BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001O04

Length=528
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009766381.1|  PREDICTED: early light-induced protein, chlo...    204   5e-63   Nicotiana sylvestris
ref|XP_004247605.1|  PREDICTED: early light-induced protein 1, ch...    204   6e-63   
ref|XP_004247604.1|  PREDICTED: early light-induced protein 1, ch...    203   1e-62   
ref|XP_006363471.1|  PREDICTED: early light-induced protein, chlo...    201   8e-62   Solanum tuberosum [potatoes]
gb|ADM72804.1|  early light-inducible protein                           192   2e-58   Capsicum annuum
ref|XP_009616081.1|  PREDICTED: early light-induced protein, chlo...    187   3e-56   Nicotiana tomentosiformis
ref|XP_009778398.1|  PREDICTED: early light-induced protein, chlo...    182   3e-54   Nicotiana sylvestris
gb|AAO33591.1|AF479309_1  putative early light induced protein          174   4e-51   Arachis hypogaea [goober]
gb|AFK41568.1|  unknown                                                 174   5e-51   Lotus japonicus
gb|AFK38527.1|  unknown                                                 172   3e-50   Lotus japonicus
ref|XP_002517068.1|  early light-induced protein, putative              171   5e-50   Ricinus communis
ref|XP_007034868.1|  Early light-induced protein, putative              171   7e-50   
gb|ACB20694.1|  putative cold-inducible protein                         171   8e-50   Camellia sinensis [black tea]
gb|ACV89760.1|  putative early light induced protein 2                  169   3e-49   Camellia sinensis [black tea]
ref|XP_011027193.1|  PREDICTED: early light-induced protein 1, ch...    167   1e-48   Populus euphratica
ref|XP_006420038.1|  hypothetical protein CICLE_v10006006mg             167   2e-48   Citrus clementina [clementine]
ref|XP_002312551.2|  hypothetical protein POPTR_0008s15770g             166   2e-48   
ref|XP_011027158.1|  PREDICTED: early light-induced protein 1, ch...    166   3e-48   Populus euphratica
gb|AFK48277.1|  unknown                                                 165   9e-48   Lotus japonicus
ref|XP_006379854.1|  early light-induced protein precursor              164   2e-47   Populus trichocarpa [western balsam poplar]
gb|AFK38098.1|  unknown                                                 164   4e-47   Lotus japonicus
ref|XP_004496671.1|  PREDICTED: early light-induced protein, chlo...    164   5e-47   Cicer arietinum [garbanzo]
ref|XP_002312552.2|  early light-induced protein precursor              162   6e-47   Populus trichocarpa [western balsam poplar]
ref|XP_010107710.1|  hypothetical protein L484_013325                   162   1e-46   Morus notabilis
ref|XP_010326693.1|  PREDICTED: early light-induced protein 1, ch...    160   1e-46   
ref|XP_007143316.1|  hypothetical protein PHAVU_007G062000g             161   3e-46   Phaseolus vulgaris [French bean]
ref|XP_010279261.1|  PREDICTED: early light-induced protein 1, ch...    161   3e-46   Nelumbo nucifera [Indian lotus]
ref|XP_010279259.1|  PREDICTED: early light-induced protein 1, ch...    161   3e-46   
gb|KEH43786.1|  early light-induced-like protein                        161   4e-46   Medicago truncatula
ref|XP_010107713.1|  hypothetical protein L484_013328                   161   4e-46   Morus notabilis
ref|XP_011027169.1|  PREDICTED: early light-induced protein 1, ch...    160   5e-46   Populus euphratica
gb|AAQ21120.1|  early light inducible protein                           160   7e-46   Trifolium pratense [peavine clover]
ref|XP_002312550.2|  hypothetical protein POPTR_0008s15760g             160   8e-46   
ref|NP_001267842.1|  uncharacterized protein LOC100263179               160   1e-45   Vitis vinifera
ref|XP_011027181.1|  PREDICTED: early light-induced protein 2, ch...    159   1e-45   Populus euphratica
ref|XP_008224239.1|  PREDICTED: early light-induced protein 1, ch...    159   2e-45   Prunus mume [ume]
gb|AAK63815.1|AF383622_1  early light inducible protein                 159   2e-45   Medicago sativa [alfalfa]
gb|ACU13898.1|  unknown                                                 159   2e-45   Glycine max [soybeans]
ref|XP_007225862.1|  hypothetical protein PRUPE_ppa011739mg             159   3e-45   Prunus persica
ref|XP_010043033.1|  PREDICTED: early light-induced protein 1, ch...    159   4e-45   Eucalyptus grandis [rose gum]
gb|ABQ01425.1|  early light inducible protein                           158   5e-45   Medicago falcata [sickle alfalfa]
sp|P11432.1|ELI_PEA  RecName: Full=Early light-induced protein, c...    158   6e-45   Pisum sativum [garden pea]
ref|XP_011090668.1|  PREDICTED: early light-induced protein 2, ch...    157   8e-45   Sesamum indicum [beniseed]
gb|ABU98940.1|  early light-induced protein 3                           157   8e-45   Rhododendron catawbiense [Catawba rosebay]
ref|XP_004296581.1|  PREDICTED: early light-induced protein 1, ch...    157   9e-45   Fragaria vesca subsp. vesca
ref|XP_010043034.1|  PREDICTED: early light-induced protein 1, ch...    157   1e-44   Eucalyptus grandis [rose gum]
gb|AFK35794.1|  unknown                                                 157   1e-44   Medicago truncatula
gb|KEH43785.1|  early light-induced-like protein                        157   1e-44   Medicago truncatula
ref|XP_007225864.1|  hypothetical protein PRUPE_ppa011747mg             157   1e-44   Prunus persica
emb|CDY10676.1|  BnaA05g16860D                                          157   2e-44   Brassica napus [oilseed rape]
gb|AFK46043.1|  unknown                                                 157   2e-44   Medicago truncatula
ref|XP_009145258.1|  PREDICTED: early light-induced protein 1, ch...    156   2e-44   Brassica rapa
gb|KEH43766.1|  early light-induced-like protein                        156   3e-44   Medicago truncatula
emb|CDO99111.1|  unnamed protein product                                156   3e-44   Coffea canephora [robusta coffee]
ref|XP_010488320.1|  PREDICTED: early light-induced protein 1, ch...    156   4e-44   Camelina sativa [gold-of-pleasure]
ref|XP_004134120.1|  PREDICTED: early light-induced protein, chlo...    155   5e-44   Cucumis sativus [cucumbers]
ref|XP_006414662.1|  hypothetical protein EUTSA_v10026335mg             155   6e-44   Eutrema salsugineum [saltwater cress]
ref|NP_001235754.1|  early light-induced protein                        155   6e-44   
ref|XP_008364578.1|  PREDICTED: early light-induced protein 1, ch...    155   6e-44   Malus domestica [apple tree]
gb|ABU98938.1|  early light-induced protein 1                           155   7e-44   Rhododendron catawbiense [Catawba rosebay]
ref|XP_006298609.1|  hypothetical protein CARUB_v10014694mg             155   8e-44   Capsella rubella
ref|XP_010440414.1|  PREDICTED: early light-induced protein 2, ch...    154   1e-43   Camelina sativa [gold-of-pleasure]
ref|XP_010440411.1|  PREDICTED: early light-induced protein 2, ch...    154   1e-43   Camelina sativa [gold-of-pleasure]
ref|XP_010043032.1|  PREDICTED: early light-induced protein 1, ch...    154   2e-43   Eucalyptus grandis [rose gum]
gb|ABU98939.1|  early light-induced protein 2                           154   2e-43   Rhododendron catawbiense [Catawba rosebay]
ref|XP_010511764.1|  PREDICTED: early light-induced protein 1, ch...    154   2e-43   Camelina sativa [gold-of-pleasure]
ref|XP_011090667.1|  PREDICTED: early light-induced protein 1, ch...    154   2e-43   Sesamum indicum [beniseed]
ref|XP_010435090.1|  PREDICTED: early light-induced protein 2, ch...    154   2e-43   Camelina sativa [gold-of-pleasure]
gb|KFK23555.1|  hypothetical protein AALP_AAs41881U000100               154   3e-43   Arabis alpina [alpine rockcress]
ref|XP_010450010.1|  PREDICTED: early light-induced protein 2, ch...    153   3e-43   Camelina sativa [gold-of-pleasure]
ref|XP_006414664.1|  hypothetical protein EUTSA_v10026318mg             153   4e-43   Eutrema salsugineum [saltwater cress]
gb|AAM67121.1|  light-induced protein-like protein                      153   5e-43   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006420039.1|  hypothetical protein CICLE_v10005974mg             153   6e-43   Citrus clementina [clementine]
emb|CBI26312.3|  unnamed protein product                                152   7e-43   Vitis vinifera
ref|XP_010466577.1|  PREDICTED: early light-induced protein 1, ch...    152   8e-43   Camelina sativa [gold-of-pleasure]
ref|XP_009108614.1|  PREDICTED: early light-induced protein 1, ch...    152   8e-43   Brassica rapa
ref|XP_010435089.1|  PREDICTED: early light-induced protein 2, ch...    152   9e-43   Camelina sativa [gold-of-pleasure]
gb|AFD62760.1|  ELIP                                                    153   1e-42   Citrus sinensis [apfelsine]
emb|CDY29755.1|  BnaA01g19110D                                          152   1e-42   Brassica napus [oilseed rape]
ref|XP_010450011.1|  PREDICTED: early light-induced protein 2, ch...    152   1e-42   Camelina sativa [gold-of-pleasure]
ref|XP_010440412.1|  PREDICTED: early light-induced protein 2, ch...    152   1e-42   Camelina sativa [gold-of-pleasure]
ref|XP_002870293.1|  hypothetical protein ARALYDRAFT_330043             155   1e-42   
ref|XP_008392721.1|  PREDICTED: early light-induced protein 1, ch...    151   2e-42   
gb|AAD28779.1|AF134132_1  early light-inducable protein                 151   2e-42   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010435088.1|  PREDICTED: early light-induced protein 2, ch...    152   2e-42   Camelina sativa [gold-of-pleasure]
gb|KCW84128.1|  hypothetical protein EUGRSUZ_B01004                     151   2e-42   Eucalyptus grandis [rose gum]
ref|XP_010450014.1|  PREDICTED: early light-induced protein 2, ch...    151   2e-42   Camelina sativa [gold-of-pleasure]
ref|NP_567438.1|  early light-inducible protein 2                       151   2e-42   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009148406.1|  PREDICTED: early light-induced protein 2, ch...    150   4e-42   Brassica rapa
ref|XP_010435087.1|  PREDICTED: early light-induced protein 2, ch...    150   4e-42   Camelina sativa [gold-of-pleasure]
emb|CDY46608.1|  BnaCnng14300D                                          150   4e-42   Brassica napus [oilseed rape]
ref|XP_010440410.1|  PREDICTED: early light-induced protein 2, ch...    150   5e-42   Camelina sativa [gold-of-pleasure]
gb|ABU98942.1|  early light-induced protein 5                           150   6e-42   Rhododendron catawbiense [Catawba rosebay]
ref|XP_010450013.1|  PREDICTED: early light-induced protein 2, ch...    150   7e-42   Camelina sativa [gold-of-pleasure]
emb|CDY10312.1|  BnaC05g29670D                                          150   7e-42   Brassica napus [oilseed rape]
gb|EYU41436.1|  hypothetical protein MIMGU_mgv1a014191mg                150   7e-42   Erythranthe guttata [common monkey flower]
ref|XP_002885526.1|  early light-inducable protein                      149   8e-42   Arabidopsis lyrata subsp. lyrata
ref|XP_006285275.1|  hypothetical protein CARUB_v10006649mg             149   1e-41   Capsella rubella
ref|XP_006285225.1|  hypothetical protein CARUB_v10006584mg             149   1e-41   Capsella rubella
emb|CDY67220.1|  BnaCnng53960D                                          149   1e-41   Brassica napus [oilseed rape]
ref|XP_004289994.1|  PREDICTED: early light-induced protein 1, ch...    149   2e-41   Fragaria vesca subsp. vesca
ref|XP_006588384.1|  PREDICTED: uncharacterized protein LOC100306...    149   2e-41   
gb|KCW84134.1|  hypothetical protein EUGRSUZ_B01008                     150   2e-41   Eucalyptus grandis [rose gum]
ref|XP_010034436.1|  PREDICTED: early light-induced protein 1, ch...    149   2e-41   Eucalyptus grandis [rose gum]
ref|XP_010045776.1|  PREDICTED: early light-induced protein 1, ch...    147   3e-41   
ref|NP_001237842.1|  uncharacterized protein LOC100306375               148   3e-41   
ref|XP_003637637.1|  Early light inducible protein                      147   3e-41   
gb|ABU98944.1|  early light-induced protein 7                           148   4e-41   Rhododendron catawbiense [Catawba rosebay]
ref|XP_010279260.1|  PREDICTED: early light-induced protein 1, ch...    146   4e-41   
gb|KHN02753.1|  Early light-induced protein, chloroplastic              148   4e-41   Glycine soja [wild soybean]
emb|CAB10248.1|  light induced protein like                             151   5e-41   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010034506.1|  PREDICTED: early light-induced protein 1, ch...    147   5e-41   Eucalyptus grandis [rose gum]
gb|KFK39567.1|  hypothetical protein AALP_AA3G261100                    148   5e-41   Arabis alpina [alpine rockcress]
ref|XP_010043035.1|  PREDICTED: early light-induced protein 1, ch...    147   5e-41   Eucalyptus grandis [rose gum]
ref|XP_010043036.1|  PREDICTED: early light-induced protein 1, ch...    147   6e-41   
gb|KFK23556.1|  hypothetical protein AALP_AAs41881U000200               147   7e-41   Arabis alpina [alpine rockcress]
gb|ABU98943.1|  early light-induced protein 6                           147   8e-41   Rhododendron catawbiense [Catawba rosebay]
ref|XP_009135830.1|  PREDICTED: early light-induced protein 1, ch...    147   9e-41   Brassica rapa
emb|CDX92959.1|  BnaA03g36810D                                          147   1e-40   
gb|KCW84135.1|  hypothetical protein EUGRSUZ_B01008                     148   1e-40   Eucalyptus grandis [rose gum]
gb|KHG26201.1|  Early light-induced, chloroplastic                      147   1e-40   Gossypium arboreum [tree cotton]
ref|XP_010034491.1|  PREDICTED: early light-induced protein 1, ch...    146   2e-40   Eucalyptus grandis [rose gum]
ref|XP_004289995.1|  PREDICTED: early light-induced protein 1, ch...    146   2e-40   Fragaria vesca subsp. vesca
ref|XP_011028244.1|  PREDICTED: early light-induced protein 1, ch...    144   2e-40   Populus euphratica
gb|KEH43789.1|  early light-induced-like protein                        146   3e-40   Medicago truncatula
gb|KHN15724.1|  Early light-induced protein, chloroplastic              145   3e-40   Glycine soja [wild soybean]
ref|XP_010045777.1|  PREDICTED: early light-induced protein 1, ch...    145   4e-40   Eucalyptus grandis [rose gum]
gb|KJB38210.1|  hypothetical protein B456_006G242600                    145   4e-40   Gossypium raimondii
gb|KCW84133.1|  hypothetical protein EUGRSUZ_B010071                    144   4e-40   Eucalyptus grandis [rose gum]
ref|XP_008341015.1|  PREDICTED: early light-induced protein 1, ch...    145   5e-40   
ref|XP_006406123.1|  hypothetical protein EUTSA_v10021557mg             145   6e-40   Eutrema salsugineum [saltwater cress]
ref|XP_010525221.1|  PREDICTED: early light-induced protein 1, ch...    145   7e-40   Tarenaya hassleriana [spider flower]
gb|KCW85053.1|  hypothetical protein EUGRSUZ_B01896                     144   7e-40   Eucalyptus grandis [rose gum]
gb|ABU98941.1|  early light-induced protein 4                           144   7e-40   Rhododendron catawbiense [Catawba rosebay]
gb|AAL32038.1|AF439279_1  early light-induced protein-like protein      143   8e-40   Retama raetam [retem]
ref|NP_188923.1|  chlorophyll A-B binding, early light-inducible ...    144   1e-39   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009371939.1|  PREDICTED: early light-induced protein 1, ch...    144   1e-39   Pyrus x bretschneideri [bai li]
emb|CDY42783.1|  BnaC01g22830D                                          144   2e-39   Brassica napus [oilseed rape]
gb|KEH43787.1|  early light-induced-like protein                        143   2e-39   Medicago truncatula
ref|XP_008438620.1|  PREDICTED: early light-induced protein 1, ch...    142   6e-39   Cucumis melo [Oriental melon]
gb|KCW84141.1|  hypothetical protein EUGRSUZ_B01008                     140   7e-39   Eucalyptus grandis [rose gum]
ref|XP_006286322.1|  hypothetical protein CARUB_v100071911mg            140   8e-39   
ref|XP_009341096.1|  PREDICTED: early light-induced protein 1, ch...    142   8e-39   Pyrus x bretschneideri [bai li]
gb|KCW84137.1|  hypothetical protein EUGRSUZ_B01008                     143   9e-39   Eucalyptus grandis [rose gum]
ref|XP_009375990.1|  PREDICTED: early light-induced protein 1, ch...    142   1e-38   Pyrus x bretschneideri [bai li]
ref|XP_010034484.1|  PREDICTED: early light-induced protein 1, ch...    141   1e-38   Eucalyptus grandis [rose gum]
ref|XP_004292245.1|  PREDICTED: early light-induced protein 1, ch...    142   1e-38   Fragaria vesca subsp. vesca
ref|XP_010676775.1|  PREDICTED: early light-induced protein 1, ch...    141   2e-38   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008224237.1|  PREDICTED: early light-induced protein 1, ch...    140   5e-38   Prunus mume [ume]
gb|ADV19257.1|  putative cold-inducible protein-like protein            139   5e-38   Helleborus orientalis [lenten-rose]
ref|XP_007224626.1|  hypothetical protein PRUPE_ppa026587mg             139   7e-38   Prunus persica
ref|XP_007225903.1|  hypothetical protein PRUPE_ppa011907mg             139   9e-38   Prunus persica
gb|KCW84143.1|  hypothetical protein EUGRSUZ_B01008                     137   1e-37   Eucalyptus grandis [rose gum]
ref|XP_008224234.1|  PREDICTED: early light-induced protein 1, ch...    137   2e-37   
ref|XP_010676773.1|  PREDICTED: early light-induced protein 2, ch...    137   4e-37   Beta vulgaris subsp. vulgaris [field beet]
gb|EPS65382.1|  early light inducible protein                           137   5e-37   Genlisea aurea
ref|XP_008224236.1|  PREDICTED: early light-induced protein 1, ch...    137   6e-37   Prunus mume [ume]
gb|ACJ09655.1|  putative cold-inducible protein                         136   6e-37   Cupressus sempervirens
gb|KDP40234.1|  hypothetical protein JCGZ_02232                         137   1e-36   Jatropha curcas
ref|XP_007226151.1|  hypothetical protein PRUPE_ppa014920mg             135   4e-36   Prunus persica
ref|XP_010935701.1|  PREDICTED: early light-induced protein 1, ch...    134   5e-36   Elaeis guineensis
ref|XP_010935694.1|  PREDICTED: early light-induced protein 1, ch...    134   6e-36   Elaeis guineensis
ref|XP_009337531.1|  PREDICTED: early light-induced protein 1, ch...    134   1e-35   Pyrus x bretschneideri [bai li]
ref|XP_010923519.1|  PREDICTED: early light-induced protein 1, ch...    134   1e-35   Elaeis guineensis
emb|CAA63338.1|  unnamed protein product                                133   2e-35   Helianthus annuus
ref|XP_009413904.1|  PREDICTED: early light-induced protein 1, ch...    133   2e-35   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010676774.1|  PREDICTED: early light-induced protein 2, ch...    132   5e-35   Beta vulgaris subsp. vulgaris [field beet]
gb|AGH13359.1|  early light-inducible protein                           130   5e-35   Helianthus annuus
ref|XP_008786056.1|  PREDICTED: early light-induced protein 1, ch...    132   6e-35   Phoenix dactylifera
ref|XP_008391008.1|  PREDICTED: early light-induced protein 1, ch...    132   6e-35   
gb|AGH13354.1|  early light-inducible protein                           129   6e-35   Helianthus annuus
ref|XP_006838940.1|  hypothetical protein AMTR_s00002p00270470          131   1e-34   Amborella trichopoda
ref|XP_009343962.1|  PREDICTED: early light-induced protein 1, ch...    130   2e-34   Pyrus x bretschneideri [bai li]
gb|ABK22971.1|  unknown                                                 130   3e-34   Picea sitchensis
ref|XP_008224238.1|  PREDICTED: early light-induced protein 1, ch...    130   3e-34   Prunus mume [ume]
ref|XP_008360362.1|  PREDICTED: early light-induced protein 1, ch...    130   4e-34   
