ EIVMTFGLVYTVYATAV
Sbjct  121  LRFSTGGLPTGTFGLSGIGAWEAVVLEIVMTFGLVYTVYATAV  163



>ref|NP_001104896.1| aquaporin TIP1-1 [Zea mays]
 sp|O64964.1|TIP11_MAIZE RecName: Full=Aquaporin TIP1-1; AltName: Full=Tonoplast intrinsic 
protein 1-1; AltName: Full=ZmTIP1-1; AltName: Full=ZmTIP1;1; 
Short=ZmTIP1 [Zea mays]
 gb|AAC09245.1| tonoplast intrinsic protein [Zea mays]
 gb|AAO86709.1| tonoplast water channel [Zea mays]
 gb|ACF85770.1| unknown [Zea mays]
 gb|ACF85962.1| unknown [Zea mays]
 gb|ACG23904.1| aquaporin TIP1.1 [Zea mays]
 gb|ACG24935.1| aquaporin TIP1.1 [Zea mays]
 gb|ACN31200.1| unknown [Zea mays]
 gb|ACN33327.1| unknown [Zea mays]
Length=250

 Score =   230 bits (587),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 134/163 (82%), Positives = 147/163 (90%), Gaps = 0/163 (0%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI++IA GSH+E+  PG LKAA AEFISTLIFVFAGQGSGMAFSKLT  G +TP+GLIA
Sbjct  1    MPINRIALGSHQEVYHPGALKAAFAEFISTLIFVFAGQGSGMAFSKLTGGGPTTPAGLIA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            AA+AHAFALFVAVSVGANISGGHVNPAVTFGAFVGGNIT FRG+LY +AQLLGST ACFL
Sbjct  61   AAVAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGNITLFRGLLYWVAQLLGSTVACFL  120

Query  428  LEFATGGMSTGAFGLSGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L F+TGG +TG FGL+GVSVW AL+ EIVMTFGLVYTVYATAV
Sbjct  121  LRFSTGGQATGTFGLTGVSVWEALVLEIVMTFGLVYTVYATAV  163



>gb|AAD10494.1| gamma-type tonoplast intrinsic protein [Triticum aestivum]
Length=250

 Score =   229 bits (585),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 133/163 (82%), Positives = 147/163 (90%), Gaps = 0/163 (0%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MP+ +IA GSH E+ + G LKAALAEFISTLIFVFAGQGSGMAFSKL+ DGA+TP+GLI+
Sbjct  1    MPVSRIAVGSHREVYEVGALKAALAEFISTLIFVFAGQGSGMAFSKLSPDGAATPAGLIS  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            AAIAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGNIT FRG+LY IAQLLGSTAACFL
Sbjct  61   AAIAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGNITLFRGLLYWIAQLLGSTAACFL  120

Query  428  LEFATGGMSTGAFGLSGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L F+TGG+ TG FGLSG+  W A++ EIVMTFGLVYTVYATAV
Sbjct  121  LRFSTGGLPTGTFGLSGIGAWEAVVLEIVMTFGLVYTVYATAV  163



>gb|EMT13047.1| Putative aquaporin TIP1-1 [Aegilops tauschii]
Length=213

 Score =   228 bits (581),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 131/163 (80%), Positives = 147/163 (90%), Gaps = 0/163 (0%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MP+ +IA GSH E+ + G LKAALAEFISTLIFVFAGQGSGMAFSKL+ DGA+TP+GLI+
Sbjct  1    MPVSRIAVGSHREVYEVGALKAALAEFISTLIFVFAGQGSGMAFSKLSPDGAATPAGLIS  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            AAIAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGNIT FRG+LY +AQLLGSTAACFL
Sbjct  61   AAIAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGNITLFRGLLYWVAQLLGSTAACFL  120

Query  428  LEFATGGMSTGAFGLSGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L F+TGG+ TG FGL+G+  W A++ EIVMTFGLVYTVYATAV
Sbjct  121  LRFSTGGLPTGTFGLTGIGAWEAVVLEIVMTFGLVYTVYATAV  163



>gb|ABB29477.1| tonoplast intrinsic protein [Panax ginseng]
Length=250

 Score =   229 bits (584),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 129/163 (79%), Positives = 143/163 (88%), Gaps = 0/163 (0%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPIH+IA G +EE R PG LKAA AEF STLIFVFAGQGSG+AFSKLT+ GA+TPSGL++
Sbjct  1    MPIHEIAVGRYEEFRHPGALKAAAAEFFSTLIFVFAGQGSGLAFSKLTDGGATTPSGLVS  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            AA+AHAF LFVAVSVGANISGGHVNPAVTFGAF+GGN+T  RG+LY+IAQLLGST AC L
Sbjct  61   AALAHAFGLFVAVSVGANISGGHVNPAVTFGAFIGGNLTLIRGILYIIAQLLGSTVACLL  120

Query  428  LEFATGGMSTGAFGLSGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L FATGG    AF LSGVSVWSA +FEIVMTFGLVYTVYATA+
Sbjct  121  LSFATGGSPISAFALSGVSVWSAFVFEIVMTFGLVYTVYATAI  163



>ref|XP_004985722.1| PREDICTED: aquaporin TIP1-1-like [Setaria italica]
Length=249

 Score =   229 bits (583),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 136/163 (83%), Positives = 147/163 (90%), Gaps = 1/163 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI++IA GSHEE+  PG LKAA AEFISTLIFVFAGQGSGMAFSKL+  G STP+GLIA
Sbjct  1    MPINRIAVGSHEEVYHPGALKAAFAEFISTLIFVFAGQGSGMAFSKLS-PGGSTPTGLIA  59

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            AAIAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGNIT FRG+LY IAQLLGST ACFL
Sbjct  60   AAIAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGNITLFRGILYWIAQLLGSTVACFL  119

Query  428  LEFATGGMSTGAFGLSGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L F+TGG+ TG FGL+G+SVW AL+ EIVMTFGLVYTVYATAV
Sbjct  120  LRFSTGGLPTGTFGLTGISVWEALVLEIVMTFGLVYTVYATAV  162



>dbj|BAP33938.1| aquaporin [Triticum aestivum]
Length=250

 Score =   228 bits (582),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 132/163 (81%), Positives = 147/163 (90%), Gaps = 0/163 (0%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MP+ +IA GSH E+ + G LKAALAEFISTLIFVFAGQGSGMAFSKL+ DGA+TP+GLI+
Sbjct  1    MPVSRIAVGSHREVYEVGALKAALAEFISTLIFVFAGQGSGMAFSKLSPDGAATPAGLIS  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            AAIAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGNIT FRG+LY IAQLLGSTAACFL
Sbjct  61   AAIAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGNITLFRGLLYWIAQLLGSTAACFL  120

Query  428  LEFATGGMSTGAFGLSGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L F+TGG+ TG FGL+G+  W A++ EIVMTFGLVYTVYATAV
Sbjct  121  LRFSTGGLPTGTFGLTGIGAWEAVVLEIVMTFGLVYTVYATAV  163



>ref|NP_001241727.1| aquaporin TIP1.1 [Zea mays]
 gb|ACG25449.1| aquaporin TIP1.1 [Zea mays]
Length=250

 Score =   228 bits (580),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 133/163 (82%), Positives = 146/163 (90%), Gaps = 0/163 (0%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI++IA GSH+E+  PG LKAA AEFISTLIFVFAGQGSGMAFSKLT  G +TP+GLIA
Sbjct  1    MPINRIALGSHQEVYHPGALKAAFAEFISTLIFVFAGQGSGMAFSKLTGGGPTTPAGLIA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            AA+AHAFALFVAVSVGANISG HVNPAVTFGAFVGGNIT FRG+LY +AQLLGST ACFL
Sbjct  61   AAVAHAFALFVAVSVGANISGRHVNPAVTFGAFVGGNITLFRGLLYWVAQLLGSTVACFL  120

Query  428  LEFATGGMSTGAFGLSGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L F+TGG +TG FGL+GVSVW AL+ EIVMTFGLVYTVYATAV
Sbjct  121  LRFSTGGQATGTFGLTGVSVWEALVLEIVMTFGLVYTVYATAV  163



>ref|XP_003558815.1| PREDICTED: aquaporin TIP1-1 [Brachypodium distachyon]
Length=250

 Score =   226 bits (577),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 132/163 (81%), Positives = 147/163 (90%), Gaps = 0/163 (0%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI ++A GSH E+ Q G LKAA+AEFISTLIFVFAGQGSGMAF+KL   GA+TP+GLI+
Sbjct  1    MPISRVAVGSHHEVYQAGALKAAVAEFISTLIFVFAGQGSGMAFNKLNAGGAATPAGLIS  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            AAIAHAFALFVAVSVGANISGGHVNPAVTFGAF+GGNIT FRG+LY +AQLLGSTAACFL
Sbjct  61   AAIAHAFALFVAVSVGANISGGHVNPAVTFGAFLGGNITLFRGLLYWVAQLLGSTAACFL  120

Query  428  LEFATGGMSTGAFGLSGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L F+TGG+ TG FGL+GVSVW AL+ EIVMTFGLVYTVYATAV
Sbjct  121  LRFSTGGLPTGTFGLTGVSVWEALVLEIVMTFGLVYTVYATAV  163



>emb|CAA56553.1| gamma-TIP-like protein [Hordeum vulgare subsp. vulgare]
 dbj|BAI66434.1| tonoplast intrinsic protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ90879.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ98959.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=250

 Score =   226 bits (577),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 130/163 (80%), Positives = 146/163 (90%), Gaps = 0/163 (0%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MP+ +IA GSH E+ + G LKAALAEFISTLIFVFAGQGSGMAFSKL+ DG +TP+GLI+
Sbjct  1    MPVSRIAVGSHREVYEVGALKAALAEFISTLIFVFAGQGSGMAFSKLSPDGVATPAGLIS  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            AAIAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGNIT FRG+LY +AQLLGSTAACFL
Sbjct  61   AAIAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGNITLFRGLLYWVAQLLGSTAACFL  120

Query  428  LEFATGGMSTGAFGLSGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L F+TGG+ TG FGL+G+  W A++ EIVMTFGLVYTVYATAV
Sbjct  121  LRFSTGGLPTGTFGLTGIGAWEAVVLEIVMTFGLVYTVYATAV  163



>gb|ACV52008.1| tonoplast aquaporin 1;1 [Daucus carota]
Length=251

 Score =   224 bits (571),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 128/163 (79%), Positives = 142/163 (87%), Gaps = 0/163 (0%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPIH+IA G ++E+R PG +KAA AEF STLIFVFAGQGSGMAFSKLT  GA+TP+GL+A
Sbjct  1    MPIHEIAVGRYDEVRHPGAIKAAAAEFFSTLIFVFAGQGSGMAFSKLTAGGATTPAGLVA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            AA+AHAF LFVAV+VGANISGGHVNPAVTFGAFVGGNIT  +G+LYVIAQ LGST AC L
Sbjct  61   AAVAHAFGLFVAVAVGANISGGHVNPAVTFGAFVGGNITLVKGILYVIAQCLGSTVACLL  120

Query  428  LEFATGGMSTGAFGLSGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L F TGGM T AF LSGVS+WSA +FEIVMTFGLVYTVYA AV
Sbjct  121  LSFTTGGMPTSAFALSGVSIWSAFVFEIVMTFGLVYTVYAVAV  163



>ref|XP_008801219.1| PREDICTED: probable aquaporin TIP1-1 [Phoenix dactylifera]
Length=250

 Score =   224 bits (570),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 130/163 (80%), Positives = 142/163 (87%), Gaps = 0/163 (0%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI +IA G+ EE   P  LKAALAEFISTLIFVFAGQGSGMAFSKLT  GA+TP+GLIA
Sbjct  1    MPISRIAIGTREEATHPSALKAALAEFISTLIFVFAGQGSGMAFSKLTGGGATTPAGLIA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            AA+AHAF LFVAVSV ANISGGHVNPAVTFGAF+GGNIT  RG+LY IAQLLGST AC L
Sbjct  61   AALAHAFGLFVAVSVAANISGGHVNPAVTFGAFIGGNITLLRGILYWIAQLLGSTVACLL  120

Query  428  LEFATGGMSTGAFGLSGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L F+TGG+STG FGL+GVSVW AL+ EIVMTFGLVYTVYATA+
Sbjct  121  LRFSTGGLSTGTFGLTGVSVWEALVLEIVMTFGLVYTVYATAL  163



>ref|XP_009411359.1| PREDICTED: probable aquaporin TIP1-1 [Musa acuminata subsp. malaccensis]
Length=250

 Score =   223 bits (568),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 130/163 (80%), Positives = 140/163 (86%), Gaps = 0/163 (0%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MP  QIA G  EE   P  LKAALAEFI TLIFVFAGQGSGMA++KLT+DGA+TP+GLIA
Sbjct  1    MPFSQIAIGRPEEATHPSALKAALAEFICTLIFVFAGQGSGMAYNKLTSDGAATPAGLIA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            AA+AH FALFVAVSVGANISGGHVNPAVTFGAFVGGNIT  RG+LY IAQLLGST AC L
Sbjct  61   AALAHGFALFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGILYWIAQLLGSTVACLL  120

Query  428  LEFATGGMSTGAFGLSGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L F+TGG+ TG FGLSGVS W AL+ EIVMTFGLVYTVYATAV
Sbjct  121  LRFSTGGLETGTFGLSGVSAWEALVLEIVMTFGLVYTVYATAV  163



>ref|XP_009382161.1| PREDICTED: probable aquaporin TIP1-1 [Musa acuminata subsp. malaccensis]
Length=250

 Score =   221 bits (564),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 129/163 (79%), Positives = 140/163 (86%), Gaps = 0/163 (0%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI QIA G+  E   P  LKAALAEFI T IFVFAGQGSGMA++KLT+DGA+TP GLIA
Sbjct  1    MPITQIAIGTTAEATHPTALKAALAEFICTFIFVFAGQGSGMAYNKLTSDGAATPEGLIA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            AA+AH FALFVAVSVGANISGGHVNPAVTFGAFVGGNIT  RG+LY IAQLLGST AC L
Sbjct  61   AALAHGFALFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGILYWIAQLLGSTVACLL  120

Query  428  LEFATGGMSTGAFGLSGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L F+TGG+ TG FGL+GVSVW AL+ EIVMTFGLVYTVYATAV
Sbjct  121  LRFSTGGLETGTFGLTGVSVWEALVLEIVMTFGLVYTVYATAV  163



>ref|XP_010933183.1| PREDICTED: probable aquaporin TIP1-1 [Elaeis guineensis]
Length=250

 Score =   219 bits (559),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 125/163 (77%), Positives = 141/163 (87%), Gaps = 0/163 (0%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI +IA G+ +E   P  LKAA AEFISTLIFVFAGQGSGMAFSKLT  G++TP+GL+A
Sbjct  1    MPISRIAIGTRDEATHPSALKAAFAEFISTLIFVFAGQGSGMAFSKLTGGGSTTPAGLVA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            A++AHAF LFVAVSVGANISGGHVNPAVTFGAF+GGNIT  RG+LY IAQLLGSTAAC L
Sbjct  61   ASLAHAFGLFVAVSVGANISGGHVNPAVTFGAFIGGNITLLRGILYWIAQLLGSTAACLL  120

Query  428  LEFATGGMSTGAFGLSGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L F TGG++TG FGL+GV+VW A + EIVMTFGLVYTVYATAV
Sbjct  121  LRFCTGGLATGTFGLTGVTVWEAFVLEIVMTFGLVYTVYATAV  163



>ref|XP_006837956.1| hypothetical protein AMTR_s00102p00061000 [Amborella trichopoda]
 gb|ERN00525.1| hypothetical protein AMTR_s00102p00061000 [Amborella trichopoda]
Length=250

 Score =   219 bits (559),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 125/163 (77%), Positives = 144/163 (88%), Gaps = 0/163 (0%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI +IA G  EE   P  LKAALAEFISTLIFVFAG+GSGMAF+KLT++ ++TP+GL+A
Sbjct  1    MPISRIAIGRAEEATHPDALKAALAEFISTLIFVFAGEGSGMAFNKLTDNASTTPAGLVA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            A++AHAF LFVAVSVGANISGGHVNPAVTFGAFVGGNIT  RG+LY IAQLLG+  AC L
Sbjct  61   ASLAHAFGLFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGILYWIAQLLGAVVACGL  120

Query  428  LEFATGGMSTGAFGLSGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+FATGG++T AFGLSGVSVW+A +FEIVMTFGLVYTVYATA+
Sbjct  121  LKFATGGLTTSAFGLSGVSVWNAFVFEIVMTFGLVYTVYATAI  163



>ref|XP_002519456.1| tonoplast intrinsic protein, putative [Ricinus communis]
 gb|EEF42870.1| tonoplast intrinsic protein, putative [Ricinus communis]
Length=251

 Score =   219 bits (558),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 132/164 (80%), Positives = 144/164 (88%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI  IA G   E  QP  LKAALAEFISTLIFVFAG+GSGMAF+KLTN+GA+TPSGL+A
Sbjct  1    MPIRNIAVGHPHEATQPDALKAALAEFISTLIFVFAGEGSGMAFNKLTNNGAATPSGLVA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            AAIAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGNIT  RG+LY IAQLLGST AC L
Sbjct  61   AAIAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGILYWIAQLLGSTVACLL  120

Query  428  LEFATGGMSTGAFGL-SGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+F+TGG++T AF L SGV VW+A +FEIVMTFGLVYTVYATAV
Sbjct  121  LKFSTGGLTTSAFALSSGVGVWNAFVFEIVMTFGLVYTVYATAV  164



>ref|XP_010911210.1| PREDICTED: probable aquaporin TIP1-1 [Elaeis guineensis]
Length=250

 Score =   218 bits (556),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 126/163 (77%), Positives = 140/163 (86%), Gaps = 0/163 (0%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI +IA G+ EE   P  L+AALAE ISTLIFVFAGQGSGMAFSKLT   ++TP+GL+A
Sbjct  1    MPISRIAIGTREEATHPSALRAALAELISTLIFVFAGQGSGMAFSKLTGGSSTTPAGLVA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            A++AHAF LFVAVSV ANISGGHVNPAVTFGAFVGGNIT  RG+LY  AQLLGST ACFL
Sbjct  61   ASLAHAFGLFVAVSVAANISGGHVNPAVTFGAFVGGNITLLRGILYWFAQLLGSTIACFL  120

Query  428  LEFATGGMSTGAFGLSGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L F+TGG+STG FGL+GVSVW AL+ EIVMTFGLVYTVYATAV
Sbjct  121  LRFSTGGLSTGTFGLTGVSVWEALVLEIVMTFGLVYTVYATAV  163



>ref|XP_010253312.1| PREDICTED: aquaporin TIP1-3-like [Nelumbo nucifera]
Length=251

 Score =   218 bits (555),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 127/164 (77%), Positives = 146/164 (89%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI +IA G+  E  QP  LKAALAEFISTLIFVFAG+GSGMAF+KLT++G+STP+GL++
Sbjct  1    MPISRIAIGTPGEASQPDALKAALAEFISTLIFVFAGEGSGMAFNKLTSNGSSTPAGLVS  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            A++AHAFALFVAVSVGANISGGHVNPAVTFGAF+GGNIT  RG+LY IAQLLGS  AC L
Sbjct  61   ASLAHAFALFVAVSVGANISGGHVNPAVTFGAFIGGNITLLRGILYWIAQLLGSIVACLL  120

Query  428  LEFATGGMSTGAFGLS-GVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+FATGG++T AF LS  VSVW+AL+FEIVMTFGLVYTVYATAV
Sbjct  121  LKFATGGLTTSAFSLSTDVSVWNALVFEIVMTFGLVYTVYATAV  164



>gb|AGD98716.1| aquaporin protein 13 [Camellia sinensis]
 gb|AGD98717.1| aquaporin protein 14 [Camellia sinensis]
Length=251

 Score =   218 bits (555),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 128/164 (78%), Positives = 145/164 (88%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI++IA G+ EE   P  LKAALAEFISTLIFVFAG+GSGMAF+KLT DGA+TPSG+I+
Sbjct  1    MPINRIAVGTREEATHPDALKAALAEFISTLIFVFAGEGSGMAFNKLTGDGAATPSGVIS  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            AAIAHAFALFVAVS+GANISGGHVNPAVTFGAF+GG+IT  RG+LY IAQLLGS  AC L
Sbjct  61   AAIAHAFALFVAVSIGANISGGHVNPAVTFGAFIGGHITLLRGILYWIAQLLGSIVACLL  120

Query  428  LEFATGGMSTGAFGL-SGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+F+T GMST AF L SGVSVW+A +FEIVMTFGLVYTVYATA+
Sbjct  121  LKFSTNGMSTSAFSLSSGVSVWNAFVFEIVMTFGLVYTVYATAL  164



>ref|XP_009397029.1| PREDICTED: probable aquaporin TIP1-1 [Musa acuminata subsp. malaccensis]
Length=250

 Score =   218 bits (555),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 129/163 (79%), Positives = 142/163 (87%), Gaps = 0/163 (0%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI +IA G+ EE   PG LKAALAEFISTLIFVFAGQGSGMAFSKLT   A+TP+GLIA
Sbjct  1    MPIPRIAVGTQEEATHPGTLKAALAEFISTLIFVFAGQGSGMAFSKLTGGAATTPAGLIA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            AA+AHAFALFVAVSVGANISGGHVNPAVTFG F+GGNIT  R ++Y IAQLLGST AC L
Sbjct  61   AALAHAFALFVAVSVGANISGGHVNPAVTFGVFIGGNITLLRSIIYWIAQLLGSTVACLL  120

Query  428  LEFATGGMSTGAFGLSGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L ++TGG+STG+F LSGVSVW AL+ EIVMTFGLVYTVYATAV
Sbjct  121  LRYSTGGLSTGSFALSGVSVWEALVLEIVMTFGLVYTVYATAV  163



>ref|XP_010243206.1| PREDICTED: aquaporin TIP1-1-like [Nelumbo nucifera]
Length=251

 Score =   218 bits (554),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 127/164 (77%), Positives = 146/164 (89%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MP+ +IA G  EE   P  LKAALAEF STLIFVFAG+GSGMAF+KLT++G++TP+GL+A
Sbjct  1    MPVSRIAVGRPEEATHPDALKAALAEFFSTLIFVFAGEGSGMAFNKLTSNGSATPAGLVA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            AA++HAFALFVAVSVGANISGGHVNPAVTFGAFVGGNIT FRG+LY IAQLLGST AC L
Sbjct  61   AALSHAFALFVAVSVGANISGGHVNPAVTFGAFVGGNITLFRGILYWIAQLLGSTVACLL  120

Query  428  LEFATGGMSTGAFGL-SGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+FATGG++T AF L SGV+VW+A +FEIVMTFGLVYTVYATAV
Sbjct  121  LKFATGGLTTSAFSLSSGVTVWNAFVFEIVMTFGLVYTVYATAV  164



>ref|XP_010267262.1| PREDICTED: aquaporin TIP1-1 [Nelumbo nucifera]
Length=252

 Score =   218 bits (554),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 128/164 (78%), Positives = 145/164 (88%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI++IA G  EE   P  L+AALAEFISTLIFVFAG+GSGMAF+KLT++G+STP+GL+A
Sbjct  1    MPINRIAVGRPEEATHPDALRAALAEFISTLIFVFAGEGSGMAFNKLTSNGSSTPAGLVA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            AA+AHAF LFVAVSVGANISGGHVNPAVTFGAFVGGNIT  RG+LY IAQLLGST AC L
Sbjct  61   AALAHAFGLFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGILYWIAQLLGSTVACLL  120

Query  428  LEFATGGMSTGAFGL-SGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+FATGG++T AF L SGVSVW+A + EIVMTFGLVYTVYATAV
Sbjct  121  LKFATGGLTTSAFSLSSGVSVWNAFVLEIVMTFGLVYTVYATAV  164



>gb|ACX37451.1| tonoplast intrinsic protein [Hevea brasiliensis]
Length=252

 Score =   217 bits (552),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 128/164 (78%), Positives = 143/164 (87%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI  IA G  +E   P  LKAALAEFISTLIFVFAG+GSGMAFSKLTN+GA+TP+GL+A
Sbjct  1    MPIRNIAVGHPQEATHPDALKAALAEFISTLIFVFAGEGSGMAFSKLTNNGATTPAGLVA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            A+IAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGNIT  RG+LY IAQLLGST AC L
Sbjct  61   ASIAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGILYWIAQLLGSTVACLL  120

Query  428  LEFATGGMSTGAFGL-SGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+F+TGG++T  F L SGV VW+A +FEIVMTFGLVYTVYATA+
Sbjct  121  LKFSTGGLTTAGFALSSGVGVWNAFVFEIVMTFGLVYTVYATAI  164



>gb|ADO17795.1| tonoplast intrinsic protein [Jatropha curcas]
Length=252

 Score =   216 bits (551),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 125/164 (76%), Positives = 142/164 (87%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI  IA G  +E   P  LKAALAEFISTLIFVFAG+GSGMAF+KLTN+GA+TP+GL+A
Sbjct  1    MPIRNIAIGHPQEATHPDALKAALAEFISTLIFVFAGEGSGMAFNKLTNNGATTPAGLVA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            A++AH F LFVAVSVGANISGGHVNPAVTFGAFVGGNIT  RG+LY IAQLLGST AC L
Sbjct  61   ASLAHGFGLFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGILYWIAQLLGSTVACLL  120

Query  428  LEFATGGMSTGAFGL-SGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+F+TGG++T AF L SGV VW+A +FEIVMTFGLVYTVYATA+
Sbjct  121  LKFSTGGLTTSAFALSSGVGVWNAFVFEIVMTFGLVYTVYATAI  164



>gb|KDP29188.1| hypothetical protein JCGZ_16577 [Jatropha curcas]
Length=252

 Score =   216 bits (550),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 125/164 (76%), Positives = 142/164 (87%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI  IA G  +E   P  LKAALAEFISTLIFVFAG+GSGMAF+KLTN+GA+TP+GL+A
Sbjct  1    MPIRNIAIGHPQEATHPDALKAALAEFISTLIFVFAGEGSGMAFNKLTNNGATTPAGLVA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            A++AH F LFVAVSVGANISGGHVNPAVTFGAFVGGNIT  RG+LY IAQLLGST AC L
Sbjct  61   ASLAHGFGLFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGILYWIAQLLGSTVACLL  120

Query  428  LEFATGGMSTGAFGL-SGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+F+TGG++T AF L SGV VW+A +FEIVMTFGLVYTVYATA+
Sbjct  121  LKFSTGGLTTSAFALSSGVGVWNAFVFEIVMTFGLVYTVYATAI  164



>gb|ADB93067.1| aquaporin [Jatropha curcas]
Length=252

 Score =   216 bits (550),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 125/164 (76%), Positives = 142/164 (87%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI  IA G  +E   P  LKAALAEFISTLIFVFAG+GSGMAF+KLTN+GA+TP+GL+A
Sbjct  1    MPIRNIAIGHPQEATHPDALKAALAEFISTLIFVFAGEGSGMAFNKLTNNGATTPAGLVA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            A++AH F LFVAVSVGANISGGHVNPAVTFGAFVGGNIT  RG+LY IAQLLGST AC L
Sbjct  61   ASLAHGFGLFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGILYWIAQLLGSTVACLL  120

Query  428  LEFATGGMSTGAFGL-SGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+F+TGG++T AF L SGV VW+A +FEIVMTFGLVYTVYATA+
Sbjct  121  LKFSTGGLTTSAFALSSGVGVWNAFVFEIVMTFGLVYTVYATAI  164



>ref|XP_009401846.1| PREDICTED: probable aquaporin TIP1-1 [Musa acuminata subsp. malaccensis]
Length=251

 Score =   216 bits (549),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 129/164 (79%), Positives = 140/164 (85%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI +IA G+ EE   P  LKAALAEFI T IFVFAGQGSGMA+SK+T+ GA+TP+GLI 
Sbjct  1    MPISRIAIGTTEEATHPSALKAALAEFICTFIFVFAGQGSGMAYSKMTSGGAATPTGLIM  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            AA+AHAFALFVAVSVGANISGGHVNPAVTFGAFVGGNIT  RGVLY +AQLLGSTAAC L
Sbjct  61   AALAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGVLYWVAQLLGSTAACLL  120

Query  428  LEFATGGMSTGAFGL-SGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L FATGG+ TG FGL SGV VW AL+ E VMTFGLVYTVYATAV
Sbjct  121  LHFATGGLETGTFGLSSGVGVWEALVLEAVMTFGLVYTVYATAV  164



>tpg|DAA33867.1| TPA_inf: aquaporin TIP1;4 [Gossypium hirsutum]
 gb|KHG03043.1| Aquaporin TIP1-1 -like protein [Gossypium arboreum]
Length=251

 Score =   215 bits (548),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 125/164 (76%), Positives = 140/164 (85%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI  IA G  EE  QP  LKAALAEFISTLIFVFAG GSGMAF+KLT++GA+TP+GL+A
Sbjct  1    MPIRNIAVGRPEEATQPDALKAALAEFISTLIFVFAGSGSGMAFNKLTDNGATTPAGLVA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            A+IAH   LFVAVSVGANISGGHVNPAVTFGAFVGGNI+  RG+LY IAQLLGST AC L
Sbjct  61   ASIAHGLGLFVAVSVGANISGGHVNPAVTFGAFVGGNISLLRGILYWIAQLLGSTVACLL  120

Query  428  LEFATGGMSTGAFGL-SGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+FAT  M+  AFGL SGV VW+A++FEIVMTFGLVYTVYATA+
Sbjct  121  LKFATSDMTVPAFGLSSGVGVWNAVVFEIVMTFGLVYTVYATAI  164



>ref|XP_010920700.1| PREDICTED: probable aquaporin TIP1-2 [Elaeis guineensis]
Length=253

 Score =   215 bits (548),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 129/164 (79%), Positives = 143/164 (87%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI +IA GS  E  QP  LKAALAEFIS LIFVFAG+GSGMAF+KLTNDG++TP+GL+A
Sbjct  1    MPISRIAIGSPGEASQPDTLKAALAEFISMLIFVFAGEGSGMAFNKLTNDGSTTPAGLVA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            AA+AHAFALFVAVSVGANISGGHVNPAVTFGAF+GGNIT  RG+LY IAQLLGS  AC L
Sbjct  61   AALAHAFALFVAVSVGANISGGHVNPAVTFGAFIGGNITLLRGILYWIAQLLGSVVACLL  120

Query  428  LEFATGGMSTGAFGLS-GVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+FATGG+ T AF LS  VS W+AL+FEIVMTFGLVYTVYATAV
Sbjct  121  LKFATGGLKTAAFSLSTDVSAWNALVFEIVMTFGLVYTVYATAV  164



>emb|CAE53881.1| aquaporin [Ricinus communis]
Length=251

 Score =   215 bits (548),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 130/164 (79%), Positives = 142/164 (87%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI  IA G   E  QP  LKAALAEFISTLIFVFAG+GSGMAF+KLTN+G +TPSGL+A
Sbjct  1    MPIRNIAVGHPHEATQPDALKAALAEFISTLIFVFAGEGSGMAFNKLTNNGVATPSGLVA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            AAIAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGNIT  RG+LY  AQLLGST AC L
Sbjct  61   AAIAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGILYWFAQLLGSTVACLL  120

Query  428  LEFATGGMSTGAFGL-SGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+F+TGG++T AF L SGV VW+A +FEIVMTFGLVYTVYATAV
Sbjct  121  LKFSTGGLTTSAFALSSGVGVWNAFVFEIVMTFGLVYTVYATAV  164



>ref|XP_008794805.1| PREDICTED: LOW QUALITY PROTEIN: probable aquaporin TIP1-2 [Phoenix 
dactylifera]
Length=252

 Score =   215 bits (547),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 129/164 (79%), Positives = 144/164 (88%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI +IA GS  E  QP  LKAALAEFIS LIFVFAG+GSGMAF+KLTNDG++TP+GL+A
Sbjct  1    MPISRIAIGSPGEASQPDALKAALAEFISVLIFVFAGEGSGMAFNKLTNDGSTTPAGLVA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            AA+AHAFALFVAVSVGANISGGHVNPAVTFGAF+GGNIT  RG+LY IAQLLGS  AC L
Sbjct  61   AALAHAFALFVAVSVGANISGGHVNPAVTFGAFIGGNITLLRGILYWIAQLLGSVVACLL  120

