BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001O07

Length=561
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010261181.1|  PREDICTED: membrane-anchored ubiquitin-fold ...  58.9    3e-08   Nelumbo nucifera [Indian lotus]
ref|XP_010261178.1|  PREDICTED: membrane-anchored ubiquitin-fold ...  59.3    4e-08   Nelumbo nucifera [Indian lotus]
ref|XP_002285815.1|  PREDICTED: membrane-anchored ubiquitin-fold ...  58.2    5e-08   Vitis vinifera
ref|XP_004237877.1|  PREDICTED: membrane-anchored ubiquitin-fold ...  57.8    9e-08   Solanum lycopersicum
ref|XP_010320147.1|  PREDICTED: membrane-anchored ubiquitin-fold ...  58.5    9e-08   Solanum lycopersicum
ref|XP_006354034.1|  PREDICTED: membrane-anchored ubiquitin-fold ...  57.4    1e-07   Solanum tuberosum [potatoes]
ref|XP_009771581.1|  PREDICTED: membrane-anchored ubiquitin-fold ...  57.0    2e-07   Nicotiana sylvestris
ref|XP_009591939.1|  PREDICTED: membrane-anchored ubiquitin-fold ...  57.0    2e-07   Nicotiana tomentosiformis
ref|XP_010269154.1|  PREDICTED: membrane-anchored ubiquitin-fold ...  56.6    2e-07   Nelumbo nucifera [Indian lotus]
ref|XP_006827031.1|  hypothetical protein AMTR_s00010p00223360        55.5    7e-07   
ref|XP_007018878.1|  Membrane-anchored ubiquitin-fold protein 6 p...  55.1    7e-07   
ref|XP_004252547.1|  PREDICTED: membrane-anchored ubiquitin-fold ...  55.1    8e-07   Solanum lycopersicum
ref|XP_006360282.1|  PREDICTED: membrane-anchored ubiquitin-fold ...  54.7    9e-07   Solanum tuberosum [potatoes]
gb|KJB59137.1|  hypothetical protein B456_009G240600                  54.7    1e-06   Gossypium raimondii
gb|KHG05013.1|  Membrane-anchored ubiquitin-fold 5 -like protein      54.7    1e-06   Gossypium arboreum [tree cotton]
gb|KJB59138.1|  hypothetical protein B456_009G240600                  54.7    1e-06   Gossypium raimondii
ref|XP_009401077.1|  PREDICTED: membrane-anchored ubiquitin-fold ...  54.7    1e-06   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010926245.1|  PREDICTED: membrane-anchored ubiquitin-fold ...  54.3    1e-06   Elaeis guineensis
gb|ADE76616.1|  unknown                                               54.3    1e-06   Picea sitchensis
emb|CDP01184.1|  unnamed protein product                              53.9    2e-06   Coffea canephora [robusta coffee]
ref|XP_010905933.1|  PREDICTED: membrane-anchored ubiquitin-fold ...  53.5    3e-06   Elaeis guineensis
ref|XP_009789083.1|  PREDICTED: membrane-anchored ubiquitin-fold ...  53.1    4e-06   Nicotiana sylvestris
ref|XP_009617620.1|  PREDICTED: membrane-anchored ubiquitin-fold ...  53.1    4e-06   Nicotiana tomentosiformis
gb|KJB64358.1|  hypothetical protein B456_010G045000                  53.1    4e-06   Gossypium raimondii
ref|XP_010905932.1|  PREDICTED: membrane-anchored ubiquitin-fold ...  53.5    4e-06   Elaeis guineensis
ref|XP_010105864.1|  hypothetical protein L484_021519                 53.1    4e-06   
ref|XP_001777238.1|  predicted protein                                52.8    5e-06   
ref|XP_008780876.1|  PREDICTED: membrane-anchored ubiquitin-fold ...  52.8    5e-06   Phoenix dactylifera
ref|XP_009383194.1|  PREDICTED: membrane-anchored ubiquitin-fold ...  52.8    5e-06   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009383193.1|  PREDICTED: membrane-anchored ubiquitin-fold ...  52.4    6e-06   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008801008.1|  PREDICTED: membrane-anchored ubiquitin-fold ...  52.4    6e-06   Phoenix dactylifera
ref|XP_008780877.1|  PREDICTED: membrane-anchored ubiquitin-fold ...  52.4    6e-06   
gb|EYU43584.1|  hypothetical protein MIMGU_mgv1a016511mg              52.4    7e-06   Erythranthe guttata [common monkey flower]
ref|XP_002513864.1|  conserved hypothetical protein                   52.0    8e-06   Ricinus communis
ref|XP_008801007.1|  PREDICTED: membrane-anchored ubiquitin-fold ...  52.4    8e-06   Phoenix dactylifera
gb|KHG00624.1|  Membrane-anchored ubiquitin-fold 6 -like protein      52.0    9e-06   Gossypium arboreum [tree cotton]
ref|XP_010939604.1|  PREDICTED: membrane-anchored ubiquitin-fold ...  51.6    1e-05   Elaeis guineensis
ref|XP_011098040.1|  PREDICTED: membrane-anchored ubiquitin-fold ...  51.6    1e-05   Sesamum indicum [beniseed]
gb|ADE75780.1|  unknown                                               51.6    1e-05   Picea sitchensis
ref|XP_010939603.1|  PREDICTED: membrane-anchored ubiquitin-fold ...  52.0    1e-05   Elaeis guineensis
ref|XP_007225848.1|  hypothetical protein PRUPE_ppa013501mg           51.6    1e-05   Prunus persica
emb|CDY00416.1|  BnaC07g14100D                                        51.2    2e-05   
ref|XP_006434054.1|  hypothetical protein CICLE_v10002874mg           51.2    2e-05   
ref|XP_011465526.1|  PREDICTED: membrane-anchored ubiquitin-fold ...  51.2    2e-05   Fragaria vesca subsp. vesca
emb|CDP20158.1|  unnamed protein product                              50.1    2e-05   Coffea canephora [robusta coffee]
ref|XP_006434052.1|  hypothetical protein CICLE_v10002874mg           51.2    2e-05   
ref|XP_008352674.1|  PREDICTED: membrane-anchored ubiquitin-fold ...  50.8    2e-05   Malus domestica [apple tree]
ref|XP_009347209.1|  PREDICTED: membrane-anchored ubiquitin-fold ...  50.8    2e-05   Pyrus x bretschneideri [bai li]
ref|XP_009401284.1|  PREDICTED: membrane-anchored ubiquitin-fold ...  50.8    2e-05   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008378511.1|  PREDICTED: membrane-anchored ubiquitin-fold ...  50.4    3e-05   Malus domestica [apple tree]
emb|CDP19190.1|  unnamed protein product                              49.3    3e-05   Coffea canephora [robusta coffee]
ref|XP_009103265.1|  PREDICTED: membrane-anchored ubiquitin-fold ...  50.4    4e-05   Brassica rapa
gb|KDP32712.1|  hypothetical protein JCGZ_12004                       50.4    4e-05   Jatropha curcas
ref|XP_002512895.1|  conserved hypothetical protein                   50.1    4e-05   Ricinus communis
ref|XP_008798420.1|  PREDICTED: membrane-anchored ubiquitin-fold ...  50.1    4e-05   Phoenix dactylifera
ref|XP_008798419.1|  PREDICTED: membrane-anchored ubiquitin-fold ...  50.1    5e-05   Phoenix dactylifera
ref|XP_001765999.1|  predicted protein                                50.1    5e-05   
ref|XP_008790793.1|  PREDICTED: membrane-anchored ubiquitin-fold ...  50.1    5e-05   Phoenix dactylifera
gb|EPS66518.1|  hypothetical protein M569_08260                       49.7    7e-05   Genlisea aurea
emb|CDY04698.1|  BnaC05g17360D                                        49.3    8e-05   
emb|CDY30646.1|  BnaAnng04210D                                        49.3    9e-05   Brassica napus [oilseed rape]
ref|XP_009145379.1|  PREDICTED: membrane-anchored ubiquitin-fold ...  49.3    9e-05   Brassica rapa
ref|XP_009399542.1|  PREDICTED: membrane-anchored ubiquitin-fold ...  49.3    9e-05   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010916931.1|  PREDICTED: membrane-anchored ubiquitin-fold ...  49.3    1e-04   Elaeis guineensis
ref|XP_010916930.1|  PREDICTED: membrane-anchored ubiquitin-fold ...  49.3    1e-04   Elaeis guineensis
ref|XP_010916933.1|  PREDICTED: membrane-anchored ubiquitin-fold ...  48.9    1e-04   
ref|XP_002968410.1|  hypothetical protein SELMODRAFT_231107           48.9    1e-04   Selaginella moellendorffii
ref|XP_010916929.1|  PREDICTED: membrane-anchored ubiquitin-fold ...  48.9    1e-04   
ref|XP_001769332.1|  predicted protein                                48.5    1e-04   
ref|XP_006416236.1|  hypothetical protein EUTSA_v10009136mg           48.5    2e-04   Eutrema salsugineum [saltwater cress]
ref|XP_006447013.1|  hypothetical protein CICLE_v10017208mg           48.5    2e-04   Citrus clementina [clementine]
ref|XP_011045750.1|  PREDICTED: membrane-anchored ubiquitin-fold ...  47.8    3e-04   Populus euphratica
emb|CDP03432.1|  unnamed protein product                              48.1    4e-04   Coffea canephora [robusta coffee]
gb|EYU31845.1|  hypothetical protein MIMGU_mgv1a0165171mg             46.2    4e-04   Erythranthe guttata [common monkey flower]
ref|XP_011015326.1|  PREDICTED: membrane-anchored ubiquitin-fold ...  47.4    4e-04   Populus euphratica
gb|AFK46010.1|  unknown                                               47.4    5e-04   Lotus japonicus
ref|NP_001151697.1|  NTGP5                                            47.4    5e-04   Zea mays [maize]
gb|AFW85262.1|  NTGP5                                                 47.4    5e-04   
gb|KCW58217.1|  hypothetical protein EUGRSUZ_H00920                   47.4    6e-04   Eucalyptus grandis [rose gum]
ref|XP_010069778.1|  PREDICTED: membrane-anchored ubiquitin-fold ...  47.0    6e-04   
ref|XP_002890488.1|  ubiquitin family protein                         47.0    7e-04   
ref|XP_010069777.1|  PREDICTED: membrane-anchored ubiquitin-fold ...  47.8    7e-04   
gb|KCW58214.1|  hypothetical protein EUGRSUZ_H00920                   47.4    7e-04   Eucalyptus grandis [rose gum]
gb|AAF86549.1|AC069252_8  F2E2.12                                     46.6    8e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010556298.1|  PREDICTED: membrane-anchored ubiquitin-fold ...  46.6    8e-04   Tarenaya hassleriana [spider flower]
ref|NP_173624.1|  membrane-anchored ubiquitin-fold protein 6          46.6    8e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010069776.1|  PREDICTED: membrane-anchored ubiquitin-fold ...  47.4    8e-04   Eucalyptus grandis [rose gum]
ref|XP_009337543.1|  PREDICTED: membrane-anchored ubiquitin-fold ...  46.6    0.001   Pyrus x bretschneideri [bai li]
ref|XP_010521219.1|  PREDICTED: membrane-anchored ubiquitin-fold ...  46.6    0.001   Tarenaya hassleriana [spider flower]
ref|XP_007161692.1|  hypothetical protein PHAVU_001G090400g           46.6    0.001   Phaseolus vulgaris [French bean]