ref|XP_008360363.1|  PREDICTED: early light-induced protein 1, ch...    130   5e-34   
ref|XP_009343966.1|  PREDICTED: early light-induced protein 1, ch...    129   8e-34   Pyrus x bretschneideri [bai li]
ref|XP_009343965.1|  PREDICTED: early light-induced protein 1, ch...    129   8e-34   Pyrus x bretschneideri [bai li]
ref|XP_009341094.1|  PREDICTED: early light-induced protein 1, ch...    129   8e-34   Pyrus x bretschneideri [bai li]
ref|XP_009341095.1|  PREDICTED: early light-induced protein 1, ch...    129   9e-34   Pyrus x bretschneideri [bai li]
gb|AGH13356.1|  early light-inducible protein                           126   1e-33   Helianthus annuus
ref|XP_008777102.1|  PREDICTED: early light-induced protein 1, ch...    128   2e-33   
sp|Q01931.1|DS22_CRAPL  RecName: Full=Desiccation stress protein ...    129   2e-33   Craterostigma plantagineum
ref|XP_009343974.1|  PREDICTED: early light-induced protein 1, ch...    127   2e-33   
gb|ABK24316.1|  unknown                                                 128   3e-33   Picea sitchensis
gb|AEW08119.1|  hypothetical protein 2_114_01                           125   3e-33   Pinus radiata
gb|ABR16737.1|  unknown                                                 126   3e-33   Picea sitchensis
gb|AFG63029.1|  hypothetical protein 2_114_01                           125   3e-33   Pinus taeda
ref|XP_009341105.1|  PREDICTED: early light-induced protein 1, ch...    125   8e-33   Pyrus x bretschneideri [bai li]
gb|ACN39996.1|  unknown                                                 127   8e-33   Picea sitchensis
ref|XP_009341102.1|  PREDICTED: early light-induced protein 1, ch...    125   2e-32   Pyrus x bretschneideri [bai li]
ref|XP_009341101.1|  PREDICTED: early light-induced protein 1, ch...    125   2e-32   Pyrus x bretschneideri [bai li]
ref|XP_009341107.1|  PREDICTED: early light-induced protein 1, ch...    126   2e-32   
gb|ABR16462.1|  unknown                                                 123   7e-32   Picea sitchensis
ref|XP_003557495.1|  PREDICTED: high molecular mass early light-i...    123   2e-31   Brachypodium distachyon [annual false brome]
gb|ACN40010.1|  unknown                                                 122   3e-31   Picea sitchensis
gb|EMT18433.1|  High molecular mass early light-inducible protein...    122   3e-31   
gb|ABK24238.1|  unknown                                                 121   8e-31   Picea sitchensis
gb|AFP90212.1|  early light-induced protein                             119   9e-31   Pinus armandii [Armand pine]
dbj|BAJ86766.1|  predicted protein                                      120   3e-30   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ97969.1|  predicted protein                                      120   4e-30   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ86949.1|  predicted protein                                      119   4e-30   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMS57269.1|  hypothetical protein TRIUR3_20794                       119   4e-30   Triticum urartu
ref|XP_009586916.1|  PREDICTED: early light-induced protein 2, ch...    116   1e-29   Nicotiana tomentosiformis
ref|XP_010228291.1|  PREDICTED: high molecular mass early light-i...    118   1e-29   Brachypodium distachyon [annual false brome]
ref|XP_002461536.1|  hypothetical protein SORBIDRAFT_02g004380          119   2e-29   Sorghum bicolor [broomcorn]
dbj|BAJ90265.1|  predicted protein                                      118   2e-29   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003557497.1|  PREDICTED: low molecular mass early light-in...    117   2e-29   Brachypodium distachyon [annual false brome]
gb|EMT24337.1|  High molecular mass early light-inducible protein...    117   2e-29   
ref|XP_004955632.1|  PREDICTED: low molecular mass early light-in...    117   2e-29   Setaria italica
ref|XP_011463234.1|  PREDICTED: early light-induced protein 1, ch...    116   4e-29   Fragaria vesca subsp. vesca
dbj|BAJ89047.1|  predicted protein                                      117   4e-29   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004955631.1|  PREDICTED: high molecular mass early light-i...    117   5e-29   Setaria italica
dbj|BAJ90110.1|  predicted protein                                      116   6e-29   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001152683.1|  early light-induced protein                        116   9e-29   
ref|NP_001152927.1|  early light-induced protein                        116   1e-28   
ref|NP_001152703.1|  early light-induced protein                        116   1e-28   
gb|ACG24515.1|  early light-induced protein                             116   1e-28   Zea mays [maize]
ref|XP_004955633.1|  PREDICTED: low molecular mass early light-in...    115   1e-28   Setaria italica
sp|P14895.1|ELI5_HORVU  RecName: Full=High molecular mass early l...    116   2e-28   Hordeum vulgare [barley]
ref|NP_001059030.1|  Os07g0178800                                       115   2e-28   
dbj|BAD30330.1|  putative low molecular mass early light-induced ...    115   2e-28   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006379855.1|  hypothetical protein POPTR_0008s15800g             111   4e-28   
ref|XP_009622523.1|  PREDICTED: early light-induced protein 2, ch...    114   4e-28   Nicotiana tomentosiformis
ref|XP_009615000.1|  PREDICTED: early light-induced protein 2, ch...    114   5e-28   Nicotiana tomentosiformis
tpg|DAA42559.1|  TPA: early light-induced protein                       113   1e-27   
ref|XP_004955634.1|  PREDICTED: low molecular mass early light-in...    112   2e-27   Setaria italica
gb|AFP90187.1|  early light-induced protein                             110   2e-27   Pinus densata
gb|EMT23518.1|  hypothetical protein F775_14184                         113   3e-27   
gb|EMS68027.1|  hypothetical protein TRIUR3_23641                       111   7e-27   Triticum urartu
ref|XP_003557498.1|  PREDICTED: low molecular mass early light-in...    110   8e-27   Brachypodium distachyon [annual false brome]
ref|XP_002980561.1|  LHC-related protein                                111   8e-27   Selaginella moellendorffii
ref|XP_002976832.1|  LHC-related protein                                110   1e-26   Selaginella moellendorffii
ref|NP_001152179.1|  early light-induced protein                        110   1e-26   
gb|EMS45625.1|  hypothetical protein TRIUR3_10356                       109   2e-26   Triticum urartu
gb|EAY73277.1|  hypothetical protein OsI_01151                          110   2e-26   Oryza sativa Indica Group [Indian rice]
gb|EMS65479.1|  hypothetical protein TRIUR3_00475                       109   2e-26   Triticum urartu
gb|ACG27686.1|  early light-induced protein                             109   3e-26   Zea mays [maize]
gb|ACG24151.1|  early light-induced protein                             109   3e-26   Zea mays [maize]
ref|XP_002461537.1|  hypothetical protein SORBIDRAFT_02g004390          109   3e-26   
ref|NP_001059029.1|  Os07g0178700                                       109   4e-26   
ref|NP_001105051.1|  early light-inducible protein ELIP                 108   7e-26   
dbj|BAJ88670.1|  predicted protein                                      107   9e-26   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EAZ02969.1|  hypothetical protein OsI_25109                          108   9e-26   Oryza sativa Indica Group [Indian rice]
sp|P14896.1|ELI6_HORVU  RecName: Full=Low molecular mass early li...    107   1e-25   Hordeum vulgare [barley]
dbj|BAJ86624.1|  predicted protein                                      107   1e-25   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMS45333.1|  hypothetical protein TRIUR3_35028                       108   1e-25   Triticum urartu
gb|ACI87755.1|  putative early light-induced protein                    105   1e-25   Cupressus sempervirens
dbj|BAJ91644.1|  predicted protein                                      107   1e-25   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ84888.1|  predicted protein                                      107   2e-25   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001042574.1|  Os01g0246400                                       107   2e-25   
sp|P14897.1|ELI9_HORVU  RecName: Full=Low molecular mass early li...    107   2e-25   Hordeum vulgare [barley]
gb|EMS65481.1|  hypothetical protein TRIUR3_00477                       106   2e-25   Triticum urartu
gb|EMT03102.1|  Low molecular mass early light-inducible protein ...    106   2e-25   
gb|EMS51739.1|  hypothetical protein TRIUR3_09306                       107   2e-25   Triticum urartu
gb|EMT08136.1|  Low molecular mass early light-inducible protein ...    106   3e-25   
dbj|BAJ90447.1|  predicted protein                                      106   3e-25   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ98694.1|  predicted protein                                      106   3e-25   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDJ26488.1|  unnamed protein product                                104   1e-24   Triticum aestivum [Canadian hard winter wheat]
gb|KJB38211.1|  hypothetical protein B456_006G242700                    103   3e-24   Gossypium raimondii
dbj|BAA76309.1|  early light-inducible protein                          103   3e-24   Triticum aestivum [Canadian hard winter wheat]
emb|CDJ26491.1|  unnamed protein product                                103   3e-24   Triticum aestivum [Canadian hard winter wheat]
gb|ABR15761.1|  early light-inducible protein                           103   3e-24   Spirogyra varians
gb|KHG26202.1|  Early light-induced, chloroplastic                      103   3e-24   Gossypium arboreum [tree cotton]
gb|AFP90175.1|  early light-induced protein                           99.4    5e-23   Pinus yunnanensis [Yunnan pine]
gb|AFP90174.1|  early light-induced protein                           99.4    5e-23   Pinus yunnanensis [Yunnan pine]
gb|AFP90157.1|  early light-induced protein                           98.2    1e-22   Pinus densata
ref|XP_003557500.1|  PREDICTED: low molecular mass early light-in...  98.6    3e-22   Brachypodium distachyon [annual false brome]
ref|XP_003557499.1|  PREDICTED: low molecular mass early light-in...  97.8    5e-22   Brachypodium distachyon [annual false brome]
gb|AFP90210.1|  early light-induced protein                           95.5    2e-21   Pinus densata
gb|AFP90201.1|  early light-induced protein                           93.2    1e-20   Pinus yunnanensis [Yunnan pine]
ref|XP_007210927.1|  hypothetical protein PRUPE_ppa027213mg           93.2    1e-20   
gb|AFP90166.1|  early light-induced protein                           92.8    1e-20   Pinus densata
gb|AFP90182.1|  early light-induced protein                           92.8    1e-20   Pinus densata
gb|AFP90167.1|  early light-induced protein                           92.8    1e-20   Pinus yunnanensis [Yunnan pine]
gb|AFP90192.1|  early light-induced protein                           92.8    1e-20   Pinus yunnanensis [Yunnan pine]
gb|AFP90205.1|  early light-induced protein                           92.8    1e-20   Pinus tabuliformis [southern Chinese pine]
gb|AFP90162.1|  early light-induced protein                           92.8    1e-20   Pinus tabuliformis [southern Chinese pine]
gb|AFP90185.1|  early light-induced protein                           92.8    2e-20   
gb|AFP90160.1|  early light-induced protein                           92.8    2e-20   
gb|AFP90168.1|  early light-induced protein                           92.8    2e-20   
gb|AFP90179.1|  early light-induced protein                           92.4    2e-20   
gb|AFP90211.1|  early light-induced protein                           92.4    2e-20   
gb|ACI87803.1|  putative early light-induced protein                  92.8    2e-20   
gb|AFP90159.1|  early light-induced protein                           92.0    3e-20   
ref|XP_010497961.1|  PREDICTED: early light-induced protein 1, ch...  90.1    4e-20   
ref|XP_006493973.1|  PREDICTED: uncharacterized protein LOC102620537  94.7    5e-20   
gb|AFP90180.1|  early light-induced protein                           90.9    7e-20   
gb|AFP90158.1|  early light-induced protein                           90.9    7e-20   
gb|AFP90193.1|  early light-induced protein                           90.9    9e-20   
gb|AFP90197.1|  early light-induced protein                           90.5    1e-19   
gb|AAP80747.1|  early light-induced protein                           89.0    1e-19   
gb|AFP90177.1|  early light-induced protein                           90.1    1e-19   
gb|AFP90164.1|  early light-induced protein                           89.7    2e-19   
gb|EMS68026.1|  hypothetical protein TRIUR3_23640                     90.5    5e-19   
gb|AFP90204.1|  early light-induced protein                           87.4    2e-18   
gb|AFP90176.1|  early light-induced protein                           86.7    3e-18   
gb|EMT08135.1|  hypothetical protein F775_02149                       87.4    3e-18   
ref|XP_006386973.1|  hypothetical protein POPTR_2515s00200g           84.3    8e-18   
gb|KDP40233.1|  hypothetical protein JCGZ_02231                       83.2    5e-17   
gb|ACI87806.1|  putative early light-induced protein                  82.8    1e-16   
ref|XP_001757063.1|  early light-induced protein 6                    78.2    6e-15   
ref|XP_001779289.1|  predicted protein                                77.8    1e-14   
gb|AFD61608.1|  putative early light-inducible protein 2              78.6    1e-14   
ref|XP_001765645.1|  early light-induced protein 8                    79.3    2e-14   
dbj|BAJ87895.1|  predicted protein                                    75.9    4e-14   
ref|XP_005647188.1|  hypothetical protein COCSUDRAFT_63786            75.9    8e-14   
ref|XP_001754855.1|  predicted protein                                75.1    1e-13   
ref|XP_001781652.1|  predicted protein                                75.1    1e-13   
ref|WP_039311765.1|  hypothetical protein                             73.2    2e-13   
ref|XP_001771612.1|  early light-induced protein 10                   74.7    3e-13   
ref|XP_001774160.1|  early light-induced protein 9                    74.3    4e-13   
gb|KCW84132.1|  hypothetical protein EUGRSUZ_B010072                  72.8    4e-13   
ref|XP_005851999.1|  hypothetical protein CHLNCDRAFT_13796            71.6    1e-12   
ref|XP_009623411.1|  PREDICTED: desiccation stress protein DSP-22...  69.7    3e-12   
gb|AAK59377.1|  early light-inducible protein ELIPB                   71.2    4e-12   
ref|XP_010045778.1|  PREDICTED: early light-induced protein 1, ch...  70.1    5e-12   
gb|ABI79071.1|  chloroplast carotene biosynthesis-related protein     69.7    1e-11   
gb|AAK59376.1|  early light-inducible protein ELIPA                   69.7    2e-11   
ref|XP_001775741.1|  early light-induced protein 12                   69.3    2e-11   
ref|XP_002978298.1|  LHC-related protein                              69.3    2e-11   
ref|XP_001783605.1|  early light-induced protein 5                    68.9    2e-11   
ref|XP_001753766.1|  early light-induced protein 1                    68.6    2e-11   
gb|AAB25012.1|  early light-inducible protein homolog                 68.6    4e-11   
ref|XP_001753653.1|  early light-induced protein 3                    67.8    7e-11   
ref|XP_002970600.1|  LHC-related protein                              67.8    8e-11   
gb|KIZ07947.1|  Carotene biosynthesis-related protein CBR             67.0    1e-10   
ref|XP_002968437.1|  LHC-related protein                              67.4    1e-10   
ref|XP_005651515.1|  hypothetical protein COCSUDRAFT_59463            66.6    1e-10   
ref|XP_001779648.1|  early light-induced protein 13                   66.6    2e-10   
ref|XP_002506128.1|  early light induced protein-like protein, ch...  66.2    2e-10   
ref|XP_001778462.1|  early light-induced protein 4                    66.2    3e-10   
dbj|BAD27891.1|  putative early light-induced protein, low molecu...  65.5    5e-10   
gb|ACJ09609.1|  putative early light-induced protein                  63.5    7e-10   
gb|ACJ09653.1|  putative early light-induced protein                  63.5    1e-09   
ref|XP_002966276.1|  LHC-related protein                              63.9    2e-09   
gb|AAP44626.1|  putative low molecular mass early light-inducible...  63.5    2e-09   
gb|EMS51551.1|  hypothetical protein TRIUR3_06314                     61.2    3e-09   
gb|EEE60635.1|  hypothetical protein OsJ_14071                        62.0    5e-09   
ref|NP_001172891.1|  Os02g0265550                                     61.6    5e-09   
sp|P27516.1|CBR_DUNSA  RecName: Full=Carotene biosynthesis-relate...  62.0    5e-09   
ref|XP_007034869.1|  Uncharacterized protein TCM_020705               60.5    6e-09   
ref|XP_005649925.1|  hypothetical protein COCSUDRAFT_61600            64.7    6e-09   
emb|CAA79273.1|  early light-inducible protein                        62.4    7e-09   
ref|XP_005848720.1|  hypothetical protein CHLNCDRAFT_21915            60.5    7e-09   
ref|XP_001694210.1|  predicted protein                                60.5    8e-09   
ref|XP_007227407.1|  hypothetical protein PRUPE_ppb019918mg           59.3    9e-09   
ref|XP_005643265.1|  hypothetical protein COCSUDRAFT_60029            61.2    1e-08   
gb|AAB70536.1|  low molecular early light-inducible protein           60.5    1e-08   
gb|EMS51552.1|  hypothetical protein TRIUR3_06315                     60.1    2e-08   
ref|XP_001694751.1|  early light-inducible protein                    59.3    4e-08   
gb|KDO74447.1|  hypothetical protein CISIN_1g045593mg                 57.8    5e-08   
ref|XP_002954801.1|  hypothetical protein VOLCADRAFT_76453            58.9    5e-08   
ref|XP_006420037.1|  hypothetical protein CICLE_v10006775mg           57.4    6e-08   
ref|XP_001695978.1|  early light-inducible protein                    58.5    7e-08   
gb|AAX92667.1|  chloroplast carotene biosynthesis related protein     58.5    7e-08   
ref|XP_005642666.1|  hypothetical protein COCSUDRAFT_20912            56.6    1e-07   
gb|EMS49711.1|  hypothetical protein TRIUR3_31915                     57.4    1e-07   
ref|XP_005648653.1|  chlorophyll a/b-binding protein                  57.4    2e-07   
ref|XP_001760998.1|  early light-induced protein 11                   53.1    2e-06   
gb|KIZ04465.1|  hypothetical protein MNEG_3496                        52.8    4e-06   
ref|XP_002952327.1|  hypothetical protein VOLCADRAFT_105462           53.1    8e-06   
gb|AFD61607.1|  putative early light-inducible protein 1              52.4    1e-05   
gb|ABF96631.1|  hypothetical protein LOC_Os03g30400                   50.8    2e-05   
gb|KIZ07472.1|  early light-inducible protein                         51.2    3e-05   
ref|XP_002947126.1|  hypothetical protein VOLCADRAFT_103348           50.8    5e-05   
ref|XP_011397347.1|  Oxidoreductase HTATIP2                           51.6    6e-05   
ref|XP_002502857.1|  early light induced protein-like 5, chloropl...  51.2    7e-05   
ref|XP_005645007.1|  hypothetical protein COCSUDRAFT_18438            49.7    8e-05   
ref|XP_001694681.1|  early light-inducible protein                    50.4    8e-05   
ref|XP_007513716.1|  early light induced protein-like 6, chloropl...  50.4    8e-05   
gb|AHZ44785.1|  early light inducible protein                         48.9    9e-05   
ref|XP_002949317.1|  hypothetical protein VOLCADRAFT_104260           48.1    4e-04   