Query  428  LEFATGGMSTGAFGLS-GVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+FATGG+ T AF LS  VSVW+AL+FEIVMTFGLVYTVYATA+
Sbjct  121  LKFATGGLKTSAFSLSTDVSVWNALVFEIVMTFGLVYTVYATAL  164



>gb|KJB46503.1| hypothetical protein B456_007G372700 [Gossypium raimondii]
Length=251

 Score =   215 bits (547),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 125/164 (76%), Positives = 140/164 (85%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI  IA G  EE  QP  L+AALAEFISTLIFVFAG GSGMAF+KLT++GA+TP+GL+A
Sbjct  1    MPIRNIAVGRPEEATQPDALRAALAEFISTLIFVFAGSGSGMAFNKLTDNGATTPAGLVA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            A+IAH   LFVAVSVGANISGGHVNPAVTFGAFVGGNI+  RG+LY IAQLLGST AC L
Sbjct  61   ASIAHGLGLFVAVSVGANISGGHVNPAVTFGAFVGGNISLLRGILYWIAQLLGSTVACLL  120

Query  428  LEFATGGMSTGAFGL-SGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+FAT  M+  AFGL SGV VW+A++FEIVMTFGLVYTVYATAV
Sbjct  121  LKFATSDMTVPAFGLSSGVGVWNAVVFEIVMTFGLVYTVYATAV  164



>gb|AAT08702.1| mitochondrial tonoplast intrinsic protein [Hyacinthus orientalis]
Length=220

 Score =   213 bits (543),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 125/159 (79%), Positives = 142/159 (89%), Gaps = 1/159 (1%)
 Frame = +2

Query  80   QIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGliaaaia  259
             IA G+H E+  PG LKAALAEFISTLIFVFAGQGSG+AFSKL+  G +TP+GLI+AA++
Sbjct  4    NIAIGTHHEVSHPGALKAALAEFISTLIFVFAGQGSGIAFSKLSGGGPATPAGLISAALS  63

Query  260  hafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFLLEFA  439
            HAFALFVAVSVGANISGGHVNPAVTFGAF+GGNIT FRG+LY +AQLLGSTAAC LL F+
Sbjct  64   HAFALFVAVSVGANISGGHVNPAVTFGAFLGGNITLFRGLLYWVAQLLGSTAACLLLRFS  123

Query  440  TGGMSTGAFGLSGVSVWSALIFEIVMTFGLVYTVYATAV  556
            T G  TG+FGLSGVSVW+AL+ EIVMTFGLVYTVYATA+
Sbjct  124  T-GEETGSFGLSGVSVWNALVLEIVMTFGLVYTVYATAI  161



>emb|CAN69323.1| hypothetical protein VITISV_032929 [Vitis vinifera]
Length=251

 Score =   214 bits (546),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 124/164 (76%), Positives = 143/164 (87%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI  IAFG  EE  +P  LKAA AEFI TLIFVFAG+GSGMAF+KLT++G++TP+GL+A
Sbjct  1    MPIRNIAFGRPEEATRPDALKAAFAEFICTLIFVFAGEGSGMAFNKLTDNGSTTPAGLVA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            A++AHAFALFVAVSVGANISG HVNPAVTFGAFVGGNIT  RG+LY IAQLLGST AC L
Sbjct  61   ASLAHAFALFVAVSVGANISGXHVNPAVTFGAFVGGNITLLRGILYWIAQLLGSTVACLL  120

Query  428  LEFATGGMSTGAFGL-SGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+F+T GM+T AF L SGV+VW+A +FEIVMTFGLVYTVYATA+
Sbjct  121  LKFSTNGMTTSAFSLSSGVTVWNAFVFEIVMTFGLVYTVYATAI  164



>ref|XP_010037134.1| PREDICTED: aquaporin TIP1-1 [Eucalyptus grandis]
 gb|KCW48797.1| hypothetical protein EUGRSUZ_K02438 [Eucalyptus grandis]
Length=252

 Score =   214 bits (544),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 125/164 (76%), Positives = 141/164 (86%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI  IA G  EE   P  LKAALAEF STLIFVFAG+GSGMAF+KLT++G++TP+GL+A
Sbjct  1    MPIRNIAVGRPEETYHPDALKAALAEFFSTLIFVFAGEGSGMAFNKLTDNGSTTPAGLVA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            AA+AH F LFVAVSVGANISGGHVNPAVTFGAFVGGNIT  RG+LY IAQLLGST AC L
Sbjct  61   AALAHGFGLFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGILYWIAQLLGSTVACLL  120

Query  428  LEFATGGMSTGAFGL-SGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+FATGG++T AF L SGVSVW+A + EIVMTFGLVYTVYATA+
Sbjct  121  LKFATGGLTTSAFSLSSGVSVWNAFVLEIVMTFGLVYTVYATAI  164



>ref|XP_010096653.1| Aquaporin TIP1-3 [Morus notabilis]
 gb|EXB65321.1| Aquaporin TIP1-3 [Morus notabilis]
Length=252

 Score =   214 bits (544),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 128/164 (78%), Positives = 143/164 (87%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            M I++IA G+  E RQP  ++AA AEF S LIFVFAG+GSGMAF+KLTN+GASTPSGL+A
Sbjct  1    MAIYRIAIGNPGEARQPDAIRAAFAEFFSMLIFVFAGEGSGMAFNKLTNNGASTPSGLVA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            AA+AHAFALFVAVSVGANISGGHVNPAVTFGAF+GGNIT  RG+LY IAQLLGS  AC L
Sbjct  61   AALAHAFALFVAVSVGANISGGHVNPAVTFGAFLGGNITLLRGILYWIAQLLGSVVACLL  120

Query  428  LEFATGGMSTGAFGL-SGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+FATGG+ T AF L SGVS W+ALIFEIVMTFGLVYTVYATAV
Sbjct  121  LKFATGGLETSAFALSSGVSTWNALIFEIVMTFGLVYTVYATAV  164



>ref|XP_007218847.1| hypothetical protein PRUPE_ppa010364mg [Prunus persica]
 gb|EMJ20046.1| hypothetical protein PRUPE_ppa010364mg [Prunus persica]
Length=252

 Score =   214 bits (544),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 125/164 (76%), Positives = 143/164 (87%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI++IA G+  E   P  ++AA AEF STLIFVFAG+GSGMAF+KLTN+G++TPSGL+A
Sbjct  1    MPINKIAVGTPGEASHPDAIRAAFAEFFSTLIFVFAGEGSGMAFNKLTNNGSTTPSGLVA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            A++AHAFALFVAVSVGANISGGHVNPAVTFGAF+GGNIT  RG+LY IAQLLGS  AC L
Sbjct  61   ASLAHAFALFVAVSVGANISGGHVNPAVTFGAFIGGNITLLRGILYWIAQLLGSVVACLL  120

Query  428  LEFATGGMSTGAFGL-SGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+FATGG  T AF L SGVSVW+AL+FEIVMTFGLVYTVYATAV
Sbjct  121  LKFATGGWETAAFSLSSGVSVWNALVFEIVMTFGLVYTVYATAV  164



>ref|XP_009404620.1| PREDICTED: aquaporin TIP1-1-like [Musa acuminata subsp. malaccensis]
Length=252

 Score =   213 bits (543),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 120/164 (73%), Positives = 141/164 (86%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI +I  G+ EE R P  LKAALAEFIS LIFVFAGQGSGMAF+KLT+DG++TP+GL++
Sbjct  1    MPILRITIGTPEEARHPTALKAALAEFISVLIFVFAGQGSGMAFNKLTDDGSTTPAGLVS  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            A++AH F L+VAV+VGANISGGHVNPAVTFGAF+GGNIT  RG+LY IAQLLGS  AC L
Sbjct  61   ASLAHGFGLYVAVAVGANISGGHVNPAVTFGAFLGGNITLLRGILYWIAQLLGSVVACLL  120

Query  428  LEFATGGMSTGAFGL-SGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+FATGG+ T  F L S V+VW+AL+FEIVMTFGLVYTVYATA+
Sbjct  121  LKFATGGLETTPFSLSSSVTVWNALVFEIVMTFGLVYTVYATAI  164



>ref|XP_008788358.1| PREDICTED: probable aquaporin TIP1-1 [Phoenix dactylifera]
Length=414

 Score =   218 bits (556),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 125/159 (79%), Positives = 139/159 (87%), Gaps = 0/159 (0%)
 Frame = +2

Query  80   QIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGliaaaia  259
            +IA G+ EE   P  LKAALAEFI TLIFVFAGQGSGMAFSKLT   A+TP+GL+AA++A
Sbjct  169  RIAIGTREEATHPNALKAALAEFICTLIFVFAGQGSGMAFSKLTGGSATTPAGLVAASLA  228

Query  260  hafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFLLEFA  439
            HAF LFVAVSVGANISGGHVNPAVTFGAFVGGNIT  RG+LY IAQLLGST ACFLL F+
Sbjct  229  HAFGLFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGILYWIAQLLGSTIACFLLRFS  288

Query  440  TGGMSTGAFGLSGVSVWSALIFEIVMTFGLVYTVYATAV  556
            TGG+STG FGL+G+SVW AL+ EIVMTFGLVYTVYATA+
Sbjct  289  TGGLSTGTFGLTGISVWEALVLEIVMTFGLVYTVYATAL  327



>ref|XP_007009482.1| Tonoplast intrinsic protein 1,3 [Theobroma cacao]
 gb|EOY18292.1| Tonoplast intrinsic protein 1,3 [Theobroma cacao]
Length=252

 Score =   213 bits (542),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 125/164 (76%), Positives = 142/164 (87%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI++IA G+  E  QP  LKAA AEF S LIFVFAG+GSGMAF+KLTN+G+STP+GL+A
Sbjct  1    MPINRIAIGTPGEASQPDALKAAFAEFFSMLIFVFAGEGSGMAFNKLTNNGSSTPAGLVA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            A++AHAFALFVAVSVGANISGGHVNPAVTFGAF+GGNIT  RG+LY IAQLLGS  AC L
Sbjct  61   ASLAHAFALFVAVSVGANISGGHVNPAVTFGAFIGGNITLLRGILYWIAQLLGSVVACLL  120

Query  428  LEFATGGMSTGAFGL-SGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+FATGG+ T AF L S VS W+AL+FEIVMTFGLVYTVYATAV
Sbjct  121  LKFATGGLETSAFSLSSDVSAWNALVFEIVMTFGLVYTVYATAV  164



>ref|XP_011088796.1| PREDICTED: aquaporin TIP1-1-like [Sesamum indicum]
Length=255

 Score =   213 bits (542),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 119/163 (73%), Positives = 142/163 (87%), Gaps = 0/163 (0%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            +P+ ++A GSH+E RQPG +KAA+AEFISTL+FVFAG GSG+A++KLT +  +TP+GLIA
Sbjct  8    VPLRRVAIGSHDEFRQPGAVKAAVAEFISTLVFVFAGSGSGIAYNKLTGNAPNTPAGLIA  67

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            A++AHAF LFVAV++GANISGGHVNPAVTFG FVGGNIT FRG+LY+IAQLLGS  AC L
Sbjct  68   ASVAHAFGLFVAVAIGANISGGHVNPAVTFGLFVGGNITLFRGILYIIAQLLGSIVACLL  127

Query  428  LEFATGGMSTGAFGLSGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L F TGG +  AF +SGVSVWSA +FEIVMTFGLVYTVYATAV
Sbjct  128  LSFTTGGWAIPAFTVSGVSVWSAFVFEIVMTFGLVYTVYATAV  170



>gb|AAN40746.1| tonoplast intrinsic protein [Kandelia candel]
Length=252

 Score =   213 bits (541),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 124/164 (76%), Positives = 142/164 (87%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI QIA G   E  +P  LKAALAEFISTLIFVFAG+GSGMAF+KLT++G++TP+GLIA
Sbjct  1    MPIRQIAVGHPHEATRPDVLKAALAEFISTLIFVFAGEGSGMAFNKLTDNGSTTPAGLIA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            A+IAHAF LFV VSV ANISGGHVNPAVTFGAF+GGNIT  RG+LY I QLLGST AC L
Sbjct  61   ASIAHAFGLFVGVSVSANISGGHVNPAVTFGAFIGGNITLLRGILYWIGQLLGSTVACLL  120

Query  428  LEFATGGMSTGAFGL-SGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+F+TGG++T AF L SGVSVW+A +FEIVMTFGLVYTVYATA+
Sbjct  121  LKFSTGGLTTSAFSLSSGVSVWNAFVFEIVMTFGLVYTVYATAI  164



>gb|EYU18933.1| hypothetical protein MIMGU_mgv1a012390mg [Erythranthe guttata]
Length=252

 Score =   213 bits (541),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 125/164 (76%), Positives = 143/164 (87%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI ++A G+  E+RQP  +KAA+AEFIS LIFVFAG+GSGMAF+KLT  GASTP+G+ A
Sbjct  1    MPISRVAVGTPAEVRQPEAIKAAVAEFISMLIFVFAGEGSGMAFAKLTGGGASTPAGMTA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            AA+AHAFALFVAVSVGANISGGHVNPAVTFGAFVGG+I+ FR +LY IAQLLGS  AC L
Sbjct  61   AALAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGHISLFRSILYWIAQLLGSVVACLL  120

Query  428  LEFATGGMSTGAFGL-SGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L FATGG+ T AF L SGV+VW+AL+FEIVMTFGLVYTVYATAV
Sbjct  121  LNFATGGLETSAFALSSGVTVWNALVFEIVMTFGLVYTVYATAV  164



>ref|XP_007027468.1| Aquaporin TIP1,6 [Theobroma cacao]
 gb|EOY07970.1| Aquaporin TIP1,6 [Theobroma cacao]
Length=251

 Score =   212 bits (540),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 125/164 (76%), Positives = 139/164 (85%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MP   IA G  EE   P  LKAALAEFISTLIFVFAG GS MA++KLT++GASTP+GL+A
Sbjct  1    MPFRNIAVGRPEEAAHPDALKAALAEFISTLIFVFAGSGSSMAYNKLTDNGASTPAGLVA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            A++A+ FALFVAVSVGANISGGHVNPAVTFGAFVGGNIT  RG+LY IAQLLGST AC L
Sbjct  61   ASLAYGFALFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGILYWIAQLLGSTVACLL  120

Query  428  LEFATGGMSTGAFGL-SGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+FAT G+S  AFGL SGV VW+A +FEIVMTFGLVYTVYATAV
Sbjct  121  LKFATNGLSIPAFGLSSGVGVWNAFVFEIVMTFGLVYTVYATAV  164



>ref|XP_008233574.1| PREDICTED: aquaporin TIP1-3 [Prunus mume]
Length=252

 Score =   212 bits (539),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 124/164 (76%), Positives = 143/164 (87%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI++IA G+  E   P  ++AA AEF STLIFVFAG+GSGMAF+KLT++G++TPSGL+A
Sbjct  1    MPINKIAVGTPGEASHPDAIRAAFAEFFSTLIFVFAGEGSGMAFNKLTDNGSTTPSGLVA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            A++AHAFALFVAVSVGANISGGHVNPAVTFGAF+GGNIT  RG+LY IAQLLGS  AC L
Sbjct  61   ASLAHAFALFVAVSVGANISGGHVNPAVTFGAFIGGNITLLRGILYWIAQLLGSVVACLL  120

Query  428  LEFATGGMSTGAFGL-SGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+FATGG  T AF L SGVSVW+AL+FEIVMTFGLVYTVYATAV
Sbjct  121  LKFATGGWETAAFSLSSGVSVWNALVFEIVMTFGLVYTVYATAV  164



>gb|ACJ53709.1| tonoplast intrinsic protein 1-2 [Lolium perenne]
Length=249

 Score =   211 bits (537),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 129/163 (79%), Positives = 142/163 (87%), Gaps = 1/163 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MP+ +IA G+H E+ + G LKAA+AEFISTLIFVFAGQGSG+AF+KL+  G   P GLIA
Sbjct  1    MPVSRIAVGTHHEVYETGALKAAVAEFISTLIFVFAGQGSGVAFAKLSG-GTDAPIGLIA  59

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            AAIAHAFALFVAVSVGANISGGHVNPAVTFGAF+GGNIT FRG+LY IAQLLGSTAACFL
Sbjct  60   AAIAHAFALFVAVSVGANISGGHVNPAVTFGAFLGGNITLFRGLLYWIAQLLGSTAACFL  119

Query  428  LEFATGGMSTGAFGLSGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L FATGG+ TG F LSGVS W AL+ EIVMTFGLVYTVYATAV
Sbjct  120  LRFATGGLPTGFFALSGVSCWEALVLEIVMTFGLVYTVYATAV  162



>dbj|BAD90702.1| tonoplast intrinsic protein 1;1 [Mimosa pudica]
Length=251

 Score =   211 bits (537),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 124/164 (76%), Positives = 142/164 (87%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MP+  IA G  EE   P  LKA LAEFISTLIFVFAG GSGMAF+KLT++GA+TP+GLI+
Sbjct  1    MPVQNIAIGRPEEATHPDTLKAGLAEFISTLIFVFAGSGSGMAFNKLTDNGATTPAGLIS  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            AAIAHAFALFVAV+VGANISGGHVNPAVTFGAF+GGNI+  RG++Y IAQLLGS  AC L
Sbjct  61   AAIAHAFALFVAVAVGANISGGHVNPAVTFGAFIGGNISLLRGIVYWIAQLLGSVVACLL  120

Query  428  LEFATGGMSTGAFGL-SGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+F TGG++T AFGL SGV VW+A++FEIVMTFGLVYTVYATAV
Sbjct  121  LKFVTGGLTTPAFGLSSGVGVWNAVVFEIVMTFGLVYTVYATAV  164



>gb|KDP29873.1| hypothetical protein JCGZ_18448 [Jatropha curcas]
Length=252

 Score =   211 bits (537),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 123/164 (75%), Positives = 143/164 (87%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI +IA G+  E  QP  L+AALAEF S +IFVFAG+GSGMAF+KLT+DG+STP+GL+A
Sbjct  1    MPITRIAIGNPGEASQPDALRAALAEFFSMVIFVFAGEGSGMAFNKLTSDGSSTPAGLVA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            A++AHAFALFVAVSVGANISGGHVNPAVTFGAF+GGNIT  RG+LY IAQLLGS  AC L
Sbjct  61   ASLAHAFALFVAVSVGANISGGHVNPAVTFGAFIGGNITLLRGILYWIAQLLGSVVACLL  120

Query  428  LEFATGGMSTGAFGL-SGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L++ATGG+ T AF L SGVS W+A++FEIVMTFGLVYTVYATAV
Sbjct  121  LKYATGGLETSAFALSSGVSAWNAVVFEIVMTFGLVYTVYATAV  164



>gb|AGG39699.1| aquaporin protein AQU21 [Camellia sinensis]
Length=252

 Score =   211 bits (536),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 126/164 (77%), Positives = 144/164 (88%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI++IA G+  E   P  LKAALAEFIS LIFVFAG+GSGMAF+KLT++G++TP+GL+A
Sbjct  1    MPIYRIAVGTPREASHPDALKAALAEFISMLIFVFAGEGSGMAFNKLTDNGSTTPAGLVA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            AA+AHAFALFVAVSVGANISGGHVNPAVTFGAF+GGNIT  RG+LY IAQ LGS  AC L
Sbjct  61   AALAHAFALFVAVSVGANISGGHVNPAVTFGAFLGGNITLLRGILYWIAQCLGSIVACLL  120

Query  428  LEFATGGMSTGAFGLS-GVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+FATGG+ T AF LS GVSVW+AL+FEIVMTFGLVYTVYATAV
Sbjct  121  LKFATGGLETSAFSLSIGVSVWNALVFEIVMTFGLVYTVYATAV  164



>ref|XP_011089965.1| PREDICTED: aquaporin TIP1-1-like [Sesamum indicum]
Length=259

 Score =   211 bits (537),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 118/163 (72%), Positives = 139/163 (85%), Gaps = 0/163 (0%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            +P+ ++A G+ EE RQPG +KAA+AEFISTL+FVFAG GSGMA++K+T +  ++P GLI 
Sbjct  10   VPLRRVAIGNTEEFRQPGAVKAAVAEFISTLVFVFAGSGSGMAYNKITGNAPNSPEGLIV  69

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            AA+AHAF LFVAV++ ANISGGHVNPAVTFG FVGGNIT FRG+LY+IAQLLGS  AC L
Sbjct  70   AAVAHAFGLFVAVAIAANISGGHVNPAVTFGLFVGGNITLFRGILYIIAQLLGSVVACLL  129

Query  428  LEFATGGMSTGAFGLSGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L F TGG+ T AF LSGVSVWSA +FEIVMTFGLVYTVYATAV
Sbjct  130  LTFTTGGLETPAFSLSGVSVWSAFVFEIVMTFGLVYTVYATAV  172



>ref|XP_008343557.1| PREDICTED: aquaporin TIP1-3 [Malus domestica]
Length=252

 Score =   211 bits (536),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 123/164 (75%), Positives = 142/164 (87%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI++IA G+  E  QP  ++AALAEF S LIFVFAG+GSGMAF+KLT++ ++TPSGL+A
Sbjct  1    MPINRIAVGTPGEASQPDAIRAALAEFFSMLIFVFAGEGSGMAFNKLTDNASTTPSGLVA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            A++AHAFALFVAVSVGANISGGHVNPAVTFGAF+GGNIT  RG+LY IAQLLGS  AC L
Sbjct  61   ASLAHAFALFVAVSVGANISGGHVNPAVTFGAFIGGNITLLRGILYWIAQLLGSVVACLL  120

Query  428  LEFATGGMSTGAFGL-SGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+FATGG  T  F L SGVSVW+AL+FEIVMTFGLVYTVYATAV
Sbjct  121  LKFATGGWETAXFSLSSGVSVWNALVFEIVMTFGLVYTVYATAV  164



>gb|AGD98711.1| aquaporin protein 8 [Camellia sinensis]
Length=252

 Score =   211 bits (536),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 126/164 (77%), Positives = 143/164 (87%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI++IA G+  E   P  LKAALAEFIS LIFVFAG+GSGMAF+KLT++G++TP+GL+A
Sbjct  1    MPIYRIAVGTPREASHPDALKAALAEFISMLIFVFAGEGSGMAFNKLTDNGSTTPAGLVA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            AA+AHAFALFVAVSVGANISGGHVNPAVTFGAF+GGNIT  RG+LY IAQ LGS  AC L
Sbjct  61   AALAHAFALFVAVSVGANISGGHVNPAVTFGAFLGGNITLLRGILYWIAQCLGSIVACLL  120

Query  428  LEFATGGMSTGAFGLS-GVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+FATGG+ T AF LS GVSVW AL+FEIVMTFGLVYTVYATAV
Sbjct  121  LKFATGGLETSAFSLSIGVSVWKALVFEIVMTFGLVYTVYATAV  164



>gb|ACP28878.1| tonoplast intrinsic protein [Gossypium hirsutum]
 tpg|DAA33866.1| TPA_inf: aquaporin TIP1;3 [Gossypium hirsutum]
 gb|KHG01699.1| Aquaporin TIP1-1 -like protein [Gossypium arboreum]
 gb|KJB62347.1| hypothetical protein B456_009G413000 [Gossypium raimondii]
Length=251

 Score =   210 bits (535),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 127/164 (77%), Positives = 140/164 (85%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI  IA G  EE   P  LKAALAEFISTLIFVFAG GSGMAF+KLT++GA+TP+GL+A
Sbjct  1    MPIRNIAVGRPEEATHPDALKAALAEFISTLIFVFAGSGSGMAFNKLTDNGATTPAGLVA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            AA+AH F LFVAVSVGANISGGHVNPAVTFGAFVGGNIT  RG+LY IAQLLGST AC L
Sbjct  61   AALAHGFGLFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGILYWIAQLLGSTVACLL  120

Query  428  LEFATGGMSTGAFGL-SGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+FATG ++  AFGL SGV V +AL+FEIVMTFGLVYTVYATAV
Sbjct  121  LKFATGDLAVPAFGLSSGVGVSNALVFEIVMTFGLVYTVYATAV  164



>ref|XP_011089824.1| PREDICTED: aquaporin TIP1-3-like [Sesamum indicum]
Length=252

 Score =   210 bits (535),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 130/164 (79%), Positives = 143/164 (87%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI +IA GS  E  QP  +KAALAEFIS LIFVFAG+GSGMAF+KLTN GASTP+GLIA
Sbjct  1    MPIARIAVGSPAEASQPEAVKAALAEFISMLIFVFAGEGSGMAFAKLTNGGASTPAGLIA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            A+IAHAFALFVAVSVGANISGGHVNPAVTFGAFVGG+IT FR +LY IAQLLGS  AC L
Sbjct  61   ASIAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGHITLFRSILYWIAQLLGSVVACLL  120

Query  428  LEFATGGMSTGAFGL-SGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+FATGG+ T AF L SGV+V +AL+FEIVMTFGLVYTVYATAV
Sbjct  121  LKFATGGLETSAFALSSGVTVTNALVFEIVMTFGLVYTVYATAV  164



>gb|AHA50083.1| tonoplast intrinsic protein [Eleutherococcus senticosus]
Length=251

 Score =   210 bits (535),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 122/164 (74%), Positives = 138/164 (84%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MP-IHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGli  244
            MP  H+IA G +EE RQPG +KAA AE  STL FVFAGQGSGMAFSK+T  G ++P GL+
Sbjct  1    MPRFHRIAVGQYEEFRQPGAIKAAAAELFSTLTFVFAGQGSGMAFSKITKGGPTSPPGLV  60

Query  245  aaaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACF  424
            AAA+AH F LFVAVSVGANISGGHVNPAVTFGA +GGN+T  R VLY+IAQLLGST AC 
Sbjct  61   AAALAHGFGLFVAVSVGANISGGHVNPAVTFGAAIGGNLTLVRAVLYIIAQLLGSTVACI  120

Query  425  LLEFATGGMSTGAFGLSGVSVWSALIFEIVMTFGLVYTVYATAV  556
            LL F+TGG++T AF LSGVSVWSA +FEIVMTFGLVYTVYATA+
Sbjct  121  LLAFSTGGLTTTAFALSGVSVWSAFVFEIVMTFGLVYTVYATAL  164



>emb|CBI31728.3| unnamed protein product [Vitis vinifera]
Length=251

 Score =   210 bits (535),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 124/164 (76%), Positives = 142/164 (87%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI++IA G+  E   P  LKAALAEF S LIFVFAG+GSGMAF+KLT+ G+STP+GL+A
Sbjct  1    MPINRIAIGTPGEASHPDALKAALAEFFSMLIFVFAGEGSGMAFNKLTDSGSSTPAGLVA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            AA+AH FALFVAVSVGANISGGHVNPAVTFGAF+GG+IT  RG+LY IAQLLGS  AC L
Sbjct  61   AALAHGFALFVAVSVGANISGGHVNPAVTFGAFIGGHITLLRGILYWIAQLLGSVVACLL  120

Query  428  LEFATGGMSTGAFGL-SGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+F+TGG+ T AF L SGVSVW+AL+FEIVMTFGLVYTVYATAV
Sbjct  121  LKFSTGGLETSAFSLSSGVSVWNALVFEIVMTFGLVYTVYATAV  164



>gb|AFU51578.1| aquaporin [Gladiolus hybrid cultivar]
Length=259

 Score =   210 bits (535),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 123/174 (71%), Positives = 143/174 (82%), Gaps = 4/174 (2%)
 Frame = +2

Query  35   QLRASILDFPAMPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTN  214
             L   I +F A    +IA G  EE   PG +KAA AEFIST+IFVFAGQGSGMA++KLTN
Sbjct  3    NLPPRITEFQA----RIAVGHREEAWHPGTIKAAFAEFISTVIFVFAGQGSGMAYAKLTN  58

Query  215  DGASTPSGliaaaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIA  394
            DG +T +GLI AA+AHAF LFVAVSV ANISGGHVNPAVTFGAF+GG+ITFFRG++Y+IA
Sbjct  59   DGVTTAAGLIVAAVAHAFGLFVAVSVSANISGGHVNPAVTFGAFLGGHITFFRGLVYIIA  118

Query  395  QLLGSTAACFLLEFATGGMSTGAFGLSGVSVWSALIFEIVMTFGLVYTVYATAV  556
            QLLGST +C LL F TGG++TG+F LSGVSVW  L+ EIVMTFGLVYTVYATA+
Sbjct  119  QLLGSTVSCLLLRFCTGGLATGSFSLSGVSVWEGLVLEIVMTFGLVYTVYATAL  172



>ref|XP_002322910.1| gamma-tonoplast intrinsic protein 2 [Populus trichocarpa]
 gb|ABK93416.1| unknown [Populus trichocarpa]
 gb|ABK93851.1| unknown [Populus trichocarpa]
 gb|EEF04671.1| gamma-tonoplast intrinsic protein 2 [Populus trichocarpa]
Length=252

 Score =   210 bits (535),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 128/164 (78%), Positives = 141/164 (86%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI  IA G + E  QP  LKAALAEFISTLIFVFAG+GSGMAFSKLT+  ++TP+GLIA
Sbjct  1    MPIRNIAVGHYRETTQPDALKAALAEFISTLIFVFAGEGSGMAFSKLTDGASNTPAGLIA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            AAIAHAFALFVAVSVGANISGGHVNPAVTFGAF+GGNIT FRG+LY IAQLLGST AC L
Sbjct  61   AAIAHAFALFVAVSVGANISGGHVNPAVTFGAFIGGNITLFRGILYWIAQLLGSTVACLL  120

Query  428  LEFATGGMSTGAFGLS-GVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+F TGG+ T AF LS GV VW+A + EIVMTFGLVYTVYATA+
Sbjct  121  LKFVTGGLETSAFALSTGVGVWNAFVLEIVMTFGLVYTVYATAI  164



>gb|AIK66517.1| putative aquaporin [Vitis vinifera]
Length=251

 Score =   210 bits (534),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 124/164 (76%), Positives = 142/164 (87%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI++IA G+  E   P  LKAALAEF S LIFVFAG+GSGMAF+KLT+ G+STP+GL+A
Sbjct  1    MPINRIAIGTPGEASHPDALKAALAEFFSMLIFVFAGEGSGMAFNKLTDSGSSTPAGLVA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            AA+AH FALFVAVSVGANISGGHVNPAVTFGAF+GG+IT  RG+LY IAQLLGS  AC L
Sbjct  61   AALAHGFALFVAVSVGANISGGHVNPAVTFGAFIGGHITLLRGILYWIAQLLGSVVACLL  120

Query  428  LEFATGGMSTGAFGL-SGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+F+TGG+ T AF L SGVSVW+AL+FEIVMTFGLVYTVYATAV
Sbjct  121  LKFSTGGLETSAFSLSSGVSVWNALVFEIVMTFGLVYTVYATAV  164



>emb|CDX10339.1| aquaporin [Coffea arabica]
Length=251

 Score =   210 bits (534),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 126/164 (77%), Positives = 143/164 (87%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI +IA GS  E  QP  LKAALAEFIS LIFVFAG+GSGMAFSKLT++G++TP+GL+A
Sbjct  1    MPISRIAVGSPAEASQPDALKAALAEFISMLIFVFAGEGSGMAFSKLTDNGSTTPAGLVA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            AAIAHAFALFVAVSV ANISGGHVNPAVTFGAF+GG+IT  R VLY IAQLLG+  AC L
Sbjct  61   AAIAHAFALFVAVSVAANISGGHVNPAVTFGAFLGGHITLLRSVLYWIAQLLGAVVACLL  120

Query  428  LEFATGGMSTGAFGL-SGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+F+TGG+ T AF L SGVSVW+AL+FEIVMTFGLVYTVYATA+
Sbjct  121  LKFSTGGLETAAFSLSSGVSVWNALVFEIVMTFGLVYTVYATAL  164



>ref|XP_011004488.1| PREDICTED: aquaporin TIP1-1-like [Populus euphratica]
Length=252

 Score =   210 bits (534),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 129/164 (79%), Positives = 141/164 (86%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI  IA G + E  QP  LKAALAEFISTLIFVFAG+GSGMAFSKLT+  ++TP+GLIA
Sbjct  1    MPIRNIAVGHYHETTQPDALKAALAEFISTLIFVFAGEGSGMAFSKLTDGASNTPAGLIA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            AAIAHAFALFVAVSVGANISGGHVNPAVTFGAF+GGNIT FRGVLY IAQLLGST AC L
Sbjct  61   AAIAHAFALFVAVSVGANISGGHVNPAVTFGAFIGGNITLFRGVLYWIAQLLGSTVACLL  120