>ref|XP_010261181.1| PREDICTED: membrane-anchored ubiquitin-fold protein 3-like isoform 
X2 [Nelumbo nucifera]
Length=118

 Score = 58.9 bits (141),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +1

Query  460  MAAAELVDIKFRLADGTDIGPDKYGPSSTVGSLK  561
            MAA EL+++KFRL DGTDIGP+KY PS+TVGSLK
Sbjct  1    MAADELIELKFRLFDGTDIGPNKYNPSTTVGSLK  34



>ref|XP_010261178.1| PREDICTED: membrane-anchored ubiquitin-fold protein 3-like isoform 
X1 [Nelumbo nucifera]
 ref|XP_010261179.1| PREDICTED: membrane-anchored ubiquitin-fold protein 3-like isoform 
X1 [Nelumbo nucifera]
Length=147

 Score = 59.3 bits (142),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +1

Query  460  MAAAELVDIKFRLADGTDIGPDKYGPSSTVGSLK  561
            MAA EL+++KFRL DGTDIGP+KY PS+TVGSLK
Sbjct  1    MAADELIELKFRLFDGTDIGPNKYNPSTTVGSLK  34



>ref|XP_002285815.1| PREDICTED: membrane-anchored ubiquitin-fold protein 3 [Vitis 
vinifera]
 ref|XP_010664290.1| PREDICTED: membrane-anchored ubiquitin-fold protein 3 [Vitis 
vinifera]
 emb|CBI19110.3| unnamed protein product [Vitis vinifera]
Length=118

 Score = 58.2 bits (139),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +1

Query  460  MAAAELVDIKFRLADGTDIGPDKYGPSSTVGSLK  561
            MA  EL+++KFRLADGTDIGP+KY P+++VGSLK
Sbjct  1    MAGEELIELKFRLADGTDIGPNKYNPTTSVGSLK  34



>ref|XP_004237877.1| PREDICTED: membrane-anchored ubiquitin-fold protein 3 isoform 
X2 [Solanum lycopersicum]
Length=118

 Score = 57.8 bits (138),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +1

Query  460  MAAAELVDIKFRLADGTDIGPDKYGPSSTVGSLK  561
            MA  EL++IKFRLADG+DIGP+KY P++TVGSLK
Sbjct  1    MALKELIEIKFRLADGSDIGPNKYTPATTVGSLK  34



>ref|XP_010320147.1| PREDICTED: membrane-anchored ubiquitin-fold protein 3 isoform 
X1 [Solanum lycopersicum]
Length=183

 Score = 58.5 bits (140),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +1

Query  460  MAAAELVDIKFRLADGTDIGPDKYGPSSTVGSLK  561
            MA  EL++IKFRLADG+DIGP+KY P++TVGSLK
Sbjct  1    MALKELIEIKFRLADGSDIGPNKYTPATTVGSLK  34



>ref|XP_006354034.1| PREDICTED: membrane-anchored ubiquitin-fold protein 3-like [Solanum 
tuberosum]
Length=118

 Score = 57.4 bits (137),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +1

Query  460  MAAAELVDIKFRLADGTDIGPDKYGPSSTVGSLK  561
            MA  EL++IKFRLADG+DIGP+KY P++TVGSLK
Sbjct  1    MALKELIEIKFRLADGSDIGPNKYTPATTVGSLK  34