>ref|XP_009766381.1| PREDICTED: early light-induced protein, chloroplastic-like [Nicotiana 
sylvestris]
Length=195

 Score =   204 bits (519),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 110/176 (63%), Positives = 135/176 (77%), Gaps = 9/176 (5%)
 Frame = +1

Query  7    MQSIL--GSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEs  180
            MQS++   SP TSF  RNG++QFVP  YLPR Q++    V+ MSED   KEQ ++P+T +
Sbjct  7    MQSMIVGSSPPTSFSKRNGLNQFVPGCYLPRFQKSSRLRVKCMSEDGEKKEQSSSPLTNT  66

Query  181  sttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGG  360
            + T+    PPP+ A         N  DVFSFSG GPERINGRLAMIGF AA+G+ELANGG
Sbjct  67   AATSKPTPPPPAKAST-------NFSDVFSFSGAGPERINGRLAMIGFVAALGVELANGG  119

Query  361  DLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            DL AQ+SNGG +WFLG++ALLTLAS+IPLFQG++AESKS G+M+ADAEIWNGRFAM
Sbjct  120  DLSAQLSNGGFSWFLGTSALLTLASLIPLFQGISAESKSGGIMSADAEIWNGRFAM  175



>ref|XP_004247605.1| PREDICTED: early light-induced protein 1, chloroplastic isoform 
X2 [Solanum lycopersicum]
 gb|AAS92268.1| early light inducible protein [Solanum lycopersicum]
Length=191

 Score =   204 bits (519),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 113/175 (65%), Positives = 133/175 (76%), Gaps = 10/175 (6%)
 Frame = +1

Query  7    MQSI-LGSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEss  183
            MQSI LGSP+   +N+NG++QFVPS YLPRL R     V+ M+E+  G+++ +TP T+ S
Sbjct  6    MQSIILGSPLKLSQNKNGLNQFVPSCYLPRLHRTSRVSVKCMAEE--GEKESSTPSTDYS  63

Query  184  ttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGD  363
             T PKPTP              N  D+FSFSGP PERINGRLAMIGF AA+GMELANG D
Sbjct  64   ATVPKPTPAKPKPST-------NFIDIFSFSGPAPERINGRLAMIGFVAAIGMELANGAD  116

Query  364  LFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            L AQ+SNGG+ WFLGS+ALLTLAS+IPLFQGVT ESKS G+MTADAEIWNGRFAM
Sbjct  117  LSAQLSNGGLLWFLGSSALLTLASLIPLFQGVTVESKSDGIMTADAEIWNGRFAM  171



>ref|XP_004247604.1| PREDICTED: early light-induced protein 1, chloroplastic isoform 
X1 [Solanum lycopersicum]
Length=192

 Score =   203 bits (517),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 113/175 (65%), Positives = 134/175 (77%), Gaps = 10/175 (6%)
 Frame = +1

Query  7    MQSI-LGSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEss  183
            MQSI LGSPV   +++NG++QFVPS YLPRL+R     V+ M+E+  G+++ +TP T+ S
Sbjct  7    MQSIILGSPVKLSQSKNGLNQFVPSCYLPRLRRTSRVRVKCMAEE--GEKESSTPSTDYS  64

Query  184  ttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGD  363
             T PKPTP              N  D+FSFSGP PERINGRLAMIGF AA+GMELANG D
Sbjct  65   ATVPKPTPAKPKPST-------NFIDIFSFSGPAPERINGRLAMIGFVAAIGMELANGAD  117

Query  364  LFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            L AQ+SNGG+ WFLGS+ALLTLAS+IPLFQGVT ESKS G+MTADAEIWNGRFAM
Sbjct  118  LSAQLSNGGLLWFLGSSALLTLASLIPLFQGVTVESKSDGIMTADAEIWNGRFAM  172



>ref|XP_006363471.1| PREDICTED: early light-induced protein, chloroplastic-like [Solanum 
tuberosum]
Length=197

 Score =   201 bits (512),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 113/175 (65%), Positives = 136/175 (78%), Gaps = 5/175 (3%)
 Frame = +1

Query  7    MQSI-LGSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEss  183
            MQSI LGSPV   ++RNG++QFVPS YLPRL R     V+ M+E+    ++ +TP+T+S+
Sbjct  7    MQSIILGSPVKLSQSRNGLNQFVPSCYLPRLHRRSPLRVKCMAEEGEKLDKASTPLTDSA  66

Query  184  ttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGD  363
             T PKPTP P    K +     N  D+FSFSGP PERINGRLAMIGF AA+G+ELANG D
Sbjct  67   ATVPKPTPAPFAKAKPST----NFSDIFSFSGPAPERINGRLAMIGFVAAIGVELANGAD  122

Query  364  LFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            L AQ+SNGG+ WFLGS+ALLTLAS+IPLFQGVT ESKS G+M+ADAEIWNGRFAM
Sbjct  123  LSAQLSNGGLLWFLGSSALLTLASLIPLFQGVTVESKSDGIMSADAEIWNGRFAM  177



>gb|ADM72804.1| early light-inducible protein [Capsicum annuum]
Length=160

 Score =   192 bits (487),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 102/172 (59%), Positives = 119/172 (69%), Gaps = 34/172 (20%)
 Frame = +1

Query  16   ILGSPVTSF-KNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEsstta  192
            ILGSPVTS  ++RNG++QFVPSSYLPRL RN    V+ MSE  +  +             
Sbjct  2    ILGSPVTSLSQSRNGLNQFVPSSYLPRLHRNTRLRVKCMSEPKSSTD-------------  48

Query  193  pkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFA  372
                                 +D+FSFSGP PERINGRLAMIGF AA+G+ELANGGDL A
Sbjct  49   --------------------FFDLFSFSGPAPERINGRLAMIGFVAAIGVELANGGDLSA  88

Query  373  QISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            Q+S+GG+ WFLGS+ LLTLAS+IPLFQGVTAESKS G M+ADAEIWNGRFAM
Sbjct  89   QLSSGGLLWFLGSSVLLTLASIIPLFQGVTAESKSGGFMSADAEIWNGRFAM  140



>ref|XP_009616081.1| PREDICTED: early light-induced protein, chloroplastic-like [Nicotiana 
tomentosiformis]
Length=199

 Score =   187 bits (475),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 103/179 (58%), Positives = 128/179 (72%), Gaps = 7/179 (4%)
 Frame = +1

Query  1    VVMQS-ILGSPVTS-FKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVT  174
            V MQ+ ILGSP+ S    RNGV+QFVPS Y+PRLQRN +  V+ MSED   K Q +  + 
Sbjct  5    VGMQTMILGSPIVSNISKRNGVNQFVPSCYIPRLQRNSTLSVKCMSEDGE-KGQTSNSLN  63

Query  175  EssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELAN  354
            + + T      P  P     +       D+F+FSGP PERINGRLAMIGF AA+G E AN
Sbjct  64   DITATPTPTPTPTPPPVAKTST---KFGDLFAFSGPAPERINGRLAMIGFVAALGAEFAN  120

Query  355  GGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESK-SKGLMTADAEIWNGRFAM  528
            GGD+FAQ+S+GG +WFLG++ALLTLAS+IPLFQG+ AE K + G+M+ADAEIWNGRFAM
Sbjct  121  GGDIFAQLSSGGFSWFLGTSALLTLASLIPLFQGIRAEKKYTSGIMSADAEIWNGRFAM  179



>ref|XP_009778398.1| PREDICTED: early light-induced protein, chloroplastic-like [Nicotiana 
sylvestris]
Length=200

 Score =   182 bits (462),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 108/176 (61%), Positives = 133/176 (76%), Gaps = 4/176 (2%)
 Frame = +1

Query  7    MQS-ILGSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEss  183
            MQS ILGSP+ S   RNGV+QFVP  Y+PR QRN +  V+ MSED    +   +    ++
Sbjct  7    MQSMILGSPIVS--KRNGVNQFVPCCYIPRPQRNSTLSVKCMSEDGEKGQTSNSLNDIAT  64

Query  184  ttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGD  363
            T  P PTP P P P+  AK+ST   D+F+FSGP PERINGRLAMIGF AA+G E ANGGD
Sbjct  65   TPTPTPTPTPIPTPRPVAKTSTKFGDLFAFSGPAPERINGRLAMIGFVAALGAEFANGGD  124

Query  364  LFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESK-SKGLMTADAEIWNGRFAM  528
            +FAQ+S+GG +WFLG++ALLTLAS+IPLFQG+ AE K + G+M+ADAEIWNGRFAM
Sbjct  125  IFAQLSSGGFSWFLGTSALLTLASLIPLFQGIRAEKKYTSGIMSADAEIWNGRFAM  180



>gb|AAO33591.1|AF479309_1 putative early light induced protein [Arachis hypogaea]
Length=189

 Score =   174 bits (440),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 97/175 (55%), Positives = 125/175 (71%), Gaps = 9/175 (5%)
 Frame = +1

Query  7    MQSILGSPVTSFKNRNGVSQF-VPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEss  183
            MQSIL SP+T   +R+ V+QF VP+ Y+P ++RN S  VRSM+E++  KEQ T P +  +
Sbjct  8    MQSILASPMTRTPSRSRVNQFGVPALYMPNMRRNASLSVRSMAEEEQ-KEQSTEPTSPVT  66

Query  184  ttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGD  363
               PKP P                 DV +FSGP PERINGRLAMIGF AA+ +EL+NG D
Sbjct  67   PPPPKPQPRSPKMST-------KFSDVLAFSGPAPERINGRLAMIGFVAALAVELSNGQD  119

Query  364  LFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            L +QISNGG+ WFLG++ +L+LAS+IPLFQGV+ ESKS G M++DAE+WNGRFAM
Sbjct  120  LLSQISNGGIPWFLGTSVVLSLASLIPLFQGVSVESKSGGFMSSDAELWNGRFAM  174



>gb|AFK41568.1| unknown [Lotus japonicus]
Length=194

 Score =   174 bits (440),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 99/175 (57%), Positives = 125/175 (71%), Gaps = 7/175 (4%)
 Frame = +1

Query  7    MQSILGSPVTSFKNRNGVSQF-VPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEss  183
            MQSIL +P+     R+ V+QF +PS Y+P  +RN S  VRSM+E+   K+QP  P T +S
Sbjct  8    MQSILANPMIRMTTRSRVNQFTIPSVYMPSQRRNSSLRVRSMAEEP--KKQPIEPATSAS  65

Query  184  ttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGD  363
               P   PP   APKV+        DV +F GP PERINGRLAMIGFAAAM +E+A G  
Sbjct  66   PVTPSAPPPKPRAPKVST----KFSDVMAFGGPAPERINGRLAMIGFAAAMAVEVARGQG  121

Query  364  LFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            +F QIS+GGV WFLG++ +LTLAS++PLFQGV+ ESKSKG+MT+DAE+WNGR AM
Sbjct  122  VFEQISDGGVPWFLGTSVVLTLASLVPLFQGVSVESKSKGVMTSDAELWNGRLAM  176



>gb|AFK38527.1| unknown [Lotus japonicus]
Length=193

 Score =   172 bits (435),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 96/175 (55%), Positives = 123/175 (70%), Gaps = 4/175 (2%)
 Frame = +1

Query  7    MQSILGSPVTSFKNRNGVSQFV-PSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEss  183
            MQSI+ SP+     R+ V+QF  P+ Y+P L+RN +  VRSM+E +  KEQP  PVT +S
Sbjct  4    MQSIISSPMIRMTTRSRVNQFTTPAVYMPSLRRNATLRVRSMAEGEP-KEQPIEPVTSAS  62

Query  184  ttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGD  363
               P P PPP         +  +  DV +F GP PERINGRLAMIGF AAM +E+A G  
Sbjct  63   PVTPSPPPPPPKPRAPKVSTKFS--DVMAFGGPAPERINGRLAMIGFVAAMAVEVARGQG  120

Query  364  LFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            +F QIS+GGV WFLG++ + TLAS++PLFQGV+ ESKSKGLMT+DAE+WNG+ AM
Sbjct  121  VFEQISDGGVPWFLGASVVFTLASLVPLFQGVSVESKSKGLMTSDAELWNGKLAM  175



>ref|XP_002517068.1| early light-induced protein, putative [Ricinus communis]
 gb|EEF45231.1| early light-induced protein, putative [Ricinus communis]
Length=191

 Score =   171 bits (433),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 98/179 (55%), Positives = 125/179 (70%), Gaps = 16/179 (9%)
 Frame = +1

Query  4    VMQS-ILGSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFL-VRSMSEDDAGKE-QPTTPVT  174
            VMQ+ IL SPV    NR  V+QF+P+ Y PRL+R  +   VR M+E+   +E +PT PV+
Sbjct  7    VMQAAILASPVLR-PNRARVTQFLPAPYTPRLRRMATATPVRCMAEEKENQEMKPTEPVS  65

Query  175  EssttapkptpppspapkvaaksstNLW-DVFSFSGPGPERINGRLAMIGFAAAMGMELA  351
             +    P P P  S             W D+ +FSGP PERINGRLAMIGF AAM +ELA
Sbjct  66   ATPKPQPAPKPKVSTK-----------WSDLLAFSGPAPERINGRLAMIGFVAAMAVELA  114

Query  352  NGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
             G DLF Q+S+GG+TWF+G++ +L+LAS+IPLF+GV  ESKSKGLMT+DAE+WNGRFAM
Sbjct  115  KGQDLFTQVSSGGITWFVGTSVVLSLASLIPLFKGVNVESKSKGLMTSDAELWNGRFAM  173



>ref|XP_007034868.1| Early light-induced protein, putative [Theobroma cacao]
 gb|EOY05794.1| Early light-induced protein, putative [Theobroma cacao]
Length=193

 Score =   171 bits (432),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 95/175 (54%), Positives = 119/175 (68%), Gaps = 7/175 (4%)
 Frame = +1

Query  7    MQSIL-GSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEss  183
            MQS+L   PVT   NR  V QF P   +PR QRN +  VR ++E++   EQPT PVT + 
Sbjct  7    MQSLLLAGPVTGLANRGRVIQFFPVKSVPRFQRNANLHVRCLAEEEP-TEQPTKPVTSAP  65

Query  184  ttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGD  363
               PKP P P+              DV +FSGP PERINGRLAM+GF AA+ MEL+ G D
Sbjct  66   PQVPKPNPSPAAPKVST-----KFSDVLAFSGPAPERINGRLAMVGFVAALAMELSKGQD  120

Query  364  LFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            +F QIS+GG+  FLG++ L++LAS+IPLF+GVT ESKS G MT+DAE+WNGRFAM
Sbjct  121  VFTQISDGGIPLFLGTSILVSLASLIPLFRGVTVESKSGGFMTSDAELWNGRFAM  175



>gb|ACB20694.1| putative cold-inducible protein [Camellia sinensis]
 gb|ACV89762.1| putative light-inducible protein [Camellia sinensis]
Length=190

 Score =   171 bits (432),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 98/174 (56%), Positives = 118/174 (68%), Gaps = 7/174 (4%)
 Frame = +1

Query  7    MQSILGSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEsst  186
            MQSIL  PV+    R   SQF P SY+PRLQRN    VR M+EDD  K+           
Sbjct  6    MQSILARPVSGVTARARFSQFTPCSYVPRLQRNAGMQVRCMAEDDQNKDVTPI-------  58