Query  428  LEFATGGMSTGAFGL-SGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+F TGG+ T AF L SGV VW+A + EIVMTFGLVYTVYATA+
Sbjct  121  LKFVTGGLETSAFALSSGVGVWNAFVLEIVMTFGLVYTVYATAI  164



>emb|CDP08994.1| unnamed protein product [Coffea canephora]
Length=251

 Score =   210 bits (534),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 126/164 (77%), Positives = 143/164 (87%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI +IA GS  E  QP  LKAALAEFIS LIFVFAG+GSGMAFSKLT++G++TP+GL+A
Sbjct  1    MPISRIAVGSPAEASQPDALKAALAEFISMLIFVFAGEGSGMAFSKLTDNGSTTPAGLVA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            AAIAHAFALFVAVSV ANISGGHVNPAVTFGAF+GG+IT  R VLY IAQLLG+  AC L
Sbjct  61   AAIAHAFALFVAVSVAANISGGHVNPAVTFGAFLGGHITLLRSVLYWIAQLLGAVVACLL  120

Query  428  LEFATGGMSTGAFGL-SGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+F+TGG+ T AF L SGVSVW+AL+FEIVMTFGLVYTVYATA+
Sbjct  121  LKFSTGGLETAAFSLSSGVSVWNALVFEIVMTFGLVYTVYATAL  164



>ref|XP_002316308.1| Gamma-tonoplast intrinsic protein 3 [Populus trichocarpa]
 gb|ABK94058.1| unknown [Populus trichocarpa]
 gb|EEF02479.1| Gamma-tonoplast intrinsic protein 3 [Populus trichocarpa]
Length=252

 Score =   210 bits (534),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 124/164 (76%), Positives = 141/164 (86%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI++IAFG+  E   P  L+AALAEFIS LIFVFAG GSGMAF+KLT++ ++TPSGL+A
Sbjct  1    MPINRIAFGTPREASHPDALRAALAEFISMLIFVFAGSGSGMAFNKLTDNASTTPSGLVA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            AA+AHAFALFVAVSVGANISGGHVNPAVTFGA +GGNIT  R +LY IAQLLGS  AC L
Sbjct  61   AALAHAFALFVAVSVGANISGGHVNPAVTFGALIGGNITLLRSILYWIAQLLGSVVACLL  120

Query  428  LEFATGGMSTGAFGL-SGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+FATGG+ T AFGL SGV  W+AL+FEIVMTFGLVYTVYATAV
Sbjct  121  LKFATGGLETPAFGLSSGVGAWNALVFEIVMTFGLVYTVYATAV  164



>gb|AAF78757.1|AF271660_1 putative aquaporin TIP3 [Vitis cinerea var. helleri x Vitis rupestris]
Length=251

 Score =   210 bits (534),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 124/164 (76%), Positives = 142/164 (87%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI++IA G+  E   P  LKAALAEF S LIFVFAG+GSGMAF+KLT+ G+STP+GL+A
Sbjct  1    MPIYRIAIGTPGEASHPDALKAALAEFFSMLIFVFAGEGSGMAFNKLTDSGSSTPAGLVA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            AA+AH FALFVAVSVGANISGGHVNPAVTFGAF+GG+IT  RG+LY IAQLLGS  AC L
Sbjct  61   AALAHGFALFVAVSVGANISGGHVNPAVTFGAFLGGHITLLRGILYWIAQLLGSVVACLL  120

Query  428  LEFATGGMSTGAFGL-SGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+F+TGG+ T AF L SGVSVW+AL+FEIVMTFGLVYTVYATAV
Sbjct  121  LKFSTGGLETSAFSLSSGVSVWNALVFEIVMTFGLVYTVYATAV  164



>ref|XP_009421351.1| PREDICTED: probable aquaporin TIP1-2 [Musa acuminata subsp. malaccensis]
Length=252

 Score =   210 bits (534),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 122/164 (74%), Positives = 141/164 (86%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI  IA G+  E   P  +KA+LAEFISTLIFVFAG+GSGMAF+KLTNDG++TP+GL+A
Sbjct  1    MPIGSIAIGAPGEASHPDTIKASLAEFISTLIFVFAGEGSGMAFNKLTNDGSTTPAGLVA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            A++AH FALFVAVSVGANISGGHVNPAVTFGAF+GGNI+  RG+LY IAQLLGS  AC L
Sbjct  61   ASLAHGFALFVAVSVGANISGGHVNPAVTFGAFLGGNISLIRGILYWIAQLLGSVVACLL  120

Query  428  LEFATGGMSTGAFGL-SGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+ ATGG+ T AF L S VSVW+A++FEIVMTFGLVYTVYATAV
Sbjct  121  LKLATGGLETSAFSLSSDVSVWNAVVFEIVMTFGLVYTVYATAV  164



>ref|XP_009780564.1| PREDICTED: aquaporin TIP1-3 [Nicotiana sylvestris]
Length=252

 Score =   210 bits (534),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 128/164 (78%), Positives = 141/164 (86%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI +I  G+  E  QP  LKAALAEFIS LIFVFAG+GSGMAF KLTN GA+TP+GLI+
Sbjct  1    MPISKITLGNLAEASQPDALKAALAEFISMLIFVFAGEGSGMAFGKLTNGGAATPAGLIS  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            AAIAHAFALFVAVSVGANISGGHVNPAVTFGAFVGG+IT FR VLY IAQLLGS  AC L
Sbjct  61   AAIAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACVL  120

Query  428  LEFATGGMSTGAFGLS-GVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+FATGG+ T AF LS GV+ W+A++FEIVMTFGLVYTVYATAV
Sbjct  121  LKFATGGLETSAFALSTGVTPWNAVVFEIVMTFGLVYTVYATAV  164



>ref|XP_009624595.1| PREDICTED: aquaporin TIP1-3 [Nicotiana tomentosiformis]
Length=252

 Score =   210 bits (534),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 127/164 (77%), Positives = 142/164 (87%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI +I+ G+  E  QP  LKAALAEFIS LIFVFAG+GSGMAF KLTN GA+TP+GLI+
Sbjct  1    MPISKISLGNLAEASQPDALKAALAEFISMLIFVFAGEGSGMAFGKLTNGGAATPAGLIS  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            AAIAHAFALFVAVSVGANISGGHVNPAVTFGAFVGG+IT FR VLY IAQLLGS  AC L
Sbjct  61   AAIAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACVL  120

Query  428  LEFATGGMSTGAFGLS-GVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+FATGG+ T AF LS GV+ W+A++FEIVMTFGLVYTVYATA+
Sbjct  121  LKFATGGLETSAFALSTGVTPWNAVVFEIVMTFGLVYTVYATAI  164



>ref|NP_001267923.1| aquaporin-like [Vitis vinifera]
 gb|ABH09329.1| putative aquaporin [Vitis vinifera]
 gb|AAW02943.2| aquaporin [Vitis vinifera]
Length=251

 Score =   209 bits (533),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 124/164 (76%), Positives = 142/164 (87%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI++IA G+  E   P  LKAALAEF S LIFVFAG+GSGMAF+KLT+ G+STP+GL+A
Sbjct  1    MPINRIAIGTPGEASHPEALKAALAEFFSMLIFVFAGEGSGMAFNKLTDSGSSTPAGLVA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            AA+AH FALFVAVSVGANISGGHVNPAVTFGAF+GG+IT  RG+LY IAQLLGS  AC L
Sbjct  61   AALAHGFALFVAVSVGANISGGHVNPAVTFGAFIGGHITLLRGILYWIAQLLGSVVACLL  120

Query  428  LEFATGGMSTGAFGL-SGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+F+TGG+ T AF L SGVSVW+AL+FEIVMTFGLVYTVYATAV
Sbjct  121  LKFSTGGLETSAFSLSSGVSVWNALVFEIVMTFGLVYTVYATAV  164



>ref|XP_004304478.1| PREDICTED: aquaporin TIP1-1-like [Fragaria vesca subsp. vesca]
Length=253

 Score =   209 bits (533),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 124/164 (76%), Positives = 138/164 (84%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI  IA G  E+   P  LKA LAEFISTLIFVFAG+GSGMAF+KLT+DGA+TP+GL+A
Sbjct  1    MPIQNIAVGRPEDAYHPDALKAGLAEFISTLIFVFAGEGSGMAFNKLTDDGATTPAGLVA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            AA+AHAF LFVAVSV ANISGGHVNPAVTFGAFVGGNI+  RG+LY IAQLLGST AC L
Sbjct  61   AALAHAFGLFVAVSVAANISGGHVNPAVTFGAFVGGNISLLRGILYWIAQLLGSTVACLL  120

Query  428  LEFATGGMSTGAFGL-SGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+F T G +T AF L SGV VW+A +FEIVMTFGLVYTVYATAV
Sbjct  121  LKFVTNGQTTSAFALSSGVGVWNAFVFEIVMTFGLVYTVYATAV  164



>ref|XP_011077300.1| PREDICTED: aquaporin TIP1-1 [Sesamum indicum]
Length=252

 Score =   209 bits (533),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 124/164 (76%), Positives = 142/164 (87%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI +I  G  EE  +P  LKAALAEFISTL+FV+AG+GSGMAF+KLT+DGA+TP+GLIA
Sbjct  1    MPISRITVGRTEEATRPDALKAALAEFISTLLFVYAGEGSGMAFNKLTSDGAATPAGLIA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            AA+AHAFALFVAVS+ ANISGGHVNPAVTFGAFVGGNI+  RG+LY IAQLLG+  AC L
Sbjct  61   AAVAHAFALFVAVSIAANISGGHVNPAVTFGAFVGGNISLLRGILYWIAQLLGAVVACLL  120

Query  428  LEFATGGMSTGAFGL-SGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+F TGG++T AF L SGVSVW+A IFE VMTFGLVYTVYATAV
Sbjct  121  LKFTTGGLTTSAFALSSGVSVWNAFIFETVMTFGLVYTVYATAV  164



>ref|XP_002531118.1| tonoplast intrinsic protein, putative [Ricinus communis]
 gb|EEF31283.1| tonoplast intrinsic protein, putative [Ricinus communis]
Length=252

 Score =   209 bits (532),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 125/164 (76%), Positives = 141/164 (86%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            M I  IAFGS  E  QP  LKAALAEFIS LIFVFAG+GSGMAF+KLT+DGA+TP+GL+A
Sbjct  1    MAITSIAFGSPAEAGQPDALKAALAEFISMLIFVFAGEGSGMAFNKLTSDGATTPAGLVA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            A++AH FALFVAVSVGANISGGHVNPAVTFGAFVGG+ITF R +LY IAQLLGS  AC L
Sbjct  61   ASLAHGFALFVAVSVGANISGGHVNPAVTFGAFVGGHITFIRSILYWIAQLLGSVVACLL  120

Query  428  LEFATGGMSTGAFGL-SGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+F+TGG+ T AF L SGV  W+A++FEIVMTFGLVYTVYATAV
Sbjct  121  LKFSTGGLETSAFALSSGVGAWNAVVFEIVMTFGLVYTVYATAV  164



>gb|ACI95283.1| tonoplast intrinsic protein [Sinapis arvensis]
Length=251

 Score =   209 bits (532),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 126/164 (77%), Positives = 140/164 (85%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI  IA G  EE  +P  LKAALAEFIST+IFVFAG GSGMAF+KLT +GA+TP+GL+A
Sbjct  1    MPIRNIAVGRPEEATRPDALKAALAEFISTMIFVFAGSGSGMAFNKLTENGATTPAGLVA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            A++AHAF LFVAVSVGANISGGHVNPAVTFGAFVGGNIT  RG+LY IAQLLGS  AC L
Sbjct  61   ASLAHAFGLFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGILYWIAQLLGSVVACLL  120

Query  428  LEFATGGMSTGAFGLS-GVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+FATGG+   AFGLS GV V +AL+FEIVMTFGLVYTVYATAV
Sbjct  121  LKFATGGLVVPAFGLSAGVGVSNALVFEIVMTFGLVYTVYATAV  164



>ref|XP_011027129.1| PREDICTED: aquaporin TIP1-3-like [Populus euphratica]
Length=252

 Score =   209 bits (532),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 124/164 (76%), Positives = 141/164 (86%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI++IAFG+  E   P  L+AALAEFIS LIFVFAG GSGMAF+KLT++ ++TPSGL+A
Sbjct  1    MPINRIAFGTPREASHPDALRAALAEFISMLIFVFAGSGSGMAFNKLTDNASTTPSGLVA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            AA+AHAFALFVAVSVGANISGGHVNPAVTFGA +GGNIT  R +LY IAQLLGS  AC L
Sbjct  61   AALAHAFALFVAVSVGANISGGHVNPAVTFGALMGGNITLLRSILYWIAQLLGSVVACLL  120

Query  428  LEFATGGMSTGAFGL-SGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+FATGG+ T AFGL SGV  W+AL+FEIVMTFGLVYTVYATAV
Sbjct  121  LKFATGGLETPAFGLSSGVGAWNALVFEIVMTFGLVYTVYATAV  164



>gb|AAN05780.1| tonoplast intrinsic protein bobTIP26-2 [Brassica oleracea var. 
botrytis]
Length=251

 Score =   209 bits (532),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 127/164 (77%), Positives = 140/164 (85%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI  IA G  +E  +P  LKAALAEFIST+IFVFAG GSGMAF+KLT +GA+TPSGL+A
Sbjct  1    MPIRNIAVGRTDEATRPDALKAALAEFISTMIFVFAGSGSGMAFNKLTENGATTPSGLVA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            AA+AHAF LFVAVSVGANISGGHVNPAVTFGAFVGGNIT  RG+LY IAQLLGS  AC L
Sbjct  61   AALAHAFGLFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGILYWIAQLLGSVVACLL  120

Query  428  LEFATGGMSTGAFGLS-GVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+FATGG+   AFGLS GV V +AL+FEIVMTFGLVYTVYATAV
Sbjct  121  LKFATGGLVVPAFGLSAGVGVSNALVFEIVMTFGLVYTVYATAV  164



>gb|AGD98709.1| aquaporin protein 6 [Camellia sinensis]
Length=252

 Score =   209 bits (532),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 123/164 (75%), Positives = 142/164 (87%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI +IA GS  E  QP  LKAALAEFIS LIFVFAG+G+GMAFSKLT+ G++TP+GL+A
Sbjct  1    MPISRIAVGSPAEASQPDALKAALAEFISMLIFVFAGEGAGMAFSKLTDGGSTTPAGLVA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            A++AHAFALFVAVSVGANISGGHVNPAVTFGAF+GG+IT  R +LY IAQ LGS  AC L
Sbjct  61   ASLAHAFALFVAVSVGANISGGHVNPAVTFGAFLGGHITLLRSILYWIAQCLGSVVACLL  120

Query  428  LEFATGGMSTGAFGL-SGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+FATGG+ T AF L SGV+VW+AL+FEIVMTFGLVYTVYATA+
Sbjct  121  LKFATGGLETSAFSLSSGVTVWNALVFEIVMTFGLVYTVYATAL  164



>gb|KHG11211.1| Aquaporin TIP1-3 -like protein [Gossypium arboreum]
 gb|KJB55935.1| hypothetical protein B456_009G101700 [Gossypium raimondii]
Length=252

 Score =   209 bits (531),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 124/164 (76%), Positives = 143/164 (87%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI +IA GS  E  Q   LKAALAEFIS LIFVFAG+GSGMAF+KLT++G+STP+GL+A
Sbjct  1    MPISRIAVGSPAEASQSDALKAALAEFISMLIFVFAGEGSGMAFNKLTDNGSSTPAGLVA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            A++AHAFALFVAVSVGANISGGHVNPAVTFGAFVGG+IT FR +LY IAQLLGS  AC L
Sbjct  61   ASVAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGHITLFRSILYWIAQLLGSVVACLL  120

Query  428  LEFATGGMSTGAFGL-SGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+F+TGG++T AF L SGV  W+A++FEIVMTFGLVYTVYATAV
Sbjct  121  LKFSTGGLTTSAFSLSSGVGAWNAVVFEIVMTFGLVYTVYATAV  164



>emb|CAN74049.1| hypothetical protein VITISV_007330 [Vitis vinifera]
Length=251

 Score =   209 bits (531),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 124/164 (76%), Positives = 141/164 (86%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI +IA G+  E   P  LKAALAEF S LIFVFAG+GSGMAF+KLT+ G+STP+GL+A
Sbjct  1    MPIXRIAIGTPGEASHPXALKAALAEFFSMLIFVFAGEGSGMAFNKLTDSGSSTPAGLVA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            AA+AH FALFVAVSVGANISGGHVNPAVTFGAF+GG+IT  RG+LY IAQLLGS  AC L
Sbjct  61   AALAHGFALFVAVSVGANISGGHVNPAVTFGAFIGGHITLLRGILYWIAQLLGSVVACLL  120

Query  428  LEFATGGMSTGAFGL-SGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+F+TGG+ T AF L SGVSVW+AL+FEIVMTFGLVYTVYATAV
Sbjct  121  LKFSTGGLETSAFSLSSGVSVWNALVFEIVMTFGLVYTVYATAV  164



>tpg|DAA33870.1| TPA_inf: aquaporin TIP1;8 [Gossypium hirsutum]
Length=251

 Score =   209 bits (531),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 126/164 (77%), Positives = 139/164 (85%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI  I  G  EE   P  LKAALAEFISTLIFVFAG GSGMAF+KLT++GA+TP+GL+A
Sbjct  1    MPIRNIPVGRPEEATHPDALKAALAEFISTLIFVFAGSGSGMAFNKLTDNGATTPAGLVA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            AA+AH F LFVAVSVGANISGGHVNPAVTFGAFVGGNIT  RG+LY IAQLLGST AC L
Sbjct  61   AALAHGFGLFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGILYWIAQLLGSTVACLL  120

Query  428  LEFATGGMSTGAFGL-SGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+FATG ++  AFGL SGV V +AL+FEIVMTFGLVYTVYATAV
Sbjct  121  LKFATGDLAVPAFGLSSGVGVSNALVFEIVMTFGLVYTVYATAV  164



>gb|ADD59910.1| aquaporin [Chimonanthus praecox]
Length=269

 Score =   209 bits (533),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 126/164 (77%), Positives = 141/164 (86%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI +IA G  EE  QP  L+AALAEFI TLIFVFAG+GSGMAF+KLTND  +TP+GLIA
Sbjct  1    MPISRIAVGRPEEATQPDALRAALAEFICTLIFVFAGEGSGMAFNKLTNDAPNTPAGLIA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            AA+AHAFALFVAVSVGANISGGHVNPAVTFGAFVGGNI+ FRG+LY IAQLLG+T AC L
Sbjct  61   AALAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGNISLFRGILYWIAQLLGATVACLL  120

Query  428  LEFATGGMSTGAFGLS-GVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+F T GM+T AF LS G SVW+A + EIVMTFGLVYTVYATA+
Sbjct  121  LKFCTRGMTTSAFSLSAGESVWNAFVMEIVMTFGLVYTVYATAI  164



>ref|XP_009141610.1| PREDICTED: aquaporin TIP1-1 [Brassica rapa]
Length=251

 Score =   208 bits (530),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 126/164 (77%), Positives = 140/164 (85%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI  IA GS  E  +P  LKAALAEFIST+IFVFAG GSGMAF+KLT +GA+TP+GL+A
Sbjct  1    MPIRNIAVGSPNEATRPDALKAALAEFISTMIFVFAGSGSGMAFNKLTENGATTPAGLVA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            A++AHAF LFVAVSVGANISGGHVNPAVTFGAFVGGNIT  RG+LY IAQLLGS  AC L
Sbjct  61   ASLAHAFGLFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGILYWIAQLLGSVVACLL  120

Query  428  LEFATGGMSTGAFGLS-GVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+FATGG+   AFGLS GV V +AL+FEIVMTFGLVYTVYATAV
Sbjct  121  LKFATGGLVVPAFGLSAGVGVSNALVFEIVMTFGLVYTVYATAV  164



>gb|AFH36344.1| aquaporin TIP2;2 [Quercus petraea]
Length=251

 Score =   208 bits (530),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 126/164 (77%), Positives = 141/164 (86%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI  IA G   E   P  LKAALAEFISTLIFVFAG+GSGMAF+KLT++G++TP+GL+A
Sbjct  1    MPIRNIAVGRPAEATHPDALKAALAEFISTLIFVFAGEGSGMAFNKLTDNGSTTPAGLVA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            AA+AHAFALFVAVSVGANISGGHVNPAVTFGAFVGGNIT  RG+LY IAQLLGST AC L
Sbjct  61   AALAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGILYWIAQLLGSTVACLL  120

Query  428  LEFATGGMSTGAFGL-SGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+FAT GM+T AF L SGV VW+A + EIVMTFGLVYTVYATA+
Sbjct  121  LKFATNGMTTSAFSLSSGVGVWNAFVLEIVMTFGLVYTVYATAI  164



>ref|XP_004497305.1| PREDICTED: aquaporin TIP1-3-like [Cicer arietinum]
Length=252

 Score =   208 bits (530),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 121/164 (74%), Positives = 137/164 (84%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            M I++IA GS  E   P  ++AA AEF S LIFVFAGQGSGMA+SKLTN+GA+TP GLI 
Sbjct  1    MAIYRIAIGSPREASNPAAIRAAFAEFFSMLIFVFAGQGSGMAYSKLTNNGAATPEGLIV  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            A+++HAF LFVAVSVGANISGGHVNPAVTFGAF+GGNITF R +LY IAQLLGS AAC +
Sbjct  61   ASLSHAFGLFVAVSVGANISGGHVNPAVTFGAFIGGNITFLRSILYWIAQLLGSVAACII  120

Query  428  LEFATGGMSTGAFGL-SGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L   TGGM T AF L SGVSVW+AL+FEIVMTFGLVYTVYATA+
Sbjct  121  LNSCTGGMETSAFSLSSGVSVWNALVFEIVMTFGLVYTVYATAI  164



>ref|XP_009337569.1| PREDICTED: aquaporin TIP1-3 [Pyrus x bretschneideri]
Length=252

 Score =   208 bits (530),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 122/164 (74%), Positives = 141/164 (86%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI++IA G+  E   P  ++AALAEF S LIFVFAG+GSGMAF+KLT++ ++TPSGL+A
Sbjct  1    MPINRIAVGTPGEASHPDAIRAALAEFFSMLIFVFAGEGSGMAFNKLTDNASTTPSGLVA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            A++AHAFALFVAVSVGANISGGHVNPAVTFGAF+GGNIT  RG+LY IAQLLGS  AC L
Sbjct  61   ASLAHAFALFVAVSVGANISGGHVNPAVTFGAFIGGNITLLRGILYWIAQLLGSVVACLL  120

Query  428  LEFATGGMSTGAFGL-SGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+FATGG  T  F L SGVSVW+AL+FEIVMTFGLVYTVYATAV
Sbjct  121  LKFATGGWETAGFSLSSGVSVWNALVFEIVMTFGLVYTVYATAV  164



>ref|XP_006436063.1| hypothetical protein CICLE_v10032534mg [Citrus clementina]
 ref|XP_006486051.1| PREDICTED: aquaporin TIP1-3-like [Citrus sinensis]
 gb|ESR49303.1| hypothetical protein CICLE_v10032534mg [Citrus clementina]
 gb|KDO67730.1| hypothetical protein CISIN_1g025464mg [Citrus sinensis]
Length=252

 Score =   208 bits (530),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 124/164 (76%), Positives = 141/164 (86%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI++IA G+  E   P  LKAALAEF S +IFVFAGQGSGMAFSKLT+ GASTP+GLI+
Sbjct  1    MPIYRIAIGTPGEASHPDALKAALAEFFSMIIFVFAGQGSGMAFSKLTDGGASTPAGLIS  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            A++AHAFALFVAVSVGANISGGHVNPAVTFGAFVGG+IT  R +LY IAQLLGS  AC L
Sbjct  61   ASLAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGHITLLRSILYWIAQLLGSVVACLL  120

Query  428  LEFATGGMSTGAFGL-SGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+F+TGG+ T AF L SGVS W+A++FEIVMTFGLVYTVYATAV
Sbjct  121  LKFSTGGLETSAFALSSGVSSWNAVVFEIVMTFGLVYTVYATAV  164



>ref|XP_010031004.1| PREDICTED: aquaporin TIP1-3-like [Eucalyptus grandis]
 gb|KCW50265.1| hypothetical protein EUGRSUZ_J00051 [Eucalyptus grandis]
Length=252

 Score =   208 bits (529),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 122/164 (74%), Positives = 142/164 (87%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            M I++IA G+  E  +P  ++AALAEF S LIFVFAG+GSGMAF+KLT+DG++TP+GL+A
Sbjct  1    MAIYKIAIGTPGEASRPDAIRAALAEFFSMLIFVFAGEGSGMAFNKLTDDGSTTPAGLVA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            AA+AHAF LFVAVSVGANISGGHVNPAVTFGAF+GGNIT  RG+LY IAQLLGS  AC L
Sbjct  61   AALAHAFGLFVAVSVGANISGGHVNPAVTFGAFLGGNITLLRGILYWIAQLLGSVVACLL  120

Query  428  LEFATGGMSTGAFGL-SGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+FATGG+ T AF L S VSVW+AL+FEIVMTFGLVYTVYATAV
Sbjct  121  LKFATGGLETSAFSLSSDVSVWNALVFEIVMTFGLVYTVYATAV  164



>ref|XP_010043596.1| PREDICTED: aquaporin TIP1-3-like [Eucalyptus grandis]
 ref|XP_010042712.1| PREDICTED: aquaporin TIP1-3-like [Eucalyptus grandis]
 gb|KCW85618.1| hypothetical protein EUGRSUZ_B02403 [Eucalyptus grandis]
Length=252

 Score =   208 bits (529),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 124/164 (76%), Positives = 142/164 (87%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI +IA GS  E+ Q   LKA LAEFIS LIFVFAG+GSGMAF+KLT+DG++TP+GL+A
Sbjct  1    MPISRIAIGSPAEIGQVDALKAGLAEFISMLIFVFAGEGSGMAFNKLTDDGSTTPAGLVA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            A++AHAFALFVAVSVGANISGGHVNPAVTFGAFVGG+IT  R VLY +AQLLGS  AC L
Sbjct  61   ASLAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGHITLSRSVLYWVAQLLGSVVACLL  120

Query  428  LEFATGGMSTGAFGL-SGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+F+TGGM T AF L S V+VW+AL+FEIVMTFGLVYTVYATAV
Sbjct  121  LKFSTGGMETSAFSLSSDVTVWNALVFEIVMTFGLVYTVYATAV  164



>gb|ACB71282.1| tonoplast intrinsic protein [Tamarix hispida]
Length=252

 Score =   208 bits (529),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 120/164 (73%), Positives = 140/164 (85%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI  IA GS  + R P  L+AALAEFIS LIFVFAG+GSGMAF+KLT+DG++TP+GL+A
Sbjct  1    MPIRNIAVGSPADARHPDALRAALAEFISVLIFVFAGEGSGMAFNKLTDDGSATPAGLVA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            AA+AH FALFVAVSVGANISGGHVNPAVTFGAF+GG+I+  R +LY IAQ LGS  AC L
Sbjct  61   AALAHGFALFVAVSVGANISGGHVNPAVTFGAFIGGHISLLRSILYWIAQCLGSVVACLL  120

Query  428  LEFATGGMSTGAFGL-SGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+FATGG++T AF L S V+VW+AL+ EIVMTFGLVYTVYATAV
Sbjct  121  LKFATGGLTTSAFALSSDVTVWNALVLEIVMTFGLVYTVYATAV  164



>gb|AFQ23566.1| aquaporin TIP1 [Hedychium coronarium]
Length=249

 Score =   208 bits (529),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 123/164 (75%), Positives = 140/164 (85%), Gaps = 2/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI +IA G+ EE+  P  LKAA+AEFISTLIFVFAGQGSG+AF+KLT+DGA+TP+GL+A
Sbjct  1    MPISRIAIGTTEEVTHPTTLKAAVAEFISTLIFVFAGQGSGIAFNKLTSDGATTPAGLVA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            A+IAH F LFVAV+VGANISGGHVNPAVTFG FVGGNIT FR + Y IAQLLGST AC L
Sbjct  61   ASIAHGFGLFVAVAVGANISGGHVNPAVTFGVFVGGNITLFRAIWYWIAQLLGSTVACLL  120

Query  428  LEFATGGMSTGAFGLS-GVSVWSALIFEIVMTFGLVYTVYATAV  556
            L F T G++TG FGLS GV VW A++ EIVMTFGLVYTVYATAV
Sbjct  121  LRFTT-GLATGTFGLSTGVGVWQAVVLEIVMTFGLVYTVYATAV  163



>gb|KDP44188.1| hypothetical protein JCGZ_05655 [Jatropha curcas]
Length=252

 Score =   208 bits (529),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 124/164 (76%), Positives = 141/164 (86%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI  IA GS  E+ Q   LKAALAEFISTLIFVFAG+GSGMAF+KLT+DG++TP+GL+A
Sbjct  1    MPITSIAIGSPAEVGQADALKAALAEFISTLIFVFAGEGSGMAFNKLTSDGSTTPAGLVA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            A++AH FALFVAVSVGANISGGHVNPAVTFGAFVGG+IT  R +LY + QLLGS  AC L
Sbjct  61   ASLAHGFALFVAVSVGANISGGHVNPAVTFGAFVGGHITLMRSILYWVGQLLGSVVACLL  120

Query  428  LEFATGGMSTGAFGL-SGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+FATGG+ T AF L SGVS W+AL+FEIVMTFGLVYTVYATAV
Sbjct  121  LKFATGGLETSAFALSSGVSSWNALVFEIVMTFGLVYTVYATAV  164



>gb|AAB51393.2| tonoplast intrinsic protein bobTIP26-1 [Brassica oleracea var. 
botrytis]
Length=251

 Score =   208 bits (529),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 125/164 (76%), Positives = 140/164 (85%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI  IA G  +E  +P  LKAALAEFIST+IFVFAG GSGMAF+KLT +GA+TP+GL+A
Sbjct  1    MPIRNIAVGRPDEATRPDALKAALAEFISTMIFVFAGSGSGMAFNKLTENGATTPAGLVA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            A++AHAF LFVAVSVGANISGGHVNPAVTFGAFVGGNIT  RG+LY IAQLLGS  AC L
Sbjct  61   ASLAHAFGLFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGILYWIAQLLGSVVACLL  120

Query  428  LEFATGGMSTGAFGLS-GVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+FATGG+   AFGLS GV V +AL+FEIVMTFGLVYTVYATAV
Sbjct  121  LKFATGGLVVPAFGLSAGVGVSNALVFEIVMTFGLVYTVYATAV  164



>ref|XP_010098813.1| Aquaporin TIP1-1 [Morus notabilis]
 gb|EXB75901.1| Aquaporin TIP1-1 [Morus notabilis]
Length=251

 Score =   207 bits (528),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 126/164 (77%), Positives = 140/164 (85%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI  IA G  EE   P  LKAALAEFISTLIFVFAG GSG+AF+KLT++GA+TPSGLI+
Sbjct  1    MPIRNIAIGGREEATHPDALKAALAEFISTLIFVFAGSGSGIAFNKLTDNGATTPSGLIS  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            AAIAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGNIT  RG+LY IAQLLGST A  L
Sbjct  61   AAIAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGILYWIAQLLGSTVAALL  120

Query  428  LEFATGGMSTGAFGLS-GVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+F TGG++   F LS GV VW+A++FEIV+TFGLVYTVYATAV
Sbjct  121  LKFVTGGLAVPTFNLSAGVGVWNAVVFEIVITFGLVYTVYATAV  164



>dbj|BAM44345.1| vacuolar aluminum transporter [Hydrangea macrophylla]
Length=252

 Score =   207 bits (528),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 124/164 (76%), Positives = 141/164 (86%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI++IA G+  E   P  L+AALAEF S LIFVFAG+GSGMAF+K+TN+ ++TPSGLIA
Sbjct  1    MPIYKIAIGTPGEASNPDALRAALAEFFSMLIFVFAGEGSGMAFNKITNNSSTTPSGLIA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            AA+AHAFALFVAVSVGANISGGHVNPAVTFGAF+GGNITF R +LY IAQLLGS  AC L
Sbjct  61   AALAHAFALFVAVSVGANISGGHVNPAVTFGAFLGGNITFLRSILYWIAQLLGSVVACLL  120