>ref|XP_009771581.1| PREDICTED: membrane-anchored ubiquitin-fold protein 6-like [Nicotiana 
sylvestris]
 ref|XP_009771582.1| PREDICTED: membrane-anchored ubiquitin-fold protein 6-like [Nicotiana 
sylvestris]
 ref|XP_009771583.1| PREDICTED: membrane-anchored ubiquitin-fold protein 6-like [Nicotiana 
sylvestris]
 ref|XP_009771585.1| PREDICTED: membrane-anchored ubiquitin-fold protein 6-like [Nicotiana 
sylvestris]
 gb|AAD00119.1| NTGP5 [Nicotiana tabacum]
Length=118

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +1

Query  460  MAAAELVDIKFRLADGTDIGPDKYGPSSTVGSLK  561
            MA  ELV+IKFRLADG+DIGP+KY  S+TVGSLK
Sbjct  1    MAVEELVEIKFRLADGSDIGPNKYASSTTVGSLK  34



>ref|XP_009591939.1| PREDICTED: membrane-anchored ubiquitin-fold protein 6-like [Nicotiana 
tomentosiformis]
 ref|XP_009591940.1| PREDICTED: membrane-anchored ubiquitin-fold protein 6-like [Nicotiana 
tomentosiformis]
 ref|XP_009591941.1| PREDICTED: membrane-anchored ubiquitin-fold protein 6-like [Nicotiana 
tomentosiformis]
Length=118

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +1

Query  460  MAAAELVDIKFRLADGTDIGPDKYGPSSTVGSLK  561
            MA  ELV+IKFRLADG+DIGP+KY  S+TVGSLK
Sbjct  1    MAVEELVEIKFRLADGSDIGPNKYASSTTVGSLK  34



>ref|XP_010269154.1| PREDICTED: membrane-anchored ubiquitin-fold protein 3-like [Nelumbo 
nucifera]
Length=117

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +1

Query  460  MAAAELVDIKFRLADGTDIGPDKYGPSSTVGSLK  561
            MA+ ELV++K RL +GTDIGP+KY PS+TVGSLK
Sbjct  1    MASDELVELKLRLCNGTDIGPNKYNPSTTVGSLK  34



>ref|XP_006827031.1| hypothetical protein AMTR_s00010p00223360 [Amborella trichopoda]
 gb|ERM94268.1| hypothetical protein AMTR_s00010p00223360 [Amborella trichopoda]
Length=129

 Score = 55.5 bits (132),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +1

Query  460  MAAAELVDIKFRLADGTDIGPDKYGPSSTVGSLK  561
            MA  EL+++KFRL DGTDIGP+KY P++T+GSLK
Sbjct  1    MAGEELLELKFRLYDGTDIGPNKYPPATTIGSLK  34



>ref|XP_007018878.1| Membrane-anchored ubiquitin-fold protein 6 precursor [Theobroma 
cacao]
 gb|EOY16103.1| Membrane-anchored ubiquitin-fold protein 6 precursor [Theobroma 
cacao]
Length=118

 Score = 55.1 bits (131),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +1

Query  460  MAAAELVDIKFRLADGTDIGPDKYGPSSTVGSLK  561
            MA  +LV++KFRLADGTDIGP KY P++TV SLK
Sbjct  1    MAGEDLVELKFRLADGTDIGPSKYSPATTVASLK  34



>ref|XP_004252547.1| PREDICTED: membrane-anchored ubiquitin-fold protein 6 [Solanum 
lycopersicum]
 ref|XP_004252548.1| PREDICTED: membrane-anchored ubiquitin-fold protein 6 [Solanum 
lycopersicum]
 ref|XP_004252549.1| PREDICTED: membrane-anchored ubiquitin-fold protein 6 [Solanum 
lycopersicum]
 ref|XP_010314464.1| PREDICTED: membrane-anchored ubiquitin-fold protein 6 [Solanum 
lycopersicum]
Length=118

 Score = 55.1 bits (131),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +1

Query  460  MAAAELVDIKFRLADGTDIGPDKYGPSSTVGSLK  561
            MA  ELV+IKFRLADG+DIGP+KY  S+TV SLK
Sbjct  1    MAVQELVEIKFRLADGSDIGPNKYASSTTVASLK  34



>ref|XP_006360282.1| PREDICTED: membrane-anchored ubiquitin-fold protein 6-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006360283.1| PREDICTED: membrane-anchored ubiquitin-fold protein 6-like isoform 
X2 [Solanum tuberosum]
 ref|XP_006360284.1| PREDICTED: membrane-anchored ubiquitin-fold protein 6-like isoform 
X3 [Solanum tuberosum]
 ref|XP_006360285.1| PREDICTED: membrane-anchored ubiquitin-fold protein 6-like isoform 
X4 [Solanum tuberosum]
 ref|XP_006360286.1| PREDICTED: membrane-anchored ubiquitin-fold protein 6-like isoform 
X5 [Solanum tuberosum]
Length=118

 Score = 54.7 bits (130),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +1

Query  460  MAAAELVDIKFRLADGTDIGPDKYGPSSTVGSLK  561
            MA  ELV+IKFRLADG+DIGP+KY  S+TV SLK
Sbjct  1    MAVQELVEIKFRLADGSDIGPNKYASSTTVASLK  34



>gb|KJB59137.1| hypothetical protein B456_009G240600 [Gossypium raimondii]
Length=118

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +1

Query  460  MAAAELVDIKFRLADGTDIGPDKYGPSSTVGSLK  561
            MA  +LV++KFRLADGTDIGP KY P++TV SLK
Sbjct  1    MAGEDLVELKFRLADGTDIGPSKYSPATTVASLK  34



>gb|KHG05013.1| Membrane-anchored ubiquitin-fold 5 -like protein [Gossypium arboreum]
Length=118

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +1

Query  460  MAAAELVDIKFRLADGTDIGPDKYGPSSTVGSLK  561
            MA  +LV++KFRLADGTDIGP KY P++TV SLK
Sbjct  1    MAGEDLVELKFRLADGTDIGPSKYSPATTVASLK  34



>gb|KJB59138.1| hypothetical protein B456_009G240600 [Gossypium raimondii]
Length=117

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +1

Query  460  MAAAELVDIKFRLADGTDIGPDKYGPSSTVGSLK  561
            MA  +LV++KFRLADGTDIGP KY P++TV SLK
Sbjct  1    MAGEDLVELKFRLADGTDIGPSKYSPATTVASLK  34



>ref|XP_009401077.1| PREDICTED: membrane-anchored ubiquitin-fold protein 3-like [Musa 
acuminata subsp. malaccensis]
Length=118

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +1

Query  460  MAAAELVDIKFRLADGTDIGPDKYGPSSTVGSLK  561
            MA  +L+++KFRL+DGTDIGP+KY PS+TV SLK
Sbjct  1    MAKEDLIELKFRLSDGTDIGPNKYDPSTTVASLK  34



>ref|XP_010926245.1| PREDICTED: membrane-anchored ubiquitin-fold protein 3-like [Elaeis 
guineensis]
Length=118

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +1

Query  460  MAAAELVDIKFRLADGTDIGPDKYGPSSTVGSLK  561
            MA  +L+D+KFRL DG+DIGPDKY PS+TV SLK
Sbjct  1    MAEDDLIDLKFRLFDGSDIGPDKYDPSTTVASLK  34



>gb|ADE76616.1| unknown [Picea sitchensis]
Length=114

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +1

Query  460  MAAAELVDIKFRLADGTDIGPDKYGPSSTVGSLK  561
            MA AE V++KFRL DGTDIGP++Y P++TV SLK
Sbjct  1    MAVAESVELKFRLYDGTDIGPNRYAPATTVASLK  34