Query  187  tapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDL  366
            T P PT  P   P    K ST   DV +FSGP PERINGRLAMIGF AAM +EL+ G D+
Sbjct  59   TTPPPTSQPISFPPPKPKVSTKFSDVLAFSGPAPERINGRLAMIGFVAAMAVELSKGEDV  118

Query  367  FAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
             AQISNGGV WF G++ +LTLAS+IPLF+G + ES+S+G+M++DAE+WNGRFAM
Sbjct  119  LAQISNGGVPWFGGTSIVLTLASLIPLFKGGSVESRSEGIMSSDAELWNGRFAM  172



>gb|ACV89760.1| putative early light induced protein 2 [Camellia sinensis]
 gb|ACV89763.1| putative early light induced protein 2 [Camellia sinensis]
Length=175

 Score =   169 bits (427),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 87/174 (50%), Positives = 112/174 (64%), Gaps = 23/174 (13%)
 Frame = +1

Query  7    MQSILGSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEsst  186
            MQS+L  PVTS   R    QF P SY+P LQ+N S  VR M++    ++    P      
Sbjct  7    MQSVLARPVTSVTTRARFGQFTPCSYVPYLQKNASMQVRCMAKYGQKEDVTQKP------  60

Query  187  tapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDL  366
                             K ST   DV +FSGP PERINGRLAMIGF AAM +EL+NG D+
Sbjct  61   -----------------KVSTKFSDVLAFSGPAPERINGRLAMIGFVAAMAVELSNGEDV  103

Query  367  FAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
              QISNGGV WF+G++ +LTLAS++PLF+GV+ ES+S+ +M++DAE+WNGRFAM
Sbjct  104  LVQISNGGVPWFVGTSIVLTLASLVPLFKGVSVESRSERIMSSDAELWNGRFAM  157



>ref|XP_011027193.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
[Populus euphratica]
Length=182

 Score =   167 bits (423),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 90/180 (50%), Positives = 123/180 (68%), Gaps = 26/180 (14%)
 Frame = +1

Query  4    VMQSILGSPVTS--FKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQP---TTP  168
            VMQ++L SPV S   KNR+GVS    ++Y+PRL+ + S  V+  ++ D  K+     +TP
Sbjct  6    VMQTVLASPVPSSLVKNRSGVSNLFSATYVPRLRGSASKRVQCQAKLDDQKKSAGLSSTP  65

Query  169  VTEssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMGMEL  348
              + ST                        D+ +FSGP PERINGRLAMIGF AAM +EL
Sbjct  66   KPKVST---------------------KFADLLAFSGPAPERINGRLAMIGFVAAMAVEL  104

Query  349  ANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            + G DLF+QISNGGV+WF+G++ LL++AS+IPLF+G++AESKS+G+MT+DAE+WNGRFAM
Sbjct  105  SKGQDLFSQISNGGVSWFVGTSILLSVASLIPLFKGISAESKSEGVMTSDAEMWNGRFAM  164



>ref|XP_006420038.1| hypothetical protein CICLE_v10006006mg [Citrus clementina]
 ref|XP_006489464.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
[Citrus sinensis]
 gb|ESR33278.1| hypothetical protein CICLE_v10006006mg [Citrus clementina]
 gb|KDO74446.1| hypothetical protein CISIN_1g029976mg [Citrus sinensis]
Length=184

 Score =   167 bits (422),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 90/178 (51%), Positives = 118/178 (66%), Gaps = 24/178 (13%)
 Frame = +1

Query  10   QSILGSPVTSFK----NRNGVSQFVPSSYLP-RLQRNPSFLVRSMSEDDAGKEQPTTPVT  174
            QS+LGS V + +     ++GV QF    YLP  LQRN S  VR M++++  K+Q T P  
Sbjct  8    QSMLGSSVVAARVTGIRKSGVYQFSSVKYLPGTLQRNVSLSVRCMAKNEQQKDQSTQP--  65

Query  175  EssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELAN  354
                                 + ST   DVF+FSGP PERINGRLAMIGF AA+ +EL+ 
Sbjct  66   -----------------PKLPRISTKFSDVFAFSGPAPERINGRLAMIGFVAALAVELSK  108

Query  355  GGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            G D+FAQ+S+GGV WFLG++ LL++AS++PLF+GV+ ESKS G MT+DAE+WNGRFAM
Sbjct  109  GQDVFAQLSDGGVAWFLGTSVLLSVASLVPLFKGVSVESKSDGFMTSDAELWNGRFAM  166



>ref|XP_002312551.2| hypothetical protein POPTR_0008s15770g [Populus trichocarpa]
 gb|EEE89918.2| hypothetical protein POPTR_0008s15770g [Populus trichocarpa]
Length=182

 Score =   166 bits (421),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 91/180 (51%), Positives = 120/180 (67%), Gaps = 26/180 (14%)
 Frame = +1

Query  4    VMQSILGSPVTS--FKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGK---EQPTTP  168
            VMQ++L +PV S   KNR+ VS    ++Y+PRL+ + S  V+    DD  K   E  +TP
Sbjct  6    VMQTVLATPVPSGLVKNRSRVSNLFSATYVPRLRGSASKRVQCSKLDDQIKKLAEPSSTP  65

Query  169  VTEssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMGMEL  348
              + S                         D+F+FSGP PERINGRLAMIGF AAM +EL
Sbjct  66   KPKVSP---------------------KFLDLFAFSGPAPERINGRLAMIGFVAAMAVEL  104

Query  349  ANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            + G DLF+QISNGGV+WF+G++ LL++AS+IPLF+GV+AESKS G+MT+DAE+WNGRFAM
Sbjct  105  SKGQDLFSQISNGGVSWFVGTSILLSVASLIPLFKGVSAESKSDGVMTSDAEMWNGRFAM  164



>ref|XP_011027158.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
[Populus euphratica]
Length=182

 Score =   166 bits (421),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 89/180 (49%), Positives = 123/180 (68%), Gaps = 26/180 (14%)
 Frame = +1

Query  4    VMQSILGSPVTS--FKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQP---TTP  168
            VMQ++L +PV S   KNR+GVS    ++Y+PRL+ + S  V+  ++ D  K+     +TP
Sbjct  6    VMQTVLATPVPSSLVKNRSGVSNLFSATYVPRLRGSASKRVQCQAKLDDQKKSAGLSSTP  65

Query  169  VTEssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMGMEL  348
              + ST                        D+ +FSGP PERINGRLAMIGF AAM +EL
Sbjct  66   KPKVST---------------------KFADLLAFSGPAPERINGRLAMIGFVAAMAVEL  104

Query  349  ANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            + G DLF+QISNGGV+WF+G++ LL++AS+IPLF+G++AESKS+G+MT+DAE+WNGRFAM
Sbjct  105  SKGQDLFSQISNGGVSWFVGTSILLSVASLIPLFKGISAESKSEGVMTSDAEMWNGRFAM  164



>gb|AFK48277.1| unknown [Lotus japonicus]
Length=188

 Score =   165 bits (417),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 96/175 (55%), Positives = 121/175 (69%), Gaps = 13/175 (7%)
 Frame = +1

Query  7    MQSILGSPVTSFKNRNGVSQF-VPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEss  183
            +QSIL +P+     R+ V+QF +PS Y+P L+RN S  VRSM+E+   KEQ  +      
Sbjct  8    IQSILANPMIRMTTRSRVNQFTIPSVYMPSLRRNSSLRVRSMAEEP--KEQSAS------  59

Query  184  ttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGD  363
                  TP P P    A K ST   DV +F GP PERINGRLAMIGF AAM +E+A G  
Sbjct  60   ----PVTPSPPPPKPRAPKVSTKFSDVMAFGGPAPERINGRLAMIGFVAAMAVEVARGQG  115

Query  364  LFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            +F QIS+GGV WFLG++ +LTLAS++PLFQGV+ ESKSKG+MT+DAE+WNGR AM
Sbjct  116  VFEQISDGGVPWFLGTSVVLTLASLVPLFQGVSVESKSKGVMTSDAELWNGRLAM  170



>ref|XP_006379854.1| early light-induced protein precursor [Populus trichocarpa]
 gb|ABK95874.1| unknown [Populus trichocarpa]
 gb|ERP57651.1| early light-induced protein precursor [Populus trichocarpa]
Length=182

 Score =   164 bits (415),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 86/177 (49%), Positives = 115/177 (65%), Gaps = 20/177 (11%)
 Frame = +1

Query  4    VMQSILGSPVTS--FKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTE  177
            VMQ++L SPV S   KNR+ VS    ++Y+PRL+ + S  ++  +E D  K         
Sbjct  6    VMQTVLASPVASSLVKNRSRVSNLFSATYVPRLRGSASKRLQCKAELDEQKMSAEPSPPP  65

Query  178  ssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANG  357
                +                      DV +FSGP PERINGRLAMIGF AAM +EL+ G
Sbjct  66   KPKVST------------------KFADVLAFSGPAPERINGRLAMIGFVAAMAVELSKG  107

Query  358  GDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
             DLF+QISNGGV+WF+G++ LL++AS++PLF+GV+AESKS G+MT+DAE+WNGRFAM
Sbjct  108  QDLFSQISNGGVSWFVGTSILLSVASLVPLFKGVSAESKSDGVMTSDAEMWNGRFAM  164



>gb|AFK38098.1| unknown [Lotus japonicus]
Length=188

 Score =   164 bits (414),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 95/175 (54%), Positives = 121/175 (69%), Gaps = 13/175 (7%)
 Frame = +1

Query  7    MQSILGSPVTSFKNRNGVSQF-VPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEss  183
            MQSIL +P+     R+ V+QF +PS Y+P L+RN S  VRSM+E+   KEQ  +      
Sbjct  8    MQSILANPMIRMTTRSRVNQFTIPSVYMPSLRRNSSLRVRSMAEEP--KEQSAS------  59

Query  184  ttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGD  363
                  TP P P    A K ST   DV +F GP PERINGRLAMIGF AAM +E+A G  
Sbjct  60   ----PVTPSPPPPKPRAPKVSTKFSDVMAFGGPAPERINGRLAMIGFVAAMAVEVARGQG  115

Query  364  LFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            +F QIS+GGV WFLG++ +LTLAS++PLFQGV+ ESKSKG+MT+DAE+WNG+ A+
Sbjct  116  VFEQISDGGVPWFLGTSVVLTLASLVPLFQGVSVESKSKGVMTSDAELWNGKLAV  170



>ref|XP_004496671.1| PREDICTED: early light-induced protein, chloroplastic-like [Cicer 
arietinum]
Length=197

 Score =   164 bits (414),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 90/168 (54%), Positives = 118/168 (70%), Gaps = 4/168 (2%)
 Frame = +1

Query  31   VTSFKNRNGVSQF--VPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEssttapkpt  204
            +T   +R+ VSQF  +PS Y+P  +R+ S  VRSM+E++  K+QP  PV   +  +  P 
Sbjct  14   MTGISSRSRVSQFSSIPSVYIPNTRRSASLKVRSMAEEEQ-KQQPKVPVNPVTPVSQPPP  72

Query  205  pppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISN  384
            PP     + +  S+    D+ +F GP PERINGRLAMIGF AAMG+E+A G  LF QIS 
Sbjct  73   PPQPAYTRPSKMST-KFSDLMAFGGPAPERINGRLAMIGFVAAMGVEIAKGQGLFEQISG  131

Query  385  GGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            GGV WFLG++ LLTLAS+IP FQGV+ ESKSKG+M++DAE+WNGR AM
Sbjct  132  GGVPWFLGTSVLLTLASLIPFFQGVSVESKSKGVMSSDAELWNGRIAM  179



>ref|XP_002312552.2| early light-induced protein precursor [Populus trichocarpa]
 gb|ABK94838.1| unknown [Populus trichocarpa]
 gb|EEE89919.2| early light-induced protein precursor [Populus trichocarpa]
Length=182

 Score =   162 bits (411),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 92/177 (52%), Positives = 122/177 (69%), Gaps = 20/177 (11%)
 Frame = +1

Query  4    VMQSILGSPVTS--FKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTE  177
            VMQ++L SPV S   KNR+ VS    ++Y+PRL+ +    ++  +E D   EQ  +    
Sbjct  6    VMQTVLASPVASSLVKNRSRVSNLFSATYVPRLRGSAGKRLQCKAELD---EQNMSA---  59

Query  178  ssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANG  357
                         P+P    K ST   DV +FSGP PERINGRLAMIGF AAM +EL+ G
Sbjct  60   ------------EPSPPPKPKVSTKFADVLAFSGPAPERINGRLAMIGFVAAMAVELSKG  107

Query  358  GDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
             DLF+QISNGGV+WF+G++ LL++AS+IPLF+GV+AESKS+G+MT+DAE+WNGRFAM
Sbjct  108  QDLFSQISNGGVSWFVGTSILLSVASLIPLFKGVSAESKSEGVMTSDAEMWNGRFAM  164



>ref|XP_010107710.1| hypothetical protein L484_013325 [Morus notabilis]
 gb|EXC16745.1| hypothetical protein L484_013325 [Morus notabilis]
Length=195

 Score =   162 bits (411),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 86/156 (55%), Positives = 110/156 (71%), Gaps = 8/156 (5%)
 Frame = +1

Query  64   QFVPSSYLPRLQR-NPSFLVRSMSEDDAGKEQPTTPVTEssttapkptpppspapkvaak  240
            QF+PS  LPRL+R N    VR M++D   KEQPT PV  S          P+P       
Sbjct  29   QFLPSLNLPRLRRINTPLRVRCMTQDGEQKEQPT-PVPNSPPQPTPAPSRPTPKVST---  84

Query  241  sstNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNGGVTWFLGSTAL  420
                  D+ +FSGP PERINGRLAM+GF AAM +EL+ G D+FAQISNGG++WF+G++ +
Sbjct  85   ---KFSDILAFSGPAPERINGRLAMVGFVAAMAVELSKGQDVFAQISNGGISWFVGTSIV  141

Query  421  LTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            LTLAS++PLF+GV+ ESKS G+MT+DAE+WNGRFAM
Sbjct  142  LTLASLVPLFKGVSVESKSSGVMTSDAELWNGRFAM  177



>ref|XP_010326693.1| PREDICTED: early light-induced protein 1, chloroplastic-like, 
partial [Solanum lycopersicum]
Length=122

 Score =   160 bits (404),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 77/93 (83%), Positives = 84/93 (90%), Gaps = 0/93 (0%)
 Frame = +1

Query  250  NLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNGGVTWFLGSTALLTL  429
            N  D+FSFSGP PERINGRLAMIGF AA+GMELANG DL AQ+SNGG+ WFLGS+ALLTL
Sbjct  7    NFIDIFSFSGPAPERINGRLAMIGFVAAIGMELANGADLSAQLSNGGLLWFLGSSALLTL  66

Query  430  ASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            AS+IPLFQGVT ESKS G+MTADAEIWNGRFAM
Sbjct  67   ASLIPLFQGVTVESKSDGIMTADAEIWNGRFAM  99



>ref|XP_007143316.1| hypothetical protein PHAVU_007G062000g [Phaseolus vulgaris]
 gb|ESW15310.1| hypothetical protein PHAVU_007G062000g [Phaseolus vulgaris]
Length=192

 Score =   161 bits (408),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 94/175 (54%), Positives = 121/175 (69%), Gaps = 9/175 (5%)
 Frame = +1

Query  7    MQSILGSPVTSFKNRNGVSQF-VPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEss  183
            MQSIL +P+     R+ V+ F +P+ Y+   +RN S  VRS++E++  + +P  PVT   
Sbjct  8    MQSILANPMIGMSTRSRVNHFGLPAVYM---RRNVSLRVRSLAEEEQ-QSEPAAPVTP--  61

Query  184  ttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGD  363
               P   P   PA   + K ST   DV +FSGP PERINGRLAMIGF AAM +E+A G  
Sbjct  62   --PPSVKPVQQPATTASPKVSTKFSDVLAFSGPAPERINGRLAMIGFVAAMAVEVAKGQG  119

Query  364  LFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            +F QISNGGV WFLG++ +LTLAS+IPLFQGV+ ESKS G M++DAE+WNGRFAM
Sbjct  120  VFEQISNGGVPWFLGTSVVLTLASLIPLFQGVSVESKSGGFMSSDAELWNGRFAM  174



>ref|XP_010279261.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
[Nelumbo nucifera]
Length=195

 Score =   161 bits (408),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 102/180 (57%), Positives = 127/180 (71%), Gaps = 11/180 (6%)
 Frame = +1

Query  1    VVMQSILGSPVT--SFKNRNGVSQFV-PSSYLPRLQRNPSFL-VRSMSEDDAGKEQPTTP  168
            V MQSIL +PV      +R   S  V PS+Y PR Q+N   L VR M+E+   KEQ    
Sbjct  5    VSMQSILVNPVAVGRLGHRCRPSSMVFPSTYFPRQQKNGCTLQVRCMAEESQ-KEQ----  59

Query  169  VTEssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMGMEL  348
              +SS  +  P+PP   +P  + K ST   DV +FSGP PERINGRLAMIGF AAM +EL
Sbjct  60   --KSSPVSAPPSPPQPTSPSASPKVSTKFTDVLAFSGPAPERINGRLAMIGFVAAMAVEL  117

Query  349  ANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            A G D+ AQ++NGG+TWFLG+TA+L+LAS+IPLF+GV  +SKSKGLMT+DAE+WNGRFAM
Sbjct  118  AKGDDVAAQLANGGLTWFLGTTAVLSLASLIPLFKGVDVQSKSKGLMTSDAELWNGRFAM  177



>ref|XP_010279259.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
isoform X1 [Nelumbo nucifera]
Length=195

 Score =   161 bits (408),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 102/180 (57%), Positives = 126/180 (70%), Gaps = 11/180 (6%)
 Frame = +1

Query  1    VVMQSILGSPVT--SFKNRNGVSQFV-PSSYLPRLQRNPSFL-VRSMSEDDAGKEQPTTP  168
            V MQSIL +PV      +R   S  V PS+Y PR Q+N   L VR M+E+   KEQ    
Sbjct  5    VSMQSILVNPVAVGRLGHRGRPSSMVFPSTYFPRQQKNGCTLQVRCMAEESQ-KEQ----  59

Query  169  VTEssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMGMEL  348
              +SS  +  P+PP    P  + K ST   DV +FSGP PERINGRLAMIGF AAM +EL
Sbjct  60   --KSSPVSAPPSPPQHTTPSGSPKVSTKFTDVLAFSGPAPERINGRLAMIGFVAAMAVEL  117