Query  428  LEFATGGMSTGAFGL-SGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+FATGG+ T AF L S VSVW+AL+FEIVMTFGLVYTVYA AV
Sbjct  121  LKFATGGLETSAFALSSNVSVWNALVFEIVMTFGLVYTVYALAV  164



>ref|XP_011018806.1| PREDICTED: aquaporin TIP1-1 [Populus euphratica]
Length=252

 Score =   207 bits (527),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 127/164 (77%), Positives = 141/164 (86%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI  IA G + E  +P  L+AALAEFISTLIFVFAG+GSGMAF+KLT+  A+TP+GLIA
Sbjct  1    MPIRNIAVGHYHEATRPDALRAALAEFISTLIFVFAGEGSGMAFAKLTDGAANTPAGLIA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            AAIAHAFALFVAVSVGANISGGHVNPAVTFGAF+GGNIT  RG+LY IAQLLGST AC L
Sbjct  61   AAIAHAFALFVAVSVGANISGGHVNPAVTFGAFIGGNITLLRGILYWIAQLLGSTVACLL  120

Query  428  LEFATGGMSTGAFGL-SGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+F TGG+ T AF L SGVSVW+A + EIVMTFGLVYTVYATAV
Sbjct  121  LKFTTGGLETSAFALSSGVSVWNAFVLEIVMTFGLVYTVYATAV  164



>emb|CDY53270.1| BnaCnng24720D [Brassica napus]
Length=251

 Score =   207 bits (527),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 126/164 (77%), Positives = 139/164 (85%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI  IA G  +E  +P  LKAALAEFIST+IFVFAG GSGMAF+KLT +G +TPSGL+A
Sbjct  1    MPIRNIAVGRADEATRPDALKAALAEFISTMIFVFAGSGSGMAFNKLTENGGTTPSGLVA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            AA+AHAF LFVAVSVGANISGGHVNPAVTFGAFVGGNIT  RG+LY IAQLLGS  AC L
Sbjct  61   AALAHAFGLFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGILYWIAQLLGSVVACLL  120

Query  428  LEFATGGMSTGAFGLS-GVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+FATGG+   AFGLS GV V +AL+FEIVMTFGLVYTVYATAV
Sbjct  121  LKFATGGLVVPAFGLSAGVGVSNALVFEIVMTFGLVYTVYATAV  164



>gb|ADU25490.1| tonoplastic intrinsic protein [Helianthemum almeriense]
Length=252

 Score =   207 bits (527),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 123/164 (75%), Positives = 139/164 (85%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI  IA G   E   P  LKAALAEFISTLIFVFAG+GSGMAF+KLT++G++TP+GL+A
Sbjct  1    MPIRNIAVGGPSEATHPDALKAALAEFISTLIFVFAGEGSGMAFNKLTDNGSTTPAGLVA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            AA+AHAF LFVAVSVGANISGGHVNPAVTFGAF+GGNIT  RG+LY IAQLLGST AC L
Sbjct  61   AALAHAFGLFVAVSVGANISGGHVNPAVTFGAFLGGNITLLRGILYWIAQLLGSTVACLL  120

Query  428  LEFATGGMSTGAFGL-SGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+FAT G +T AF L SGV VW+A + EIVMTFGLVYTVYATA+
Sbjct  121  LKFATNGQTTSAFALSSGVGVWNAFVLEIVMTFGLVYTVYATAL  164



>emb|CAB61841.1| putative gamma tonoplast intrinsic protein (TIP) [Sporobolus 
stapfianus]
Length=250

 Score =   207 bits (527),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 122/163 (75%), Positives = 139/163 (85%), Gaps = 1/163 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MP+  IA G+ +E+  PG LKAALAEFISTLIFVFAGQGSG+A+SKL+  G +TPS LI+
Sbjct  1    MPMRNIAVGNTQEVTHPGALKAALAEFISTLIFVFAGQGSGVAYSKLSG-GITTPSSLIS  59

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            AA+AHAFALFVAVSV ANISGGHVNPAVTFGAF+GGNI+ FR +LY IAQLLGS  AC L
Sbjct  60   AAVAHAFALFVAVSVSANISGGHVNPAVTFGAFLGGNISLFRSILYWIAQLLGSIVACLL  119

Query  428  LEFATGGMSTGAFGLSGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L F TGG+ TG FGL+G+SVW AL+ EIVMTFGLVYTVYATAV
Sbjct  120  LRFVTGGLPTGTFGLTGISVWEALVLEIVMTFGLVYTVYATAV  162



>ref|XP_006428460.1| hypothetical protein CICLE_v10012553mg [Citrus clementina]
 ref|XP_006493539.1| PREDICTED: aquaporin TIP1-1-like [Citrus sinensis]
 gb|ESR41700.1| hypothetical protein CICLE_v10012553mg [Citrus clementina]
 gb|KDO40803.1| hypothetical protein CISIN_1g025548mg [Citrus sinensis]
Length=251

 Score =   207 bits (527),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 122/164 (74%), Positives = 140/164 (85%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI  IA G   E   P  L+AALAEFISTLIFVFAG+GSGMAF+KLT++GA+TPSGL+A
Sbjct  1    MPIRNIAVGHPREATHPDALRAALAEFISTLIFVFAGEGSGMAFNKLTHNGANTPSGLVA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            A++AHAFALFVAV+VGANISGGHVNPAVTFGAFVGGNI+  RG+LY IAQLLGST AC L
Sbjct  61   ASVAHAFALFVAVAVGANISGGHVNPAVTFGAFVGGNISLLRGILYWIAQLLGSTVACLL  120

Query  428  LEFATGGMSTGAFGL-SGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+F T G +T AF L SGV  W+A++FEIVMTFGLVYTVYATA+
Sbjct  121  LKFVTNGQTTSAFALSSGVGAWNAVVFEIVMTFGLVYTVYATAL  164



>ref|NP_001267926.1| aquaporin-like [Vitis vinifera]
 gb|ABH09330.1| putative aquaporin [Vitis vinifera]
Length=251

 Score =   207 bits (527),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 121/164 (74%), Positives = 140/164 (85%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MP   IA G  EE  +P  LKAA AEFI TLIFVFAG+GSGMAF+KLT++G++TP+GL+A
Sbjct  1    MPTRNIAIGRPEEATRPDALKAAFAEFICTLIFVFAGEGSGMAFNKLTDNGSTTPAGLVA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            A++AHAFALFVAVSVGAN SGGHVNPAVT GAFVGGNIT  RG+LY IAQLLGST AC L
Sbjct  61   ASLAHAFALFVAVSVGANTSGGHVNPAVTSGAFVGGNITLLRGILYWIAQLLGSTVACLL  120

Query  428  LEFATGGMSTGAFGL-SGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+F+T GM+T AF L SGV+VW+A +FEIVMTFGLVYTVYATA+
Sbjct  121  LKFSTNGMTTSAFSLSSGVTVWNAFVFEIVMTFGLVYTVYATAI  164



>emb|CDP07030.1| unnamed protein product [Coffea canephora]
 emb|CDX10340.1| aquaporin [Coffea arabica]
Length=257

 Score =   207 bits (527),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 116/164 (71%), Positives = 135/164 (82%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            +P  +IAFG+ EE+RQPG +KAALAE ISTLIFVFAG+GSGMA+SKLT    STP+GLI+
Sbjct  7    VPFRRIAFGNREEIRQPGAIKAALAELISTLIFVFAGEGSGMAYSKLTGGAPSTPAGLIS  66

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            AA+A+   LFV VSV ANISGGHVNPAVT GAF+GGNIT FRG+LY+I QL+GS  AC L
Sbjct  67   AALAYGLGLFVGVSVSANISGGHVNPAVTIGAFLGGNITLFRGILYIIGQLVGSIIACLL  126

Query  428  LEFATGGMSTGAFGLS-GVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+ +TGGM T A  L+ GVSVW A I EIVMTFGLVYTVYATA+
Sbjct  127  LKVSTGGMKTSALSLAHGVSVWDAFILEIVMTFGLVYTVYATAI  170



>ref|NP_001238026.1| nodulin-26 [Glycine max]
 gb|AAA02947.1| nodulin-26 [Glycine max]
Length=255

 Score =   207 bits (527),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 123/164 (75%), Positives = 142/164 (87%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI +IA G+  EL Q   LKAALAEFIS LIFVFAG+GSGMA++KLTN+G++TP+GL+A
Sbjct  1    MPISRIAIGNSSELNQSDALKAALAEFISMLIFVFAGEGSGMAYNKLTNNGSATPAGLVA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            A+++HAFALFVAVSVGANISGGHVNPAVTFGAFVGG+IT FR +LY IAQLLGS  AC L
Sbjct  61   ASLSHAFALFVAVSVGANISGGHVNPAVTFGAFVGGHITLFRSILYWIAQLLGSVVACLL  120

Query  428  LEFATGGMSTGAFGLS-GVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+FATGG+ T AF LS GV   +AL+FEIVMTFGLVYTVYATAV
Sbjct  121  LKFATGGLETSAFALSPGVEAGNALVFEIVMTFGLVYTVYATAV  164



>gb|KDP43963.1| hypothetical protein JCGZ_05430 [Jatropha curcas]
Length=254

 Score =   207 bits (527),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 118/161 (73%), Positives = 140/161 (87%), Gaps = 2/161 (1%)
 Frame = +2

Query  80   QIAFG-SHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGliaaai  256
            +IA G  HE++  PG +KAALAEFIST IFVFAG+GSGMAF+KLT+DG+STP+G+I A++
Sbjct  7    RIAVGLPHEDITHPGAIKAALAEFISTAIFVFAGEGSGMAFNKLTDDGSSTPAGIIMASL  66

Query  257  ahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFLLEF  436
            AHAF LF+ V+  ANISGGHVNPAVTFGAFVGGNIT  RG+LY IAQLLGST AC LL+F
Sbjct  67   AHAFGLFIGVATAANISGGHVNPAVTFGAFVGGNITLLRGILYWIAQLLGSTVACLLLKF  126

Query  437  ATGGMSTGAFGL-SGVSVWSALIFEIVMTFGLVYTVYATAV  556
            +T GM+T AF L SGV+VW+AL+FEIVMTFGLVYTVYATA+
Sbjct  127  STHGMTTSAFALSSGVNVWNALVFEIVMTFGLVYTVYATAI  167



>gb|KHN30200.1| Aquaporin TIP1-3 [Glycine soja]
Length=252

 Score =   207 bits (526),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 123/164 (75%), Positives = 142/164 (87%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI +IA G+  EL Q   LKAALAEFIS LIFVFAG+GSGMA++KLTN+G++TP+GL+A
Sbjct  1    MPISRIAIGNSSELNQSDALKAALAEFISMLIFVFAGEGSGMAYNKLTNNGSATPAGLVA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            A+++HAFALFVAVSVGANISGGHVNPAVTFGAFVGG+IT FR +LY IAQLLGS  AC L
Sbjct  61   ASLSHAFALFVAVSVGANISGGHVNPAVTFGAFVGGHITLFRSILYWIAQLLGSVVACLL  120

Query  428  LEFATGGMSTGAFGLS-GVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+FATGG+ T AF LS GV   +AL+FEIVMTFGLVYTVYATAV
Sbjct  121  LKFATGGLETSAFALSPGVEAGNALVFEIVMTFGLVYTVYATAV  164



>ref|XP_006381378.1| gamma-tonoplast intrinsic protein 2 [Populus trichocarpa]
 gb|ABK93036.1| unknown [Populus trichocarpa]
 gb|ABK93934.1| unknown [Populus trichocarpa]
 gb|ERP59175.1| gamma-tonoplast intrinsic protein 2 [Populus trichocarpa]
Length=252

 Score =   207 bits (526),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 127/164 (77%), Positives = 140/164 (85%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI  IA G + E  QP  L+AALAEFISTLIFVFAG+GSGMAF+KLT+  A+TP+GLIA
Sbjct  1    MPIRNIAVGHYHEATQPDALRAALAEFISTLIFVFAGEGSGMAFAKLTDGAANTPAGLIA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            AAIAHAFALFVAVSVGANISGGHVNPAVTFGAF+GGNIT  RG+LY IAQLLGST AC L
Sbjct  61   AAIAHAFALFVAVSVGANISGGHVNPAVTFGAFIGGNITLLRGILYWIAQLLGSTVACLL  120

Query  428  LEFATGGMSTGAFGL-SGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+F TGG+ T AF L SGV VW+A + EIVMTFGLVYTVYATAV
Sbjct  121  LKFTTGGLETSAFALSSGVGVWNAFVLEIVMTFGLVYTVYATAV  164



>gb|ABR68795.1| aquaporin gamma-TIP [Gossypium hirsutum]
Length=252

 Score =   206 bits (525),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 125/164 (76%), Positives = 142/164 (87%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI +IA GS  E  Q   LKAALAEFIS LIFVFAG+GSGMAF+KLT+DG+STP+GL+A
Sbjct  1    MPISRIAVGSPAEAGQADALKAALAEFISVLIFVFAGEGSGMAFNKLTDDGSSTPAGLVA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            AA+AHA ALFVAVS+GANISGGHVNPAVTFGAFVGG+IT  R +LY IAQLLGS  ACFL
Sbjct  61   AALAHALALFVAVSIGANISGGHVNPAVTFGAFVGGHITLVRSILYWIAQLLGSVVACFL  120

Query  428  LEFATGGMSTGAFGL-SGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+F+TGGM+T AF L SGV  W+A++FEIVMTFGLVYTVYATAV
Sbjct  121  LKFSTGGMTTSAFSLSSGVGAWNAVVFEIVMTFGLVYTVYATAV  164



>gb|ABK96489.1| unknown [Populus trichocarpa x Populus deltoides]
Length=252

 Score =   206 bits (525),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 127/164 (77%), Positives = 140/164 (85%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI  IA G + E  QP  L+AALAEFISTLIFVFAG+GSGMAF+KLT+  A+TP+GLIA
Sbjct  1    MPIRNIAVGHYHEATQPDALRAALAEFISTLIFVFAGEGSGMAFAKLTDGAANTPAGLIA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            AAIAHAFALFVAVSVGANISGGHVNPAVTFGAF+GGNIT  RG+LY IAQLLGST AC L
Sbjct  61   AAIAHAFALFVAVSVGANISGGHVNPAVTFGAFIGGNITLLRGILYWIAQLLGSTVACLL  120

Query  428  LEFATGGMSTGAFGL-SGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+F TGG+ T AF L SGV VW+A + EIVMTFGLVYTVYATAV
Sbjct  121  LKFTTGGLETSAFALSSGVGVWNAFVLEIVMTFGLVYTVYATAV  164



>tpg|DAA33869.1| TPA_inf: aquaporin TIP1;6 [Gossypium hirsutum]
Length=284

 Score =   207 bits (528),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 122/161 (76%), Positives = 137/161 (85%), Gaps = 1/161 (1%)
 Frame = +2

Query  77   HQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGliaaai  256
              IA G  EE  QP  LKAALAEFISTLIFVFAG GSGMAF+KLT++GA+TP+GL+AA+I
Sbjct  4    RNIAVGRPEEATQPDALKAALAEFISTLIFVFAGSGSGMAFNKLTDNGATTPAGLVAASI  63

Query  257  ahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFLLEF  436
            AH   LFVAVSVGANISGGHVNPAVTFGAFVGGNI+  RG+LY IAQLLGST AC LL+F
Sbjct  64   AHGLGLFVAVSVGANISGGHVNPAVTFGAFVGGNISLLRGILYWIAQLLGSTVACLLLKF  123

Query  437  ATGGMSTGAFGL-SGVSVWSALIFEIVMTFGLVYTVYATAV  556
            AT  M+  AFGL SGV VW+A++FEIVMTFGLVYTVYATA+
Sbjct  124  ATSDMTVPAFGLSSGVGVWNAVVFEIVMTFGLVYTVYATAI  164



>ref|XP_006410854.1| hypothetical protein EUTSA_v10017134mg [Eutrema salsugineum]
 gb|ESQ52307.1| hypothetical protein EUTSA_v10017134mg [Eutrema salsugineum]
Length=251

 Score =   206 bits (524),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 125/164 (76%), Positives = 138/164 (84%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI  IA G  EE  +P  LKAALAEFIST+IFVFAG GSGMAF+KLT +GA+TPSGL+A
Sbjct  1    MPIRNIAVGRPEEATKPDALKAALAEFISTMIFVFAGSGSGMAFNKLTENGATTPSGLVA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            AA+AHAF LFVAVSVGANISGGHVNPAVTFGAFVGGNIT  RG+LY IAQL GS  AC L
Sbjct  61   AALAHAFGLFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGILYWIAQLAGSVVACLL  120

Query  428  LEFATGGMSTGAFGLS-GVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+FATGG+   AFGLS GV V +A +FEIVMTFGLVYTVYATA+
Sbjct  121  LKFATGGLVVPAFGLSAGVGVLNAFVFEIVMTFGLVYTVYATAI  164



>ref|XP_009799741.1| PREDICTED: aquaporin TIP1-1 [Nicotiana sylvestris]
 ref|XP_009765894.1| PREDICTED: aquaporin TIP1-1 [Nicotiana sylvestris]
Length=248

 Score =   206 bits (524),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 129/164 (79%), Positives = 138/164 (84%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI +IA G  EE   P  LKAALAEFISTLIFVFAG GSG+AFSKLT  GA+TP+GLIA
Sbjct  1    MPISRIAIGRPEEATHPDALKAALAEFISTLIFVFAGSGSGVAFSKLTGGGANTPAGLIA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            AAIAHAF LFVAVSVGANISGGHVNPAVTFGAFVGGNIT  RG+LY IAQLLGS  ACFL
Sbjct  61   AAIAHAFGLFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGILYWIAQLLGSVVACFL  120

Query  428  LEFATGGMSTGAFGLS-GVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+F TGG+  G FGLS GV V +AL+ EIVMTFGLVYTVYATAV
Sbjct  121  LKFTTGGLEIGTFGLSDGVGVGNALVLEIVMTFGLVYTVYATAV  164



>ref|XP_002284411.1| PREDICTED: aquaporin TIP1-1 [Vitis vinifera]
 emb|CBI16192.3| unnamed protein product [Vitis vinifera]
Length=252

 Score =   206 bits (524),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 125/164 (76%), Positives = 142/164 (87%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI +IA GS  E  Q   LKAALAEFIS LIFVFAG+GSGMAF+KLT+DG+STP+GL+A
Sbjct  1    MPIPRIALGSPAEAGQADALKAALAEFISVLIFVFAGEGSGMAFNKLTDDGSSTPAGLVA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            AA+AHAFALFVAVS+ ANISGGHVNPAVTFGA VGG+IT FR +LY IAQLLGS  AC L
Sbjct  61   AAVAHAFALFVAVSIAANISGGHVNPAVTFGALVGGHITLFRSLLYWIAQLLGSVVACLL  120

Query  428  LEFATGGMSTGAFGL-SGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+FATGG++T AF L SGVS W+AL+FEIVMTFGLVYTVYATA+
Sbjct  121  LKFATGGLTTSAFSLSSGVSAWNALVFEIVMTFGLVYTVYATAI  164



>gb|KEH21895.1| tonoplast intrinsic protein [Medicago truncatula]
Length=252

 Score =   206 bits (524),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 122/164 (74%), Positives = 138/164 (84%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            M IH+IA GS  E  QP  ++AA AEF S LIFVFAGQGSGMA+SKLTN+G +TP+GLIA
Sbjct  1    MAIHRIAIGSPGEAGQPDAIRAAFAEFFSMLIFVFAGQGSGMAYSKLTNNGPATPAGLIA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            A+++HAF LFVAVSVGANISGGHVNPAVTFGAF+GGNIT  R +LY IAQLLGS  AC L
Sbjct  61   ASLSHAFGLFVAVSVGANISGGHVNPAVTFGAFIGGNITLLRSILYWIAQLLGSVVACIL  120

Query  428  LEFATGGMSTGAFGL-SGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+ ATGGM T AF L S +SVW+AL+FEIVMTFGLVYTVYATAV
Sbjct  121  LKSATGGMETSAFALSSDISVWNALLFEIVMTFGLVYTVYATAV  164



>ref|XP_010505228.1| PREDICTED: aquaporin TIP1-1 [Camelina sativa]
 ref|XP_010509432.1| PREDICTED: aquaporin TIP1-1 [Camelina sativa]
 ref|XP_010516909.1| PREDICTED: aquaporin TIP1-1 [Camelina sativa]
Length=251

 Score =   206 bits (524),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 124/164 (76%), Positives = 139/164 (85%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI  IA G  +E  +P  LKAALAEFISTLIFV AG GSGMAF+KLT +GA+TPSGL+A
Sbjct  1    MPIRNIAVGRPDEATRPDALKAALAEFISTLIFVVAGSGSGMAFNKLTENGATTPSGLVA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            AA+AHAF LFVAVSVGANISGGHVNPAVTFGAFVGGNIT  RG+LY IAQLLGS  AC +
Sbjct  61   AALAHAFGLFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGILYWIAQLLGSVVACLI  120

Query  428  LEFATGGMSTGAFGLS-GVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+FATGG++  AFGLS GV V +A +FEIVMTFGLVYTVYATA+
Sbjct  121  LKFATGGLAVPAFGLSAGVGVLNAFVFEIVMTFGLVYTVYATAI  164



>ref|XP_004249473.1| PREDICTED: aquaporin TIP1-1 [Solanum lycopersicum]
Length=248

 Score =   206 bits (524),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 129/164 (79%), Positives = 137/164 (84%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI +IA G  EE   P  LKAALAEFISTLIFVFAG GSG+AFSKLT  GA+TP+GLIA
Sbjct  1    MPISRIAIGRREEATHPDALKAALAEFISTLIFVFAGSGSGVAFSKLTGGGANTPTGLIA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            AAIAHAF LFVAVSVGANISGGHVNPAVTFGAFVGGNIT  RG+LY IAQLLGS  AC L
Sbjct  61   AAIAHAFGLFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGILYWIAQLLGSVVACLL  120

Query  428  LEFATGGMSTGAFGLS-GVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+F TGGM  GAF LS GV V +AL+ EIVMTFGLVYTVYATAV
Sbjct  121  LKFTTGGMEIGAFSLSNGVGVGNALVLEIVMTFGLVYTVYATAV  164



>ref|XP_009617954.1| PREDICTED: aquaporin TIP1-1 [Nicotiana tomentosiformis]
Length=248

 Score =   206 bits (523),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 129/164 (79%), Positives = 138/164 (84%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI +IA G  EE   P  LKAALAEFISTLIFVFAG GSG+AFSKLT  GA+TP+GLIA
Sbjct  1    MPISRIAIGRPEEATHPDALKAALAEFISTLIFVFAGSGSGVAFSKLTGGGANTPAGLIA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            AAIAHAF LFVAVSVGANISGGHVNPAVTFGAFVGGNIT  RG+LY IAQLLGS  AC L
Sbjct  61   AAIAHAFGLFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGILYWIAQLLGSVVACLL  120

Query  428  LEFATGGMSTGAFGLS-GVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+F TGG+  GAFGLS GV V +AL+ EIVMTFGLVYTVYATAV
Sbjct  121  LKFTTGGLEIGAFGLSDGVGVGNALVLEIVMTFGLVYTVYATAV  164



>ref|NP_181221.1| aquaporin TIP1-1 [Arabidopsis thaliana]
 sp|P25818.1|TIP11_ARATH RecName: Full=Aquaporin TIP1-1; AltName: Full=Aquaporin TIP; 
AltName: Full=Gamma-tonoplast intrinsic protein; Short=Gamma-TIP; 
AltName: Full=Tonoplast intrinsic protein 1-1; Short=AtTIP1;1; 
AltName: Full=Tonoplast intrinsic protein, root-specific 
RB7; Contains: RecName: Full=Aquaporin TIP1-1, N-terminally 
processed [Arabidopsis thaliana]
 gb|AAK43987.1|AF370172_1 putative tonoplast intrinsic protein gamma, aquaporin [Arabidopsis 
thaliana]
 emb|CAA45115.1| tonoplast intrinsic protein, gamma-TIP(Ara) [Arabidopsis thaliana]
 gb|AAA32806.1| tonoplast intrinsic protein [Arabidopsis thaliana]
 gb|AAD31569.1| putative aquaporin (tonoplast intrinsic protein gamma) [Arabidopsis 
thaliana]
 gb|AAL15240.1| putative aquaporin [Arabidopsis thaliana]
 gb|AEC09303.1| aquaporin TIP1-1 [Arabidopsis thaliana]
 prf||1908432B tonoplast intrinsic protein gamma
Length=251

 Score =   206 bits (524),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 123/164 (75%), Positives = 139/164 (85%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI  IA G  +E  +P  LKAALAEFISTLIFV AG GSGMAF+KLT +GA+TPSGL+A
Sbjct  1    MPIRNIAIGRPDEATRPDALKAALAEFISTLIFVVAGSGSGMAFNKLTENGATTPSGLVA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            AA+AHAF LFVAVSVGANISGGHVNPAVTFGAF+GGNIT  RG+LY IAQLLGS  AC +
Sbjct  61   AAVAHAFGLFVAVSVGANISGGHVNPAVTFGAFIGGNITLLRGILYWIAQLLGSVVACLI  120

Query  428  LEFATGGMSTGAFGLS-GVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+FATGG++  AFGLS GV V +A +FEIVMTFGLVYTVYATA+
Sbjct  121  LKFATGGLAVPAFGLSAGVGVLNAFVFEIVMTFGLVYTVYATAI  164



>ref|XP_006294859.1| hypothetical protein CARUB_v10023912mg [Capsella rubella]
 gb|EOA27757.1| hypothetical protein CARUB_v10023912mg [Capsella rubella]
Length=251

 Score =   206 bits (523),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 124/164 (76%), Positives = 139/164 (85%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI  IA G  +E  +P  LKAALAEFISTLIFV AG GSGMAF+KLT +GA+TPSGL+A
Sbjct  1    MPIRNIAVGRPDEATRPDALKAALAEFISTLIFVVAGSGSGMAFNKLTENGATTPSGLVA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            AA+AHAF LFVAVSVGANISGGHVNPAVTFGAFVGGNIT  RG+LY IAQLLGS  AC +
Sbjct  61   AALAHAFGLFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGILYWIAQLLGSVVACLI  120

Query  428  LEFATGGMSTGAFGLS-GVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+FATGG++  AFGLS GV V +A +FEIVMTFGLVYTVYATA+
Sbjct  121  LKFATGGLAVPAFGLSAGVGVLNAFVFEIVMTFGLVYTVYATAI  164



>gb|AAM65100.1| putative aquaporin (tonoplast intrinsic protein gamma) [Arabidopsis 
thaliana]
Length=251

 Score =   206 bits (523),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 123/164 (75%), Positives = 139/164 (85%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI  IA G  +E  +P  LKAALAEFISTLIFV AG GSGMAF+KLT +GA+TPSGL+A
Sbjct  1    MPIRNIAIGRPDEATRPDALKAALAEFISTLIFVVAGSGSGMAFNKLTENGATTPSGLVA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            AA+AHAF LFVAVSVGANISGGHVNPAVTFGAF+GGNIT  RG+LY IAQLLGS  AC +
Sbjct  61   AALAHAFGLFVAVSVGANISGGHVNPAVTFGAFIGGNITLLRGILYWIAQLLGSVVACLI  120

Query  428  LEFATGGMSTGAFGLS-GVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+FATGG++  AFGLS GV V +A +FEIVMTFGLVYTVYATA+
Sbjct  121  LKFATGGLAVPAFGLSAGVGVLNAFVFEIVMTFGLVYTVYATAI  164



>ref|XP_002299893.1| nodulin-26 family protein [Populus trichocarpa]
 gb|EEE84698.1| nodulin-26 family protein [Populus trichocarpa]
Length=252

 Score =   206 bits (523),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 122/164 (74%), Positives = 140/164 (85%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI  IAFGS  E  QP  L+AALAEFIS LIFVFAG+GSGMAF+KLT++G+STP+GL+A
Sbjct  1    MPITSIAFGSPAEAGQPDALRAALAEFISMLIFVFAGEGSGMAFNKLTDNGSSTPAGLVA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            A++AHAFALFVAVSVGANISGGHVNPAVTFGAF+GG+ITF R +LY +AQ LGS  AC L
Sbjct  61   ASLAHAFALFVAVSVGANISGGHVNPAVTFGAFIGGHITFIRSLLYWVAQCLGSVVACLL  120

Query  428  LEFATGGMSTGAFGL-SGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+ ATGG  T AF L SGV  W+A++FEIVMTFGLVYTVYATAV
Sbjct  121  LKLATGGQETSAFALSSGVGAWNAVVFEIVMTFGLVYTVYATAV  164



>ref|NP_001284655.1| aquaporin TIP1-1 [Cucumis melo]
 gb|AGW99230.1| aquaporin TIP1-1 [Cucumis melo]
Length=250

 Score =   206 bits (523),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 127/164 (77%), Positives = 139/164 (85%), Gaps = 2/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI  IA G  EE   P  LKA LAEFISTLIFVFAGQGSG+AFSKLTNDGA+TP+GLI+
Sbjct  1    MPIRNIAIGRPEEATHPDALKAGLAEFISTLIFVFAGQGSGIAFSKLTNDGAATPAGLIS  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            A+IAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGNIT  RG++Y IAQLLGS  AC L
Sbjct  61   ASIAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGIIYWIAQLLGSVVACLL  120

Query  428  LEFATGGMSTGAFGLS-GVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+F T G+ TG+FGLS GV   +A +FEIVMTFGLVYTVYATAV
Sbjct  121  LKFVT-GLPTGSFGLSAGVGELNAFVFEIVMTFGLVYTVYATAV  163



>ref|XP_010556519.1| PREDICTED: aquaporin TIP1-1 [Tarenaya hassleriana]
Length=252

 Score =   206 bits (523),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 124/164 (76%), Positives = 136/164 (83%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI  I+ G  EE   P  L+AALAEFI TLIFVFAG GSGMAF+KLTNDGA+TPSGL+A
Sbjct  1    MPIRNISVGRPEEATHPDALRAALAEFICTLIFVFAGSGSGMAFNKLTNDGATTPSGLVA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            AA+AHAF LFVAVSVGANISGGHVNPAVTFGAFVGGNIT  RG+LY IAQLLGS  AC L
Sbjct  61   AALAHAFGLFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGILYWIAQLLGSVVACLL  120

Query  428  LEFATGGMSTGAFGLS-GVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+F TGG++  AF LS GV   +A +FEIVMTFGLVYTVYATAV
Sbjct  121  LKFTTGGLAVPAFSLSAGVGTLNAFVFEIVMTFGLVYTVYATAV  164



>tpg|DAA33868.1| TPA_inf: aquaporin TIP1;5 [Gossypium hirsutum]
 gb|KHG18573.1| Aquaporin TIP1-1 -like protein [Gossypium arboreum]
Length=249

 Score =   205 bits (522),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 125/164 (76%), Positives = 137/164 (84%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI  IA G  EE   P  LKAALAEFISTLIFVFAG GSGMAF+KLT+ GA+TP+GL+A
Sbjct  1    MPIRNIAVGRPEEATHPDALKAALAEFISTLIFVFAGSGSGMAFNKLTDGGATTPAGLVA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            A++AH FALFVAVSVGANISGGHVNPAVTFGAFVGGNIT  RG+LY IAQLLGST AC L
Sbjct  61   ASLAHGFALFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGILYWIAQLLGSTVACLL  120

Query  428  LEFATGGMSTGAFGL-SGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+FAT G+   AFGL SGV   +A +FEIVMTFGLVYTVYATAV
Sbjct  121  LKFATSGLGVPAFGLSSGVGALNAFVFEIVMTFGLVYTVYATAV  164



>ref|XP_002314201.1| nodulin-26 family protein [Populus trichocarpa]
 gb|ABK92822.1| unknown [Populus trichocarpa]
 gb|EEE88156.1| nodulin-26 family protein [Populus trichocarpa]
Length=252

 Score =   205 bits (522),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 123/164 (75%), Positives = 141/164 (86%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            M I  IAFGS  E+ Q   LKAALAEFIS LIFVFAG+GSGMAF+KLT+DG+STP+GL+A
Sbjct  1    MAITSIAFGSPAEVGQSDALKAALAEFISMLIFVFAGEGSGMAFNKLTDDGSSTPAGLVA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            A++AHAFALFVAVSVGANISGGHVNPAVTFGAF+GG+ITF R +LY +AQ LGS  AC L
Sbjct  61   ASLAHAFALFVAVSVGANISGGHVNPAVTFGAFLGGHITFIRSILYWVAQCLGSVVACLL  120