>emb|CDP01184.1| unnamed protein product [Coffea canephora]
Length=118

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +1

Query  460  MAAAELVDIKFRLADGTDIGPDKYGPSSTVGSLK  561
            MA  +LV+IKFRLADG+DIGP K+ PS+TV SLK
Sbjct  1    MAVEDLVEIKFRLADGSDIGPSKFSPSTTVSSLK  34



>ref|XP_010905933.1| PREDICTED: membrane-anchored ubiquitin-fold protein 3-like isoform 
X2 [Elaeis guineensis]
Length=118

 Score = 53.5 bits (127),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +1

Query  460  MAAAELVDIKFRLADGTDIGPDKYGPSSTVGSLK  561
            MA  +L+++KFRL DGTDIGP+KY PS+TV SLK
Sbjct  1    MAGEDLIEVKFRLFDGTDIGPNKYDPSTTVTSLK  34



>ref|XP_009789083.1| PREDICTED: membrane-anchored ubiquitin-fold protein 3-like [Nicotiana 
sylvestris]
Length=118

 Score = 53.1 bits (126),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +1

Query  460  MAAAELVDIKFRLADGTDIGPDKYGPSSTVGSLK  561
            MAA EL++IKFRLADG+DIGP+KY P++ V +LK
Sbjct  1    MAAKELIEIKFRLADGSDIGPNKYMPNTRVDTLK  34



>ref|XP_009617620.1| PREDICTED: membrane-anchored ubiquitin-fold protein 3-like [Nicotiana 
tomentosiformis]
Length=118

 Score = 53.1 bits (126),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +1

Query  460  MAAAELVDIKFRLADGTDIGPDKYGPSSTVGSLK  561
            MAA EL++IKFRLADG+DIGP+KY P++ V +LK
Sbjct  1    MAAKELIEIKFRLADGSDIGPNKYMPNTRVDTLK  34



>gb|KJB64358.1| hypothetical protein B456_010G045000 [Gossypium raimondii]
Length=118

 Score = 53.1 bits (126),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +1

Query  460  MAAAELVDIKFRLADGTDIGPDKYGPSSTVGSLK  561
            MA  +LV++KFRLADGTDIGP KY P +T+ SLK
Sbjct  1    MAGEDLVELKFRLADGTDIGPTKYTPDTTIASLK  34



>ref|XP_010905932.1| PREDICTED: membrane-anchored ubiquitin-fold protein 3-like isoform 
X1 [Elaeis guineensis]
Length=143

 Score = 53.5 bits (127),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +1

Query  460  MAAAELVDIKFRLADGTDIGPDKYGPSSTVGSLK  561
            MA  +L+++KFRL DGTDIGP+KY PS+TV SLK
Sbjct  1    MAGEDLIEVKFRLFDGTDIGPNKYDPSTTVTSLK  34



>ref|XP_010105864.1| hypothetical protein L484_021519 [Morus notabilis]
 gb|EXC06683.1| hypothetical protein L484_021519 [Morus notabilis]
Length=135

 Score = 53.1 bits (126),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +1

Query  460  MAAAELVDIKFRLADGTDIGPDKYGPSSTVGSLK  561
            MA+ +L+++KFRL+DGTDIGP KY P+++V SLK
Sbjct  1    MASQDLIEVKFRLSDGTDIGPSKYSPTASVASLK  34



>ref|XP_001777238.1| predicted protein [Physcomitrella patens]
 gb|EDQ57893.1| predicted protein [Physcomitrella patens]
Length=118

 Score = 52.8 bits (125),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 20/34 (59%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +1

Query  460  MAAAELVDIKFRLADGTDIGPDKYGPSSTVGSLK  561
            M+  ELV++KFRL DGTDIGP++Y P++TV ++K
Sbjct  1    MSLEELVELKFRLHDGTDIGPNRYAPTTTVANMK  34



>ref|XP_008780876.1| PREDICTED: membrane-anchored ubiquitin-fold protein 3-like isoform 
X1 [Phoenix dactylifera]
Length=118

 Score = 52.8 bits (125),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +1

Query  460  MAAAELVDIKFRLADGTDIGPDKYGPSSTVGSLK  561
            MA  +L+++KFRL DG+DIGPDKY PS+TV SLK
Sbjct  1    MADDDLIELKFRLFDGSDIGPDKYDPSTTVASLK  34



>ref|XP_009383194.1| PREDICTED: membrane-anchored ubiquitin-fold protein 3-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=116

 Score = 52.8 bits (125),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +1

Query  460  MAAAELVDIKFRLADGTDIGPDKYGPSSTVGSLK  561
            MA  +L+++KFRL DGTDIGP+KY PS+TV SLK
Sbjct  1    MAGDDLIELKFRLFDGTDIGPNKYDPSTTVASLK  34



>ref|XP_009383193.1| PREDICTED: membrane-anchored ubiquitin-fold protein 3-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=118

 Score = 52.4 bits (124),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +1

Query  460  MAAAELVDIKFRLADGTDIGPDKYGPSSTVGSLK  561
            MA  +L+++KFRL DGTDIGP+KY PS+TV SLK
Sbjct  1    MAGDDLIELKFRLFDGTDIGPNKYDPSTTVASLK  34



>ref|XP_008801008.1| PREDICTED: membrane-anchored ubiquitin-fold protein 3 isoform 
X2 [Phoenix dactylifera]
Length=118

 Score = 52.4 bits (124),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +1

Query  460  MAAAELVDIKFRLADGTDIGPDKYGPSSTVGSLK  561
            MA  +L+++KFRL DGTD+GP+KY PS+TV SLK
Sbjct  1    MAGEDLIELKFRLFDGTDLGPNKYDPSTTVASLK  34



>ref|XP_008780877.1| PREDICTED: membrane-anchored ubiquitin-fold protein 3-like isoform 
X2 [Phoenix dactylifera]
Length=112

 Score = 52.4 bits (124),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +1

Query  460  MAAAELVDIKFRLADGTDIGPDKYGPSSTVGSLK  561
            MA  +L+++KFRL DG+DIGPDKY PS+TV SLK
Sbjct  1    MADDDLIELKFRLFDGSDIGPDKYDPSTTVASLK  34



>gb|EYU43584.1| hypothetical protein MIMGU_mgv1a016511mg [Erythranthe guttata]
Length=118

 Score = 52.4 bits (124),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +1

Query  460  MAAAELVDIKFRLADGTDIGPDKYGPSSTVGSLK  561
            MA  ELV++KFRLADG+DIGP KY  S+TV SLK
Sbjct  1    MATDELVELKFRLADGSDIGPSKYNSSATVSSLK  34



>ref|XP_002513864.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF48447.1| conserved hypothetical protein [Ricinus communis]
Length=118

 Score = 52.0 bits (123),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +1

Query  460  MAAAELVDIKFRLADGTDIGPDKYGPSSTVGSLK  561
            MA  +L+++KFRLADGTDIGP+KY P++TV +LK
Sbjct  1    MAGEDLIELKFRLADGTDIGPNKYTPATTVVTLK  34



>ref|XP_008801007.1| PREDICTED: membrane-anchored ubiquitin-fold protein 3 isoform 
X1 [Phoenix dactylifera]
Length=143

 Score = 52.4 bits (124),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +1

Query  460  MAAAELVDIKFRLADGTDIGPDKYGPSSTVGSLK  561
            MA  +L+++KFRL DGTD+GP+KY PS+TV SLK
Sbjct  1    MAGEDLIELKFRLFDGTDLGPNKYDPSTTVASLK  34