Query  349  ANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            A G D+ AQ++NGG+TWFLG+TA+L+LAS+IPLF+GV  +SKSKGLMT+DAE+WNGRFAM
Sbjct  118  AKGDDVAAQLANGGLTWFLGTTAVLSLASLIPLFKGVDVQSKSKGLMTSDAELWNGRFAM  177



>gb|KEH43786.1| early light-induced-like protein [Medicago truncatula]
Length=197

 Score =   161 bits (407),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 96/162 (59%), Positives = 118/162 (73%), Gaps = 4/162 (2%)
 Frame = +1

Query  49   RNGVSQF--VPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEssttapkptpppspa  222
            R+ V+Q   +PS Y+P  +RN SF VRSM+E+   KEQP  PV +S T    PTPPP  A
Sbjct  20   RSRVNQISNIPSVYMPSFRRNASFKVRSMAEEGQ-KEQPKVPV-DSITPTSAPTPPPQSA  77

Query  223  pkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNGGVTWF  402
               A K ST   D+ +F GP PERINGRLAMIGF AAMG+E+A G  LF QIS GG+ WF
Sbjct  78   YTRAPKMSTKFSDLMAFGGPAPERINGRLAMIGFVAAMGVEIAKGQGLFDQISGGGIPWF  137

Query  403  LGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            LG++ LL+LAS+IP FQGV+ ESKSKG+M++DAE+WNGR AM
Sbjct  138  LGTSVLLSLASLIPFFQGVSVESKSKGVMSSDAELWNGRIAM  179



>ref|XP_010107713.1| hypothetical protein L484_013328 [Morus notabilis]
 gb|EXC16748.1| hypothetical protein L484_013328 [Morus notabilis]
Length=195

 Score =   161 bits (407),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 87/156 (56%), Positives = 111/156 (71%), Gaps = 8/156 (5%)
 Frame = +1

Query  64   QFVPSSYLPRLQR-NPSFLVRSMSEDDAGKEQPTTPVTEssttapkptpppspapkvaak  240
            Q +PS  LPRL+R N    VR M++D   K+QPT PV  S      P  PP+P       
Sbjct  29   QLLPSLNLPRLRRINTPLRVRCMTKDREQKKQPT-PVRNSPPQPTLPPSPPTPKVST---  84

Query  241  sstNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNGGVTWFLGSTAL  420
                  DV +FSGP PERINGRLAM+GF AAM +EL+ G D+FAQISNGG++WF+G++ +
Sbjct  85   ---KFSDVLAFSGPAPERINGRLAMVGFVAAMAVELSKGQDVFAQISNGGISWFVGTSLV  141

Query  421  LTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            LTLAS++PLF+GV+ ESKS G+MT+DAE+WNGRFAM
Sbjct  142  LTLASLVPLFKGVSVESKSSGVMTSDAELWNGRFAM  177



>ref|XP_011027169.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
[Populus euphratica]
Length=182

 Score =   160 bits (406),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 87/178 (49%), Positives = 115/178 (65%), Gaps = 22/178 (12%)
 Frame = +1

Query  4    VMQSILGSPVTS--FKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSE-DDAGKEQPTTPVT  174
            VMQ++L SPV S   KNR+ VS    ++Y+PRL+   S  V+  +E DD       +P  
Sbjct  6    VMQTVLASPVASSLVKNRSRVSNLFSATYVPRLRGGASKRVQCKAELDDQKMSAEPSPAP  65

Query  175  EssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELAN  354
            +   +                       DV +FSGP PERINGRLAMIGF AAM +EL+ 
Sbjct  66   KPKVST-------------------KFADVLAFSGPAPERINGRLAMIGFVAAMAVELSK  106

Query  355  GGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            G DLF+QISNGG +WF+G++ LL++AS+IPLF+GV+ ESKS G+MT+DAE+WNGRFAM
Sbjct  107  GPDLFSQISNGGGSWFVGTSILLSVASLIPLFKGVSVESKSDGVMTSDAEMWNGRFAM  164



>gb|AAQ21120.1| early light inducible protein [Trifolium pratense]
Length=198

 Score =   160 bits (406),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 93/159 (58%), Positives = 117/159 (74%), Gaps = 3/159 (2%)
 Frame = +1

Query  58   VSQF--VPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEssttapkptpppspapkv  231
            V+QF  +PS Y+P ++RN SF VRSM+E++  KEQP  PV   + T    TPPP P    
Sbjct  23   VNQFSNIPSVYMPNMRRNASFKVRSMAEEEQ-KEQPKVPVDPITPTPTPVTPPPKPTYTR  81

Query  232  aaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNGGVTWFLGS  411
            + K ST   D+ +F GP PERINGRLAMIGF AAMG+E+A G  LF QIS GGV WFLG+
Sbjct  82   SPKISTKFSDLMAFGGPAPERINGRLAMIGFVAAMGVEIAKGQGLFEQISGGGVPWFLGT  141

Query  412  TALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            + +L+LAS+IP FQGV+ ESKSKG+M++DAE+WNGR AM
Sbjct  142  SVVLSLASLIPFFQGVSVESKSKGVMSSDAELWNGRIAM  180



>ref|XP_002312550.2| hypothetical protein POPTR_0008s15760g [Populus trichocarpa]
 gb|EEE89917.2| hypothetical protein POPTR_0008s15760g [Populus trichocarpa]
Length=182

 Score =   160 bits (404),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 89/180 (49%), Positives = 118/180 (66%), Gaps = 26/180 (14%)
 Frame = +1

Query  4    VMQSILGSPVTS--FKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGK---EQPTTP  168
            VMQ++L +PV S   KNR+ VS    ++++PRL+ + S  V+    DD  K   E  +TP
Sbjct  6    VMQTVLATPVPSGLVKNRSRVSNLFSATFVPRLRGSASKRVQCSKLDDQIKKLAEPSSTP  65

Query  169  VTEssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMGMEL  348
              + S                         D+F+FSGP PERINGRLAMIGF AAM +EL
Sbjct  66   KPKVSP---------------------KFLDLFAFSGPAPERINGRLAMIGFVAAMAVEL  104

Query  349  ANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            + G DL  QISNGGV+WF+G++ LL++AS+IPLF+GV+AESKS G+MT+DAE+WNGRFAM
Sbjct  105  SKGQDLSYQISNGGVSWFVGTSILLSVASLIPLFKGVSAESKSDGVMTSDAEMWNGRFAM  164



>ref|NP_001267842.1| uncharacterized protein LOC100263179 [Vitis vinifera]
 gb|ADG21226.1| chloroplast ELIP early light-induced protein [Vitis vinifera]
Length=199

 Score =   160 bits (404),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 96/176 (55%), Positives = 118/176 (67%), Gaps = 3/176 (2%)
 Frame = +1

Query  7    MQSILGSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQP--TTPVTEs  180
            MQS L + +T   NR    Q VP   + RLQR+ +  VR   ED   +  P  TT   + 
Sbjct  7    MQSTLATAMTRVANRTRDLQVVPPRSVLRLQRS-AVQVRCTKEDGQIERPPPVTTNPQQP  65

Query  181  sttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGG  360
             + +    P P P P  A K ST   DVF+FSGP PERINGRLAM+GF AAMG E+  G 
Sbjct  66   PSLSQSRQPIPPPPPPPAPKVSTKFGDVFAFSGPAPERINGRLAMVGFVAAMGAEIWKGE  125

Query  361  DLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            D+FAQISNGG+ WFLG+  +L+LAS+IPLF+GV+ ESKSKGLMT+DAE+WNGRFAM
Sbjct  126  DVFAQISNGGIPWFLGTAVVLSLASLIPLFKGVSVESKSKGLMTSDAEMWNGRFAM  181



>ref|XP_011027181.1| PREDICTED: early light-induced protein 2, chloroplastic-like 
[Populus euphratica]
Length=181

 Score =   159 bits (403),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 90/180 (50%), Positives = 120/180 (67%), Gaps = 27/180 (15%)
 Frame = +1

Query  4    VMQSILGSPVTS--FKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGK---EQPTTP  168
            VMQ++L +P  S   KNR+ VS F  ++Y+P L+ + S  V+  +E D  K   E  +TP
Sbjct  6    VMQTVLATPAASSLVKNRSRVSNFFSATYVP-LRGSASKRVQCKAELDDQKMSAEPSSTP  64

Query  169  VTEssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMGMEL  348
              + ST                        D+ +FSGP PERINGRLAMIGF AAM +EL
Sbjct  65   KPKVST---------------------KFADLLAFSGPAPERINGRLAMIGFVAAMAVEL  103

Query  349  ANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            + G DLF+QISNGGV+WF+G++ LL++AS+IPLF+GV AESKS+G+MT+DAE+WNGRFAM
Sbjct  104  SKGQDLFSQISNGGVSWFVGTSILLSVASLIPLFKGVRAESKSEGVMTSDAEMWNGRFAM  163



>ref|XP_008224239.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
[Prunus mume]
Length=198

 Score =   159 bits (403),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 95/177 (54%), Positives = 128/177 (72%), Gaps = 6/177 (3%)
 Frame = +1

Query  7    MQSILGSPVTSFKNRNG---VSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTE  177
            MQS+L + V     ++    V+  +P+ Y P L R P+  VRSM+E+   +EQP+T    
Sbjct  7    MQSLLANSVAFGAGKSKSLRVNHLLPAKYAPTLHRYPNMRVRSMAENGQ-EEQPST--AP  63

Query  178  ssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANG  357
             ++  P P P P+P PK + K STN  DVF+FSGP PERINGRLAM+GF +A+ +ELA G
Sbjct  64   EASKIPPPPPTPTPPPKRSPKISTNFSDVFAFSGPAPERINGRLAMVGFVSALAVELAKG  123

Query  358  GDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
             DLFAQIS+GGV+ FLG++ LL++AS+IPLF+GV+ ESKS G+MT+DAE+WNGR AM
Sbjct  124  QDLFAQISDGGVSLFLGTSILLSVASLIPLFRGVSVESKSDGIMTSDAELWNGRMAM  180



>gb|AAK63815.1|AF383622_1 early light inducible protein [Medicago sativa]
Length=199

 Score =   159 bits (403),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 90/163 (55%), Positives = 113/163 (69%), Gaps = 4/163 (2%)
 Frame = +1

Query  49   RNGVSQF--VPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEssttapkptpppspa  222
            R  V+QF  +PS Y+P  +RN S  VRSM+E+   KEQP  PV   +  +    PP    
Sbjct  20   RPRVNQFNNIPSVYMPSFRRNASLKVRSMAEEGQ-KEQPKVPVDPITPPSAPTPPPQPQP  78

Query  223  pkvaa-ksstNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNGGVTW  399
                + K ST   D+ +F GP PERINGRLAMIGF AAMG+E+ANG  LF QIS GG+ W
Sbjct  79   TYTRSPKMSTKFSDLMAFGGPAPERINGRLAMIGFVAAMGVEIANGQGLFDQISGGGIPW  138

Query  400  FLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            FLG++ LL+LAS+IP FQGV+ ESKSKG+M++DAE+WNGR AM
Sbjct  139  FLGTSVLLSLASLIPFFQGVSVESKSKGVMSSDAELWNGRIAM  181



>gb|ACU13898.1| unknown [Glycine max]
Length=192

 Score =   159 bits (402),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 94/175 (54%), Positives = 124/175 (71%), Gaps = 9/175 (5%)
 Frame = +1

Query  7    MQSILGSPVTSFKNRNGVSQF-VPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEss  183
            MQSIL +P+    + + V+QF VP+ ++   +RN    VRSM++++   E P TPVT   
Sbjct  8    MQSILANPLIRISSGSRVNQFGVPALHM---RRNVGLRVRSMAKEEQPSE-PATPVTPPP  63

Query  184  ttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGD  363
            +  PKP P  +P+ KV+        DV +FSGP PERINGRLAMIGF AAM +E+A G  
Sbjct  64   SVEPKPQPVSAPSSKVST----KFSDVLAFSGPAPERINGRLAMIGFVAAMAVEVAKGQG  119

Query  364  LFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            +  QISNGG+ WFLG++ +LTLAS+IPLFQGV+ ESKSKG M++DAE+WNGRFAM
Sbjct  120  VLEQISNGGIPWFLGTSVVLTLASLIPLFQGVSVESKSKGFMSSDAELWNGRFAM  174



>ref|XP_007225862.1| hypothetical protein PRUPE_ppa011739mg [Prunus persica]
 gb|EMJ27061.1| hypothetical protein PRUPE_ppa011739mg [Prunus persica]
Length=198

 Score =   159 bits (401),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 95/177 (54%), Positives = 126/177 (71%), Gaps = 6/177 (3%)
 Frame = +1

Query  7    MQSILGSPVTSFKNRNG---VSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTE  177
            MQSIL + V     ++G   VS  VP+ Y     R P   VRSM+E+   +EQP+T  T 
Sbjct  7    MQSILANSVVYGAGKSGSVRVSHLVPAKYATTSHRYPQLRVRSMAENGQ-EEQPST--TP  63

Query  178  ssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANG  357
             ++  P P P P+P+PK + K ST   DVF+FSGP PERINGRLAM+GF +A+ +EL+ G
Sbjct  64   EASRIPPPPPTPTPSPKRSPKVSTKFSDVFAFSGPAPERINGRLAMVGFVSALAVELSKG  123

Query  358  GDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
             D+FAQIS+GGV+ FL ++ LL++ASVIPLF+GV+ ESKS G+MT+DAE+WNGR AM
Sbjct  124  QDVFAQISDGGVSLFLATSILLSVASVIPLFKGVSVESKSDGIMTSDAELWNGRLAM  180



>ref|XP_010043033.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
isoform X2 [Eucalyptus grandis]
 gb|KCW85048.1| hypothetical protein EUGRSUZ_B01895 [Eucalyptus grandis]
Length=199

 Score =   159 bits (401),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 94/179 (53%), Positives = 126/179 (70%), Gaps = 5/179 (3%)
 Frame = +1

Query  1    VVMQSILGSPVTS--FKNRNGVSQ-FVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPV  171
            ++M SI  SP T+    +R  V++   P+++ PRL       VR M+E+   +    TP 
Sbjct  5    ILMHSIPVSPTTTIDLSSRKSVARGLFPANHSPRLAPRGGLRVRCMTEEIKPEGSTETPA  64

Query  172  TEssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELA  351
            ++  +++P PTP PSP PK    +  N  DVF+FSGP PERINGRLAMIGF AA+ +EL+
Sbjct  65   SDVPSSSPTPTPSPSPKPKRKVST--NFTDVFAFSGPAPERINGRLAMIGFVAAIAVELS  122

Query  352  NGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
             G DLFAQIS+GG+ WFLG++ LL++AS++PLFQGVT ESKS GLMT+DAE+WNGR AM
Sbjct  123  KGQDLFAQISDGGIPWFLGTSVLLSVASLVPLFQGVTVESKSDGLMTSDAELWNGRLAM  181



>gb|ABQ01425.1| early light inducible protein [Medicago falcata]
Length=199

 Score =   158 bits (400),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 90/163 (55%), Positives = 113/163 (69%), Gaps = 4/163 (2%)
 Frame = +1

Query  49   RNGVSQF--VPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEssttapkptpppspa  222
            R  V+QF  +PS Y+P  +RN S  VRSM+E+   KEQP  PV   +  +    PP    
Sbjct  20   RPRVNQFNNIPSVYMPSFRRNASLKVRSMAEEGQ-KEQPKGPVDPITPPSAPTPPPQPQP  78

Query  223  pkvaa-ksstNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNGGVTW  399
                + K ST   D+ +F GP PERINGRLAMIGF AAMG+E+ANG  LF QIS GG+ W
Sbjct  79   TYTRSPKMSTKFSDLMAFGGPAPERINGRLAMIGFVAAMGVEIANGQGLFDQISGGGIPW  138

Query  400  FLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            FLG++ LL+LAS+IP FQGV+ ESKSKG+M++DAE+WNGR AM
Sbjct  139  FLGTSVLLSLASLIPFFQGVSVESKSKGVMSSDAELWNGRIAM  181



>sp|P11432.1|ELI_PEA RecName: Full=Early light-induced protein, chloroplastic; Short=ELIP; 
Flags: Precursor [Pisum sativum]
 emb|CAA29399.1| ELI protein [Pisum sativum]
Length=196

 Score =   158 bits (399),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 92/175 (53%), Positives = 122/175 (70%), Gaps = 5/175 (3%)
 Frame = +1

Query  10   QSILGSPVTSFKNRNGVSQF--VPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEss  183
            QSI+ + +T+  +R+ V+QF  +PS Y+P L+RN S  VRSM+E +  KEQ    V  ++
Sbjct  7    QSIMSNSMTNISSRSRVNQFTNIPSVYIPTLRRNVSLKVRSMAEGEP-KEQSKVAVDPTT  65

Query  184  ttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGD  363
             TA  PTP P+        +  +  D+ +FSGP PERINGRLAMIGF AAMG+E+A G  
Sbjct  66   PTASTPTPQPAYTRPPKMSTKFS--DLMAFSGPAPERINGRLAMIGFVAAMGVEIAKGQG  123

Query  364  LFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            L  Q+S GGV WFLG++ LL+LAS+IP FQGV+ ESKSK +M++DAE WNGR AM
Sbjct  124  LSEQLSGGGVAWFLGTSVLLSLASLIPFFQGVSVESKSKSIMSSDAEFWNGRIAM  178



>ref|XP_011090668.1| PREDICTED: early light-induced protein 2, chloroplastic isoform 
X2 [Sesamum indicum]
Length=188

 Score =   157 bits (398),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 89/173 (51%), Positives = 116/173 (67%), Gaps = 19/173 (11%)
 Frame = +1

Query  19   LGSPVTSFKNRNGVSQFV-PSSY--LPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEsstt  189
             GSPVT  +   G+++F  P++Y  LP  +R   F VRSM+E+D   ++P     + +T 
Sbjct  14   CGSPVT--RRAAGLNKFFGPTNYAMLPA-KRVAKFRVRSMAEEDDQIKEPAVVPPKPTTP  70

Query  190  apkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLF  369
                                   DV +FSGPGPERINGRLAMIGF AA+GME+ANG D+F
Sbjct  71   PKPKVST-------------GFSDVLAFSGPGPERINGRLAMIGFVAAIGMEIANGQDIF  117