Query  428  LEFATGGMSTGAFGL-SGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+ ATGG+ T AF L SGV VW+A++FEIVMTFGLVYTVYATAV
Sbjct  121  LKLATGGLETSAFSLSSGVGVWNAVVFEIVMTFGLVYTVYATAV  164



>ref|XP_011000304.1| PREDICTED: probable aquaporin TIP1-2 [Populus euphratica]
Length=252

 Score =   205 bits (522),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 123/164 (75%), Positives = 140/164 (85%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            M I  IAFGS  E  QP  LKAALAEFIS LIFVFAG+GSGMAF+KLT++G+STP+GL+A
Sbjct  1    MAITSIAFGSPAEAGQPDALKAALAEFISMLIFVFAGEGSGMAFNKLTDNGSSTPAGLVA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            A++AHAFALFVAVSVGANISGGHVNPAVTFGAF+GG+ITFFR +LY +AQ LGS  AC L
Sbjct  61   ASLAHAFALFVAVSVGANISGGHVNPAVTFGAFIGGHITFFRSLLYWVAQCLGSVVACLL  120

Query  428  LEFATGGMSTGAFGL-SGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+ ATGG  T AF L SGV  W+A++FEIVMTFGLVYTVYATAV
Sbjct  121  LKLATGGQETSAFALSSGVGAWNAVVFEIVMTFGLVYTVYATAV  164



>dbj|BAD90703.1| tonoplast intrinsic protein 1;2 [Mimosa pudica]
Length=252

 Score =   205 bits (522),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 119/164 (73%), Positives = 140/164 (85%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI +IA G+  E +Q   LKAALAEFIS LIFVFAG+GSGMA++KLTN+GA+TP+GL++
Sbjct  1    MPISRIAIGNASEFQQADALKAALAEFISMLIFVFAGEGSGMAYNKLTNNGAATPAGLVS  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            A+IAHA ALFVAV+VGANISGGHVNPAVTFGAFVGG+I+  R +LY IAQLLG   AC L
Sbjct  61   ASIAHALALFVAVAVGANISGGHVNPAVTFGAFVGGHISLLRSILYWIAQLLGCVVACLL  120

Query  428  LEFATGGMSTGAFGLS-GVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+FATGG+ T AF LS GV  W+A++FEIVMTFGLVYTVYATAV
Sbjct  121  LKFATGGLETSAFALSAGVGAWNAVVFEIVMTFGLVYTVYATAV  164



>ref|XP_002879627.1| tonoplast intrinsic protein gamma [Arabidopsis lyrata subsp. 
lyrata]
 emb|CAA51171.1| tonoplast intrinsic protein gamma (gamma-TIP) [Arabidopsis thaliana]
 gb|EFH55886.1| tonoplast intrinsic protein gamma [Arabidopsis lyrata subsp. 
lyrata]
Length=251

 Score =   205 bits (522),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 123/164 (75%), Positives = 139/164 (85%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI  IA G  +E  +P  LKAALAEFISTLIFV AG GSGMAF+KLT +GA+TPSGL+A
Sbjct  1    MPIRNIAVGRPDEATRPDALKAALAEFISTLIFVVAGSGSGMAFNKLTENGATTPSGLVA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            AA+AHAF LFVAVSVGANISGGHVNPAVTFGAF+GGNIT  RG+LY IAQLLGS  AC +
Sbjct  61   AALAHAFGLFVAVSVGANISGGHVNPAVTFGAFIGGNITLLRGILYWIAQLLGSVVACLI  120

Query  428  LEFATGGMSTGAFGLS-GVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+FATGG++  AFGLS GV V +A +FEIVMTFGLVYTVYATA+
Sbjct  121  LKFATGGLAVPAFGLSAGVGVLNAFVFEIVMTFGLVYTVYATAI  164



>gb|ABB76813.1| tonoplast intrinsic protein [Olea europaea]
Length=252

 Score =   205 bits (522),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 123/164 (75%), Positives = 142/164 (87%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI ++A GS  E  Q   +KAA+AEFIS LIFVFAGQGSGMAF+KLT++ ++TP+GLIA
Sbjct  1    MPISRVAIGSPAEFSQLDAIKAAVAEFISMLIFVFAGQGSGMAFAKLTDNESTTPAGLIA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            A+IAHAFALFVAVSVGANISGGHVNPAVT GAFVGG+IT FR ++Y IAQLLGS  AC L
Sbjct  61   ASIAHAFALFVAVSVGANISGGHVNPAVTLGAFVGGHITLFRSIMYWIAQLLGSVIACLL  120

Query  428  LEFATGGMSTGAFGL-SGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+FATGG+ T AF L SGV+VW+A+IFEIVMTFGLVYTVYATAV
Sbjct  121  LKFATGGLETSAFALSSGVTVWNAVIFEIVMTFGLVYTVYATAV  164



>gb|KJB16755.1| hypothetical protein B456_002G245900 [Gossypium raimondii]
Length=249

 Score =   205 bits (522),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 125/164 (76%), Positives = 137/164 (84%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI  IA G  EE   P  LKAALAEFISTLIFVFAG GSGMAF+KLT+ GA+TP+GL+A
Sbjct  1    MPIRNIAVGRPEEATHPDALKAALAEFISTLIFVFAGSGSGMAFNKLTDGGATTPAGLVA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            A++AH FALFVAVSVGANISGGHVNPAVTFGAFVGGNIT  RG+LY IAQLLGST AC L
Sbjct  61   ASLAHGFALFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGILYWIAQLLGSTVACLL  120

Query  428  LEFATGGMSTGAFGL-SGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+FAT G+   AFGL SGV   +A +FEIVMTFGLVYTVYATAV
Sbjct  121  LKFATSGLGVPAFGLSSGVGALNAFVFEIVMTFGLVYTVYATAV  164



>dbj|BAB12722.1| gamma tonoplast intrinsic protein [Pyrus communis]
Length=252

 Score =   205 bits (522),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 120/164 (73%), Positives = 138/164 (84%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI  IA G  EE   P  L+AALAEFISTLIFVFAG+GSGMAF+KLT+D A+TP+GL+A
Sbjct  1    MPIRNIAVGRPEETYHPDALRAALAEFISTLIFVFAGEGSGMAFAKLTDDAANTPAGLVA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            AA+AHAF LFVAVS+ ANISGGHVNPAVTFGAF+GGNI+  RG+LY IAQLLG+T AC L
Sbjct  61   AALAHAFGLFVAVSISANISGGHVNPAVTFGAFIGGNISLLRGILYWIAQLLGATVACGL  120

Query  428  LEFATGGMSTGAFGL-SGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+F T G +T AF L SGV VW+A +FEIVMTFGLVYTVYATA+
Sbjct  121  LKFVTNGQTTAAFSLSSGVGVWNAFVFEIVMTFGLVYTVYATAI  164



>gb|AJA04408.1| tonoplast intrinsic protein [Chorispora bungeana]
Length=252

 Score =   205 bits (522),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 127/165 (77%), Positives = 140/165 (85%), Gaps = 2/165 (1%)
 Frame = +2

Query  68   MPIHQIAFGS-HEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGli  244
            MPI  IA G   EE+  P  L+AALAEFISTLIFVFAG GSG+AF+KLT++GA+TPSGL+
Sbjct  1    MPIRNIAIGGVQEEVTHPSALRAALAEFISTLIFVFAGSGSGIAFNKLTDNGATTPSGLV  60

Query  245  aaaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACF  424
            AAA+AHAF LFVAVSVGANISGGHVNPAVTFGAFVGGNIT  RGVLY IAQLLGS  ACF
Sbjct  61   AAALAHAFGLFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGVLYWIAQLLGSVVACF  120

Query  425  LLEFATGGMSTGAFGLS-GVSVWSALIFEIVMTFGLVYTVYATAV  556
            LL+FATGG+   AFGLS GV   +A +FEIVMTFGLVYTVYATAV
Sbjct  121  LLQFATGGLPVPAFGLSEGVGSLNAFVFEIVMTFGLVYTVYATAV  165



>ref|XP_009349744.1| PREDICTED: aquaporin TIP1-1-like [Pyrus x bretschneideri]
Length=252

 Score =   205 bits (522),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 120/164 (73%), Positives = 138/164 (84%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI  IA G  EE   P  L+AALAEFISTLIFVFAG+GSGMAF+KLT+D A+TP+GL+A
Sbjct  1    MPIRNIAVGRPEETYHPDALRAALAEFISTLIFVFAGEGSGMAFAKLTDDAANTPAGLVA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            AA+AHAF LFVAVS+ ANISGGHVNPAVTFGAF+GGNI+  RG+LY IAQLLG+T AC L
Sbjct  61   AALAHAFGLFVAVSISANISGGHVNPAVTFGAFIGGNISLLRGILYWIAQLLGATVACGL  120

Query  428  LEFATGGMSTGAFGL-SGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+F T G +T AF L SGV VW+A +FEIVMTFGLVYTVYATA+
Sbjct  121  LKFVTNGQTTAAFSLSSGVGVWNAFVFEIVMTFGLVYTVYATAI  164



>gb|KJB83802.1| hypothetical protein B456_013G265400 [Gossypium raimondii]
Length=252

 Score =   205 bits (522),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 125/164 (76%), Positives = 141/164 (86%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI +IA GS  E  Q   LKAALAEFIS LIFVFAG+GSGMAF+KLT+DG+STP+GL+A
Sbjct  1    MPISRIAVGSPAEAGQADALKAALAEFISVLIFVFAGEGSGMAFNKLTDDGSSTPAGLVA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            AA+AHA ALFVAVSVGANISGGHVNPAVTFGAFVGG+IT  R +LY IAQLLGS  AC L
Sbjct  61   AALAHALALFVAVSVGANISGGHVNPAVTFGAFVGGHITLVRSILYWIAQLLGSVVACLL  120

Query  428  LEFATGGMSTGAFGL-SGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+F+TGGM+T AF L SGV  W+A++FEIVMTFGLVYTVYATAV
Sbjct  121  LKFSTGGMTTSAFSLSSGVGAWNAVVFEIVMTFGLVYTVYATAV  164



>ref|XP_002531978.1| tonoplast intrinsic protein, putative [Ricinus communis]
 gb|EEF30414.1| tonoplast intrinsic protein, putative [Ricinus communis]
Length=252

 Score =   205 bits (522),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 120/164 (73%), Positives = 142/164 (87%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI +IA G+  E  QP  L+AALAEF S +IFVFAG+GSGMAF+KLT+ G++TPSGL+A
Sbjct  1    MPISRIAVGNPGEASQPDALRAALAEFFSMIIFVFAGEGSGMAFNKLTDGGSTTPSGLVA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            A+++HAFALFVAVSVGANISGGHVNPAVTFGAF+GG+IT  RG+LY IAQLLGS  AC L
Sbjct  61   ASLSHAFALFVAVSVGANISGGHVNPAVTFGAFIGGHITLLRGILYWIAQLLGSVVACLL  120

Query  428  LEFATGGMSTGAFGL-SGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+F+TGG+ T AF L SGVS W+A++FEIVMTFGLVYTVYATAV
Sbjct  121  LKFSTGGLETSAFALSSGVSSWNAVVFEIVMTFGLVYTVYATAV  164



>gb|KFK36559.1| hypothetical protein AALP_AA4G139100 [Arabis alpina]
Length=251

 Score =   205 bits (521),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 123/164 (75%), Positives = 139/164 (85%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI  IA G  +E  +P  L+AALAEFIST+IFVFAG GSGMAF+KLT++GA+TPSGL+A
Sbjct  1    MPIRNIAVGRPDEATRPDALRAALAEFISTMIFVFAGSGSGMAFNKLTDNGATTPSGLVA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            AA+AHAF LFVAVSVGANISGGHVNPAVTFGAF+GGNIT  RG+LY IAQLLGS  AC L
Sbjct  61   AALAHAFGLFVAVSVGANISGGHVNPAVTFGAFIGGNITLLRGILYWIAQLLGSVVACLL  120

Query  428  LEFATGGMSTGAFGLS-GVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+ ATGG+   AFGLS GV V +A +FEIVMTFGLVYTVYATAV
Sbjct  121  LKVATGGLVVPAFGLSAGVGVLNAFVFEIVMTFGLVYTVYATAV  164



>ref|XP_006339093.1| PREDICTED: aquaporin TIP1-1-like [Solanum tuberosum]
Length=248

 Score =   205 bits (521),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 129/164 (79%), Positives = 137/164 (84%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI +IA G  EE   P  LKAALAEFISTLIFVFAG GSG+AFSKLT  GA+TP+GLIA
Sbjct  1    MPISRIAIGRTEEATHPDALKAALAEFISTLIFVFAGSGSGVAFSKLTGGGANTPTGLIA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            AAIAHAF LFVAVSVGANISGGHVNPAVTFGAFVGGNIT  RG+LY IAQLLGS  AC L
Sbjct  61   AAIAHAFGLFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGILYWIAQLLGSVVACLL  120

Query  428  LEFATGGMSTGAFGLS-GVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+F TGGM  GAF LS GV V +AL+ EIVMTFGLVYTVYATAV
Sbjct  121  LKFTTGGMEIGAFSLSDGVGVGNALVLEIVMTFGLVYTVYATAV  164



>gb|KJB16756.1| hypothetical protein B456_002G245900 [Gossypium raimondii]
Length=249

 Score =   205 bits (521),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 125/164 (76%), Positives = 137/164 (84%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI  IA G  EE   P  LKAALAEFISTLIFVFAG GSGMAF+KLT+ GA+TP+GL+A
Sbjct  1    MPIRNIAVGRPEEATHPDALKAALAEFISTLIFVFAGSGSGMAFNKLTDGGATTPAGLVA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            A++AH FALFVAVSVGANISGGHVNPAVTFGAFVGGNIT  RG+LY IAQLLGST AC L
Sbjct  61   ASLAHGFALFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGILYWIAQLLGSTVACLL  120

Query  428  LEFATGGMSTGAFGL-SGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+FAT G+   AFGL SGV   +A +FEIVMTFGLVYTVYATAV
Sbjct  121  LKFATSGLVIPAFGLSSGVGALNAFVFEIVMTFGLVYTVYATAV  164



>gb|AJK93570.1| tonoplast intrinsic protein [Suaeda glauca]
Length=254

 Score =   205 bits (521),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 118/164 (72%), Positives = 138/164 (84%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI++IA G+ +E R P  LKA LAEFISTLIFV+AGQGSGMAF+KLT   A+TP+GL+A
Sbjct  1    MPINRIAVGTADEARHPNTLKAGLAEFISTLIFVYAGQGSGMAFAKLTAGAANTPAGLVA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            A++AH FALFVAV++GANISGGHVNPAVTFGAFVGGNIT   G++Y IAQLLGST AC L
Sbjct  61   ASVAHGFALFVAVAIGANISGGHVNPAVTFGAFVGGNITLLNGIVYWIAQLLGSTVACLL  120

Query  428  LEFATGGMSTGAFGL-SGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+F TGGM T AF L +  S W+AL+ EIVMTFGLVYTVYATA+
Sbjct  121  LKFTTGGMETSAFALATDCSTWNALVMEIVMTFGLVYTVYATAI  164



>ref|XP_003565186.1| PREDICTED: probable aquaporin TIP1-2 [Brachypodium distachyon]
Length=252

 Score =   204 bits (520),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 123/164 (75%), Positives = 140/164 (85%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MP+ +IA GS  EL  P   KAA+AEFIS LIFVFAG GSGMAF KLT+ GA+TPSGLIA
Sbjct  1    MPVSRIAIGSPGELSHPDTFKAAVAEFISMLIFVFAGSGSGMAFGKLTDGGATTPSGLIA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            AA+AHAFALFVAVSVGANISGGHVNPAVTFGAF+GGNI+  + ++Y +AQLLGSTAAC L
Sbjct  61   AALAHAFALFVAVSVGANISGGHVNPAVTFGAFIGGNISLLKAIVYWVAQLLGSTAACLL  120

Query  428  LEFATGGMSTGAFGLS-GVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+ +TGG S GAF LS GV VW+A++FEIVMTFGLVYTVYATAV
Sbjct  121  LQISTGGASVGAFSLSAGVGVWNAVVFEIVMTFGLVYTVYATAV  164



>gb|KJB73799.1| hypothetical protein B456_011G253100 [Gossypium raimondii]
Length=252

 Score =   204 bits (520),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 121/164 (74%), Positives = 140/164 (85%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPIH+IA G+  E   P  +KAALAEF S +IFVFAG+GSGMA++KLTN+G+STP+GL+A
Sbjct  1    MPIHRIAVGAPGEASHPTVIKAALAEFFSMIIFVFAGEGSGMAYNKLTNNGSSTPAGLVA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            A+++HAFALFVAVSVGANISGGHVNPAVTFGAF+GG+IT  R   Y IAQLLGS  AC L
Sbjct  61   ASLSHAFALFVAVSVGANISGGHVNPAVTFGAFIGGHITLLRSFSYWIAQLLGSVVACLL  120

Query  428  LEFATGGMSTGAFGL-SGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+FA+GGM T AF L SGVS W+ALIFEIVMTFGLVYTVYATAV
Sbjct  121  LKFASGGMETSAFALSSGVSTWNALIFEIVMTFGLVYTVYATAV  164



>ref|XP_011041956.1| PREDICTED: probable aquaporin TIP1-2 [Populus euphratica]
Length=252

 Score =   204 bits (520),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 123/164 (75%), Positives = 141/164 (86%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            M I  IAFGS  E+ Q   LKAALAEFIS LIFVFAG+GSGMAF+KLT+DG+STP+GL+A
Sbjct  1    MAITSIAFGSPAEVGQIDALKAALAEFISMLIFVFAGEGSGMAFNKLTDDGSSTPAGLVA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            A++AHAFALFVAVSVGANISGGHVNPAVTFGAF+GG+ITF R +LY +AQ LGS  AC L
Sbjct  61   ASLAHAFALFVAVSVGANISGGHVNPAVTFGAFLGGHITFIRSILYWVAQCLGSVVACLL  120

Query  428  LEFATGGMSTGAFGL-SGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+ ATGG+ T AF L SGV VW+A++FEIVMTFGLVYTVYATAV
Sbjct  121  LKLATGGLETSAFSLSSGVGVWNAVVFEIVMTFGLVYTVYATAV  164



>gb|KHG06645.1| putative aquaporin TIP1-2 [Gossypium arboreum]
Length=252

 Score =   204 bits (520),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 123/164 (75%), Positives = 141/164 (86%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI +IA GS  E  Q   LKAALAEFIS LIFVFAG+GSGMAF+KLT+DG+STP+GL+A
Sbjct  1    MPISRIAVGSPSEAGQADALKAALAEFISVLIFVFAGEGSGMAFNKLTDDGSSTPAGLVA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            AA+AHA ALFVAVS+GANISGGHVNPAVTFGAFVGG+IT  R +LY IAQLLGS  AC L
Sbjct  61   AALAHALALFVAVSIGANISGGHVNPAVTFGAFVGGHITLVRSILYWIAQLLGSVVACLL  120

Query  428  LEFATGGMSTGAFGL-SGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+F+TGGM+T AF L SGV  W+A++FEIVMTFGLVYTVYATA+
Sbjct  121  LKFSTGGMTTSAFSLSSGVGAWNAVVFEIVMTFGLVYTVYATAI  164



>emb|CAA64952.1| tonoplast intrinsic protein [Tulipa gesneriana]
Length=259

 Score =   205 bits (521),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 126/164 (77%), Positives = 141/164 (86%), Gaps = 2/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI +IA GS +E  Q G LKAALAEFISTLIFV+AGQGSG+AF KL+ DG +TP+GL+A
Sbjct  1    MPISRIAIGSPQEATQAGALKAALAEFISTLIFVYAGQGSGIAFGKLSVDGVTTPAGLVA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            AAIAHAFALFVAVSVGANISGGHVNPAVTFGAF+GGNIT  RGVLY+IAQLLGS+ AC L
Sbjct  61   AAIAHAFALFVAVSVGANISGGHVNPAVTFGAFLGGNITLLRGVLYIIAQLLGSSVACLL  120

Query  428  LEFATGGMSTGAFGL-SGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L F T G+ TG FGL +GVS+WS L+ EIVMT GLVYTVYATAV
Sbjct  121  LRFTT-GLGTGHFGLVAGVSIWSGLVMEIVMTCGLVYTVYATAV  163



>emb|CAA38633.1| possible membrane channel protein [Arabidopsis thaliana]
Length=253

 Score =   204 bits (520),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 122/164 (74%), Positives = 138/164 (84%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI  IA G  +E  +P  LKAALAEFISTLIFV AG GSGMAF+KLT +GA+TPSGL+A
Sbjct  1    MPIRNIAIGRPDEATRPDALKAALAEFISTLIFVVAGSGSGMAFNKLTENGATTPSGLVA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            AA+AHAF LFVAVSVGANISGGHVNPAVTFGAF+GGNIT  RG+LY IAQLLGS  AC +
Sbjct  61   AAVAHAFGLFVAVSVGANISGGHVNPAVTFGAFIGGNITLLRGILYWIAQLLGSVVACLI  120

Query  428  LEFATGGMSTGAFGLS-GVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+FATGG++   FGLS GV V +A +FEIVMTFGLVYTVYATA+
Sbjct  121  LKFATGGLAVPPFGLSAGVGVLNAFVFEIVMTFGLVYTVYATAI  164



>gb|KHG14163.1| Aquaporin TIP1-3 -like protein [Gossypium arboreum]
 gb|KJB20178.1| hypothetical protein B456_003G136600 [Gossypium raimondii]
Length=252

 Score =   204 bits (520),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 122/164 (74%), Positives = 142/164 (87%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI +IA GS  E  Q   LKAALAEFIS LIFVFAG+GSGMAF+KLT++G++TP+GL+A
Sbjct  1    MPISRIAVGSAAEAGQADALKAALAEFISMLIFVFAGEGSGMAFNKLTDNGSTTPAGLVA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            A++AHAFALFVAVSVGANISGGHVNPAVTFGAFVGG+IT  R +LY IAQLLGS  AC L
Sbjct  61   ASVAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGHITLVRSILYWIAQLLGSVVACLL  120

Query  428  LEFATGGMSTGAFGL-SGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+F+TGG++T AF L SGV  W+A++FEIVMTFGLVYTVYATAV
Sbjct  121  LKFSTGGLTTSAFALSSGVGAWNAVVFEIVMTFGLVYTVYATAV  164



>ref|XP_010033163.1| PREDICTED: aquaporin TIP1-3-like [Eucalyptus grandis]
 gb|KCW52713.1| hypothetical protein EUGRSUZ_J02074 [Eucalyptus grandis]
Length=251

 Score =   204 bits (519),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 120/164 (73%), Positives = 141/164 (86%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI +IA GS  E+ Q   LKAALAEFIS LIFVFAG+G+GMAF+K+T+DG++TP+GL+ 
Sbjct  1    MPISRIAVGSPAEVGQADTLKAALAEFISMLIFVFAGEGAGMAFNKVTDDGSTTPAGLVQ  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            A++AHAFALFVAVSVGANISGGHVNPAVTFGAFVGG+IT  R V+Y IAQ  GS  AC L
Sbjct  61   ASLAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGHITLARSVMYWIAQCAGSVVACLL  120

Query  428  LEFATGGMSTGAFGL-SGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+FATGG+ T AF L SGV+VW+AL+FEIVMTFGLVYTVYATA+
Sbjct  121  LKFATGGLETSAFSLSSGVTVWNALVFEIVMTFGLVYTVYATAI  164



>gb|KHG16987.1| Aquaporin TIP1-3 -like protein [Gossypium arboreum]
Length=252

 Score =   204 bits (519),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 121/164 (74%), Positives = 140/164 (85%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MP+++IA G+  E   P  +KAALAEF S LIFVFAG+GSGMA++KLTN+G+STP+GL+A
Sbjct  1    MPMNRIAVGTAGEASHPTVIKAALAEFFSMLIFVFAGEGSGMAYNKLTNNGSSTPAGLVA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            A+++HAFALFVAVSVGANISGGHVNPAVTFGAF+GG+IT  R   Y IAQLLGS  AC L
Sbjct  61   ASLSHAFALFVAVSVGANISGGHVNPAVTFGAFIGGHITLLRSFWYWIAQLLGSVVACLL  120

Query  428  LEFATGGMSTGAFGL-SGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+FATGGM T AF L SGVS W+ALIFEIVMTFGLVYTVYATAV
Sbjct  121  LKFATGGMETSAFALSSGVSTWNALIFEIVMTFGLVYTVYATAV  164



>ref|XP_007016527.1| Tonoplast intrinsic protein 1,3 [Theobroma cacao]
 gb|EOY34146.1| Tonoplast intrinsic protein 1,3 [Theobroma cacao]
Length=252

 Score =   204 bits (518),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 122/164 (74%), Positives = 142/164 (87%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI +IA GS  E  Q   LKAALAEFIS LIFVFAG+GSGMAF+KLT++G+STP+GL+A
Sbjct  1    MPISRIAVGSPAEAGQADALKAALAEFISMLIFVFAGEGSGMAFNKLTDNGSSTPAGLVA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            A++AHAFALFVAVSVGANISGGHVNPAVTFGAFVGG+I+  R +LY IAQLLGS  AC L
Sbjct  61   ASLAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGHISLVRSILYWIAQLLGSVVACLL  120

Query  428  LEFATGGMSTGAFGL-SGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+F+TGG++T AF L SGV  W+A++FEIVMTFGLVYTVYATAV
Sbjct  121  LKFSTGGLTTSAFSLSSGVGAWNAVVFEIVMTFGLVYTVYATAV  164



>ref|XP_008795635.1| PREDICTED: probable aquaporin TIP1-1 [Phoenix dactylifera]
Length=250

 Score =   204 bits (518),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 117/163 (72%), Positives = 135/163 (83%), Gaps = 0/163 (0%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI +IA G+ EE+  P   +AALAEFISTLIFVFAGQGS MAF+KLT  GA+TP+GL+A
Sbjct  1    MPIPRIAIGTREEVIHPSAFQAALAEFISTLIFVFAGQGSVMAFNKLTGGGATTPAGLVA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            A++AHAF LFVAVSV AN SGGH+NPAVTFG F+GG IT  RG+LY IAQ LGST AC L
Sbjct  61   ASVAHAFGLFVAVSVAANFSGGHINPAVTFGVFIGGRITLLRGILYWIAQFLGSTVACLL  120

Query  428  LEFATGGMSTGAFGLSGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L  +TGG++TG FGL+GV VW AL+ EIVMTFGLVYTVYATAV
Sbjct  121  LRLSTGGLATGTFGLTGVGVWEALLLEIVMTFGLVYTVYATAV  163



>gb|ABP35520.1| tonoplast intrinsic protein [Ipomoea batatas]
Length=251

 Score =   203 bits (517),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 123/163 (75%), Positives = 140/163 (86%), Gaps = 0/163 (0%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            M + +IA GS  E   P  LKAA+AEFIS LIFVFAG GSGMAF+KLT++GA+TP+GLI+
Sbjct  1    MAVPRIAIGSVGEATSPDALKAAVAEFISMLIFVFAGSGSGMAFNKLTDNGAATPAGLIS  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            AAIAHAFALFVAVSVGA+ISGGHVNPAVTFGAFVGG+IT  R V+Y IAQLLGS  AC L
Sbjct  61   AAIAHAFALFVAVSVGADISGGHVNPAVTFGAFVGGHITLLRSVVYWIAQLLGSVVACLL  120

Query  428  LEFATGGMSTGAFGLSGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+FATGG+ T AFGLSGV  W+A++FEIVMTFGLVYTVYATAV
Sbjct  121  LKFATGGLETPAFGLSGVGPWNAVVFEIVMTFGLVYTVYATAV  163



>ref|XP_008463495.1| PREDICTED: aquaporin TIP1-3-like isoform X3 [Cucumis melo]
Length=211

 Score =   202 bits (513),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 119/164 (73%), Positives = 136/164 (83%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPIH+  FGS  E  QP  +KA+ AEF S +IF+FAGQGSG+AF KLT+ G++T SGLI 
Sbjct  1    MPIHKFTFGSPGEASQPDAIKASFAEFFSMIIFIFAGQGSGLAFDKLTDGGSTTASGLIM  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            A++AHAFALFVAVSVGANISGGHVNPAVTFGA VGGNI+FFR ++Y IAQLLGS  ACFL
Sbjct  61   ASLAHAFALFVAVSVGANISGGHVNPAVTFGALVGGNISFFRSIMYWIAQLLGSVVACFL  120

Query  428  LEFATGGMSTGAFGL-SGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+FATGG  T AFGL SGVSVW+  I E VMTFGLVYTVYATA+
Sbjct  121  LKFATGGKVTPAFGLSSGVSVWNGFILEAVMTFGLVYTVYATAI  164



>ref|XP_008463494.1| PREDICTED: aquaporin TIP1-3-like isoform X2 [Cucumis melo]
Length=212

 Score =   202 bits (513),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 119/164 (73%), Positives = 136/164 (83%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPIH+  FGS  E  QP  +KA+ AEF S +IF+FAGQGSG+AF KLT+ G++T SGLI 
Sbjct  1    MPIHKFTFGSPGEASQPDAIKASFAEFFSMIIFIFAGQGSGLAFDKLTDGGSTTASGLIM  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            A++AHAFALFVAVSVGANISGGHVNPAVTFGA VGGNI+FFR ++Y IAQLLGS  ACFL
Sbjct  61   ASLAHAFALFVAVSVGANISGGHVNPAVTFGALVGGNISFFRSIMYWIAQLLGSVVACFL  120

Query  428  LEFATGGMSTGAFGL-SGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+FATGG  T AFGL SGVSVW+  I E VMTFGLVYTVYATA+
Sbjct  121  LKFATGGKVTPAFGLSSGVSVWNGFILEAVMTFGLVYTVYATAI  164



>gb|AAD31847.1|AF133531_1 water channel protein MipI [Mesembryanthemum crystallinum]
Length=252

 Score =   203 bits (517),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 119/164 (73%), Positives = 138/164 (84%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            M I +I  GS  E+  P  LKAALAEFIS LIFVFAGQGSGMAFSKLT+DG++TP+GL+A
Sbjct  1    MAIPRIDLGSPAEVSHPSALKAALAEFISMLIFVFAGQGSGMAFSKLTDDGSATPAGLVA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            A+++H FALFVAVSVGANISGGHVNPAVTFGAF+GG I+  R +LY IAQ LG+  AC L
Sbjct  61   ASLSHGFALFVAVSVGANISGGHVNPAVTFGAFLGGKISLPRTILYWIAQCLGAVVACLL  120

Query  428  LEFATGGMSTGAFGL-SGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L FATGG+ T AF L SG++VW+AL+FEIVMTFGLVYTVYATAV
Sbjct  121  LSFATGGLPTSAFALSSGITVWNALVFEIVMTFGLVYTVYATAV  164



>gb|ADE34283.1| aquaporin TIP1;7 [Gossypium hirsutum]
Length=252

 Score =   203 bits (516),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 124/164 (76%), Positives = 140/164 (85%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI +IA GS  E  Q   LKAALAEFIS LIFVFAG+GSGMAF+KLT+D +STP+GL+A
Sbjct  1    MPISRIAVGSPAEAGQADALKAALAEFISVLIFVFAGEGSGMAFNKLTDDDSSTPAGLVA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            AA+AHA ALFVAVSVGANISGGHVNPAVTFGAFVGG+IT  R +LY IAQLLGS  AC L
Sbjct  61   AALAHALALFVAVSVGANISGGHVNPAVTFGAFVGGHITLVRSILYWIAQLLGSVVACLL  120

Query  428  LEFATGGMSTGAFGL-SGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+F+TGGM+T AF L SGV  W+A++FEIVMTFGLVYTVYATAV
Sbjct  121  LKFSTGGMTTSAFSLSSGVGAWNAVVFEIVMTFGLVYTVYATAV  164



>ref|XP_008350342.1| PREDICTED: aquaporin TIP1-1-like [Malus domestica]
Length=252