>gb|KHG00624.1| Membrane-anchored ubiquitin-fold 6 -like protein [Gossypium arboreum]
Length=118

 Score = 52.0 bits (123),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +1

Query  460  MAAAELVDIKFRLADGTDIGPDKYGPSSTVGSLK  561
            MA  +LV++KFRLADGTDIGP K+ P +TV SLK
Sbjct  1    MAGEDLVELKFRLADGTDIGPTKHTPDTTVASLK  34



>ref|XP_010939604.1| PREDICTED: membrane-anchored ubiquitin-fold protein 3 isoform 
X2 [Elaeis guineensis]
Length=118

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +1

Query  460  MAAAELVDIKFRLADGTDIGPDKYGPSSTVGSLK  561
            MA  +L+++KFRL DGTDIGP KY PS+TV SLK
Sbjct  1    MAGDDLIELKFRLFDGTDIGPSKYDPSTTVASLK  34



>ref|XP_011098040.1| PREDICTED: membrane-anchored ubiquitin-fold protein 3 [Sesamum 
indicum]
Length=118

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +1

Query  460  MAAAELVDIKFRLADGTDIGPDKYGPSSTVGSLK  561
            MA  ELV++KFRLADG+DIGP KY  S+TV SLK
Sbjct  1    MAGDELVELKFRLADGSDIGPSKYNSSTTVTSLK  34



>gb|ADE75780.1| unknown [Picea sitchensis]
Length=118

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +1

Query  460  MAAAELVDIKFRLADGTDIGPDKYGPSSTVGSLK  561
            MA  EL+++KFRL DGTDIGP KY P++T+ +LK
Sbjct  1    MAGGELLELKFRLYDGTDIGPHKYAPAATIATLK  34



>ref|XP_010939603.1| PREDICTED: membrane-anchored ubiquitin-fold protein 3 isoform 
X1 [Elaeis guineensis]
Length=143

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +1

Query  460  MAAAELVDIKFRLADGTDIGPDKYGPSSTVGSLK  561
            MA  +L+++KFRL DGTDIGP KY PS+TV SLK
Sbjct  1    MAGDDLIELKFRLFDGTDIGPSKYDPSTTVASLK  34



>ref|XP_007225848.1| hypothetical protein PRUPE_ppa013501mg [Prunus persica]
 ref|XP_008233977.1| PREDICTED: membrane-anchored ubiquitin-fold protein 6 [Prunus 
mume]
 gb|EMJ27047.1| hypothetical protein PRUPE_ppa013501mg [Prunus persica]
Length=119

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/33 (67%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +1

Query  463  AAAELVDIKFRLADGTDIGPDKYGPSSTVGSLK  561
            A  +L+++KFRL+DGTDIGP KY PS+TV SLK
Sbjct  3    AGQDLIELKFRLSDGTDIGPHKYSPSTTVQSLK  35



>emb|CDY00416.1| BnaC07g14100D [Brassica napus]
Length=114

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +1

Query  460  MAAAELVDIKFRLADGTDIGPDKYGPSSTVGSLK  561
            M + + +++KFRLADGTDIGP KY PS TV SLK
Sbjct  1    MGSEDWIELKFRLADGTDIGPSKYSPSMTVSSLK  34



>ref|XP_006434054.1| hypothetical protein CICLE_v10002874mg [Citrus clementina]
 gb|ESR47294.1| hypothetical protein CICLE_v10002874mg [Citrus clementina]
 gb|KDO80874.1| hypothetical protein CISIN_1g033522mg [Citrus sinensis]
Length=108

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +1

Query  460  MAAAELVDIKFRLADGTDIGPDKYGPSSTVGSLK  561
            MA  +L+++KFRLADG DIGP K+ P++TV SLK
Sbjct  1    MAGEDLIELKFRLADGADIGPSKFSPTTTVASLK  34



>ref|XP_011465526.1| PREDICTED: membrane-anchored ubiquitin-fold protein 6 [Fragaria 
vesca subsp. vesca]
Length=119

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 30/35 (86%), Gaps = 1/35 (3%)
 Frame = +1

Query  460  MAAAE-LVDIKFRLADGTDIGPDKYGPSSTVGSLK  561
            MAA + L+++KFRL+DGTDIGP KY P++TV SLK
Sbjct  1    MAATQDLIEVKFRLSDGTDIGPHKYSPAATVASLK  35



>emb|CDP20158.1| unnamed protein product [Coffea canephora]
Length=54

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +1

Query  460  MAAAELVDIKFRLADGTDIGPDKYGPSSTVGSLK  561
            MA  +LV++KFRLADG+DIGP K+ PS+ V SLK
Sbjct  1    MAVEDLVEMKFRLADGSDIGPSKFNPSTIVLSLK  34



>ref|XP_006434052.1| hypothetical protein CICLE_v10002874mg [Citrus clementina]
 ref|XP_006434053.1| hypothetical protein CICLE_v10002874mg [Citrus clementina]
 ref|XP_006434055.1| hypothetical protein CICLE_v10002874mg [Citrus clementina]
 ref|XP_006472658.1| PREDICTED: membrane-anchored ubiquitin-fold protein 6-like isoform 
X1 [Citrus sinensis]
 ref|XP_006472659.1| PREDICTED: membrane-anchored ubiquitin-fold protein 6-like isoform 
X2 [Citrus sinensis]
 ref|XP_006472660.1| PREDICTED: membrane-anchored ubiquitin-fold protein 6-like isoform 
X3 [Citrus sinensis]
 gb|ESR47292.1| hypothetical protein CICLE_v10002874mg [Citrus clementina]
 gb|ESR47293.1| hypothetical protein CICLE_v10002874mg [Citrus clementina]
 gb|ESR47295.1| hypothetical protein CICLE_v10002874mg [Citrus clementina]
 gb|KDO80869.1| hypothetical protein CISIN_1g033522mg [Citrus sinensis]
 gb|KDO80870.1| hypothetical protein CISIN_1g033522mg [Citrus sinensis]
 gb|KDO80871.1| hypothetical protein CISIN_1g033522mg [Citrus sinensis]
 gb|KDO80872.1| hypothetical protein CISIN_1g033522mg [Citrus sinensis]
Length=117

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +1

Query  460  MAAAELVDIKFRLADGTDIGPDKYGPSSTVGSLK  561
            MA  +L+++KFRLADG DIGP K+ P++TV SLK
Sbjct  1    MAGEDLIELKFRLADGADIGPSKFSPTTTVASLK  34



>ref|XP_008352674.1| PREDICTED: membrane-anchored ubiquitin-fold protein 3-like [Malus 
domestica]
Length=119

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/33 (67%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +1

Query  463  AAAELVDIKFRLADGTDIGPDKYGPSSTVGSLK  561
            A  +L+++KFRL DGTDIGP KY PS+TV SLK
Sbjct  3    AGQDLIELKFRLIDGTDIGPQKYSPSTTVQSLK  35



>ref|XP_009347209.1| PREDICTED: membrane-anchored ubiquitin-fold protein 3-like [Pyrus 
x bretschneideri]
Length=119

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 29/35 (83%), Gaps = 1/35 (3%)
 Frame = +1

Query  460  MAAAE-LVDIKFRLADGTDIGPDKYGPSSTVGSLK  561
            MAA + L+++KFRL DGTDIGP KY PS+TV SLK
Sbjct  1    MAAGQDLIELKFRLIDGTDIGPQKYSPSTTVQSLK  35