Query  370  AQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            AQ+ NGG+ WFLG++ LL+LAS+IP+F+GVTAESKS  LMT+DAE+WNGRFAM
Sbjct  118  AQVQNGGIPWFLGTSVLLSLASLIPMFRGVTAESKSGDLMTSDAELWNGRFAM  170



>gb|ABU98940.1| early light-induced protein 3 [Rhododendron catawbiense]
Length=181

 Score =   157 bits (397),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 88/176 (50%), Positives = 117/176 (66%), Gaps = 19/176 (11%)
 Frame = +1

Query  4    VMQSILGSPVTSFKNRNGVSQFVP-SSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEs  180
            VMQSIL SPVT      G+S+ +P SSYLPR  R+   LVR M++D   KE+  +PV   
Sbjct  6    VMQSILVSPVTGVAKGAGLSRTIPRSSYLPRQGRDSGMLVRCMAKDGK-KEEVESPVK--  62

Query  181  sttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGG  360
                              AK+  + +D+ +FSGPGPERINGRLAM+GF AA+ +EL+ G 
Sbjct  63   ---------------ATVAKARIDFFDLLAFSGPGPERINGRLAMVGFVAAIAVELSKGE  107

Query  361  DLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            D+FAQISNGG+ WFL +T +L++AS+IPL  GV+ ES+SK   ++DAE+ NGRFAM
Sbjct  108  DVFAQISNGGIPWFLLTTGVLSIASLIPLSSGVSVESRSKPFWSSDAEMLNGRFAM  163



>ref|XP_004296581.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
[Fragaria vesca subsp. vesca]
Length=197

 Score =   157 bits (398),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 89/148 (60%), Positives = 110/148 (74%), Gaps = 0/148 (0%)
 Frame = +1

Query  85   LPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEssttapkptpppspapkvaaksstNLWDV  264
            LP L R P+  VRSM+ED   +E+P+T    S   A  PTP P P P    K ST   DV
Sbjct  32   LPTLHRYPNMRVRSMAEDGLPEEKPSTVSEPSKIPAAAPTPTPFPPPPRTPKVSTKFGDV  91

Query  265  FSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNGGVTWFLGSTALLTLASVIP  444
            F+FSGP PERINGRLAM+GF +A+ +EL  G D+F+QIS+GGV+ FLG++ LL++ASVIP
Sbjct  92   FAFSGPAPERINGRLAMVGFVSALAVELLKGQDVFSQISDGGVSVFLGTSILLSVASVIP  151

Query  445  LFQGVTAESKSKGLMTADAEIWNGRFAM  528
            LFQGV+ ESKSKGLMT+DAE+WNGR AM
Sbjct  152  LFQGVSVESKSKGLMTSDAELWNGRLAM  179



>ref|XP_010043034.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
isoform X3 [Eucalyptus grandis]
 gb|KCW85049.1| hypothetical protein EUGRSUZ_B01895 [Eucalyptus grandis]
Length=181

 Score =   157 bits (396),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 88/179 (49%), Positives = 116/179 (65%), Gaps = 23/179 (13%)
 Frame = +1

Query  1    VVMQSILGSPVTS--FKNRNGVSQ-FVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPV  171
            ++M SI  SP T+    +R  V++   P+++ PRL       VR M+E++     P+   
Sbjct  5    ILMHSIPVSPTTTIDLSSRKSVARGLFPANHSPRLAPRGGLRVRCMTEENKRDLNPSP--  62

Query  172  TEssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELA  351
                              K  +K STN  DVF+FSGP PERINGRLAMIGF AA+ +EL+
Sbjct  63   ------------------KSKSKVSTNFRDVFAFSGPAPERINGRLAMIGFVAAISVELS  104

Query  352  NGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
             G DLFAQIS GG+ WF+G++ LL++AS++PLFQGVTAESKS GLMT+DAE+WNGR AM
Sbjct  105  KGQDLFAQISEGGIPWFIGTSVLLSVASLVPLFQGVTAESKSDGLMTSDAELWNGRLAM  163



>gb|AFK35794.1| unknown [Medicago truncatula]
Length=191

 Score =   157 bits (397),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 90/163 (55%), Positives = 113/163 (69%), Gaps = 4/163 (2%)
 Frame = +1

Query  49   RNGVSQF--VPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEssttapkptpppspa  222
            R  V+QF  +PS Y+P  +RN S  VRSM+E+   KEQP  PV   + T+    PP    
Sbjct  12   RPRVNQFNNIPSVYMPSFRRNASLKVRSMAEEGQ-KEQPKVPVDPITPTSAPTPPPQPQP  70

Query  223  pkvaa-ksstNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNGGVTW  399
                + K ST   D+ +F GP PERINGRLAMIGF AAMG+E+A G  LF QIS GG+ W
Sbjct  71   TYTRSPKMSTKFSDLMAFGGPAPERINGRLAMIGFVAAMGVEIAKGQGLFDQISGGGIPW  130

Query  400  FLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            FLG++ LL+LAS+IP FQGV+ ESKSKG+M++DAE+WNGR AM
Sbjct  131  FLGTSVLLSLASLIPFFQGVSVESKSKGVMSSDAELWNGRIAM  173



>gb|KEH43785.1| early light-induced-like protein [Medicago truncatula]
Length=200

 Score =   157 bits (397),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 90/163 (55%), Positives = 113/163 (69%), Gaps = 4/163 (2%)
 Frame = +1

Query  49   RNGVSQF--VPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEssttapkptpppspa  222
            R  V+QF  +PS Y+P  +RN S  VRSM+E+   KEQP  PV   + T+    PP    
Sbjct  21   RPRVNQFNNIPSVYMPSFRRNASLKVRSMAEEGQ-KEQPKVPVDPITPTSAPTPPPQPQP  79

Query  223  pkvaa-ksstNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNGGVTW  399
                + K ST   D+ +F GP PERINGRLAMIGF AAMG+E+A G  LF QIS GG+ W
Sbjct  80   TYTRSPKMSTKFSDLMAFGGPAPERINGRLAMIGFVAAMGVEIAKGQGLFDQISGGGIPW  139

Query  400  FLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            FLG++ LL+LAS+IP FQGV+ ESKSKG+M++DAE+WNGR AM
Sbjct  140  FLGTSVLLSLASLIPFFQGVSVESKSKGVMSSDAELWNGRIAM  182



>ref|XP_007225864.1| hypothetical protein PRUPE_ppa011747mg [Prunus persica]
 gb|EMJ27063.1| hypothetical protein PRUPE_ppa011747mg [Prunus persica]
Length=198

 Score =   157 bits (397),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 89/157 (57%), Positives = 118/157 (75%), Gaps = 3/157 (2%)
 Frame = +1

Query  58   VSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEssttapkptpppspapkvaa  237
            V+  +P+ Y P L R P+  VRSM+E+   +EQP+T     ++  P P P P+P PK + 
Sbjct  27   VNHLLPAKYAPTLHRYPNMRVRSMAENGQ-EEQPST--APEASKIPPPPPTPTPPPKRSP  83

Query  238  ksstNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNGGVTWFLGSTA  417
            K ST   DVF+FSGP PERINGRLAM+GF +A+ +ELA G DLFAQIS+GGV+ FLG++ 
Sbjct  84   KISTKFSDVFAFSGPAPERINGRLAMVGFVSALAVELAKGQDLFAQISDGGVSLFLGTSI  143

Query  418  LLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            LL++AS+IPLF+GV+ ESKS G+MT+DAE+WNGR AM
Sbjct  144  LLSVASLIPLFRGVSVESKSDGIMTSDAELWNGRLAM  180



>emb|CDY10676.1| BnaA05g16860D [Brassica napus]
Length=196

 Score =   157 bits (396),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 94/175 (54%), Positives = 128/175 (73%), Gaps = 5/175 (3%)
 Frame = +1

Query  7    MQSILGSPVTSFK-NRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEss  183
            MQS+    +T+ K N N +  F   ++ P L+RN    VR M+E +  K++ +TP+T ++
Sbjct  8    MQSVFAGGLTTRKINTNNL--FFAGNF-PNLKRNFPVGVRCMAEGEPMKDE-STPLTSAA  63

Query  184  ttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGD  363
               PK + PP P P    K ST   D+ +FSGP PERINGRLAM+GF AA+ +EL+ G +
Sbjct  64   QPLPKSSSPPPPPPPTKPKVSTKFSDLLAFSGPAPERINGRLAMVGFVAALAVELSKGEN  123

Query  364  LFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            +FAQIS+GGV+WFLG+TA+LTLAS++PLFQG+TAESKSKG MT++AE+WNGRFAM
Sbjct  124  VFAQISDGGVSWFLGTTAILTLASLVPLFQGITAESKSKGFMTSNAELWNGRFAM  178



>gb|AFK46043.1| unknown [Medicago truncatula]
Length=200

 Score =   157 bits (396),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 89/160 (56%), Positives = 112/160 (70%), Gaps = 4/160 (3%)
 Frame = +1

Query  58   VSQF--VPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEssttapkptpppspapkv  231
            V+QF  +PS Y+P  +RN S  VRSM+E+   KEQP  PV   + T+    PP       
Sbjct  24   VNQFNNIPSVYMPSFRRNASLKVRSMAEEGQ-KEQPKVPVDPITPTSAPTPPPQPQPTYT  82

Query  232  aa-ksstNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNGGVTWFLG  408
             + K ST   D+ +F GP PERINGRLAMIGF AAMG+E+A G  LF QIS GG+ WFLG
Sbjct  83   RSPKMSTKFSDLMAFGGPAPERINGRLAMIGFVAAMGVEIAKGQGLFDQISGGGIPWFLG  142

Query  409  STALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            ++ LL+LAS+IP FQGV+ ESKSKG+M++DAE+WNGR AM
Sbjct  143  TSVLLSLASLIPFFQGVSVESKSKGVMSSDAELWNGRIAM  182



>ref|XP_009145258.1| PREDICTED: early light-induced protein 1, chloroplastic [Brassica 
rapa]
Length=196

 Score =   156 bits (395),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 94/175 (54%), Positives = 128/175 (73%), Gaps = 5/175 (3%)
 Frame = +1

Query  7    MQSILGSPVTSFK-NRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEss  183
            MQS+    +T+ K N N +  F   ++ P L+RN    VR M+E +  K++ +TP+T ++
Sbjct  8    MQSVFAGGLTTRKINTNNL--FFAGNF-PNLKRNFPVGVRCMAEGEPMKDE-STPLTSAA  63

Query  184  ttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGD  363
               PK + PP P P    K ST   D+ +FSGP PERINGRLAM+GF AA+ +EL+ G +
Sbjct  64   QPLPKSSSPPPPPPPTKPKVSTKFNDLLAFSGPAPERINGRLAMVGFVAALAVELSKGEN  123

Query  364  LFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            +FAQIS+GGV+WFLG+TA+LTLAS++PLFQG+TAESKSKG MT++AE+WNGRFAM
Sbjct  124  VFAQISDGGVSWFLGTTAILTLASLVPLFQGITAESKSKGFMTSNAELWNGRFAM  178



>gb|KEH43766.1| early light-induced-like protein [Medicago truncatula]
Length=198

 Score =   156 bits (395),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 94/162 (58%), Positives = 117/162 (72%), Gaps = 4/162 (2%)
 Frame = +1

Query  49   RNGVSQF--VPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEssttapkptpppspa  222
            R  V+QF  +PS Y+P  +RN S  VRSM+E++  KEQ   P+ +  TT   PTPPP  A
Sbjct  21   RPRVNQFNNIPSVYMPSFRRNASLKVRSMAEEEQ-KEQSEVPL-DPITTPSAPTPPPQSA  78

Query  223  pkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNGGVTWF  402
               A K ST   D+ +F GP PERINGRLAMIGF AAMG+E+A G  LF QIS GG+ WF
Sbjct  79   YTRAPKMSTKFSDLMAFGGPAPERINGRLAMIGFVAAMGVEIAKGQGLFDQISGGGIPWF  138

Query  403  LGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            LG++ LL+LAS+IP FQGV+ ESKSKG+M++DAE+WNGR AM
Sbjct  139  LGTSVLLSLASLIPFFQGVSVESKSKGVMSSDAELWNGRIAM  180



>emb|CDO99111.1| unnamed protein product [Coffea canephora]
Length=191

 Score =   156 bits (394),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 90/181 (50%), Positives = 116/181 (64%), Gaps = 17/181 (9%)
 Frame = +1

Query  1    VVMQSILGSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKE-----QPTT  165
            V MQS LGSPV    +R G++Q V  S    L +  +F VRSM+E++  +      QPT 
Sbjct  5    VAMQSFLGSPVAGVSSRRGLNQVVRLSCGLHLPKRANFRVRSMAEENDKETADAAPQPTQ  64

Query  166  PVTEssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMGME  345
            P                P P    K ST   DV +FSGPGPERINGRLAMIGF AA+G+E
Sbjct  65   P------------NVAQPNPAPKPKVSTKFEDVLAFSGPGPERINGRLAMIGFVAAIGVE  112

Query  346  LANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFA  525
            L  G DLF QI++GG+ WF+G++ LL++AS+IPLF+GV AE++  G M +DAE+WNGRFA
Sbjct  113  LGRGQDLFTQINDGGLQWFIGTSVLLSIASLIPLFRGVRAEAEGGGFMNSDAELWNGRFA  172

Query  526  M  528
            M
Sbjct  173  M  173



>ref|XP_010488320.1| PREDICTED: early light-induced protein 1, chloroplastic [Camelina 
sativa]
Length=193

 Score =   156 bits (394),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 88/175 (50%), Positives = 118/175 (67%), Gaps = 8/175 (5%)
 Frame = +1

Query  7    MQSILGSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPT-TPVTEss  183
            MQS+    +T+ +  N    F   S+ P L+RN    VR M+E +  KE  T TP T + 
Sbjct  8    MQSVFAGGLTTTRKINSNKLFSAGSF-PNLKRNYPVGVRCMAEGEPKKEDSTATPATSAL  66

Query  184  ttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGD  363
              +P P PP  P             D+ +FSGP PERINGRLAM+GF AA+ +EL+ G +
Sbjct  67   PKSPSPPPPMKPKVST------KFSDLLAFSGPAPERINGRLAMVGFVAALAVELSKGEN  120

Query  364  LFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            + +QIS+GGV+WFLG+TA+LTLAS++PLF+G+T ESKSKG+MT+DAE+WNGRFAM
Sbjct  121  VLSQISDGGVSWFLGTTAILTLASLVPLFKGITVESKSKGIMTSDAELWNGRFAM  175



>ref|XP_004134120.1| PREDICTED: early light-induced protein, chloroplastic-like [Cucumis 
sativus]
 ref|XP_004162267.1| PREDICTED: early light-induced protein, chloroplastic-like [Cucumis 
sativus]
 gb|KGN56941.1| hypothetical protein Csa_3G145780 [Cucumis sativus]
Length=192

 Score =   155 bits (393),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 84/175 (48%), Positives = 118/175 (67%), Gaps = 6/175 (3%)
 Frame = +1

Query  4    VMQSILGSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEss  183
            VMQSIL +  T    R   ++ +P++  P  +   +F VR M+E+D  +EQ        S
Sbjct  6    VMQSILSTTATRGVYRTTTNRLLPAALRPCSRSTAAFRVRCMAEEDQ-REQAIPSSIPPS  64

Query  184  ttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGD  363
               P+P+P P             L D+ +FSGPGPERINGRLAMIGF AA+ +E++ G D
Sbjct  65   PPKPEPSPSPPSKVTST-----KLTDILAFSGPGPERINGRLAMIGFVAALAVEVSKGQD  119

Query  364  LFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            +F QI+NGG+ WF+G++ +LTLAS+IPLF+GV+AES SKG+M+++AE+WNGRFAM
Sbjct  120  VFEQIANGGIPWFVGTSVVLTLASLIPLFKGVSAESNSKGIMSSNAELWNGRFAM  174



>ref|XP_006414662.1| hypothetical protein EUTSA_v10026335mg [Eutrema salsugineum]
 gb|ESQ56115.1| hypothetical protein EUTSA_v10026335mg [Eutrema salsugineum]
Length=185

 Score =   155 bits (392),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 84/176 (48%), Positives = 112/176 (64%), Gaps = 18/176 (10%)
 Frame = +1

Query  7    MQSILGSPVTSFKNRN--GVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEs  180
            MQS+  +P     +RN    +QF         +RNPS  VR M+++D  KE  + P T +
Sbjct  8    MQSVFAAPSGGLSSRNIRNTNQFF-------FKRNPSVGVRCMAQNDPIKEDSSLPSTSA  60

Query  181  sttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGG  360
            +      + P                D+ +FSGP PERINGRLAM+GF AA+ +EL+ G 
Sbjct  61   TQPQEPASKPKVST---------KFRDLLAFSGPAPERINGRLAMVGFVAALAVELSKGE  111

Query  361  DLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            ++ AQIS+GG  WFLG+TALLTLAS++PLF+G+ AESKSKG MT+DAE+WNGRFAM
Sbjct  112  NVLAQISDGGAGWFLGTTALLTLASMVPLFKGIRAESKSKGFMTSDAELWNGRFAM  167



>ref|NP_001235754.1| early light-induced protein [Glycine max]
 gb|AAC16403.1| early light-induced protein [Glycine max]
Length=192

 Score =   155 bits (392),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 94/175 (54%), Positives = 124/175 (71%), Gaps = 9/175 (5%)
 Frame = +1

Query  7    MQSILGSPVTSFKNRNGVSQF-VPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEss  183
            MQSIL +P+    + + V+QF VP+ ++   +RN    VRSM++++   E P  PVT   
Sbjct  8    MQSILANPLIRISSGSRVNQFGVPALHM---RRNVGLRVRSMAKEEQPSE-PAIPVTPPP  63

Query  184  ttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGD  363
            +  PKP P  +P+PKV+        DV +FSGP PERINGRLAMIGF AAM +E+A G  
Sbjct  64   SVEPKPQPVSAPSPKVST----KFSDVLAFSGPAPERINGRLAMIGFVAAMAVEVAIGQG  119

Query  364  LFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            +  QISNGG+ WFLG++ +LTLAS+IPLFQGV+ ESKSKG M++DAE+WNGRFAM
Sbjct  120  VLEQISNGGIPWFLGTSVVLTLASLIPLFQGVSVESKSKGFMSSDAELWNGRFAM  174



>ref|XP_008364578.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
[Malus domestica]
Length=195