 Score =   203 bits (516),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 119/164 (73%), Positives = 137/164 (84%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI  IA G  EE   P  L+AALAEFISTLIFVFAG+GSGMAF+KLT+D A+TPSGL+A
Sbjct  1    MPIRNIAVGRPEETYHPDALRAALAEFISTLIFVFAGEGSGMAFAKLTDDAATTPSGLVA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            AA+AHAF LFVAV++ ANISGGHVNPAVTFGAF+GGNI+  RG+LY IAQLLG+T AC L
Sbjct  61   AALAHAFGLFVAVTISANISGGHVNPAVTFGAFIGGNISLLRGLLYWIAQLLGATVACGL  120

Query  428  LEFATGGMSTGAFGLS-GVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+  T G +T AF LS GV VW+A +FEIVMTFGLVYTVYATA+
Sbjct  121  LKLVTNGQTTAAFSLSPGVGVWNAFVFEIVMTFGLVYTVYATAI  164



>ref|XP_008387528.1| PREDICTED: LOW QUALITY PROTEIN: aquaporin TIP1-1 [Malus domestica]
Length=252

 Score =   202 bits (515),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 119/164 (73%), Positives = 137/164 (84%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI  IA G  EE   P  L+AALAEFISTLIFVFAG+GSGMAF+KLT+D A+TPSGL+A
Sbjct  1    MPIRNIAVGRPEETYHPDALRAALAEFISTLIFVFAGEGSGMAFAKLTDDAATTPSGLVA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            AA+AHAF LFVAV++ ANISGGHVNPAVTFGAF+GGNI+  RG+LY IAQLLG+T AC L
Sbjct  61   AALAHAFGLFVAVTISANISGGHVNPAVTFGAFIGGNISLLRGLLYWIAQLLGATVACGL  120

Query  428  LEFATGGMSTGAFGLS-GVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+  T G +T AF LS GV VW+A +FEIVMTFGLVYTVYATA+
Sbjct  121  LKLVTNGQTTAAFSLSPGVGVWNAFVFEIVMTFGLVYTVYATAI  164



>ref|XP_007142715.1| hypothetical protein PHAVU_007G010800g [Phaseolus vulgaris]
 gb|ESW14709.1| hypothetical protein PHAVU_007G010800g [Phaseolus vulgaris]
Length=252

 Score =   202 bits (515),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 117/164 (71%), Positives = 135/164 (82%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            M +++IA GS  E   P  +KAA+AEF S LIFVFAGQGSGMA+SKLT +G +TP GL+ 
Sbjct  1    MAVYRIAIGSPREASNPAAIKAAVAEFFSMLIFVFAGQGSGMAYSKLTGNGPATPDGLVL  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            A+++HAF LFVAVSVGANISGGHVNPAVTFGAF+GGNIT  + +LY IAQLLGS  ACFL
Sbjct  61   ASLSHAFGLFVAVSVGANISGGHVNPAVTFGAFIGGNITLLKSILYWIAQLLGSVVACFL  120

Query  428  LEFATGGMSTGAFGL-SGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L + TGGM T  F L SGVSVW+AL+FEIVMTFGLVYTVYATAV
Sbjct  121  LNYTTGGMETTGFSLSSGVSVWNALVFEIVMTFGLVYTVYATAV  164



>ref|XP_004143284.1| PREDICTED: aquaporin TIP1-1-like [Cucumis sativus]
 gb|KGN48203.1| hypothetical protein Csa_6G448110 [Cucumis sativus]
Length=250

 Score =   202 bits (515),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 125/164 (76%), Positives = 138/164 (84%), Gaps = 2/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI  IA G  EE   P  LKA LAEFISTLIFVFAGQGSG+AF+KLTNDGA+TP+GLI+
Sbjct  1    MPIRNIAIGRPEEATHPDALKAGLAEFISTLIFVFAGQGSGIAFNKLTNDGAATPAGLIS  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            A+IAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGNIT  RG++Y IAQLLGS  AC L
Sbjct  61   ASIAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGIIYWIAQLLGSVVACLL  120

Query  428  LEFATGGMSTGAFGLS-GVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+F T G+ TG+F LS GV   +A +FEIVMTFGLVYTVYATAV
Sbjct  121  LKFVT-GLPTGSFALSAGVGELNAFVFEIVMTFGLVYTVYATAV  163



>ref|NP_001274695.1| aquaporin TIP1-3-like [Solanum lycopersicum]
 dbj|BAO18633.1| tonoplast intrinsic protein 1;2 [Solanum lycopersicum]
Length=253

 Score =   202 bits (515),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 124/164 (76%), Positives = 139/164 (85%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI +IA G+  E  +P  LKAA AEF S LIFVFAG GSGMAF KLTN GA+TP+GLI+
Sbjct  1    MPISRIAIGNLAEATKPDALKAATAEFFSMLIFVFAGSGSGMAFGKLTNGGAATPAGLIS  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            A+IAHAFALFVAVSVGANISGGHVNPAVTFGAFVGG+IT FR VLY IAQLLGS  AC L
Sbjct  61   ASIAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACVL  120

Query  428  LEFATGGMSTGAFGL-SGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+F+TGG+ T AF L SGV+ W+A++FEIVMTFGLVYTVYATAV
Sbjct  121  LKFSTGGLETSAFALSSGVTPWNAVVFEIVMTFGLVYTVYATAV  164



>ref|XP_010502579.1| PREDICTED: aquaporin TIP1-2 [Camelina sativa]
Length=253

 Score =   202 bits (515),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 126/165 (76%), Positives = 139/165 (84%), Gaps = 2/165 (1%)
 Frame = +2

Query  68   MPIHQIAFGS-HEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGli  244
            MP   IA G   +E+  P  L+AALAEFISTLIFVFAG GSG+AF+KLTN+GA+TPSGL+
Sbjct  1    MPTRNIAIGGVQQEVTHPDALRAALAEFISTLIFVFAGSGSGIAFNKLTNNGATTPSGLV  60

Query  245  aaaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACF  424
            AAA+AHAF LFVAVSVGANISGGHVNPAVTFGAFVGGNIT  RG+LY IAQLLGS AACF
Sbjct  61   AAALAHAFGLFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGILYWIAQLLGSVAACF  120

Query  425  LLEFATGGMSTGAFGLS-GVSVWSALIFEIVMTFGLVYTVYATAV  556
            LL FATGG +  AFGLS GV   + L+FEIVMTFGLVYTVYATAV
Sbjct  121  LLSFATGGEAIPAFGLSAGVGSLNGLVFEIVMTFGLVYTVYATAV  165



>ref|XP_006350747.1| PREDICTED: aquaporin TIP1-3-like [Solanum tuberosum]
Length=253

 Score =   202 bits (515),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 124/164 (76%), Positives = 139/164 (85%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI +IA G+  E  +P  LKAA AEF S LIFVFAG GSGMAF KLTN GA+TP+GLI+
Sbjct  1    MPISRIAIGNLAEATKPDALKAATAEFFSMLIFVFAGSGSGMAFGKLTNGGAATPAGLIS  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            A+IAHAFALFVAVSVGANISGGHVNPAVTFGAFVGG+IT FR VLY IAQLLGS  AC L
Sbjct  61   ASIAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGHITLFRSVLYWIAQLLGSVVACVL  120

Query  428  LEFATGGMSTGAFGL-SGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+F+TGG+ T AF L SGV+ W+A++FEIVMTFGLVYTVYATAV
Sbjct  121  LKFSTGGLETSAFALSSGVTPWNAVVFEIVMTFGLVYTVYATAV  164



>ref|XP_011089424.1| PREDICTED: aquaporin TIP1-3-like [Sesamum indicum]
Length=254

 Score =   202 bits (515),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 121/164 (74%), Positives = 140/164 (85%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI +IA G+  E  QP  +KAA+AEFIS LIFVFAG+GSGMAF++LT  G STP+GLI+
Sbjct  1    MPISRIAVGTPAEFTQPDAVKAAVAEFISMLIFVFAGEGSGMAFAQLTAGGPSTPAGLIS  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            A+IAHAFALFVAVS+ ANISGGHVNPAVTFGAFVGG+I+ FR +LY IAQLLGS  AC L
Sbjct  61   ASIAHAFALFVAVSIAANISGGHVNPAVTFGAFVGGHISLFRSILYWIAQLLGSVVACLL  120

Query  428  LEFATGGMSTGAFGL-SGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+FATGG+ T AF L SGV+ W+AL+FEIVMTFGLVYTVYATAV
Sbjct  121  LKFATGGLETSAFALSSGVTEWNALVFEIVMTFGLVYTVYATAV  164



>gb|AAT65835.2| tonoplast intrinsic protein gamma [Salicornia herbacea]
Length=254

 Score =   202 bits (514),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 118/164 (72%), Positives = 138/164 (84%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI++IA G+ E+ R P  LKA LAEFISTLIFV+AGQGSGMAF+KLT   A+TP+GL+A
Sbjct  1    MPINRIAVGTTEDARHPNTLKAGLAEFISTLIFVYAGQGSGMAFAKLTAGAANTPAGLVA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            AAI+H FALFVAV+VGANISGGHVNPAVTFGAF+GGNIT   G++Y IAQLLGST AC L
Sbjct  61   AAISHGFALFVAVAVGANISGGHVNPAVTFGAFIGGNITLLNGIVYWIAQLLGSTVACLL  120

Query  428  LEFATGGMSTGAFGL-SGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+F+TGG+ T AF L  G +VW A + EIVMTFGLVYTVYATA+
Sbjct  121  LKFSTGGLQTSAFALCEGETVWGAFVMEIVMTFGLVYTVYATAL  164



>ref|XP_006395549.1| hypothetical protein EUTSA_v10004806mg [Eutrema salsugineum]
 gb|ESQ32835.1| hypothetical protein EUTSA_v10004806mg [Eutrema salsugineum]
Length=253

 Score =   202 bits (514),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 124/165 (75%), Positives = 140/165 (85%), Gaps = 2/165 (1%)
 Frame = +2

Query  68   MPIHQIAFGS-HEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGli  244
            MPI  IA G   EE+  P  L+AALAEFISTLIFVFAG GSG+AF+KLT++GA+TPSGL+
Sbjct  1    MPIRNIAIGGVQEEVTHPSALRAALAEFISTLIFVFAGSGSGIAFNKLTDNGATTPSGLV  60

Query  245  aaaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACF  424
            AAA+AHAF LFVAVSVGANISGGHVNPAVTFGAF+GGNIT  RG+LY IAQLLGS  ACF
Sbjct  61   AAALAHAFGLFVAVSVGANISGGHVNPAVTFGAFLGGNITLLRGILYWIAQLLGSVVACF  120

Query  425  LLEFATGGMSTGAFGLS-GVSVWSALIFEIVMTFGLVYTVYATAV  556
            LL FATGG++  AFGLS GV   +A +FEIVMTFGLVYTVYATA+
Sbjct  121  LLTFATGGLAVPAFGLSAGVGSLNAFVFEIVMTFGLVYTVYATAI  165



>ref|XP_010696310.1| PREDICTED: probable aquaporin TIP1-2 [Beta vulgaris subsp. vulgaris]
Length=254

 Score =   202 bits (514),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 119/164 (73%), Positives = 139/164 (85%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI +I+ G+ +E R P  L++ LAEFISTLIFVFAGQGSGMAF+KLT   A+TP+GL+A
Sbjct  1    MPISRISVGTPDEARHPDTLRSGLAEFISTLIFVFAGQGSGMAFAKLTEGAANTPAGLVA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            A+IAHAFALFVAV+VGANISGGHVNPAVTFGAFVGGNIT   G++Y IAQLLGS AAC L
Sbjct  61   ASIAHAFALFVAVAVGANISGGHVNPAVTFGAFVGGNITLLNGIVYWIAQLLGSVAACAL  120

Query  428  LEFATGGMSTGAFGL-SGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+FATGG+ T AF   + VS W+AL+ EIVMTFGLVYTVYATA+
Sbjct  121  LKFATGGLETAAFACATDVSAWNALVMEIVMTFGLVYTVYATAI  164



>ref|XP_009152050.1| PREDICTED: aquaporin TIP1-2 [Brassica rapa]
Length=253

 Score =   202 bits (514),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 124/165 (75%), Positives = 139/165 (84%), Gaps = 2/165 (1%)
 Frame = +2

Query  68   MPIHQIAFGS-HEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGli  244
            MPI  IA G   EE+  P  L+AALAEFISTLIFVFAG GSG+AF+KLT++GA+TPSGL+
Sbjct  1    MPIRNIAIGGVQEEVTHPSALRAALAEFISTLIFVFAGSGSGIAFNKLTDNGATTPSGLV  60

Query  245  aaaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACF  424
            AAA+AHAF LFVAVSVGANISGGHVNPAVTFGAFVGGNIT  RG+LY IAQLLGS  AC 
Sbjct  61   AAALAHAFGLFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGILYWIAQLLGSVVACL  120

Query  425  LLEFATGGMSTGAFGLS-GVSVWSALIFEIVMTFGLVYTVYATAV  556
            LL+FATGG++  AFGLS GV   +  +FEIVMTFGLVYTVYATAV
Sbjct  121  LLKFATGGLAVPAFGLSAGVESLNGFVFEIVMTFGLVYTVYATAV  165



>gb|AFQ98316.1| MIP6 [Eutrema halophilum]
Length=253

 Score =   202 bits (514),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 124/165 (75%), Positives = 140/165 (85%), Gaps = 2/165 (1%)
 Frame = +2

Query  68   MPIHQIAFGS-HEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGli  244
            MPI  IA G   EE+  P  L+AALAEFISTLIFVFAG GSG+AF+KLT++GA+TPSGL+
Sbjct  1    MPIRNIAIGGVQEEVTHPSALRAALAEFISTLIFVFAGSGSGIAFNKLTDNGATTPSGLV  60

Query  245  aaaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACF  424
            AAA+AHAF LFVAVSVGANISGGHVNPAVTFGAF+GGNIT  RG+LY IAQLLGS  ACF
Sbjct  61   AAALAHAFGLFVAVSVGANISGGHVNPAVTFGAFLGGNITLLRGILYWIAQLLGSVVACF  120

Query  425  LLEFATGGMSTGAFGLS-GVSVWSALIFEIVMTFGLVYTVYATAV  556
            LL FATGG++  AFGLS GV   +A +FEIVMTFGLVYTVYATA+
Sbjct  121  LLTFATGGLAVPAFGLSAGVGSLNAFVFEIVMTFGLVYTVYATAI  165



>ref|XP_004307558.1| PREDICTED: aquaporin TIP1-3 [Fragaria vesca subsp. vesca]
Length=252

 Score =   202 bits (513),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 120/164 (73%), Positives = 139/164 (85%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            M I +IA G+  E   P  ++AA AEF S LIFVFAG+GSGMA+SKLT++G++TPSGLIA
Sbjct  1    MAISRIAIGAPGEASHPDAIRAAFAEFFSMLIFVFAGEGSGMAYSKLTDNGSATPSGLIA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            A+++HAFALFVAVSVGANISGGHVNPAVTFGAF+GGNIT  R  LY IAQLLGS  AC L
Sbjct  61   ASLSHAFALFVAVSVGANISGGHVNPAVTFGAFLGGNITLLRASLYWIAQLLGSVVACLL  120

Query  428  LEFATGGMSTGAFGL-SGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+FATGG+ T AF L SGVS+W+AL+FEIVMTFGLVYTVYATAV
Sbjct  121  LKFATGGLETAAFSLSSGVSIWNALVFEIVMTFGLVYTVYATAV  164



>dbj|BAA12711.1| VM23 [Raphanus sativus]
 emb|CDY13639.1| BnaA06g32840D [Brassica napus]
Length=253

 Score =   202 bits (513),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 124/165 (75%), Positives = 139/165 (84%), Gaps = 2/165 (1%)
 Frame = +2

Query  68   MPIHQIAFGS-HEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGli  244
            MPI  IA G   EE+  P  L+AALAEFISTLIFVFAG GSG+AF+KLT++GA+TPSGL+
Sbjct  1    MPIRNIAIGGVQEEVTHPSALRAALAEFISTLIFVFAGSGSGIAFNKLTDNGATTPSGLV  60

Query  245  aaaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACF  424
            AAA+AHAF LFVAVSVGANISGGHVNPAVTFGAFVGGNIT  RG+LY IAQLLGS  AC 
Sbjct  61   AAALAHAFGLFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGILYWIAQLLGSVVACL  120

Query  425  LLEFATGGMSTGAFGLS-GVSVWSALIFEIVMTFGLVYTVYATAV  556
            LL+FATGG++  AFGLS GV   +  +FEIVMTFGLVYTVYATAV
Sbjct  121  LLKFATGGLAVPAFGLSAGVESLNGFVFEIVMTFGLVYTVYATAV  165



>gb|AEF59492.1| aquaporin-like protein [Gardenia jasminoides]
Length=257

 Score =   202 bits (513),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 114/164 (70%), Positives = 135/164 (82%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            +P  +IA G+ +E RQ G +KAALAEFISTLIF+FAG+GSGMA+SKLT+ G S+P+GLI 
Sbjct  7    VPFRRIALGNRDEFRQAGAIKAALAEFISTLIFIFAGEGSGMAYSKLTHGGPSSPAGLII  66

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            AA+A+   LFVAVS+ ANISGGHVNPAVT GAF+GGNIT FRG+LY+I QLLGS  AC L
Sbjct  67   AALAYGLGLFVAVSISANISGGHVNPAVTIGAFLGGNITLFRGLLYIIFQLLGSIVACLL  126

Query  428  LEFATGGMSTGAFGL-SGVSVWSALIFEIVMTFGLVYTVYATAV  556
            LEF TGG+      L SGVSVW+AL+ EIVMTFGLVYTVYATA+
Sbjct  127  LEFTTGGLEASPLTLSSGVSVWNALVLEIVMTFGLVYTVYATAL  170



>ref|XP_009129499.1| PREDICTED: aquaporin TIP1-2 [Brassica rapa]
 emb|CDY48983.1| BnaA02g28130D [Brassica napus]
 emb|CDY28539.1| BnaC02g36210D [Brassica napus]
Length=253

 Score =   201 bits (512),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 123/165 (75%), Positives = 140/165 (85%), Gaps = 2/165 (1%)
 Frame = +2

Query  68   MPIHQIAFGS-HEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGli  244
            MP   IA G   EE+  P  L+AALAEFISTLIFVFAG GSG+AF+KLT++GA+TPSGL+
Sbjct  1    MPTRNIAIGGVQEEVTHPSALRAALAEFISTLIFVFAGSGSGIAFNKLTDNGATTPSGLV  60

Query  245  aaaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACF  424
            AAA+AHAF LFVAVSVGANISGGHVNPAVTFGAF+GGNIT  RG+LY IAQLLGS  ACF
Sbjct  61   AAALAHAFGLFVAVSVGANISGGHVNPAVTFGAFLGGNITLLRGLLYWIAQLLGSVVACF  120

Query  425  LLEFATGGMSTGAFGLS-GVSVWSALIFEIVMTFGLVYTVYATAV  556
            LL+FATGG++  AFGLS GV   + L+FEIVMTFGLVYTVYATA+
Sbjct  121  LLQFATGGLAVPAFGLSAGVGTLNGLVFEIVMTFGLVYTVYATAI  165



>ref|XP_010425366.1| PREDICTED: aquaporin TIP1-2-like [Camelina sativa]
Length=253

 Score =   201 bits (512),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 125/165 (76%), Positives = 139/165 (84%), Gaps = 2/165 (1%)
 Frame = +2

Query  68   MPIHQIAFGS-HEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGli  244
            MP   IA G   +E+  P  L+AALAEFISTLIFVFAG GSG+AF+KLTN+GA+TPSGL+
Sbjct  1    MPTRNIAIGGVQQEVTHPDALRAALAEFISTLIFVFAGSGSGIAFNKLTNNGATTPSGLV  60

Query  245  aaaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACF  424
            AAA+AHAF LFVAV+VGANISGGHVNPAVTFGAFVGGNIT  RG+LY IAQLLGS AACF
Sbjct  61   AAALAHAFGLFVAVAVGANISGGHVNPAVTFGAFVGGNITLLRGILYWIAQLLGSVAACF  120

Query  425  LLEFATGGMSTGAFGLS-GVSVWSALIFEIVMTFGLVYTVYATAV  556
            LL FATGG +  AFGLS GV   + L+FEIVMTFGLVYTVYATAV
Sbjct  121  LLSFATGGEAIPAFGLSAGVGSLNGLVFEIVMTFGLVYTVYATAV  165



>gb|KEH44484.1| tonoplast intrinsic protein [Medicago truncatula]
Length=252

 Score =   201 bits (512),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 117/164 (71%), Positives = 134/164 (82%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            M I++IA GS  E   P  ++AA AEF S LIFVFAGQGSGMA++KLTN+GA+TP GLI 
Sbjct  1    MAIYRIAIGSPREASNPAAIRAAFAEFFSMLIFVFAGQGSGMAYNKLTNNGAATPEGLIV  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            A+++HAF LFVAVSVGANISGGHVNPAVTFGAF+GGNITF R +LY IAQLLG+  AC L
Sbjct  61   ASLSHAFGLFVAVSVGANISGGHVNPAVTFGAFIGGNITFLRSILYWIAQLLGAVVACIL  120

Query  428  LEFATGGMSTGAFGL-SGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L   T GM T  F L SGVSVW+AL+FEIVMTFGLVYTVYATA+
Sbjct  121  LNSCTAGMETSGFALSSGVSVWNALVFEIVMTFGLVYTVYATAI  164



>ref|XP_008463493.1| PREDICTED: aquaporin TIP1-3-like isoform X1 [Cucumis melo]
Length=253

 Score =   201 bits (511),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 119/164 (73%), Positives = 136/164 (83%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPIH+  FGS  E  QP  +KA+ AEF S +IF+FAGQGSG+AF KLT+ G++T SGLI 
Sbjct  1    MPIHKFTFGSPGEASQPDAIKASFAEFFSMIIFIFAGQGSGLAFDKLTDGGSTTASGLIM  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            A++AHAFALFVAVSVGANISGGHVNPAVTFGA VGGNI+FFR ++Y IAQLLGS  ACFL
Sbjct  61   ASLAHAFALFVAVSVGANISGGHVNPAVTFGALVGGNISFFRSIMYWIAQLLGSVVACFL  120

Query  428  LEFATGGMSTGAFGL-SGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+FATGG  T AFGL SGVSVW+  I E VMTFGLVYTVYATA+
Sbjct  121  LKFATGGKVTPAFGLSSGVSVWNGFILEAVMTFGLVYTVYATAI  164



>gb|AFS50011.1| hypothetical protein [Dendrobium catenatum]
Length=250

 Score =   201 bits (510),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 116/163 (71%), Positives = 137/163 (84%), Gaps = 0/163 (0%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI +IA GS EE   PG LKAALAEFIST+IFVFAG+GSG+A+SKLT  GASTP+GL+ 
Sbjct  1    MPITRIAIGSREEAYHPGALKAALAEFISTVIFVFAGRGSGVAYSKLTPGGASTPAGLLT  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            AA+AHAFALFVAVS  ANISGGHVNPAVTFG F+GGNIT FRG+LY +AQLLG+  AC L
Sbjct  61   AAVAHAFALFVAVSAAANISGGHVNPAVTFGLFLGGNITLFRGLLYWVAQLLGAVVACLL  120

Query  428  LEFATGGMSTGAFGLSGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L  +TG +  G+FGL+ +S W+AL+ EI++TFGLVYTVYATAV
Sbjct  121  LRVSTGFLPVGSFGLTDISDWNALVLEIILTFGLVYTVYATAV  163



>gb|AEQ29861.1| aquaporin TIP1 [Malus prunifolia]
Length=252

 Score =   201 bits (510),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 119/164 (73%), Positives = 136/164 (83%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI  IA G  EE   P  L+AALAEFISTLIFVFAG+GSGMAF+KLT D A+TPSGL+A
Sbjct  1    MPIRNIAVGRPEETYHPDALRAALAEFISTLIFVFAGEGSGMAFAKLTVDAATTPSGLVA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            AA+AHAF LFVAV++ ANISGGHVNPAVTFGAF+GGNI+  RG+LY IAQLLG+T AC L
Sbjct  61   AALAHAFGLFVAVTISANISGGHVNPAVTFGAFIGGNISLLRGLLYWIAQLLGATVACGL  120

Query  428  LEFATGGMSTGAFGLS-GVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+  T G +T AF LS GV VW+A +FEIVMTFGLVYTVYATA+
Sbjct  121  LKLVTNGQTTAAFSLSPGVGVWNAFVFEIVMTFGLVYTVYATAI  164



>ref|XP_004168293.1| PREDICTED: LOW QUALITY PROTEIN: aquaporin TIP1-1-like [Cucumis 
sativus]
Length=250

 Score =   200 bits (509),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 124/164 (76%), Positives = 137/164 (84%), Gaps = 2/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI  IA G  EE   P  LKA LAEFISTL FVFAGQGSG+AF+KLTNDGA+TP+GLI+
Sbjct  1    MPIRNIAIGRPEEATHPDALKAGLAEFISTLXFVFAGQGSGIAFNKLTNDGAATPAGLIS  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            A+IAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGNIT  RG++Y IAQLLGS  AC L
Sbjct  61   ASIAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGIIYWIAQLLGSVVACLL  120

Query  428  LEFATGGMSTGAFGLS-GVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+F T G+ TG+F LS GV   +A +FEIVMTFGLVYTVYATAV
Sbjct  121  LKFVT-GLPTGSFALSAGVGELNAFVFEIVMTFGLVYTVYATAV  163



>gb|EPS67611.1| aquaporin-like protein, partial [Genlisea aurea]
Length=262

 Score =   201 bits (510),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 115/163 (71%), Positives = 137/163 (84%), Gaps = 0/163 (0%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            +P  ++A G+ EE RQPG +KAA+AEFISTLIFVFAG GSG+A++KLT  GA++P GL++
Sbjct  15   VPFTRVALGNREEFRQPGAVKAAVAEFISTLIFVFAGSGSGIAYNKLTGHGAASPEGLLS  74

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            A++AH FALFVAV++ ANISGGHVNPAVTFG FVGGNIT FRG+LY+IAQLLGSTAA  L
Sbjct  75   ASLAHGFALFVAVAISANISGGHVNPAVTFGLFVGGNITLFRGILYIIAQLLGSTAAAAL  134

Query  428  LEFATGGMSTGAFGLSGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L F TGG     FGL+GVSVWS L+ EI +TFGLVYTVYATAV
Sbjct  135  LVFTTGGEGVPTFGLTGVSVWSGLVLEIALTFGLVYTVYATAV  177



>ref|XP_002311146.1| Gamma-tonoplast intrinsic protein 3 [Populus trichocarpa]
 gb|EEE88513.1| Gamma-tonoplast intrinsic protein 3 [Populus trichocarpa]
Length=252

 Score =   200 bits (509),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 121/164 (74%), Positives = 141/164 (86%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI++IA G+  E   P +L+AALAEFISTLIFVFAG GSGMAF+KLT+  ++TP+GL+A
Sbjct  1    MPINRIAVGTPGEASHPDSLRAALAEFISTLIFVFAGSGSGMAFNKLTDSASTTPAGLVA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            AA+AHAFALFVAVSVGANISGGHVNPAVTFGA +GGNIT  R +LY IAQLLGS  AC L
Sbjct  61   AALAHAFALFVAVSVGANISGGHVNPAVTFGALIGGNITLLRSILYWIAQLLGSVVACLL  120

Query  428  LEFATGGMSTGAFGL-SGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+F+TGG+ T AFGL SGV  W+A++FEIVMTFGLVYTVYATAV
Sbjct  121  LKFSTGGLETPAFGLSSGVGAWNAVVFEIVMTFGLVYTVYATAV  164



>ref|XP_003518658.1| PREDICTED: aquaporin TIP1-3-like [Glycine max]
 gb|KHN27207.1| Aquaporin TIP1-3 [Glycine soja]
Length=252

 Score =   200 bits (509),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 119/164 (73%), Positives = 138/164 (84%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            M I++IA G+  E  QP  ++AA AEF S +IFVFAG+GSGMA+SKLTN+G +TP+GLIA
Sbjct  1    MAIYRIAIGTPGEAGQPDAIRAAFAEFFSMIIFVFAGEGSGMAYSKLTNNGPATPAGLIA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            A+++HAF LFVAVSVGANISGGHVNPAVTFGAF+GGNIT  R +LY IAQLLGS  AC L
Sbjct  61   ASLSHAFGLFVAVSVGANISGGHVNPAVTFGAFIGGNITLLRSILYWIAQLLGSVVACIL  120

Query  428  LEFATGGMSTGAFGLS-GVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+ ATGGM T  F LS GVSVW+AL+FEIVMTFGLVYTVYATAV
Sbjct  121  LKSATGGMETTGFSLSPGVSVWNALVFEIVMTFGLVYTVYATAV  164



>gb|KHN21988.1| Aquaporin TIP1-3 [Glycine soja]
Length=252

 Score =   200 bits (508),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 118/164 (72%), Positives = 141/164 (86%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI +IA G+  E  Q   LKAALAEFIS LIFVFAG+GSGMA++KLT++G++TP+G++A
Sbjct  1    MPISRIAIGNPSEFGQADALKAALAEFISMLIFVFAGEGSGMAYNKLTDNGSATPAGVVA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            A+++HAFALFVAVSVGANISGGHVNPAVTFGAF+GG+I+  RG+LY IAQLLGS  AC L
Sbjct  61   ASLSHAFALFVAVSVGANISGGHVNPAVTFGAFIGGHISLLRGILYWIAQLLGSVVACLL  120

Query  428  LEFATGGMSTGAFGLS-GVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+FATGG+ T AF LS GV   +AL+FEIVMTFGLVYTVYATAV
Sbjct  121  LKFATGGLETSAFSLSPGVGAANALVFEIVMTFGLVYTVYATAV  164



>emb|CAC85291.1| putative tonoplast intrinsic protein [Posidonia oceanica]
Length=250

 Score =   199 bits (507),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 118/163 (72%), Positives = 134/163 (82%), Gaps = 0/163 (0%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MP  +IA G  EE+     LKA LAEFISTLIFVFAG+GSG+A++ L+ DG +T S LIA
Sbjct  1    MPFSRIAMGRREEVTHGDALKATLAEFISTLIFVFAGEGSGIAYNNLSGDGDTTASSLIA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            AA+AH   LFVAVSVGANISGGHVNPAVTFGAFVGGNITF RG+LY   QLLGS  AC L
Sbjct  61   AALAHGLGLFVAVSVGANISGGHVNPAVTFGAFVGGNITFLRGILYWHGQLLGSIVACLL  120

Query  428  LEFATGGMSTGAFGLSGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+F TGGM+TG F +SGVSVW+AL+FEIVMTFGLVYTVYATA+
Sbjct  121  LKFVTGGMTTGGFAVSGVSVWNALVFEIVMTFGLVYTVYATAI  163



>ref|XP_002274538.1| PREDICTED: aquaporin TIP1-1 [Vitis vinifera]
Length=251

 Score =   199 bits (507),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 115/164 (70%), Positives = 132/164 (80%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MP  +IA G  +E  QP  LKAALAEF  TLIFVFAG+GSGMAFSKLT+DG++TP+GLIA
Sbjct  1    MPFLRIAIGQPQETYQPDALKAALAEFFGTLIFVFAGEGSGMAFSKLTDDGSTTPAGLIA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
             A+ H   LFVAVS   NISGGH+NPAVTFGAFVGGNIT  RG+LY IAQLLGS  AC L
Sbjct  61   EALGHGLGLFVAVSGACNISGGHINPAVTFGAFVGGNITLLRGILYWIAQLLGSAVACLL  120

Query  428  LEFATGGMSTGAFGL-SGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+F T GM+T AF + SGV+VW+A + EIVMTFGLVYTVYATA+
Sbjct  121  LKFCTHGMTTSAFAISSGVTVWNAFVLEIVMTFGLVYTVYATAI  164



>ref|XP_010514297.1| PREDICTED: aquaporin TIP1-2-like [Camelina sativa]
Length=253

 Score =   199 bits (507),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 125/165 (76%), Positives = 138/165 (84%), Gaps = 2/165 (1%)
 Frame = +2

Query  68   MPIHQIAFGS-HEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGli  244
            MP   IA G   +E+  P  L+AALAEFISTLIFVFAG GSG+A++KLTN GA+TPSGL+
Sbjct  1    MPTRNIAIGGVQQEVTHPDALRAALAEFISTLIFVFAGSGSGIAYNKLTNYGATTPSGLV  60