>ref|XP_009401284.1| PREDICTED: membrane-anchored ubiquitin-fold protein 3-like [Musa 
acuminata subsp. malaccensis]
Length=118

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +1

Query  460  MAAAELVDIKFRLADGTDIGPDKYGPSSTVGSLK  561
            MA  E +++KFRL DGTDIGP+K+ PS+TV SLK
Sbjct  1    MAEEESIELKFRLFDGTDIGPNKHDPSTTVASLK  34



>ref|XP_008378511.1| PREDICTED: membrane-anchored ubiquitin-fold protein 3 [Malus 
domestica]
 ref|XP_008347769.1| PREDICTED: membrane-anchored ubiquitin-fold protein 3-like [Malus 
domestica]
 ref|XP_009345520.1| PREDICTED: membrane-anchored ubiquitin-fold protein 3-like [Pyrus 
x bretschneideri]
Length=119

 Score = 50.4 bits (119),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/33 (67%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +1

Query  463  AAAELVDIKFRLADGTDIGPDKYGPSSTVGSLK  561
            A  +L+++KFRL DGTDIGP KY PS+TV SLK
Sbjct  3    AGQDLIELKFRLFDGTDIGPQKYSPSTTVQSLK  35



>emb|CDP19190.1| unnamed protein product [Coffea canephora]
Length=54

 Score = 49.3 bits (116),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +1

Query  460  MAAAELVDIKFRLADGTDIGPDKYGPSSTVGSLK  561
            MA  +L+++KFRLADG+DIGP K+ PS+ V SLK
Sbjct  1    MAVEDLIEMKFRLADGSDIGPSKFSPSTIVLSLK  34



>ref|XP_009103265.1| PREDICTED: membrane-anchored ubiquitin-fold protein 6-like [Brassica 
rapa]
 emb|CDY01299.1| BnaA07g10720D [Brassica napus]
Length=114

 Score = 50.4 bits (119),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +1

Query  460  MAAAELVDIKFRLADGTDIGPDKYGPSSTVGSLK  561
            M   + +++KFRLADGTDIGP KY PS TV SLK
Sbjct  1    MGGEDWIELKFRLADGTDIGPTKYSPSMTVSSLK  34



>gb|KDP32712.1| hypothetical protein JCGZ_12004 [Jatropha curcas]
Length=118

 Score = 50.4 bits (119),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +1

Query  460  MAAAELVDIKFRLADGTDIGPDKYGPSSTVGSLK  561
            MA  +L+++KFRLADGTDIGP KY P+++V +LK
Sbjct  1    MAGEDLIELKFRLADGTDIGPSKYSPATSVLTLK  34



>ref|XP_002512895.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF49398.1| conserved hypothetical protein [Ricinus communis]
Length=118

 Score = 50.1 bits (118),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +1

Query  460  MAAAELVDIKFRLADGTDIGPDKYGPSSTVGSLK  561
            M   E+V++KFRL DGTDIGP +Y P+STVG LK
Sbjct  1    MPEEEVVELKFRLYDGTDIGPFRYSPASTVGMLK  34



>ref|XP_008798420.1| PREDICTED: membrane-anchored ubiquitin-fold protein 3-like isoform 
X2 [Phoenix dactylifera]
Length=118

 Score = 50.1 bits (118),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +1

Query  460  MAAAELVDIKFRLADGTDIGPDKYGPSSTVGSLK  561
            MA  + +++KFRL DG+DIGPDKY PS+TV SLK
Sbjct  1    MAEDDSIELKFRLFDGSDIGPDKYDPSTTVASLK  34



>ref|XP_008798419.1| PREDICTED: membrane-anchored ubiquitin-fold protein 3-like isoform 
X1 [Phoenix dactylifera]
Length=121

 Score = 50.1 bits (118),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +1

Query  460  MAAAELVDIKFRLADGTDIGPDKYGPSSTVGSLK  561
            MA  + +++KFRL DG+DIGPDKY PS+TV SLK
Sbjct  1    MAEDDSIELKFRLFDGSDIGPDKYDPSTTVASLK  34



>ref|XP_001765999.1| predicted protein [Physcomitrella patens]
 gb|EDQ69058.1| predicted protein [Physcomitrella patens]
Length=117

 Score = 50.1 bits (118),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +1

Query  460  MAAAELVDIKFRLADGTDIGPDKYGPSSTVGSLK  561
            MA  E V++KFRL DGTDIGP+KY P++TV ++K
Sbjct  1    MALEEPVELKFRLYDGTDIGPNKYPPATTVANIK  34



>ref|XP_008790793.1| PREDICTED: membrane-anchored ubiquitin-fold protein 3-like [Phoenix 
dactylifera]
Length=118

 Score = 50.1 bits (118),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +1

Query  460  MAAAELVDIKFRLADGTDIGPDKYGPSSTVGSLK  561
            MA  +L+++KFRL DGTDI P+KY PS+TV SLK
Sbjct  1    MAGDDLIELKFRLFDGTDIEPNKYDPSTTVASLK  34



>gb|EPS66518.1| hypothetical protein M569_08260 [Genlisea aurea]
Length=118

 Score = 49.7 bits (117),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +1

Query  460  MAAAELVDIKFRLADGTDIGPDKYGPSSTVGSLK  561
            MA  ELV++KFRLADG+DIGP KY  +++V SLK
Sbjct  1    MATDELVELKFRLADGSDIGPSKYNSTASVSSLK  34



>emb|CDY04698.1| BnaC05g17360D [Brassica napus]
Length=118

 Score = 49.3 bits (116),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +1

Query  460  MAAAELVDIKFRLADGTDIGPDKYGPSSTVGSLK  561
            MA  + +++KFRLADGTDIGP KY  S TV SLK
Sbjct  1    MAGEDWIELKFRLADGTDIGPSKYNQSMTVSSLK  34



>emb|CDY30646.1| BnaAnng04210D [Brassica napus]
Length=118

 Score = 49.3 bits (116),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +1

Query  460  MAAAELVDIKFRLADGTDIGPDKYGPSSTVGSLK  561
            MA  + +++KFRLADGTDIGP KY  S TV SLK
Sbjct  1    MAGEDWIELKFRLADGTDIGPSKYNQSMTVSSLK  34



>ref|XP_009145379.1| PREDICTED: membrane-anchored ubiquitin-fold protein 6 [Brassica 
rapa]
Length=118

 Score = 49.3 bits (116),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +1

Query  460  MAAAELVDIKFRLADGTDIGPDKYGPSSTVGSLK  561
            MA  + +++KFRLADGTDIGP KY  S TV SLK
Sbjct  1    MAGEDWIELKFRLADGTDIGPSKYNQSMTVSSLK  34



>ref|XP_009399542.1| PREDICTED: membrane-anchored ubiquitin-fold protein 3-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009399543.1| PREDICTED: membrane-anchored ubiquitin-fold protein 3-like [Musa 
acuminata subsp. malaccensis]
Length=118

 Score = 49.3 bits (116),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +1

Query  460  MAAAELVDIKFRLADGTDIGPDKYGPSSTVGSLK  561
            MA  + +++KFRL DGTDIGP KY P++TV SLK
Sbjct  1    MAGEDSIEVKFRLFDGTDIGPSKYDPTTTVASLK  34



>ref|XP_010916931.1| PREDICTED: membrane-anchored ubiquitin-fold protein 3-like isoform 
X3 [Elaeis guineensis]
Length=118