 Score =   155 bits (392),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 96/178 (54%), Positives = 126/178 (71%), Gaps = 7/178 (4%)
 Frame = +1

Query  1    VVMQSILGSPVTSFKNRNGVSQFVPSSYLP-RLQRNPSFLVRSMSEDDAGKEQPTTPVTE  177
            V MQSI  S V     ++ V+Q + S+  P  L+++    V SM++DD  KEQPTT  +E
Sbjct  5    VSMQSIFTSSVAYGVGKSRVNQLIVSANYPVSLRKHAHMRVISMAKDDQ-KEQPTTYASE  63

Query  178  ssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANG  357
            +S  AP    PP P+PKV       + DV +FSGP PERINGRLAM+GF AA+ +EL+ G
Sbjct  64   NSEPAPSSPLPPRPSPKVTP----KISDVLAFSGPAPERINGRLAMVGFVAALAVELSKG  119

Query  358  GDLFAQISNG-GVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
             D+FAQISNG G+  FLG++ LLT+AS++PL +GV+AESKSKGLMT+DAE+WNGR AM
Sbjct  120  QDVFAQISNGAGIPLFLGTSILLTVASLVPLLKGVSAESKSKGLMTSDAELWNGRLAM  177



>gb|ABU98938.1| early light-induced protein 1 [Rhododendron catawbiense]
Length=181

 Score =   155 bits (391),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 88/176 (50%), Positives = 115/176 (65%), Gaps = 19/176 (11%)
 Frame = +1

Query  4    VMQSILGSPVTSFKNRNGVSQFVP-SSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEs  180
            VMQSIL SPVT      G+S+ +P S YLPR  RN   LVR M++D   KE+  +P+   
Sbjct  6    VMQSILVSPVTGVAKGAGLSRTIPRSCYLPRQGRNSGMLVRCMAKDGR-KEEVESPIE--  62

Query  181  sttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGG  360
                              AK  T+ +D+ +FSGPGPERINGRLAM+GF AA+ +EL  G 
Sbjct  63   ---------------ANVAKVRTDFFDLLAFSGPGPERINGRLAMVGFVAAIAVELYKGE  107

Query  361  DLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            D+FAQISNGG+ WFL +T +L++AS+IPL  GV+ ES+SK   ++DAE+ NGRFAM
Sbjct  108  DVFAQISNGGIPWFLLTTGVLSVASLIPLSSGVSVESRSKPFWSSDAEMLNGRFAM  163



>ref|XP_006298609.1| hypothetical protein CARUB_v10014694mg [Capsella rubella]
 gb|EOA31507.1| hypothetical protein CARUB_v10014694mg [Capsella rubella]
Length=196

 Score =   155 bits (392),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 92/174 (53%), Positives = 123/174 (71%), Gaps = 3/174 (2%)
 Frame = +1

Query  7    MQSILGSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEsst  186
            MQS+    +T+ +  N    F   S+ P L+RN    VR M+E D  K Q +TP T S++
Sbjct  8    MQSVFAGGLTTTRKINTNKLFSAGSF-PNLKRNFPVGVRCMAEGDPTK-QDSTP-TPSTS  64

Query  187  tapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDL  366
             +      PSP P +  K ST   D+ +FSGP PERINGRLAM+GF AA+ +EL+ G ++
Sbjct  65   ASQPLPKSPSPPPPMKPKVSTKFSDLLAFSGPAPERINGRLAMVGFVAALAVELSKGENV  124

Query  367  FAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
             AQIS+GGV+WFLG+TA+LTLAS++PLF+G+TAESKS G+MT+DAE+WNGRFAM
Sbjct  125  LAQISDGGVSWFLGTTAILTLASLVPLFKGITAESKSDGIMTSDAELWNGRFAM  178



>ref|XP_010440414.1| PREDICTED: early light-induced protein 2, chloroplastic-like 
[Camelina sativa]
Length=193

 Score =   154 bits (390),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 87/174 (50%), Positives = 120/174 (69%), Gaps = 6/174 (3%)
 Frame = +1

Query  7    MQSILGSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEsst  186
            MQS+L +P     +RN     + ++     +RN    V+ M++ D  KE P+ P+T +S 
Sbjct  8    MQSVLAAPSGGLISRN-----IRNTNQLFFKRNAPVGVKCMAQGDPIKEDPSVPLTSTSA  62

Query  187  tapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDL  366
              P+  P P P       S+    D+ +FSGP PERINGRLAM+GF AA+ +EL+ G ++
Sbjct  63   AQPQMPPSPPPPVSKPKVST-KFGDLLAFSGPAPERINGRLAMVGFVAAIAVELSKGENV  121

Query  367  FAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            FAQIS+GGV WFLG+TALLTLAS++PLF+G+ AE+KSKG+MT+DAE+WNGRFAM
Sbjct  122  FAQISDGGVGWFLGTTALLTLASMVPLFKGIRAEAKSKGIMTSDAELWNGRFAM  175



>ref|XP_010440411.1| PREDICTED: early light-induced protein 2, chloroplastic-like 
[Camelina sativa]
Length=192

 Score =   154 bits (390),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 87/174 (50%), Positives = 118/174 (68%), Gaps = 7/174 (4%)
 Frame = +1

Query  7    MQSILGSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEsst  186
            MQS+  +P     +RN     + ++     +RN    VR M++ D  KE P+ P T +S 
Sbjct  8    MQSVFAAPSGGLSSRN-----IRNTNQLFFKRNAPVGVRCMAQGDPIKEDPSVPSTSTSA  62

Query  187  tapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDL  366
              P+  P P P  K    +     D+ +FSGP PERINGRLAM+GF AA+ +EL+ G ++
Sbjct  63   AQPQMPPSPPPVSKPKVST--KFRDLLAFSGPAPERINGRLAMVGFVAAIALELSKGENV  120

Query  367  FAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            FAQIS+GGV WFLG+TALLT+AS++PLF+G+ AE+KSKGLMT+DAE+WNGRFAM
Sbjct  121  FAQISDGGVGWFLGTTALLTVASMVPLFKGIRAEAKSKGLMTSDAELWNGRFAM  174



>ref|XP_010043032.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
isoform X1 [Eucalyptus grandis]
 gb|KCW85050.1| hypothetical protein EUGRSUZ_B01895 [Eucalyptus grandis]
Length=199

 Score =   154 bits (390),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 91/179 (51%), Positives = 124/179 (69%), Gaps = 5/179 (3%)
 Frame = +1

Query  1    VVMQSILGSPVTSFK---NRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPV  171
            ++++SI  SP  + +    R+ V    P+ ++PR        VR M+E+   +    TP 
Sbjct  5    ILLRSIPASPSAAIEINSRRSVVRGRFPAYHVPRTAPRGGLRVRCMTEEIKPEGSTETPA  64

Query  172  TEssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELA  351
            ++  +++P PTP PSP PK    +  N  DVF+FSGP PERINGRLAMIGF AA+ +EL+
Sbjct  65   SDVPSSSPTPTPSPSPKPKRKVST--NFTDVFAFSGPAPERINGRLAMIGFVAAIAVELS  122

Query  352  NGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
             G DLFAQIS+GG+ WFLG++ LL++AS++PLFQGVT ESKS GLMT+DAE+WNGR AM
Sbjct  123  KGQDLFAQISDGGIPWFLGTSVLLSVASLVPLFQGVTVESKSDGLMTSDAELWNGRLAM  181



>gb|ABU98939.1| early light-induced protein 2 [Rhododendron catawbiense]
Length=181

 Score =   154 bits (388),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 87/176 (49%), Positives = 115/176 (65%), Gaps = 19/176 (11%)
 Frame = +1

Query  4    VMQSILGSPVTSFKNRNGVSQFVP-SSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEs  180
            VMQSIL SPVT      G+++ +P S YLPR  RN   LVR M++D   KE+  +P+   
Sbjct  6    VMQSILVSPVTGVAKGAGLNRTIPRSCYLPRQGRNSGMLVRCMAKDGR-KEEVESPIE--  62

Query  181  sttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGG  360
                              AK  T+ +D+ +FSGPGPERINGRLAM+GF AA+ +EL  G 
Sbjct  63   ---------------ANVAKVKTDFFDLLAFSGPGPERINGRLAMVGFVAAIAVELYKGE  107

Query  361  DLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            D+FAQISNGG+ WFL +T +L++AS+IPL  GV+ ES+SK   ++DAE+ NGRFAM
Sbjct  108  DVFAQISNGGIPWFLLTTGVLSVASLIPLSSGVSVESRSKPFWSSDAEMLNGRFAM  163



>ref|XP_010511764.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
[Camelina sativa]
Length=192

 Score =   154 bits (389),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 88/175 (50%), Positives = 117/175 (67%), Gaps = 9/175 (5%)
 Frame = +1

Query  7    MQSILGSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPT-TPVTEss  183
            MQS+    +T+ +  N    F  S     L+RN    VR M+E +  KE  T TP T + 
Sbjct  8    MQSVFAGGLTTTRKINTNKHFAGS--FSNLKRNYPVGVRCMAEGEPKKEDSTATPSTSAL  65

Query  184  ttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGD  363
              +P P PP  P             D+ +FSGP PERINGRLAM+GF AA+ +EL+ G +
Sbjct  66   PKSPSPPPPMKPKVST------KFTDLLAFSGPAPERINGRLAMVGFVAALAVELSKGEN  119

Query  364  LFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            + +QIS+GGV+WFLG+TA+LTLAS++PLF+G+TAESKSKG+MT+DAE+WNGRFAM
Sbjct  120  VLSQISDGGVSWFLGTTAILTLASLVPLFKGITAESKSKGIMTSDAELWNGRFAM  174



>ref|XP_011090667.1| PREDICTED: early light-induced protein 1, chloroplastic isoform 
X1 [Sesamum indicum]
Length=189

 Score =   154 bits (389),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 91/173 (53%), Positives = 115/173 (66%), Gaps = 18/173 (10%)
 Frame = +1

Query  19   LGSPVTSFKNRNGVSQFV-PSSY--LPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEsstt  189
             GSPVT  +   G+++F  P++Y  LP  +R   F VRSM+E +   +Q   P       
Sbjct  14   CGSPVT--RRAAGLNKFFGPTNYAMLPA-KRVAKFRVRSMAEQE--DDQIKEPAVVPPKP  68

Query  190  apkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLF  369
               P P  S              DV +FSGPGPERINGRLAMIGF AA+GME+ANG D+F
Sbjct  69   TTPPKPKVST----------GFSDVLAFSGPGPERINGRLAMIGFVAAIGMEIANGQDIF  118

Query  370  AQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            AQ+ NGG+ WFLG++ LL+LAS+IP+F+GVTAESKS  LMT+DAE+WNGRFAM
Sbjct  119  AQVQNGGIPWFLGTSVLLSLASLIPMFRGVTAESKSGDLMTSDAELWNGRFAM  171



>ref|XP_010435090.1| PREDICTED: early light-induced protein 2, chloroplastic [Camelina 
sativa]
Length=193

 Score =   154 bits (389),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 88/174 (51%), Positives = 118/174 (68%), Gaps = 6/174 (3%)
 Frame = +1

Query  7    MQSILGSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEsst  186
            MQS+L +P     +RN     + ++     +RN    VR M++ D  KE P+ P T +S 
Sbjct  8    MQSVLAAPSGGLISRN-----IRNTNQLFFKRNAPVGVRCMAQGDPIKEDPSVPSTSTSA  62

Query  187  tapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDL  366
              P+  P P P       S+    D+ +FSGP PERINGRLAM+GF AA+ +EL+ G ++
Sbjct  63   AQPQMPPSPPPPVSKPKVST-KFGDLLAFSGPAPERINGRLAMVGFVAAIAVELSKGENV  121

Query  367  FAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            FAQIS+GGV WFLG+TALLTLAS++PLF+G+ AE+KSKG MT+DAE+WNGRFAM
Sbjct  122  FAQISDGGVGWFLGTTALLTLASMVPLFKGIRAEAKSKGFMTSDAELWNGRFAM  175



>gb|KFK23555.1| hypothetical protein AALP_AAs41881U000100 [Arabis alpina]
Length=193

 Score =   154 bits (388),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 87/174 (50%), Positives = 120/174 (69%), Gaps = 6/174 (3%)
 Frame = +1

Query  7    MQSILGSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEsst  186
            MQS+  +P    ++RN     + +S     +RN S +V+ M++DD  KE  ++P + ++ 
Sbjct  8    MQSVFIAPSGVLRSRN-----IRNSNQLFFKRNASMVVKCMAQDDLIKENSSSPSSSAAQ  62

Query  187  tapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDL  366
                 +P P P       S+    D+ +FSGP PERINGRLAM+GF AA+ +EL+ G ++
Sbjct  63   PQIPSSPLPPPPVSKPKVST-KFGDLLAFSGPAPERINGRLAMVGFVAAIAVELSKGENV  121

Query  367  FAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            FAQIS+GGV WFLG+TALLTLAS++PLFQG+ AESKSKG MT+DAE+WNGRFAM
Sbjct  122  FAQISDGGVGWFLGTTALLTLASMVPLFQGIRAESKSKGFMTSDAELWNGRFAM  175



>ref|XP_010450010.1| PREDICTED: early light-induced protein 2, chloroplastic-like 
[Camelina sativa]
 ref|XP_010450012.1| PREDICTED: early light-induced protein 2, chloroplastic-like 
[Camelina sativa]
Length=190

 Score =   153 bits (387),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 89/174 (51%), Positives = 119/174 (68%), Gaps = 9/174 (5%)
 Frame = +1

Query  7    MQSILGSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEsst  186
            MQS+L +P      RN     + ++     +RN    VR M++ D  KE  + P T ++ 
Sbjct  8    MQSVLAAPSGGLSTRN-----IRNTKQLFFKRNAPVGVRCMAQGDPIKEDSSVPSTSAAQ  62

Query  187  tapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDL  366
                P+PPP   PKV+        D+ +FSGP PERINGRLAM+GF AA+ +EL+ G ++
Sbjct  63   PQMPPSPPPVSKPKVST----KFRDLLAFSGPAPERINGRLAMVGFVAAIAVELSKGENV  118

Query  367  FAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            FAQIS+GGV WFLG+TALLTLAS++PLF+G+ AE+KSKGLMT+DAE+WNGRFAM
Sbjct  119  FAQISDGGVGWFLGTTALLTLASMVPLFKGIRAEAKSKGLMTSDAELWNGRFAM  172



>ref|XP_006414664.1| hypothetical protein EUTSA_v10026318mg [Eutrema salsugineum]
 gb|ESQ56117.1| hypothetical protein EUTSA_v10026318mg [Eutrema salsugineum]
Length=191

 Score =   153 bits (387),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 89/177 (50%), Positives = 119/177 (67%), Gaps = 14/177 (8%)
 Frame = +1

Query  7    MQSILGSPV---TSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTE  177
            +QS+  +P     S +N    +QF         +RNPS  VR M+++D  KE  + P T 
Sbjct  8    LQSVFAAPSGHGLSSRNIRNTNQFF-------FKRNPSVGVRCMAQNDPTKEDSSLPSTS  60

Query  178  ssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANG  357
            ++      +PPP   PKV+        D+ +FSGP PERINGRLAM+GF AA+ +EL+ G
Sbjct  61   ATQPQTPLSPPPVSKPKVST----KFGDLLAFSGPAPERINGRLAMVGFVAALAVELSKG  116

Query  358  GDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
             ++ AQIS+GGV WFLG+TALLTLAS++PLF+G+ AESKSKG MT+DAE+WNGRFAM
Sbjct  117  ENVLAQISDGGVGWFLGTTALLTLASMVPLFKGIRAESKSKGFMTSDAELWNGRFAM  173



>gb|AAM67121.1| light-induced protein-like protein [Arabidopsis thaliana]
Length=193

 Score =   153 bits (386),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 87/174 (50%), Positives = 116/174 (67%), Gaps = 6/174 (3%)
 Frame = +1

Query  7    MQSILGSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEsst  186
            MQS+  +P      RN     + ++     +RN    VR M++ D  KE P+ P T +S 
Sbjct  8    MQSVFAAPSGVLTTRN-----IRNTNQLFFKRNAPVGVRCMAQGDPIKEDPSVPSTSTSA  62

Query  187  tapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDL  366
            T P+    P P       S+    D+ +FSGP PERINGRLAM+GF AA+ +EL+ G ++
Sbjct  63   TQPQMPQSPPPPVSKPKVST-KFGDLLAFSGPAPERINGRLAMVGFVAAIAVELSKGENV  121

Query  367  FAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            FAQIS+GGV WFLG+TALLTLAS++PLF+G+ AE+KSKG MT+DAE+WNGRFAM
Sbjct  122  FAQISDGGVGWFLGTTALLTLASMVPLFKGIRAEAKSKGFMTSDAELWNGRFAM  175



>ref|XP_006420039.1| hypothetical protein CICLE_v10005974mg [Citrus clementina]
 ref|XP_006489465.1| PREDICTED: early light-induced protein 1, chloroplastic [Citrus 
sinensis]
 gb|ESR33279.1| hypothetical protein CICLE_v10005974mg [Citrus clementina]
 gb|KDO74445.1| hypothetical protein CISIN_1g029497mg [Citrus sinensis]
Length=192

 Score =   153 bits (386),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 87/180 (48%), Positives = 115/180 (64%), Gaps = 20/180 (11%)
 Frame = +1

Query  10   QSILGSPVTSFKN---RNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQ----PTTP  168
            QS+L SPV +      R+G +Q     YLP L+RN +  VR  +ED+  ++Q    PT P
Sbjct  8    QSMLASPVAARVTGIRRSGANQLSSVKYLPSLRRNVNLSVRCTAEDEQQQQQKDDQPTIP  67

Query  169  VTEssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMGMEL  348
              E                           +VF+FSGP PERINGRLAMIGF AA+G+E+
Sbjct  68   KAEPQPPKKPRMST-------------GFSEVFAFSGPAPERINGRLAMIGFVAALGVEI  114

Query  349  ANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            + G D+FAQ+S+GGV WFLG++ LLT+AS++PLF+GV+ ESKS G MT+DAE+WNGRFAM
Sbjct  115  SKGQDVFAQLSDGGVAWFLGTSVLLTVASLVPLFKGVSVESKSDGFMTSDAELWNGRFAM  174



>emb|CBI26312.3| unnamed protein product [Vitis vinifera]
Length=191

 Score =   152 bits (385),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 92/168 (55%), Positives = 113/168 (67%), Gaps = 3/168 (2%)
 Frame = +1