Query  245  aaaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACF  424
            AAA+AHAF LFVAVSVGANISGGHVNPAVTFGAFVGGNIT  RG+LY IAQLLGS AACF
Sbjct  61   AAALAHAFGLFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGILYWIAQLLGSVAACF  120

Query  425  LLEFATGGMSTGAFGLS-GVSVWSALIFEIVMTFGLVYTVYATAV  556
            LL FATGG +  AFGLS GV   + L+FEIVMTFGLVYTVYATAV
Sbjct  121  LLSFATGGEAIPAFGLSAGVGSLNGLVFEIVMTFGLVYTVYATAV  165



>ref|NP_001242707.1| uncharacterized protein LOC100777419 [Glycine max]
 gb|ACU17836.1| unknown [Glycine max]
Length=252

 Score =   199 bits (507),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 117/164 (71%), Positives = 140/164 (85%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI +IA G+  E  Q   LKAALAEFIS LIFVFAG+GSGMA++KLT++G++TP+G++A
Sbjct  1    MPISRIAIGNPSEFGQADALKAALAEFISMLIFVFAGEGSGMAYNKLTDNGSATPAGVVA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
             +++HAFALFVAVSVGANISGGHVNPAVTFGAF+GG+I+  RG+LY IAQLLGS  AC L
Sbjct  61   TSLSHAFALFVAVSVGANISGGHVNPAVTFGAFIGGHISLLRGILYWIAQLLGSVVACLL  120

Query  428  LEFATGGMSTGAFGLS-GVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+FATGG+ T AF LS GV   +AL+FEIVMTFGLVYTVYATAV
Sbjct  121  LKFATGGLETSAFSLSPGVGAANALVFEIVMTFGLVYTVYATAV  164



>ref|XP_003552678.1| PREDICTED: aquaporin TIP1-3-like [Glycine max]
Length=252

 Score =   199 bits (507),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 117/164 (71%), Positives = 136/164 (83%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            M +H+IA G+  E  QP  ++AA AEF   +IFVFAG+GSGMA+SKLTN+G +TP+GLIA
Sbjct  1    MAMHRIAIGTPGEAAQPDAIRAAFAEFFCMIIFVFAGEGSGMAYSKLTNNGPATPAGLIA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            A+++HAF LFVAVSVGANISGGHVNPAVTFGAF+GGNIT  R +LY IAQL GS  AC L
Sbjct  61   ASLSHAFGLFVAVSVGANISGGHVNPAVTFGAFIGGNITLLRSILYWIAQLFGSVVACIL  120

Query  428  LEFATGGMSTGAFGLS-GVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+ ATGGM T  F LS GVSVW+AL+FEIVMTFGLVYTVYATAV
Sbjct  121  LKHATGGMETSGFSLSPGVSVWNALVFEIVMTFGLVYTVYATAV  164



>ref|XP_006424746.1| hypothetical protein CICLE_v10029134mg [Citrus clementina]
 gb|ESR37986.1| hypothetical protein CICLE_v10029134mg [Citrus clementina]
Length=250

 Score =   199 bits (506),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 118/159 (74%), Positives = 139/159 (87%), Gaps = 1/159 (1%)
 Frame = +2

Query  83   IAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGliaaaiah  262
            IA G+  E+ QP  L+AA+AEF S +IFVFAGQGSGMA+SKLT++GA+TP+GL++A+IAH
Sbjct  4    IAIGNPAEIGQPDALRAAVAEFFSMVIFVFAGQGSGMAYSKLTDNGAATPAGLVSASIAH  63

Query  263  afalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFLLEFAT  442
            AFALFVAVSVGANISGGHVNPAVTFGAFVGG+ITF R +LY IAQLLGS  AC LL+F+T
Sbjct  64   AFALFVAVSVGANISGGHVNPAVTFGAFVGGHITFVRSILYWIAQLLGSVVACLLLKFST  123

Query  443  GGMSTGAFGL-SGVSVWSALIFEIVMTFGLVYTVYATAV  556
            GG+ T AF L SGV  W+A++FEIVMTFGLVYTVYATAV
Sbjct  124  GGLETSAFALSSGVGAWNAVVFEIVMTFGLVYTVYATAV  162



>ref|XP_010922400.1| PREDICTED: aquaporin TIP1-3-like [Elaeis guineensis]
Length=252

 Score =   199 bits (506),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 120/164 (73%), Positives = 135/164 (82%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MP+++IA G   E  QP  LKAA+AEF S LIFVFAG+GSGMAFSKLT DG +TPSGL+A
Sbjct  1    MPLNRIAIGEPGEASQPDALKAAVAEFFSMLIFVFAGEGSGMAFSKLTGDGPATPSGLVA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            AA+AHAFAL VAVSVGANISGGHVNPAVTFGAFVGGN+T  R +LY IAQLLGS  AC L
Sbjct  61   AALAHAFALIVAVSVGANISGGHVNPAVTFGAFVGGNVTLLRAILYWIAQLLGSVVACIL  120

Query  428  LEFATGGMSTGAFGLSG-VSVWSALIFEIVMTFGLVYTVYATAV  556
            L+FATGGM T AF +S  V+  +A + EIVMTFGLVYTVYATAV
Sbjct  121  LKFATGGMKTAAFAVSADVTPMNAFVLEIVMTFGLVYTVYATAV  164



>gb|AHW81522.1| ECFP-tagged gamma TIP [Cloning vector pBullet-vac-c]
 gb|AHW81534.1| ECFP-tagged gamma TIP [Cloning vector pBullet-vac-n]
Length=494

 Score =   206 bits (523),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 123/164 (75%), Positives = 139/164 (85%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI  IA G  +E  +P  LKAALAEFISTLIFV AG GSGMAF+KLT +GA+TPSGL+A
Sbjct  1    MPIRNIAIGRPDEATRPDALKAALAEFISTLIFVVAGSGSGMAFNKLTENGATTPSGLVA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            AA+AHAF LFVAVSVGANISGGHVNPAVTFGAF+GGNIT  RG+LY IAQLLGS  AC +
Sbjct  61   AAVAHAFGLFVAVSVGANISGGHVNPAVTFGAFIGGNITLLRGILYWIAQLLGSVVACLI  120

Query  428  LEFATGGMSTGAFGLS-GVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+FATGG++  AFGLS GV V +A +FEIVMTFGLVYTVYATA+
Sbjct  121  LKFATGGLAVPAFGLSAGVGVLNAFVFEIVMTFGLVYTVYATAI  164



>gb|KHN13870.1| Aquaporin TIP1-3 [Glycine soja]
Length=252

 Score =   199 bits (505),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 117/164 (71%), Positives = 136/164 (83%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            M +H+IA G+  E  QP  ++AA AEF   +IFVFAG+GSGMA+SKLTN+G +TP+GLIA
Sbjct  1    MAMHRIAIGTPGEAGQPDAIRAAFAEFFCMIIFVFAGEGSGMAYSKLTNNGPATPAGLIA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            A+++HAF LFVAVSVGANISGGHVNPAVTFGAF+GGNIT  R +LY IAQL GS  AC L
Sbjct  61   ASLSHAFGLFVAVSVGANISGGHVNPAVTFGAFIGGNITLLRSILYWIAQLFGSVVACIL  120

Query  428  LEFATGGMSTGAFGLS-GVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+ ATGGM T  F LS GVSVW+AL+FEIVMTFGLVYTVYATAV
Sbjct  121  LKHATGGMETSGFSLSPGVSVWNALVFEIVMTFGLVYTVYATAV  164



>ref|XP_008788076.1| PREDICTED: aquaporin TIP1-3-like [Phoenix dactylifera]
Length=252

 Score =   199 bits (505),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 120/164 (73%), Positives = 135/164 (82%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MP+++IA G   E  +P  LKAALAEF S LIFVFAG+GSGMAFSKLT DG +TPSGLIA
Sbjct  1    MPMNRIAIGEPGEASRPDALKAALAEFFSMLIFVFAGEGSGMAFSKLTGDGPATPSGLIA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            AA++HAFAL VAVSVGANISGGHVNPAVTFGAFVGGNIT  R +LY +AQLLGS  AC L
Sbjct  61   AALSHAFALIVAVSVGANISGGHVNPAVTFGAFVGGNITLLRAILYWMAQLLGSVVACIL  120

Query  428  LEFATGGMSTGAFGLSG-VSVWSALIFEIVMTFGLVYTVYATAV  556
            L+F TGGM T AF +S  V+  +A +FEIVMTFGLVYTVYATAV
Sbjct  121  LKFGTGGMKTAAFAVSADVTPMNAFVFEIVMTFGLVYTVYATAV  164



>emb|CDX83623.1| BnaC07g23630D [Brassica napus]
Length=253

 Score =   199 bits (505),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 123/165 (75%), Positives = 139/165 (84%), Gaps = 2/165 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHE-ELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGli  244
            MPI  IA G  + E+  P  L+AALAEFISTLIFVFAG GSG+AF+KLT++GA+TPSGL+
Sbjct  1    MPIRNIAIGGVQGEVTHPSALRAALAEFISTLIFVFAGSGSGIAFNKLTDNGATTPSGLV  60

Query  245  aaaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACF  424
            AAA+AHAF LFVAVSVGANISGGHVNPAVTFGAFVGGNIT  RG+LY IAQLLGS  AC 
Sbjct  61   AAALAHAFGLFVAVSVGANISGGHVNPAVTFGAFVGGNITLLRGILYWIAQLLGSVVACL  120

Query  425  LLEFATGGMSTGAFGLS-GVSVWSALIFEIVMTFGLVYTVYATAV  556
            LL+FATGG++  AFGLS GV   +  +FEIVMTFGLVYTVYATAV
Sbjct  121  LLKFATGGLAVPAFGLSAGVESLNGFVFEIVMTFGLVYTVYATAV  165



>ref|XP_006488253.1| PREDICTED: aquaporin TIP1-3-like [Citrus sinensis]
 gb|KDO72973.1| hypothetical protein CISIN_1g025600mg [Citrus sinensis]
Length=250

 Score =   199 bits (505),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 118/159 (74%), Positives = 139/159 (87%), Gaps = 1/159 (1%)
 Frame = +2

Query  83   IAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGliaaaiah  262
            IA G+  E+ QP  L+AA+AEF S +IFVFAGQGSGMA+SKLT++GA+TP+GL++A+IAH
Sbjct  4    IAIGNPAEIGQPDALRAAVAEFFSMVIFVFAGQGSGMAYSKLTDNGAATPAGLVSASIAH  63

Query  263  afalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFLLEFAT  442
            AFALFVAVSVGANISGGHVNPAVTFGAFVGG+ITF R +LY IAQLLGS  AC LL+F+T
Sbjct  64   AFALFVAVSVGANISGGHVNPAVTFGAFVGGHITFVRSILYWIAQLLGSVVACLLLKFST  123

Query  443  GGMSTGAFGL-SGVSVWSALIFEIVMTFGLVYTVYATAV  556
            GG+ T AF L SGV  W+A++FEIVMTFGLVYTVYATAV
Sbjct  124  GGLETSAFALSSGVGAWNAVVFEIVMTFGLVYTVYATAV  162



>ref|NP_192056.1| aquaporin TIP1-3 [Arabidopsis thaliana]
 sp|O82598.1|TIP13_ARATH RecName: Full=Aquaporin TIP1-3; AltName: Full=Gamma-tonoplast 
intrinsic protein 3; Short=Gamma-TIP3; AltName: Full=Tonoplast 
intrinsic protein 1-3; Short=AtTIP1;3; Contains: RecName: 
Full=Aquaporin TIP1-3, N-terminally processed [Arabidopsis 
thaliana]
 gb|AAC62778.1| F11O4.1 [Arabidopsis thaliana]
 emb|CAB77717.1| putative water channel protein [Arabidopsis thaliana]
 gb|ABE66039.1| major intrinsic family protein/MIP family protein [Arabidopsis 
thaliana]
 gb|AEE82031.1| aquaporin TIP1-3 [Arabidopsis thaliana]
Length=252

 Score =   199 bits (505),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 114/164 (70%), Positives = 138/164 (84%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI++IA G+  E  +P  ++AA AEF S +IFVFAGQGSGMA+ KLT DG +TP+GL+A
Sbjct  1    MPINRIAIGTPGEASRPDAIRAAFAEFFSMVIFVFAGQGSGMAYGKLTGDGPATPAGLVA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            A+++HAFALFVAVSVGAN+SGGHVNPAVTFGAF+GGNIT  R +LY IAQLLG+  AC L
Sbjct  61   ASLSHAFALFVAVSVGANVSGGHVNPAVTFGAFIGGNITLLRAILYWIAQLLGAVVACLL  120

Query  428  LEFATGGMSTGAFGLS-GVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+ +TGGM T AF LS GV+ W+A++FEIVMTFGLVYTVYATAV
Sbjct  121  LKVSTGGMETAAFSLSYGVTPWNAVVFEIVMTFGLVYTVYATAV  164



>gb|ABK25915.1| unknown [Picea sitchensis]
Length=253

 Score =   199 bits (505),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 115/164 (70%), Positives = 136/164 (83%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MP   +A G  EE+  P  LKAALAE ISTLIFVFAG+GSGMAF+KLT+D ++TP+GL+A
Sbjct  1    MPFRGVAIGRPEEVTHPTALKAALAELISTLIFVFAGEGSGMAFAKLTSDASTTPAGLVA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
             A+AH   LFVAV+VGANISGGHVNPAVTFGA VGG+IT  RG+LY IAQL+G+T AC L
Sbjct  61   VALAHGLGLFVAVAVGANISGGHVNPAVTFGALVGGHITLLRGILYWIAQLIGATVACLL  120

Query  428  LEFATGGMSTGAFGL-SGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L++ TGG+ST AF L SGV V +AL+FEIVMTFGLVYTVYATA+
Sbjct  121  LKYTTGGLSTSAFSLSSGVGVGNALVFEIVMTFGLVYTVYATAI  164



>ref|XP_002876978.1| hypothetical protein ARALYDRAFT_484417 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53237.1| hypothetical protein ARALYDRAFT_484417 [Arabidopsis lyrata subsp. 
lyrata]
Length=253

 Score =   199 bits (505),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 124/165 (75%), Positives = 137/165 (83%), Gaps = 2/165 (1%)
 Frame = +2

Query  68   MPIHQIAFGS-HEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGli  244
            MP   IA G   EE+  P  L+AALAEFISTLIFVFAG GSG+AF+KLT++GA+TPSGL+
Sbjct  1    MPTRNIAIGGVQEEVYHPNALRAALAEFISTLIFVFAGSGSGIAFNKLTDNGATTPSGLV  60

Query  245  aaaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACF  424
            AAA+AHAF LFVAVSVGANISGGHVNPAVTFG  +GGNIT  RG+LY IAQLLGS AACF
Sbjct  61   AAALAHAFGLFVAVSVGANISGGHVNPAVTFGVLLGGNITLLRGILYWIAQLLGSVAACF  120

Query  425  LLEFATGGMSTGAFGLS-GVSVWSALIFEIVMTFGLVYTVYATAV  556
            LL FATGG    AFGLS GV   +AL+FEIVMTFGLVYTVYATAV
Sbjct  121  LLSFATGGEPIPAFGLSAGVGSLNALVFEIVMTFGLVYTVYATAV  165



>ref|XP_011022886.1| PREDICTED: aquaporin TIP1-3 [Populus euphratica]
Length=252

 Score =   198 bits (504),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 120/164 (73%), Positives = 140/164 (85%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI++IA G+  E   P +L+AALAEFIS LIFVFAG GSGMAF+KLT+  ++TP+GL+A
Sbjct  1    MPINRIAVGTPGEASHPDSLRAALAEFISMLIFVFAGSGSGMAFNKLTDSASTTPAGLVA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            AA+AHAFALFVAVSVGANISGGHVNPAVTFGA +GGNIT  R +LY IAQLLGS  AC L
Sbjct  61   AALAHAFALFVAVSVGANISGGHVNPAVTFGALIGGNITLLRSILYWIAQLLGSVVACLL  120

Query  428  LEFATGGMSTGAFGL-SGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+F+TGG+ T AFGL SGV  W+A++FEIVMTFGLVYTVYATAV
Sbjct  121  LKFSTGGLETPAFGLSSGVGAWNAVVFEIVMTFGLVYTVYATAV  164



>gb|ABK28617.1| unknown [Arabidopsis thaliana]
Length=253

 Score =   198 bits (504),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 114/164 (70%), Positives = 138/164 (84%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI++IA G+  E  +P  ++AA AEF S +IFVFAGQGSGMA+ KLT DG +TP+GL+A
Sbjct  1    MPINRIAIGTPGEASRPDAIRAAFAEFFSMVIFVFAGQGSGMAYGKLTGDGPATPAGLVA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            A+++HAFALFVAVSVGAN+SGGHVNPAVTFGAF+GGNIT  R +LY IAQLLG+  AC L
Sbjct  61   ASLSHAFALFVAVSVGANVSGGHVNPAVTFGAFIGGNITLLRAILYWIAQLLGAVVACLL  120

Query  428  LEFATGGMSTGAFGLS-GVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+ +TGGM T AF LS GV+ W+A++FEIVMTFGLVYTVYATAV
Sbjct  121  LKVSTGGMETAAFSLSYGVTPWNAVVFEIVMTFGLVYTVYATAV  164



>gb|AAC62397.1| gamma tonoplast intrinsic protein 2 [Arabidopsis thaliana]
Length=253

 Score =   198 bits (504),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 122/165 (74%), Positives = 137/165 (83%), Gaps = 2/165 (1%)
 Frame = +2

Query  68   MPIHQIAFGS-HEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGli  244
            MP   IA G   EE+  P  L+AALAEFISTLIFVFAG GSG+AF+K+T++GA+TPSGL+
Sbjct  1    MPTRNIAIGGVQEEVYHPNALRAALAEFISTLIFVFAGSGSGIAFNKITDNGATTPSGLV  60

Query  245  aaaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACF  424
            AAA++HAF LFVAVSVGANISGGHVNPAVTFG  +GGNIT  RG+LY IAQLLGS AACF
Sbjct  61   AAALSHAFGLFVAVSVGANISGGHVNPAVTFGVLLGGNITLLRGILYWIAQLLGSVAACF  120

Query  425  LLEFATGGMSTGAFGLS-GVSVWSALIFEIVMTFGLVYTVYATAV  556
            LL FATGG    AFGLS GV   +AL+FEIVMTFGLVYTVYATAV
Sbjct  121  LLSFATGGEPIPAFGLSAGVRSLNALVFEIVMTFGLVYTVYATAV  165



>gb|ACI95284.1| tonoplast intrinsic protein [Tulipa gesneriana]
Length=250

 Score =   198 bits (503),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 122/163 (75%), Positives = 138/163 (85%), Gaps = 0/163 (0%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI +IA GS +E  Q G LKAALAEFISTLIFV+AGQGSG+AF KL+ DG +TP+GL+A
Sbjct  1    MPISRIAIGSPQEATQAGALKAALAEFISTLIFVYAGQGSGIAFGKLSVDGVTTPAGLVA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            AAIAHAFALFVAVSVGANISGGHVNPAVTFGAF+GGNIT  RGVLY+IAQLLGS+ AC L
Sbjct  61   AAIAHAFALFVAVSVGANISGGHVNPAVTFGAFLGGNITLLRGVLYIIAQLLGSSVACLL  120

Query  428  LEFATGGMSTGAFGLSGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L F TG  +     ++GVS+WS L+ EIVMTFGLVYTVYATAV
Sbjct  121  LRFTTGLGTGTFGLVAGVSIWSGLVMEIVMTFGLVYTVYATAV  163



>gb|ABK23010.1| unknown [Picea sitchensis]
Length=253

 Score =   198 bits (503),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 118/164 (72%), Positives = 135/164 (82%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MP   IA G  EE   P  LKAALAE ISTLIFVFAG+GSGMAF KLTND ++TP+GL+A
Sbjct  1    MPFRGIAVGRPEEATHPDALKAALAEGISTLIFVFAGEGSGMAFDKLTNDASTTPAGLVA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
             A+AHA  LFVAV+VGANISGGHVNPAVTFGAFVGG+IT  RG+LY  AQL+G+T AC L
Sbjct  61   VALAHALGLFVAVAVGANISGGHVNPAVTFGAFVGGHITLLRGILYWFAQLIGATVACLL  120

Query  428  LEFATGGMSTGAFGL-SGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+F TGG+ST AF L SGV V +A++FEIVMTFGLVYTVYATA+
Sbjct  121  LKFTTGGLSTSAFSLSSGVGVGNAVVFEIVMTFGLVYTVYATAI  164



>ref|XP_007205767.1| hypothetical protein PRUPE_ppa010367mg [Prunus persica]
 gb|EMJ06966.1| hypothetical protein PRUPE_ppa010367mg [Prunus persica]
Length=252

 Score =   197 bits (502),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 120/164 (73%), Positives = 139/164 (85%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MP+ +IA G+  E  QP  LKAALAEFIS LIFVFAG+GSGMAFSKLT+  ++TP+GLIA
Sbjct  1    MPVSRIAIGNPAEFGQPDALKAALAEFISVLIFVFAGEGSGMAFSKLTDGASTTPAGLIA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            AA+AHAFALFVAVS+ ANISGGHVNPAVTFGAF+GGNI+  R VLY IAQLLG+  AC L
Sbjct  61   AALAHAFALFVAVSIAANISGGHVNPAVTFGAFIGGNISLVRSVLYWIAQLLGAVIACLL  120

Query  428  LEFATGGMSTGAFGL-SGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L FATGG+ T AF L SGVSVW+A++ EIV+TFGLVYTVYATA+
Sbjct  121  LRFATGGLETSAFSLSSGVSVWNAVVLEIVITFGLVYTVYATAL  164



>ref|XP_006291577.1| hypothetical protein CARUB_v10017730mg, partial [Capsella rubella]
 gb|EOA24475.1| hypothetical protein CARUB_v10017730mg, partial [Capsella rubella]
Length=298

 Score =   199 bits (506),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 122/167 (73%), Positives = 138/167 (83%), Gaps = 2/167 (1%)
 Frame = +2

Query  62   PAMPIHQIAFGS-HEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSG  238
            P MP   IA G   +E+  P  L+AALAEFISTLIFVFAG GSG+AF+KLT++GA+TPSG
Sbjct  44   PIMPTRNIAIGGVQQEITHPSALRAALAEFISTLIFVFAGSGSGIAFNKLTDNGATTPSG  103

Query  239  liaaaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAA  418
            L++AA+AHAF LFVAV+VGANISGGHVNPAVTFG F+GGNIT  RG+LY IAQLLGS AA
Sbjct  104  LVSAALAHAFGLFVAVAVGANISGGHVNPAVTFGVFIGGNITLLRGILYWIAQLLGSVAA  163

Query  419  CFLLEFATGGMSTGAFGLS-GVSVWSALIFEIVMTFGLVYTVYATAV  556
            CFLL FATGG    AFGLS GV   +A +FEIVMTFGLVYTVYATAV
Sbjct  164  CFLLSFATGGEPIPAFGLSAGVGSLNAFVFEIVMTFGLVYTVYATAV  210



>gb|AAD39372.1|AF118381_1 tonoplast intrinsic protein [Brassica napus]
Length=253

 Score =   197 bits (502),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 122/165 (74%), Positives = 138/165 (84%), Gaps = 2/165 (1%)
 Frame = +2

Query  68   MPIHQIAFGS-HEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGli  244
            MP   IA G   EE+  P  L+AALAEFISTLIFVFAG GSG+AF+KLT++GA+TPSGL+
Sbjct  1    MPTRNIAIGGVQEEVTHPSALRAALAEFISTLIFVFAGSGSGIAFNKLTDNGATTPSGLV  60

Query  245  aaaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACF  424
            AAA+AHAF LFVAVSVGANISGGHVNPAVTFGAF+GGNIT  RG+LY IAQLLGS  AC 
Sbjct  61   AAALAHAFGLFVAVSVGANISGGHVNPAVTFGAFLGGNITLLRGLLYWIAQLLGSVVACL  120

Query  425  LLEFATGGMSTGAFGLS-GVSVWSALIFEIVMTFGLVYTVYATAV  556
            LL+FATGG++  AFGLS GV   +  +FEIVMTFGLVYTVYATAV
Sbjct  121  LLKFATGGLAVPAFGLSAGVESLNGFVFEIVMTFGLVYTVYATAV  165



>ref|XP_007139266.1| hypothetical protein PHAVU_008G014900g [Phaseolus vulgaris]
 gb|ESW11260.1| hypothetical protein PHAVU_008G014900g [Phaseolus vulgaris]
Length=252

 Score =   197 bits (502),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 119/164 (73%), Positives = 136/164 (83%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            M +++IA GS  E  QP  ++AA AEF S +IFVFAG+GSGMA+SKLTN+G +TP GLIA
Sbjct  1    MAMYRIAIGSPAEAGQPDAIRAAFAEFFSMIIFVFAGEGSGMAYSKLTNNGPATPVGLIA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            A+++HAF LFVAVSVGAN SGGHVNPAVTFGAFVGGNIT  R +LY IAQLLGS  AC L
Sbjct  61   ASLSHAFGLFVAVSVGANHSGGHVNPAVTFGAFVGGNITLLRSILYWIAQLLGSVVACIL  120

Query  428  LEFATGGMSTGAFGLS-GVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+ ATGGM T  F LS GVSVW+ALIFE+VMTFGLVYTVYATAV
Sbjct  121  LKSATGGMETSGFSLSPGVSVWNALIFEVVMTFGLVYTVYATAV  164



>ref|NP_189283.1| aquaporin TIP1-2 [Arabidopsis thaliana]
 sp|Q41963.2|TIP12_ARATH RecName: Full=Aquaporin TIP1-2; AltName: Full=Gamma-tonoplast 
intrinsic protein 2; Short=Gamma-TIP2; AltName: Full=Salt stress-induced 
tonoplast intrinsic protein; AltName: Full=Tonoplast 
intrinsic protein 1-2; Short=AtTIP1;2; Contains: RecName: 
Full=Aquaporin TIP1-2, N-terminally processed [Arabidopsis 
thaliana]
 gb|AAL16271.1|AF428341_1 AT3g26520/MFE16_3 [Arabidopsis thaliana]
 gb|AAL31945.1|AF419613_1 AT3g26520/MFE16_3 [Arabidopsis thaliana]
 dbj|BAB01832.1| salt-stress induced tonoplast intrinsic protein [Arabidopsis 
thaliana]
 gb|AAL84998.1| AT3g26520/MFE16_3 [Arabidopsis thaliana]
 dbj|BAH30470.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE77174.1| aquaporin TIP1-2 [Arabidopsis thaliana]
Length=253

 Score =   197 bits (502),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 123/165 (75%), Positives = 137/165 (83%), Gaps = 2/165 (1%)
 Frame = +2

Query  68   MPIHQIAFGS-HEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGli  244
            MP   IA G   EE+  P  L+AALAEFISTLIFVFAG GSG+AF+K+T++GA+TPSGL+
Sbjct  1    MPTRNIAIGGVQEEVYHPNALRAALAEFISTLIFVFAGSGSGIAFNKITDNGATTPSGLV  60

Query  245  aaaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACF  424
            AAA+AHAF LFVAVSVGANISGGHVNPAVTFG  +GGNIT  RG+LY IAQLLGS AACF
Sbjct  61   AAALAHAFGLFVAVSVGANISGGHVNPAVTFGVLLGGNITLLRGILYWIAQLLGSVAACF  120

Query  425  LLEFATGGMSTGAFGLS-GVSVWSALIFEIVMTFGLVYTVYATAV  556
            LL FATGG    AFGLS GV   +AL+FEIVMTFGLVYTVYATAV
Sbjct  121  LLSFATGGEPIPAFGLSAGVGSLNALVFEIVMTFGLVYTVYATAV  165



>ref|XP_003536771.1| PREDICTED: aquaporin TIP1-3-like [Glycine max]
 gb|KHN37323.1| Aquaporin TIP1-3 [Glycine soja]
Length=252

 Score =   197 bits (502),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 114/164 (70%), Positives = 133/164 (81%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            M +++IA GS  E   P  ++AA AEF S LIFVFAGQGSGMA+SKLT +G +TP GL+ 
Sbjct  1    MAVYRIAIGSPREASNPAAIRAAFAEFFSMLIFVFAGQGSGMAYSKLTGNGPATPGGLVV  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            A+++H F LFVAV+VGANISGGHVNPAVTFGAF+GGNIT  R +LY IAQLLGS  AC L
Sbjct  61   ASLSHTFGLFVAVAVGANISGGHVNPAVTFGAFIGGNITLLRSILYWIAQLLGSVVACIL  120

Query  428  LEFATGGMSTGAFGL-SGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+ ATGGM T AF L SGVSVW+AL+FEIVMTFGLV+TVYAT V
Sbjct  121  LKVATGGMETSAFSLSSGVSVWNALVFEIVMTFGLVHTVYATTV  164



>ref|XP_004971442.1| PREDICTED: probable aquaporin TIP1-2-like [Setaria italica]
Length=252

 Score =   197 bits (502),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 120/164 (73%), Positives = 136/164 (83%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MP+ +I+ G+  EL  P   KAA+AEFIS LIFVFAG GSGMAFSKLT  GA+TPSGLIA
Sbjct  1    MPVSRISVGAPGELSHPDTAKAAVAEFISMLIFVFAGSGSGMAFSKLTAGGATTPSGLIA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            AA+AHA ALFVAV+VGANISGGHVNPAVTFGAFVGGNIT  + V+Y +AQLLGS  AC L
Sbjct  61   AALAHALALFVAVAVGANISGGHVNPAVTFGAFVGGNITLLKAVVYWVAQLLGSVVACLL  120

Query  428  LEFATGGMSTGAFGLS-GVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+ ATGG + GAF LS GV  W+A++FEIVMTFGLVYTVYATAV
Sbjct  121  LKIATGGEAVGAFSLSAGVGAWNAVVFEIVMTFGLVYTVYATAV  164



>ref|XP_004492091.1| PREDICTED: aquaporin TIP1-3-like [Cicer arietinum]
Length=250

 Score =   197 bits (501),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 117/164 (71%), Positives = 137/164 (84%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            M I++IA GS  E  QP  ++AA AEF S LIFVFAG+GSGMA++KLTN+G +TP+GLIA
Sbjct  1    MAIYRIAIGSPGEAGQPDAIRAAFAEFFSMLIFVFAGEGSGMAYNKLTNNGPATPAGLIA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            A+++HAF LFVAVSVGAN SGGHVNPAVTFGAF+GGNIT  R +LY IAQLLGS  AC L
Sbjct  61   ASLSHAFGLFVAVSVGANASGGHVNPAVTFGAFMGGNITLLRSILYWIAQLLGSVVACIL  120

Query  428  LEFATGGMSTGAFGL-SGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+ ATGGM T AF + S +SVW+AL+FEIVMTFGLVYTVYATAV
Sbjct  121  LKSATGGMETSAFAISSDISVWNALVFEIVMTFGLVYTVYATAV  164



>dbj|BAL41683.1| tonoplast intrinsic protein [Tulipa gesneriana]
Length=250

 Score =   197 bits (501),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 123/163 (75%), Positives = 137/163 (84%), Gaps = 0/163 (0%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI +IA GS +E  Q G LKAALAEFISTLIFV+AGQGSG+AF KL+ DG +TP GL+A
Sbjct  1    MPISRIAIGSPQEATQAGALKAALAEFISTLIFVYAGQGSGIAFGKLSVDGVTTPVGLVA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            AAIAHAFALFVAVSVGANISGGHVNPAVTFGAF+GGNIT  RGVLY+IAQLLGS+ AC L
Sbjct  61   AAIAHAFALFVAVSVGANISGGHVNPAVTFGAFLGGNITLLRGVLYIIAQLLGSSVACLL  120

Query  428  LEFATGGMSTGAFGLSGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L F TG  +     ++GVSVWS L+ EIVMTFGLVYTVYATAV
Sbjct  121  LRFTTGLGTGTFGLVAGVSVWSGLVMEIVMTFGLVYTVYATAV  163



>ref|XP_010669827.1| PREDICTED: aquaporin TIP1-3-like [Beta vulgaris subsp. vulgaris]
Length=252