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +1

Query  460  MAAAELVDIKFRLADGTDIGPDKYGPSSTVGSLK  561
            MA  + +++KFRL DG+DIGPDKY P++TV SLK
Sbjct  1    MAQDDSIELKFRLFDGSDIGPDKYDPATTVASLK  34



>ref|XP_010916930.1| PREDICTED: membrane-anchored ubiquitin-fold protein 3-like isoform 
X2 [Elaeis guineensis]
Length=121

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +1

Query  460  MAAAELVDIKFRLADGTDIGPDKYGPSSTVGSLK  561
            MA  + +++KFRL DG+DIGPDKY P++TV SLK
Sbjct  1    MAQDDSIELKFRLFDGSDIGPDKYDPATTVASLK  34



>ref|XP_010916933.1| PREDICTED: membrane-anchored ubiquitin-fold protein 3-like isoform 
X4 [Elaeis guineensis]
Length=114

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +1

Query  460  MAAAELVDIKFRLADGTDIGPDKYGPSSTVGSLK  561
            MA  + +++KFRL DG+DIGPDKY P++TV SLK
Sbjct  1    MAQDDSIELKFRLFDGSDIGPDKYDPATTVASLK  34



>ref|XP_002968410.1| hypothetical protein SELMODRAFT_231107 [Selaginella moellendorffii]
 ref|XP_002970571.1| hypothetical protein SELMODRAFT_231614 [Selaginella moellendorffii]
 gb|EFJ28701.1| hypothetical protein SELMODRAFT_231614 [Selaginella moellendorffii]
 gb|EFJ30664.1| hypothetical protein SELMODRAFT_231107 [Selaginella moellendorffii]
Length=120

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 31/36 (86%), Gaps = 2/36 (6%)
 Frame = +1

Query  460  MAAA--ELVDIKFRLADGTDIGPDKYGPSSTVGSLK  561
            MAAA  EL+++KFRL+DG+DIGP KY P++T+ +LK
Sbjct  1    MAAAGQELLELKFRLSDGSDIGPYKYAPATTIATLK  36



>ref|XP_010916929.1| PREDICTED: membrane-anchored ubiquitin-fold protein 3-like isoform 
X1 [Elaeis guineensis]
Length=126

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +1

Query  460  MAAAELVDIKFRLADGTDIGPDKYGPSSTVGSLK  561
            MA  + +++KFRL DG+DIGPDKY P++TV SLK
Sbjct  1    MAQDDSIELKFRLFDGSDIGPDKYDPATTVASLK  34



>ref|XP_001769332.1| predicted protein [Physcomitrella patens]
 gb|EDQ65886.1| predicted protein [Physcomitrella patens]
Length=118

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/34 (59%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +1

Query  460  MAAAELVDIKFRLADGTDIGPDKYGPSSTVGSLK  561
            M+  E V++KFRL DGTDIGP+KY P++TV ++K
Sbjct  1    MSLEEPVELKFRLYDGTDIGPNKYPPATTVANIK  34



>ref|XP_006416236.1| hypothetical protein EUTSA_v10009136mg [Eutrema salsugineum]
 gb|ESQ34589.1| hypothetical protein EUTSA_v10009136mg [Eutrema salsugineum]
Length=118

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +1

Query  460  MAAAELVDIKFRLADGTDIGPDKYGPSSTVGSLK  561
            MA  + +++KFRLADGTDIGP KY  S TV SLK
Sbjct  1    MAGEDCIELKFRLADGTDIGPSKYDQSMTVSSLK  34



>ref|XP_006447013.1| hypothetical protein CICLE_v10017208mg [Citrus clementina]
 ref|XP_006470107.1| PREDICTED: membrane-anchored ubiquitin-fold protein 4-like [Citrus 
sinensis]
 gb|ESR60253.1| hypothetical protein CICLE_v10017208mg [Citrus clementina]
 gb|KDO63868.1| hypothetical protein CISIN_1g033470mg [Citrus sinensis]
Length=118

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +1

Query  460  MAAAELVDIKFRLADGTDIGPDKYGPSSTVGSLK  561
            M   ELV++KFRL DG+DIGP +Y P+STV  LK
Sbjct  1    MPEEELVELKFRLYDGSDIGPFRYSPTSTVAMLK  34



>ref|XP_011045750.1| PREDICTED: membrane-anchored ubiquitin-fold protein 4 [Populus 
euphratica]
 ref|XP_011045752.1| PREDICTED: membrane-anchored ubiquitin-fold protein 4 [Populus 
euphratica]
 ref|XP_011045753.1| PREDICTED: membrane-anchored ubiquitin-fold protein 4 [Populus 
euphratica]
 ref|XP_011045754.1| PREDICTED: membrane-anchored ubiquitin-fold protein 4 [Populus 
euphratica]
Length=118

 Score = 47.8 bits (112),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +1

Query  460  MAAAELVDIKFRLADGTDIGPDKYGPSSTVGSLK  561
            M   ELV++KFRL DG+DIGP +Y P+STV  LK
Sbjct  1    MPEEELVELKFRLYDGSDIGPFRYSPASTVSMLK  34



>emb|CDP03432.1| unnamed protein product [Coffea canephora]
Length=156

 Score = 48.1 bits (113),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +1

Query  460  MAAAELVDIKFRLADGTDIGPDKYGPSSTVGSLK  561
            M   +LV++KFRLADG+DIGP K+ PS+ V SLK
Sbjct  1    MVVEDLVEMKFRLADGSDIGPSKFSPSTIVLSLK  34



>gb|EYU31845.1| hypothetical protein MIMGU_mgv1a0165171mg, partial [Erythranthe 
guttata]
Length=43

 Score = 46.2 bits (108),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 20/34 (59%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +1

Query  460  MAAAELVDIKFRLADGTDIGPDKYGPSSTVGSLK  561
            M   +LV++KFRL DG+DIGP +Y P+STV  LK
Sbjct  1    MPEEDLVELKFRLYDGSDIGPFRYSPASTVAMLK  34



>ref|XP_011015326.1| PREDICTED: membrane-anchored ubiquitin-fold protein 4-like [Populus 
euphratica]
Length=118

 Score = 47.4 bits (111),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +1

Query  460  MAAAELVDIKFRLADGTDIGPDKYGPSSTVGSLK  561
            M   ELV++KFRL DG+DIGP +Y P+STV  LK
Sbjct  1    MPEEELVELKFRLYDGSDIGPFRYSPASTVSMLK  34



>gb|AFK46010.1| unknown [Lotus japonicus]
Length=118

 Score = 47.4 bits (111),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 20/34 (59%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +1

Query  460  MAAAELVDIKFRLADGTDIGPDKYGPSSTVGSLK  561
            M   ELV++KFR+ DG+DIGP +Y P+STV  LK
Sbjct  1    MPEEELVELKFRIYDGSDIGPFRYSPTSTVAMLK  34



>ref|NP_001151697.1| NTGP5 [Zea mays]
 gb|ACG44000.1| NTGP5 [Zea mays]
Length=118

 Score = 47.4 bits (111),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 19/30 (63%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +1

Query  472  ELVDIKFRLADGTDIGPDKYGPSSTVGSLK  561
            E +++KFRL+DGTDIGP KY P++TV +LK
Sbjct  6    EPIEVKFRLSDGTDIGPSKYDPNTTVAALK  35



>gb|AFW85262.1| NTGP5 [Zea mays]
Length=118

 Score = 47.4 bits (111),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 19/30 (63%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +1