 Score =   197 bits (501),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 117/164 (71%), Positives = 134/164 (82%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MP++++A GS  E   P  LKAALAEF S +IFVFAGQGSGMAFS+L ++G S  +G+IA
Sbjct  1    MPLYRMAMGSPGEAGHPDALKAALAEFFSMIIFVFAGQGSGMAFSRLKDNGTSPSTGVIA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            A++AHAF L VAVSVGANISGGHVNPAVTFGAFVGG+ITF R +LY I QLLGS  ACFL
Sbjct  61   ASLAHAFGLIVAVSVGANISGGHVNPAVTFGAFVGGHITFLRAILYWIGQLLGSVVACFL  120

Query  428  LEFATGGMSTGAFGLS-GVSVWSALIFEIVMTFGLVYTVYATAV  556
            L FATGGM   AF LS GV+ W+AL+FEIVMTFGLVYTVYA AV
Sbjct  121  LHFATGGMEVSAFALSGGVTSWNALVFEIVMTFGLVYTVYALAV  164



>ref|XP_006645407.1| PREDICTED: probable aquaporin TIP1-2-like [Oryza brachyantha]
Length=254

 Score =   197 bits (501),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 116/163 (71%), Positives = 136/163 (83%), Gaps = 1/163 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MP+ +IA G+  EL  P   KAA+AEFIS LIFVFAG GSGMAFSKLT+ GA+TP+GLI+
Sbjct  1    MPVSRIAVGAPGELSHPDTAKAAVAEFISMLIFVFAGSGSGMAFSKLTDGGATTPAGLIS  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            A++AHA ALFVAV+VGANISGGHVNPAVTFGAFVGGNI+  + V+Y +AQLLGS  AC L
Sbjct  61   ASLAHALALFVAVAVGANISGGHVNPAVTFGAFVGGNISLLKAVVYWVAQLLGSVVACLL  120

Query  428  LEFATGGMSTGAFGLS-GVSVWSALIFEIVMTFGLVYTVYATA  553
            L+ ATGG + GAF LS GV  W+A++FEIVMTFGLVYTVYATA
Sbjct  121  LKIATGGEAVGAFSLSAGVGAWNAVVFEIVMTFGLVYTVYATA  163



>gb|KFK30698.1| hypothetical protein AALP_AA6G016000 [Arabis alpina]
Length=252

 Score =   197 bits (501),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 116/164 (71%), Positives = 137/164 (84%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            M I++IA G+  E  +P  ++AA AEF S +IFVFAGQGSGMA+ KLT DG +TPSGLIA
Sbjct  1    MAINRIAIGTPGEASRPDAIRAAFAEFFSMVIFVFAGQGSGMAYGKLTGDGKATPSGLIA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            A+++HAFALFVAVSVGAN+SGGHVNPAVTFGAF+GGNIT  R +LY IAQLLG+  AC L
Sbjct  61   ASLSHAFALFVAVSVGANVSGGHVNPAVTFGAFIGGNITLLRAILYWIAQLLGAVVACLL  120

Query  428  LEFATGGMSTGAFGLS-GVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+ +TGGM TGAF LS GV  W+A++FEIVMTFGLVYTVYATAV
Sbjct  121  LKVSTGGMETGAFSLSHGVEPWNAVVFEIVMTFGLVYTVYATAV  164



>gb|EAZ15017.1| hypothetical protein OsJ_04959 [Oryza sativa Japonica Group]
Length=252

 Score =   197 bits (501),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 118/164 (72%), Positives = 136/164 (83%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MP+ +IA G+  EL  P   KAA+AEFIS LIFVFAG GSGMAFSKLT+ G +TPSGLIA
Sbjct  1    MPVSRIAVGAPGELSHPDTAKAAVAEFISMLIFVFAGSGSGMAFSKLTDGGGTTPSGLIA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            A++AHA ALFVAV+VGANISGGHVNPAVTFGAFVGGNI+  + V+Y +AQLLGS  AC L
Sbjct  61   ASLAHALALFVAVAVGANISGGHVNPAVTFGAFVGGNISLVKAVVYWVAQLLGSVVACLL  120

Query  428  LEFATGGMSTGAFGLS-GVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+ ATGG + GAF LS GV  W+A++FEIVMTFGLVYTVYATAV
Sbjct  121  LKIATGGAAVGAFSLSAGVGAWNAVVFEIVMTFGLVYTVYATAV  164



>gb|KHN32099.1| Aquaporin TIP1-1 [Glycine soja]
Length=252

 Score =   197 bits (500),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 117/164 (71%), Positives = 140/164 (85%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI +IA G+  E  Q   LKAALAEFIS LIFVFAG+GSGMA++KLT++G++TP+G++A
Sbjct  1    MPISRIAIGNPSEFGQADALKAALAEFISMLIFVFAGEGSGMAYNKLTDNGSATPAGVVA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            A+++HAFALFVAVSVGANISGGHVNPAVTFGAF+GG+I+  RG+LY IAQLLGS  AC L
Sbjct  61   ASLSHAFALFVAVSVGANISGGHVNPAVTFGAFIGGHISLLRGILYWIAQLLGSVVACLL  120

Query  428  LEFATGGMSTGAFGLS-GVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+FAT G+ T AF LS GV   +AL+FEIVMTFGLVYTVYATAV
Sbjct  121  LKFATVGLETSAFSLSPGVGAANALVFEIVMTFGLVYTVYATAV  164



>ref|XP_010685836.1| PREDICTED: aquaporin TIP1-3-like [Beta vulgaris subsp. vulgaris]
Length=248

 Score =   197 bits (500),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 116/164 (71%), Positives = 135/164 (82%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            M + +I  GS  E  QP  LKAALAEFIS LIFVFAG+GSGMAF KLT DG ++P+GL+A
Sbjct  1    MAVPRIDIGSPAEATQPAALKAALAEFISMLIFVFAGEGSGMAFGKLTGDGPASPAGLVA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            AA++H FALFVAVSV AN+SGGHVNPAVT GAF+GG I+FFR +LY IAQ LG+  AC L
Sbjct  61   AALSHGFALFVAVSVAANVSGGHVNPAVTLGAFLGGKISFFRTILYWIAQCLGAVVACLL  120

Query  428  LEFATGGMSTGAFGL-SGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L F+TGG+ T AF L SGV+VW+AL+FEIVMTFGLVYTVYATAV
Sbjct  121  LSFSTGGLPTSAFALSSGVTVWNALVFEIVMTFGLVYTVYATAV  164



>ref|NP_001045562.1| Os01g0975900 [Oryza sativa Japonica Group]
 sp|Q94CS9.1|TIP12_ORYSJ RecName: Full=Probable aquaporin TIP1-2; AltName: Full=Tonoplast 
intrinsic protein 1-2; Short=OsTIP1;2 [Oryza sativa Japonica 
Group]
 dbj|BAB63833.1| tonoplast membrane integral protein [Oryza sativa Japonica Group]
 dbj|BAC79358.1| tonoplast intrinsic protein [Oryza sativa Japonica Group]
 dbj|BAF07476.1| Os01g0975900 [Oryza sativa Japonica Group]
 dbj|BAG99409.1| unnamed protein product [Oryza sativa Japonica Group]
Length=252

 Score =   197 bits (500),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 118/164 (72%), Positives = 136/164 (83%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MP+ +IA G+  EL  P   KAA+AEFIS LIFVFAG GSGMAFSKLT+ G +TPSGLIA
Sbjct  1    MPVSRIAVGAPGELSHPDTAKAAVAEFISMLIFVFAGSGSGMAFSKLTDGGGTTPSGLIA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            A++AHA ALFVAV+VGANISGGHVNPAVTFGAFVGGNI+  + V+Y +AQLLGS  AC L
Sbjct  61   ASLAHALALFVAVAVGANISGGHVNPAVTFGAFVGGNISLVKAVVYWVAQLLGSVVACLL  120

Query  428  LEFATGGMSTGAFGLS-GVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+ ATGG + GAF LS GV  W+A++FEIVMTFGLVYTVYATAV
Sbjct  121  LKIATGGAAVGAFSLSAGVGAWNAVVFEIVMTFGLVYTVYATAV  164



>gb|KFK33580.1| hypothetical protein AALP_AA5G032300 [Arabis alpina]
Length=253

 Score =   197 bits (500),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 121/165 (73%), Positives = 137/165 (83%), Gaps = 2/165 (1%)
 Frame = +2

Query  68   MPIHQIAFGS-HEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGli  244
            MP   IA G   EE+  P  L+AALAEFISTLIFVFAG GSG+AF+KLT +GA+TPSGL+
Sbjct  1    MPTRNIAIGGVQEEVTHPSALRAALAEFISTLIFVFAGSGSGIAFNKLTENGATTPSGLV  60

Query  245  aaaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACF  424
            AAA+AHAF LFVAVSVGANISGGHVNPAVTFGA +GGNIT  RG+LY IAQLLGS  ACF
Sbjct  61   AAALAHAFGLFVAVSVGANISGGHVNPAVTFGALLGGNITLLRGILYWIAQLLGSVVACF  120

Query  425  LLEFATGGMSTGAFGL-SGVSVWSALIFEIVMTFGLVYTVYATAV  556
            LL+FATGG+   AFGL +GV   +AL+ EIVMTFGLVYTVYATA+
Sbjct  121  LLQFATGGLPVPAFGLGAGVGSLNALVLEIVMTFGLVYTVYATAI  165



>ref|XP_004294610.1| PREDICTED: probable aquaporin TIP1-2 [Fragaria vesca subsp. vesca]
Length=254

 Score =   197 bits (500),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 120/164 (73%), Positives = 139/164 (85%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI  IA GS  E      L+AALAEFISTLIFVFAG GSG+AF++LT++GA+TP+GL+A
Sbjct  1    MPISSIAVGSPSEFGSVDALRAALAEFISTLIFVFAGSGSGVAFAELTDNGATTPAGLVA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            AAIAHAFALFVAV++ ANISGGHVNPAVTFGAF+GGNIT  R +LY IAQLLGS  AC L
Sbjct  61   AAIAHAFALFVAVAIAANISGGHVNPAVTFGAFLGGNITLVRSILYWIAQLLGSVVACLL  120

Query  428  LEFATGGMSTGAFGLS-GVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+FATGGM+  AF LS GV VW+A++FEIVMTFGLVYTVYATA+
Sbjct  121  LKFATGGMTISAFSLSTGVGVWNAVVFEIVMTFGLVYTVYATAL  164



>dbj|BAI66439.1| tonoplast intrinsic protein [Hordeum vulgare subsp. vulgare]
 gb|ADW85674.1| tonoplast intrinsic protein TIP1;3 [Hordeum vulgare]
 dbj|BAJ87160.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK03480.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=252

 Score =   197 bits (500),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 118/164 (72%), Positives = 137/164 (84%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MP+ +IA G+  EL  P   +A +AEFIS LIFVFAG GSGMAF KLT+ GA+TP+GLI+
Sbjct  1    MPVSRIAIGAPGELSHPDTFRAGVAEFISMLIFVFAGSGSGMAFGKLTDGGAATPAGLIS  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            AA+AHAFALFVAVSVGANISGGHVNPAVTFGAFVGGNI+  + V+Y +AQLLGS  AC L
Sbjct  61   AALAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGNISLLKAVVYWVAQLLGSVVACLL  120

Query  428  LEFATGGMSTGAFGLS-GVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+ ATGG + GAF LS GV VW+A++FEIVMTFGLVYTVYATAV
Sbjct  121  LKIATGGEAVGAFSLSAGVGVWNAVVFEIVMTFGLVYTVYATAV  164



>dbj|BAJ98454.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=252

 Score =   196 bits (499),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 118/164 (72%), Positives = 137/164 (84%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MP+ +IA G+  EL  P   +A +AEFIS LIFVFAG GSGMAF KLT+ GA+TP+GLI+
Sbjct  1    MPVSRIAIGAPGELSHPDTFRAGVAEFISMLIFVFAGSGSGMAFGKLTDGGAATPAGLIS  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            AA+AHAFALFVAVSVGANISGGHVNPAVTFGAFVGGNI+  + V+Y +AQLLGS  AC L
Sbjct  61   AALAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGNISLLKAVVYWVAQLLGSVVACLL  120

Query  428  LEFATGGMSTGAFGLS-GVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+ ATGG + GAF LS GV VW+A++FEIVMTFGLVYTVYATAV
Sbjct  121  LKIATGGEAVGAFSLSAGVGVWNAVVFEIVMTFGLVYTVYATAV  164



>ref|XP_007202475.1| hypothetical protein PRUPE_ppa010365mg [Prunus persica]
 gb|EMJ03674.1| hypothetical protein PRUPE_ppa010365mg [Prunus persica]
Length=252

 Score =   196 bits (499),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 119/164 (73%), Positives = 133/164 (81%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI  IA G  EE   P  L+A LAEFISTLIFVFAG+GSGMAF+KLT+  A+TP+GL+A
Sbjct  1    MPIRNIAVGRPEEAYHPDALRAGLAEFISTLIFVFAGEGSGMAFAKLTHGAATTPAGLVA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            AA+AH F LFVAVSV ANISGGHVNPAVTFGAFVGGNI+  RG+LY IAQLLGS  AC L
Sbjct  61   AALAHGFGLFVAVSVSANISGGHVNPAVTFGAFVGGNISLLRGILYWIAQLLGSAVACGL  120

Query  428  LEFATGGMSTGAFGLS-GVSVWSALIFEIVMTFGLVYTVYATAV  556
            L FAT   +T AF LS GV VW+A +FEIVMTFGLVYTVYATA+
Sbjct  121  LRFATNYQTTSAFALSEGVGVWNAFVFEIVMTFGLVYTVYATAI  164



>ref|XP_010428353.1| PREDICTED: aquaporin TIP1-3 [Camelina sativa]
Length=252

 Score =   196 bits (498),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 115/164 (70%), Positives = 137/164 (84%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            M I++IA G+  E  +P  ++AA AEF S +IFVFAGQGSGMA+ KLT DG +TPSGL+A
Sbjct  1    MAINRIAIGTPGEASRPDAIRAAFAEFFSMVIFVFAGQGSGMAYGKLTGDGPATPSGLVA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            A+++HAFALFVAVSVGAN+SGGHVNPAVTFGAF+GGNIT  R +LY IAQLLG+  AC L
Sbjct  61   ASLSHAFALFVAVSVGANVSGGHVNPAVTFGAFIGGNITLLRAILYWIAQLLGAVVACLL  120

Query  428  LEFATGGMSTGAFGLS-GVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+ +TGGM T AF LS GV+ W+A+IFEIVMTFGLVYTVYATAV
Sbjct  121  LKVSTGGMETSAFSLSYGVTPWNAVIFEIVMTFGLVYTVYATAV  164



>ref|XP_010422715.1| PREDICTED: aquaporin TIP1-3-like [Camelina sativa]
Length=252

 Score =   196 bits (498),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 115/164 (70%), Positives = 137/164 (84%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            M I++IA G+  E  +P  ++AA AEF S +IFVFAGQGSGMA+ KLT DG +TPSGL+A
Sbjct  1    MAINRIAIGTPGEASRPDAIRAAFAEFFSMVIFVFAGQGSGMAYGKLTGDGPATPSGLVA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            A+++HAFALFVAVSVGAN+SGGHVNPAVTFGAF+GGNIT  R +LY IAQLLG+  AC L
Sbjct  61   ASLSHAFALFVAVSVGANVSGGHVNPAVTFGAFIGGNITLLRAILYWIAQLLGAVVACLL  120

Query  428  LEFATGGMSTGAFGLS-GVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+ +TGGM T AF LS GV+ W+A+IFEIVMTFGLVYTVYATAV
Sbjct  121  LKVSTGGMETSAFSLSYGVTPWNAVIFEIVMTFGLVYTVYATAV  164



>ref|XP_008222876.1| PREDICTED: probable aquaporin TIP1-2 [Prunus mume]
Length=252

 Score =   196 bits (498),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 118/164 (72%), Positives = 137/164 (84%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MP+ +IA G+  E  QP  LKAALAEFIS LIFVFAG+GSGMAF KLT+  ++TP+GLIA
Sbjct  1    MPVSRIAVGNPAEFGQPDALKAALAEFISVLIFVFAGEGSGMAFDKLTDGASTTPAGLIA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            AA+AHAFALFVAVS+ ANISGGHVNPAVTFGA +GGNIT  R +LY IAQLLG+  AC L
Sbjct  61   AALAHAFALFVAVSIAANISGGHVNPAVTFGALIGGNITLIRSILYWIAQLLGAVVACLL  120

Query  428  LEFATGGMSTGAFGL-SGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L FATGG+ T AF L SGVSVW+A++ EIV+TFGLVYTVYATA+
Sbjct  121  LRFATGGLKTSAFSLSSGVSVWNAVVLEIVITFGLVYTVYATAL  164



>ref|XP_002872891.1| GAMMA-TIP3/TIP1_3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49150.1| GAMMA-TIP3/TIP1_3 [Arabidopsis lyrata subsp. lyrata]
Length=252

 Score =   196 bits (498),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 115/164 (70%), Positives = 137/164 (84%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            M I++IA G+  E  +P  ++AA AEF S +IFVFAGQGSGMA+ KLT DG +TPSGL+A
Sbjct  1    MAINRIAIGTPGEASRPDAIRAAFAEFFSMVIFVFAGQGSGMAYGKLTGDGPATPSGLVA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            A+++HAFALFVAVSVGAN+SGGHVNPAVTFGAF+GGNIT  R VLY IAQLLG+  AC L
Sbjct  61   ASLSHAFALFVAVSVGANVSGGHVNPAVTFGAFIGGNITLLRAVLYWIAQLLGAVVACLL  120

Query  428  LEFATGGMSTGAFGLS-GVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+ +TGGM T AF LS GV+ W+A++FEIVMTFGLVYTVYATAV
Sbjct  121  LKVSTGGMETAAFSLSHGVTPWNAVVFEIVMTFGLVYTVYATAV  164



>ref|XP_002523724.1| tonoplast intrinsic protein, putative [Ricinus communis]
 gb|EEF38664.1| tonoplast intrinsic protein, putative [Ricinus communis]
Length=252

 Score =   196 bits (497),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 115/165 (70%), Positives = 135/165 (82%), Gaps = 2/165 (1%)
 Frame = +2

Query  68   MPIHQIAFG-SHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGli  244
            MPI +IA G    ++ Q   LKAALAEF ST IFVFAG+GS MAFSKLT+DG+STP+ +I
Sbjct  1    MPITRIAIGLPQHDILQSDALKAALAEFFSTAIFVFAGEGSSMAFSKLTDDGSSTPAAII  60

Query  245  aaaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACF  424
             A++AHAF LFV VS  ANISGGH NPAVTFGAF+GGNI+  RG+LY IAQLLGST AC 
Sbjct  61   MASLAHAFGLFVGVSTAANISGGHCNPAVTFGAFLGGNISLLRGILYWIAQLLGSTVACL  120

Query  425  LLEFATGGMSTGAFGL-SGVSVWSALIFEIVMTFGLVYTVYATAV  556
            LL+F+T GM+T AF L SGV+VW+A +FEIVMTFGLVYTVYATA+
Sbjct  121  LLKFSTHGMTTSAFALSSGVNVWNAFVFEIVMTFGLVYTVYATAI  165



>ref|XP_010554597.1| PREDICTED: aquaporin TIP1-3 [Tarenaya hassleriana]
Length=253

 Score =   196 bits (497),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 113/164 (69%), Positives = 134/164 (82%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI++IA G+  E   P  +KAA AEF S +IFVFAG+GSGMA++KLT +G +TPSGL+A
Sbjct  1    MPINRIAIGAPGEASHPDAIKAAFAEFFSMVIFVFAGEGSGMAYNKLTGNGPATPSGLVA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            A+++HAF L VAVSVGANISGGHVNPAVTFGAFVGGNIT  R +LY IAQLLGS  AC L
Sbjct  61   ASLSHAFGLVVAVSVGANISGGHVNPAVTFGAFVGGNITLLRAILYWIAQLLGSVVACLL  120

Query  428  LEFATGGMSTGAFGL-SGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+  TGG+ T AF L SGV+ W+A++ EIVMTFGLVYTVYATAV
Sbjct  121  LKIGTGGLETSAFALSSGVTPWNAVVLEIVMTFGLVYTVYATAV  164



>ref|XP_006286822.1| hypothetical protein CARUB_v10003767mg [Capsella rubella]
 gb|EOA19720.1| hypothetical protein CARUB_v10003767mg [Capsella rubella]
Length=252

 Score =   196 bits (497),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 114/164 (70%), Positives = 137/164 (84%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            M I++IA G+  E  +P  ++AA AEF S +IFVFAGQGSGMA+ KLT DG +TPSGL+A
Sbjct  1    MAINRIAIGTPGEASRPDAIRAAFAEFFSMVIFVFAGQGSGMAYGKLTGDGPATPSGLVA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            A+++HAFALFVAVSVGAN+SGGHVNPAVTFGAF+GGNIT  R +LY IAQLLG+  AC L
Sbjct  61   ASLSHAFALFVAVSVGANVSGGHVNPAVTFGAFIGGNITLLRAILYWIAQLLGAVVACLL  120

Query  428  LEFATGGMSTGAFGLS-GVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+ +TGGM T AF LS GV+ W+A++FEIVMTFGLVYTVYATAV
Sbjct  121  LKVSTGGMETSAFSLSYGVTPWNAVVFEIVMTFGLVYTVYATAV  164



>dbj|BAL41684.1| tonoplast intrinsic protein [Tulipa gesneriana]
Length=250

 Score =   195 bits (496),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 122/163 (75%), Positives = 137/163 (84%), Gaps = 0/163 (0%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI +IA GS +E  Q G LKAALAEFISTLIFV+AGQGSG+AF KL+ DG +TP+GL+A
Sbjct  1    MPISRIAIGSPQEATQAGALKAALAEFISTLIFVYAGQGSGIAFGKLSVDGVTTPAGLVA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            AAIAHAFALFVAVSVGANISGGHVNPAVTFGA +GGNIT  RGVLY+IAQLLGS+ AC L
Sbjct  61   AAIAHAFALFVAVSVGANISGGHVNPAVTFGASLGGNITLLRGVLYIIAQLLGSSVACLL  120

Query  428  LEFATGGMSTGAFGLSGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L F TG  +     ++GVSVWS L+ EIVMTFGLVYTVYATAV
Sbjct  121  LRFTTGLGTGTFGLVAGVSVWSGLVMEIVMTFGLVYTVYATAV  163



>ref|XP_008241379.1| PREDICTED: aquaporin TIP1-1 [Prunus mume]
Length=252

 Score =   195 bits (496),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 117/164 (71%), Positives = 133/164 (81%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI  IA G  EE   P  L+A LAEFISTLIFVFAG+GSGMAF+KLT+  A+TP+GLIA
Sbjct  1    MPIRNIAVGRPEETYHPDALRAGLAEFISTLIFVFAGEGSGMAFAKLTHGAATTPAGLIA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            A++AH F LFV V+V ANISGGHVNPAVTFGAFVGGNI+  RG+LY IAQLLGS  AC L
Sbjct  61   ASLAHGFGLFVGVAVSANISGGHVNPAVTFGAFVGGNISLLRGILYWIAQLLGSAVACGL  120

Query  428  LEFATGGMSTGAFGLS-GVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+FAT   +T AF LS GV VW+A +FEIVMTFGLVYTVYATA+
Sbjct  121  LKFATNYQTTSAFALSEGVGVWNAFVFEIVMTFGLVYTVYATAI  164



>ref|XP_008357781.1| PREDICTED: aquaporin TIP1-3-like [Malus domestica]
Length=252

 Score =   195 bits (495),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 119/164 (73%), Positives = 140/164 (85%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            M I++IA GS  E  Q   LKAALAEFIS LIFVFAG+GSGMAF+KLT+  ++TP+GL+A
Sbjct  1    MAINRIAVGSSAEFGQADALKAALAEFISVLIFVFAGEGSGMAFNKLTDSASTTPAGLVA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            AA+AHAFALFVAVS+ ANISGGHVNPAVTFGAF+GG+ITF R +LY IAQL+G+  AC L
Sbjct  61   AALAHAFALFVAVSIAANISGGHVNPAVTFGAFIGGHITFVRTILYWIAQLIGAVVACLL  120

Query  428  LEFATGGMSTGAFGL-SGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+FATGG+ T AF L SGVSVW+AL+ EIV+TFGLVYTVYATAV
Sbjct  121  LKFATGGLETSAFSLSSGVSVWNALVLEIVITFGLVYTVYATAV  164



>dbj|BAD04010.1| tonoplast intrinsic protein [Prunus persica]
Length=252

 Score =   194 bits (494),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 118/164 (72%), Positives = 132/164 (80%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI  IA G  EE   P  L+A LAEFISTLIFVFAG+GSGMAF+KLT+  A+TP+GL+A
Sbjct  1    MPIRNIAVGRPEEAYHPDALRAGLAEFISTLIFVFAGEGSGMAFAKLTHGAATTPAGLVA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            AA+AH F LFVAVSV ANISGGHVNPAVTFGAFVGGNI+  RG+LY IAQLLGS  AC L
Sbjct  61   AALAHGFGLFVAVSVSANISGGHVNPAVTFGAFVGGNISLLRGILYWIAQLLGSAVACGL  120

Query  428  LEFATGGMSTGAFGLS-GVSVWSALIFEIVMTFGLVYTVYATAV  556
            L FA    +T AF LS GV VW+A +FEIVMTFGLVYTVYATA+
Sbjct  121  LRFAPNYQTTSAFALSEGVGVWNAFVFEIVMTFGLVYTVYATAI  164



>ref|XP_009799587.1| PREDICTED: probable aquaporin TIP1-1 [Nicotiana sylvestris]
Length=137

 Score =   191 bits (484),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 109/128 (85%), Positives = 118/128 (92%), Gaps = 0/128 (0%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPIHQI  G+HEELRQPG LKAAL E ISTLIFVFAGQGSGMAF+KLT+D A+TP+GLIA
Sbjct  1    MPIHQITIGTHEELRQPGALKAALTELISTLIFVFAGQGSGMAFNKLTSDSATTPAGLIA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            AA+AHAFALFVAVSV ANISGGHVNPAVTFGAF+GGNITFFRG+LYVIAQLLGST AC L
Sbjct  61   AAVAHAFALFVAVSVSANISGGHVNPAVTFGAFIGGNITFFRGILYVIAQLLGSTVACLL  120

Query  428  LEFATGGM  451
            L+FAT GM
Sbjct  121  LKFATAGM  128



>gb|AGV54720.1| water-selective transport intrinsic membrane protein 1 [Phaseolus 
vulgaris]
Length=217

 Score =   193 bits (491),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 120/164 (73%), Positives = 135/164 (82%), Gaps = 2/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI  IA G  EE   P  LKA LAEFISTLIFVFAG GSG+AF+KLT++GA+TP+GLI+
Sbjct  1    MPIRNIAIGRPEEATNPDTLKAGLAEFISTLIFVFAGSGSGIAFNKLTDNGAATPAGLIS  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            A+IAHAF LFVAVSVGANISGGHVNPAVTFGAF+GGNITF RGV+Y+IAQLLGS  A  L
Sbjct  61   ASIAHAFGLFVAVSVGANISGGHVNPAVTFGAFIGGNITFLRGVVYIIAQLLGSVVASLL  120

Query  428  LEFATGGMSTGAFGLS-GVSVWSALIFEIVMTFGLVYTVYATAV  556
            L F T   +  AFGLS GV V +AL+ EIVMTFGLVYTVYATA+
Sbjct  121  LAFVTSS-TVPAFGLSAGVGVGNALVLEIVMTFGLVYTVYATAI  163



>gb|AGV54343.1| tonoplast intrinsic protein [Phaseolus vulgaris]
Length=232

 Score =   194 bits (492),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 120/164 (73%), Positives = 135/164 (82%), Gaps = 2/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MPI  IA G  EE   P  LKA LAEFISTLIFVFAG GSG+AF+KLT++GA+TP+GLI+
Sbjct  1    MPIRNIAIGRPEEATNPDTLKAGLAEFISTLIFVFAGSGSGIAFNKLTDNGAATPAGLIS  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            A+IAHAF LFVAVSVGANISGGHVNPAVTFGAF+GGNITF RGV+Y+IAQLLGS  A  L
Sbjct  61   ASIAHAFGLFVAVSVGANISGGHVNPAVTFGAFIGGNITFLRGVVYIIAQLLGSVVASLL  120

Query  428  LEFATGGMSTGAFGLS-GVSVWSALIFEIVMTFGLVYTVYATAV  556
            L F T   +  AFGLS GV V +AL+ EIVMTFGLVYTVYATA+
Sbjct  121  LAFVTSS-TVPAFGLSAGVGVGNALVLEIVMTFGLVYTVYATAI  163



>ref|XP_009358317.1| PREDICTED: aquaporin TIP1-3-like [Pyrus x bretschneideri]
Length=252

 Score =   194 bits (493),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 118/164 (72%), Positives = 141/164 (86%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            M I++IA GS  E  Q   LKAALAEFIS LIFVFAG+GSGMAF+KLT++ ++TP+GL+A
Sbjct  1    MAINRIAVGSAAEFGQADALKAALAEFISVLIFVFAGEGSGMAFNKLTDNASTTPAGLVA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            AA+AHAFALFVAVS+ ANISGGHVNPAVTFGAF+GG+ITF R +LY I+QL+G+  AC L
Sbjct  61   AALAHAFALFVAVSIAANISGGHVNPAVTFGAFIGGHITFVRTILYWISQLIGAVVACLL  120

Query  428  LEFATGGMSTGAFGL-SGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+FATGG+ T AF L SGVSVW+AL+ EIV+TFGLVYTVYATAV
Sbjct  121  LKFATGGLETSAFSLSSGVSVWNALVLEIVITFGLVYTVYATAV  164



>ref|XP_006396348.1| hypothetical protein EUTSA_v10028907mg [Eutrema salsugineum]
 gb|ESQ37801.1| hypothetical protein EUTSA_v10028907mg [Eutrema salsugineum]
Length=252

 Score =   194 bits (492),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 114/164 (70%), Positives = 136/164 (83%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            M I++IA G+  E   P  ++AA AEF S +IFVFAGQGSGMA+ KLT DG +TPSGL+A
Sbjct  1    MAINRIAIGTPGEASGPDAIRAAFAEFFSMVIFVFAGQGSGMAYGKLTGDGPATPSGLVA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
            A+++HAFALFVAVSVGAN+SGGHVNPAVTFGAF+GGNIT  R +LY IAQLLG+  AC L
Sbjct  61   ASLSHAFALFVAVSVGANVSGGHVNPAVTFGAFIGGNITLMRAILYWIAQLLGAVVACLL  120

Query  428  LEFATGGMSTGAFGLS-GVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+ +TGGM T AF LS GV+ W+A++FEIVMTFGLVYTVYATAV
Sbjct  121  LKVSTGGMETAAFSLSYGVTPWNAVVFEIVMTFGLVYTVYATAV  164



>gb|ADE76384.1| unknown [Picea sitchensis]
Length=253

 Score =   194 bits (492),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 115/164 (70%), Positives = 134/164 (82%), Gaps = 1/164 (1%)
 Frame = +2

Query  68   MPIHQIAFGSHEELRQPGNLKAALAEFISTLIFVFAGQGSGMAFSKLTNDGASTPSGlia  247
            MP   +A G  EE+  P  LKAALAE ISTLIFVFAG+GSGMAF+KLT D +STP+GL+A
Sbjct  1    MPFRGLAVGRPEEVTHPDTLKAALAEGISTLIFVFAGEGSGMAFAKLTGDASSTPAGLVA  60

Query  248  aaiahafalfvavSVGANISGGHVNPAVTFGAFVGGNITFFRGVLYVIAQLLGSTAACFL  427
             A+AH  ALFVAV+V ANISGGHVNPAVTFGA VGG+IT  RG+LY + QL+G+T AC L
Sbjct  61   VALAHGLALFVAVAVSANISGGHVNPAVTFGALVGGHITLLRGILYWLVQLIGATVACLL  120

Query  428  LEFATGGMSTGAFGL-SGVSVWSALIFEIVMTFGLVYTVYATAV  556
            L+F TGG+ST AF L SGV V +AL+FEIVMTFGLVYTVYATA+
Sbjct  121  LDFTTGGLSTTAFSLSSGVGVGNALVFEIVMTFGLVYTVYATAI  164



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 631248065840