Query  472  ELVDIKFRLADGTDIGPDKYGPSSTVGSLK  561
            E +++KFRL+DGTDIGP KY P++TV +LK
Sbjct  6    EPIEVKFRLSDGTDIGPSKYDPNTTVAALK  35



>gb|KCW58217.1| hypothetical protein EUGRSUZ_H00920 [Eucalyptus grandis]
Length=133

 Score = 47.4 bits (111),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 20/29 (69%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = +1

Query  475  LVDIKFRLADGTDIGPDKYGPSSTVGSLK  561
            L+++KFRLADG+DIGP KY P+ TV SLK
Sbjct  6    LIELKFRLADGSDIGPTKYSPAMTVASLK  34



>ref|XP_010069778.1| PREDICTED: membrane-anchored ubiquitin-fold protein 5-like isoform 
X3 [Eucalyptus grandis]
 ref|XP_010069779.1| PREDICTED: membrane-anchored ubiquitin-fold protein 5-like isoform 
X3 [Eucalyptus grandis]
 ref|XP_010069780.1| PREDICTED: membrane-anchored ubiquitin-fold protein 5-like isoform 
X3 [Eucalyptus grandis]
 gb|KCW58215.1| hypothetical protein EUGRSUZ_H00920 [Eucalyptus grandis]
 gb|KCW58216.1| hypothetical protein EUGRSUZ_H00920 [Eucalyptus grandis]
Length=118

 Score = 47.0 bits (110),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 20/29 (69%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = +1

Query  475  LVDIKFRLADGTDIGPDKYGPSSTVGSLK  561
            L+++KFRLADG+DIGP KY P+ TV SLK
Sbjct  6    LIELKFRLADGSDIGPTKYSPAMTVASLK  34



>ref|XP_002890488.1| ubiquitin family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH66747.1| ubiquitin family protein [Arabidopsis lyrata subsp. lyrata]
Length=119

 Score = 47.0 bits (110),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 26/35 (74%), Gaps = 1/35 (3%)
 Frame = +1

Query  460  MAAAE-LVDIKFRLADGTDIGPDKYGPSSTVGSLK  561
            MA  E  +++KFRLADGTDIGP KY  S TV SLK
Sbjct  1    MAGEEDWIELKFRLADGTDIGPSKYNQSMTVSSLK  35



>ref|XP_010069777.1| PREDICTED: membrane-anchored ubiquitin-fold protein 5-like isoform 
X2 [Eucalyptus grandis]
Length=161

 Score = 47.8 bits (112),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 20/29 (69%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = +1

Query  475  LVDIKFRLADGTDIGPDKYGPSSTVGSLK  561
            L+++KFRLADG+DIGP KY P+ TV SLK
Sbjct  6    LIELKFRLADGSDIGPTKYSPAMTVASLK  34



>gb|KCW58214.1| hypothetical protein EUGRSUZ_H00920 [Eucalyptus grandis]
Length=152

 Score = 47.4 bits (111),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 20/29 (69%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = +1

Query  475  LVDIKFRLADGTDIGPDKYGPSSTVGSLK  561
            L+++KFRLADG+DIGP KY P+ TV SLK
Sbjct  6    LIELKFRLADGSDIGPTKYSPAMTVASLK  34



>gb|AAF86549.1|AC069252_8 F2E2.12 [Arabidopsis thaliana]
Length=114

 Score = 46.6 bits (109),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 26/35 (74%), Gaps = 1/35 (3%)
 Frame = +1

Query  460  MAAAE-LVDIKFRLADGTDIGPDKYGPSSTVGSLK  561
            MA  E  +++KFRLADGTDIGP KY  S TV SLK
Sbjct  1    MAGEEDWIELKFRLADGTDIGPSKYNQSMTVSSLK  35



>ref|XP_010556298.1| PREDICTED: membrane-anchored ubiquitin-fold protein 4 [Tarenaya 
hassleriana]
Length=119

 Score = 46.6 bits (109),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 20/34 (59%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +1

Query  460  MAAAELVDIKFRLADGTDIGPDKYGPSSTVGSLK  561
            M   ELV++KFRL DG+DIGP  Y P++TV +LK
Sbjct  1    MPEEELVELKFRLYDGSDIGPFHYSPAATVATLK  34



>ref|NP_173624.1| membrane-anchored ubiquitin-fold protein 6 [Arabidopsis thaliana]
 sp|Q8GWJ6.1|MUB6_ARATH RecName: Full=Membrane-anchored ubiquitin-fold protein 6; Short=AtMUB6; 
Short=Membrane-anchored ub-fold protein 6; Flags: 
Precursor [Arabidopsis thaliana]
 dbj|BAC43392.1| unknown protein [Arabidopsis thaliana]
 gb|AAO63873.1| unknown protein [Arabidopsis thaliana]
 gb|AEE30189.1| membrane-anchored ubiquitin-fold protein 6 [Arabidopsis thaliana]
Length=119

 Score = 46.6 bits (109),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 26/35 (74%), Gaps = 1/35 (3%)
 Frame = +1

Query  460  MAAAE-LVDIKFRLADGTDIGPDKYGPSSTVGSLK  561
            MA  E  +++KFRLADGTDIGP KY  S TV SLK
Sbjct  1    MAGEEDWIELKFRLADGTDIGPSKYNQSMTVSSLK  35



>ref|XP_010069776.1| PREDICTED: membrane-anchored ubiquitin-fold protein 5-like isoform 
X1 [Eucalyptus grandis]
 gb|KCW58213.1| hypothetical protein EUGRSUZ_H00920 [Eucalyptus grandis]
Length=162

 Score = 47.4 bits (111),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 20/29 (69%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = +1

Query  475  LVDIKFRLADGTDIGPDKYGPSSTVGSLK  561
            L+++KFRLADG+DIGP KY P+ TV SLK
Sbjct  6    LIELKFRLADGSDIGPTKYSPAMTVASLK  34



>ref|XP_009337543.1| PREDICTED: membrane-anchored ubiquitin-fold protein 3-like [Pyrus 
x bretschneideri]
 ref|XP_009337544.1| PREDICTED: membrane-anchored ubiquitin-fold protein 3-like [Pyrus 
x bretschneideri]
Length=118

 Score = 46.6 bits (109),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = +1

Query  460  MAAAELVDIKFRLADGTDIGPDKYGPSSTVGSLK  561
            MA  +LVDIKFRL DGTDIGP  Y  +STV  LK
Sbjct  1    MAEEDLVDIKFRLYDGTDIGPFSYSSASTVDMLK  34



>ref|XP_010521219.1| PREDICTED: membrane-anchored ubiquitin-fold protein 6 isoform 
X2 [Tarenaya hassleriana]
Length=118

 Score = 46.6 bits (109),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 20/34 (59%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +1

Query  460  MAAAELVDIKFRLADGTDIGPDKYGPSSTVGSLK  561
            M+  + +++KFRLADG+DIGP KY  S TV SLK
Sbjct  1    MSGEDWIELKFRLADGSDIGPSKYSQSMTVASLK  34



>ref|XP_007161692.1| hypothetical protein PHAVU_001G090400g [Phaseolus vulgaris]
 gb|ESW33686.1| hypothetical protein PHAVU_001G090400g [Phaseolus vulgaris]
Length=119

 Score = 46.6 bits (109),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 20/34 (59%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +1

Query  460  MAAAELVDIKFRLADGTDIGPDKYGPSSTVGSLK  561
            M   ELV++KFRL DG+D+GP +Y P+STV  LK
Sbjct  1    MPEEELVELKFRLYDGSDMGPFRYSPASTVSMLK  34



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 644970849880