Query  31   VTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQP--TTPVTEssttapkpt  204
            +T   NR    Q VP   + RLQR+ +  VR   ED   +  P  TT   +  + +    
Sbjct  1    MTRVANRTRDLQVVPPRSVLRLQRS-AVQVRCTKEDGQIERPPPVTTNPQQPPSLSQSRQ  59

Query  205  pppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISN  384
            P P P P  A K ST   DVF+FSGP PERINGRLAM+GF AAMG E+  G D+FAQISN
Sbjct  60   PIPPPPPPPAPKVSTKFGDVFAFSGPAPERINGRLAMVGFVAAMGAEIWKGEDVFAQISN  119

Query  385  GGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            GG+ WFLG+  +L+LAS+IPLF+GV+ ESKSKGLMT+DAE+WNGRFAM
Sbjct  120  GGIPWFLGTAVVLSLASLIPLFKGVSVESKSKGLMTSDAEMWNGRFAM  167



>ref|XP_010466577.1| PREDICTED: early light-induced protein 1, chloroplastic [Camelina 
sativa]
Length=192

 Score =   152 bits (385),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 87/175 (50%), Positives = 116/175 (66%), Gaps = 9/175 (5%)
 Frame = +1

Query  7    MQSILGSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPT-TPVTEss  183
            MQS+    +T+ +  N    F  S     L+RN    VR M+E +  KE  T TP T + 
Sbjct  8    MQSVFAGGLTTTRKINTNEHFAGS--FSNLKRNYPVGVRCMAEGEPKKEDSTATPSTSAL  65

Query  184  ttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGD  363
              +P P PP  P             D+ +FSGP PERINGRLAM+GF AA+ +EL+ G +
Sbjct  66   PKSPSPPPPMKPKVST------KFTDLLAFSGPAPERINGRLAMVGFVAALAVELSKGEN  119

Query  364  LFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            + +QIS+GGV+WFLG+TA+LTLAS++PLF+G+T ESKSKG+MT+DAE+WNGRFAM
Sbjct  120  VLSQISDGGVSWFLGTTAILTLASLVPLFKGITVESKSKGIMTSDAELWNGRFAM  174



>ref|XP_009108614.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
[Brassica rapa]
 gb|AAR11456.1| ELIP [Brassica rapa subsp. pekinensis]
 emb|CDY34227.1| BnaA01g24440D [Brassica napus]
Length=194

 Score =   152 bits (385),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 90/177 (51%), Positives = 120/177 (68%), Gaps = 7/177 (4%)
 Frame = +1

Query  1    VVMQSILGSPVTSFK-NRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTE  177
            V MQS+    + + K N N   +   +   P L+RN    VR M+E   G +  +TP T 
Sbjct  6    VNMQSVFACGLATRKINTN---KLFFAGNFPNLKRNYPVGVRCMAE---GMKDESTPSTS  59

Query  178  ssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANG  357
            ++      + PP P P    K ST   D+ +FSGP PERINGRLAM+GF AA+ +EL+ G
Sbjct  60   AAQPLSSSSSPPPPPPPTKPKVSTKFSDLLAFSGPAPERINGRLAMVGFVAALAVELSKG  119

Query  358  GDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
             ++ AQIS+GGV+WFLG+TA+LTLAS++PLF+G+TAESKSKG MT+DAE+WNGRFAM
Sbjct  120  ENVLAQISDGGVSWFLGTTAILTLASLVPLFKGITAESKSKGFMTSDAELWNGRFAM  176



>ref|XP_010435089.1| PREDICTED: early light-induced protein 2, chloroplastic-like 
[Camelina sativa]
Length=190

 Score =   152 bits (384),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 91/177 (51%), Positives = 121/177 (68%), Gaps = 15/177 (8%)
 Frame = +1

Query  7    MQSILGSP---VTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTE  177
            MQS+  +P   ++S   RN    F         +RN    VR M++ D  KE P+ P T 
Sbjct  8    MQSVFAAPSGGLSSCNIRNTKQLF--------FKRNAPVGVRCMAQGDPIKENPSVPSTS  59

Query  178  ssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANG  357
            +S +   P+PPP   PKV+        D+ +FSGP PERINGRLAM+GF AA+ +EL+ G
Sbjct  60   TSQSQMPPSPPPVSKPKVST----KFGDLLAFSGPAPERINGRLAMVGFVAAIAVELSKG  115

Query  358  GDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
             ++FAQIS+GGV WFLG+TALLTLAS++PLF+G+ AE+KSKG+MT+DAE+WNGRFAM
Sbjct  116  ENVFAQISDGGVGWFLGTTALLTLASMVPLFKGIRAEAKSKGIMTSDAELWNGRFAM  172



>gb|AFD62760.1| ELIP, partial [Citrus sinensis]
Length=208

 Score =   153 bits (386),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 87/180 (48%), Positives = 115/180 (64%), Gaps = 20/180 (11%)
 Frame = +1

Query  10   QSILGSPVTSFKN---RNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQ----PTTP  168
            QS+L SPV +      R+G +Q     YLP L+RN +  VR  +ED+  ++Q    PT P
Sbjct  26   QSMLASPVAARVTGIRRSGANQLSSVKYLPSLRRNVNLSVRCTAEDEQQQQQKDDQPTIP  85

Query  169  VTEssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMGMEL  348
              E                           +VF+FSGP PERINGRLAMIGF AA+G+E+
Sbjct  86   KAEPQPPKKPRMST-------------GFSEVFAFSGPAPERINGRLAMIGFVAALGVEI  132

Query  349  ANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            + G D+FAQ+S+GGV WFLG++ LLT+AS++PLF+GV+ ESKS G MT+DAE+WNGRFAM
Sbjct  133  SKGQDVFAQLSDGGVAWFLGTSVLLTVASLVPLFKGVSVESKSDGFMTSDAELWNGRFAM  192



>emb|CDY29755.1| BnaA01g19110D [Brassica napus]
Length=191

 Score =   152 bits (384),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 80/143 (56%), Positives = 102/143 (71%), Gaps = 3/143 (2%)
 Frame = +1

Query  100  RNPSFLVRSMSEDDAGKEQPTTPVTEssttapkptpppspapkvaaksstNLWDVFSFSG  279
            RNP   VR M++DD  KE+   P T ++        PP  +    +       D+ +FSG
Sbjct  34   RNPLVGVRCMAQDDPIKEESPLPSTSATPPQTPLYSPPPLSKPKVST---KFGDLLAFSG  90

Query  280  PGPERINGRLAMIGFAAAMGMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGV  459
            P PERINGRLAM+GF AA+ +EL+ G ++FAQIS+GGV WFLG+TALLTLAS+IPLF+G+
Sbjct  91   PAPERINGRLAMVGFVAAIAVELSKGENMFAQISDGGVGWFLGTTALLTLASMIPLFKGI  150

Query  460  TAESKSKGLMTADAEIWNGRFAM  528
             AESKSKG MT+DAE+WNGRFAM
Sbjct  151  RAESKSKGFMTSDAELWNGRFAM  173



>ref|XP_010450011.1| PREDICTED: early light-induced protein 2, chloroplastic-like 
[Camelina sativa]
Length=190

 Score =   152 bits (384),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 86/174 (49%), Positives = 117/174 (67%), Gaps = 9/174 (5%)
 Frame = +1

Query  7    MQSILGSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEsst  186
            MQS+  +P      RN     + ++     +RN    VR M++ D  KE  + P T ++ 
Sbjct  8    MQSVFAAPSGGLSTRN-----IRNTKQLFFKRNAPVGVRCMAQGDPIKEDSSVPSTSAAQ  62

Query  187  tapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDL  366
                P+PP +  PK++        D+ +FSGP PERINGRLAMIGF AA+ +EL+ G ++
Sbjct  63   PQMPPSPPQASKPKMST----KFRDLLAFSGPAPERINGRLAMIGFVAAIAVELSKGENV  118

Query  367  FAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            FAQIS+GGV WFLG+TALLTLAS++PLF+G+ AE+KSKG MT+DAE+WNGRFAM
Sbjct  119  FAQISDGGVGWFLGTTALLTLASLVPLFKGIRAEAKSKGFMTSDAELWNGRFAM  172



>ref|XP_010440412.1| PREDICTED: early light-induced protein 2, chloroplastic-like 
[Camelina sativa]
Length=192

 Score =   152 bits (384),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 87/174 (50%), Positives = 118/174 (68%), Gaps = 7/174 (4%)
 Frame = +1

Query  7    MQSILGSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEsst  186
            MQS+  +P     +RN     + ++     +RN    VR M++ D  KE P  P T +S 
Sbjct  8    MQSVFAAPSGGLSSRN-----IRNTNQLFFKRNAPVGVRCMAQGDPIKEDPFMPSTSASA  62

Query  187  tapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDL  366
            + P+  P P P  K    +     D+ +FSGP PERINGRLAM+GF AA+ +EL+ G ++
Sbjct  63   SQPQMPPSPPPVSKPKVST--KFRDLLAFSGPAPERINGRLAMVGFVAAIAVELSKGENV  120

Query  367  FAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            FAQIS+GGV WFLG+TALLT+AS++PLF+G+ AE+KSKGLMT+DAE+WNGRFAM
Sbjct  121  FAQISDGGVGWFLGTTALLTVASMVPLFKGIRAEAKSKGLMTSDAELWNGRFAM  174



>ref|XP_002870293.1| hypothetical protein ARALYDRAFT_330043 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46552.1| hypothetical protein ARALYDRAFT_330043 [Arabidopsis lyrata subsp. 
lyrata]
Length=317

 Score =   155 bits (393),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 91/177 (51%), Positives = 119/177 (67%), Gaps = 11/177 (6%)
 Frame = +1

Query  7    MQSILGSP---VTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTE  177
            MQS+  +P   + S +N    +Q +        +RN    VR M++ D  KE P+ P T 
Sbjct  8    MQSVFAAPSGVLKSSRNIRNTNQLL-------FKRNAPVGVRCMAQGDPIKEDPSVPSTS  60

Query  178  ssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANG  357
            +S T P+  P P P       S+    D+ +FSGP PERINGRLAM+GF AA+ +EL+ G
Sbjct  61   TSATPPQMPPSPPPPVSKPKVST-KFGDLLAFSGPAPERINGRLAMVGFVAAIAVELSKG  119

Query  358  GDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
             ++FAQISNGGV WFLG+TALLTLAS++PLF+G+ AESKSKG MT+DAE+WNGRFAM
Sbjct  120  ENVFAQISNGGVGWFLGTTALLTLASMVPLFKGIRAESKSKGFMTSDAELWNGRFAM  176



>ref|XP_008392721.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
[Malus domestica]
Length=188

 Score =   151 bits (382),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 92/179 (51%), Positives = 124/179 (69%), Gaps = 4/179 (2%)
 Frame = +1

Query  1    VVMQSILGSPVTSFKNRNGVSQF-VPSSYLPR-LQRNPSFLVRSMSEDDAGKEQPTTPVT  174
            V MQSI  S V     ++ V+Q  VP++Y P  L+++    V +M++D+  KEQPTT   
Sbjct  5    VSMQSIFTSSVAYGVGKSRVNQLIVPANYAPSSLRKHAHMRVIAMAKDEQ-KEQPTTVTD  63

Query  175  EssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELAN  354
             S  + P P+ P  P P    K S    DV +FSGP PERINGRLAM+GF AA+ +EL+ 
Sbjct  64   ASENSEPAPSSPLPPPPPPPPKVSPKFSDVLAFSGPAPERINGRLAMVGFVAALAVELSK  123

Query  355  GGDLFAQISNG-GVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            G D+FAQISNG G+  FLG++ LL++AS++PLF+GV+ ESKS+GLMT+DAE+WNGR AM
Sbjct  124  GQDVFAQISNGLGIPLFLGTSILLSVASLVPLFKGVSVESKSEGLMTSDAELWNGRLAM  182



>gb|AAD28779.1|AF134132_1 early light-inducable protein [Arabidopsis thaliana]
Length=186

 Score =   151 bits (382),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 87/174 (50%), Positives = 115/174 (66%), Gaps = 6/174 (3%)
 Frame = +1

Query  7    MQSILGSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEsst  186
            MQS+  +P      RN     + ++     +R     VR M++ D  KE P+ P T +S 
Sbjct  1    MQSVFAAPSGVLTTRN-----IRNTNQLFFKRIAPVGVRCMAQGDPIKEDPSVPSTSTSA  55

Query  187  tapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDL  366
            T P+    P P       S+    D+ +FSGP PERINGRLAM+GF AA+ MEL+ G ++
Sbjct  56   TPPQMPQSPPPPVSKPKVST-KFGDLLAFSGPAPERINGRLAMVGFVAAIAMELSKGENV  114

Query  367  FAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            FAQIS+GGV WFLG+TALLTLAS++PLF+G+ AE+KSKG MT+DAE+WNGRFAM
Sbjct  115  FAQISDGGVGWFLGTTALLTLASMVPLFKGIRAEAKSKGFMTSDAELWNGRFAM  168



>ref|XP_010435088.1| PREDICTED: early light-induced protein 2, chloroplastic-like 
isoform X2 [Camelina sativa]
Length=190

 Score =   152 bits (383),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 91/177 (51%), Positives = 121/177 (68%), Gaps = 15/177 (8%)
 Frame = +1

Query  7    MQSILGSP---VTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTE  177
            MQS+  +P   ++S   RN    F         +RN    VR M++ D  KE P+ P T 
Sbjct  8    MQSVFAAPSGGLSSCNIRNTKQLF--------FKRNAPVGVRCMAQGDPIKENPSVPSTS  59

Query  178  ssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANG  357
            +S +   P+PPP   PKV+        D+ +FSGP PERINGRLAM+GF AA+ +EL+ G
Sbjct  60   TSQSQMPPSPPPVSKPKVST----KFGDLLAFSGPAPERINGRLAMVGFVAAIAVELSKG  115

Query  358  GDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
             ++FAQIS+GGV WFLG+TALLT+AS++PLF+G+ AE+KSKGLMT+DAE+WNGRFAM
Sbjct  116  ENVFAQISDGGVGWFLGTTALLTVASMVPLFKGIRAEAKSKGLMTSDAELWNGRFAM  172



>gb|KCW84128.1| hypothetical protein EUGRSUZ_B01004 [Eucalyptus grandis]
Length=181

 Score =   151 bits (382),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 86/180 (48%), Positives = 114/180 (63%), Gaps = 25/180 (14%)
 Frame = +1

Query  1    VVMQSILGSPVT----SFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTP  168
            ++M S+  SP T    SF+ ++ V  F P ++ PRL       V+ M+++      P+  
Sbjct  5    ILMHSVPASPRTVIDISFR-KSIVRGFFPVNHSPRLAPQVGLCVKCMTKEGKPDLNPSQ-  62

Query  169  VTEssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMGMEL  348
                               K  +K ST   DVF+FSGP PERINGRLAMIGF AA+ +EL
Sbjct  63   -------------------KSKSKVSTGFTDVFAFSGPAPERINGRLAMIGFVAAIAVEL  103

Query  349  ANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            + G DLFAQIS GG+ WF+G++ LL++AS++PLFQGVTAESKS GLMT+DAE+WNGR AM
Sbjct  104  SKGQDLFAQISEGGIPWFIGTSVLLSVASLVPLFQGVTAESKSDGLMTSDAELWNGRLAM  163



>ref|XP_010450014.1| PREDICTED: early light-induced protein 2, chloroplastic-like 
[Camelina sativa]
Length=193

 Score =   151 bits (382),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 87/176 (49%), Positives = 117/176 (66%), Gaps = 10/176 (6%)
 Frame = +1

Query  7    MQSILGSPVTSFKNRN--GVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEs  180
            MQS+  +P     +RN    +Q +        +RN    VR M++ D  KE P+ P T +
Sbjct  8    MQSVFAAPSGGLTSRNMRNTNQLL-------FKRNAPVGVRCMAQGDPIKEDPSVPSTST  60

Query  181  sttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGG  360
            S   P+  P P P       S+    D+ +FSGP PERINGRLAM+GF AA+ +EL+ G 
Sbjct  61   SAAQPQMPPSPPPPVSKPKVST-KFGDLLAFSGPAPERINGRLAMVGFVAAIAVELSKGE  119

Query  361  DLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            ++FAQIS+GGV WFLG++ALLTLAS++PLF+G+ AE+KSKG MT+DAE+WNGRFAM
Sbjct  120  NVFAQISDGGVGWFLGTSALLTLASMVPLFKGIRAEAKSKGFMTSDAELWNGRFAM  175



>ref|NP_567438.1| early light-inducible protein 2 [Arabidopsis thaliana]
 sp|Q94K66.1|ELIP2_ARATH RecName: Full=Early light-induced protein 2, chloroplastic; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAK44081.1|AF370266_1 unknown protein [Arabidopsis thaliana]
 gb|AAL34257.1| unknown protein [Arabidopsis thaliana]
 gb|AEE83475.1| early light-inducible protein 2 [Arabidopsis thaliana]
Length=193

 Score =   151 bits (382),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 87/174 (50%), Positives = 115/174 (66%), Gaps = 6/174 (3%)
 Frame = +1

Query  7    MQSILGSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEsst  186
            MQS+  +P      RN     + ++     +R     VR M++ D  KE P+ P T +S 
Sbjct  8    MQSVFAAPSGVLTTRN-----IRNTNQLFFKRIAPVGVRCMAQGDPIKEDPSVPSTSTSA  62

Query  187  tapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDL  366
            T P+    P P       S+    D+ +FSGP PERINGRLAM+GF AA+ MEL+ G ++
Sbjct  63   TPPQMPQSPPPPVSKPKVST-KFGDLLAFSGPAPERINGRLAMVGFVAAIAMELSKGENV  121

Query  367  FAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            FAQIS+GGV WFLG+TALLTLAS++PLF+G+ AE+KSKG MT+DAE+WNGRFAM
Sbjct  122  FAQISDGGVGWFLGTTALLTLASMVPLFKGIRAEAKSKGFMTSDAELWNGRFAM  175



>ref|XP_009148406.1| PREDICTED: early light-induced protein 2, chloroplastic [Brassica 
rapa]
Length=191

 Score =   150 bits (380),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 80/144 (56%), Positives = 101/144 (70%), Gaps = 3/144 (2%)
 Frame = +1

Query  97   QRNPSFLVRSMSEDDAGKEQPTTPVTEssttapkptpppspapkvaaksstNLWDVFSFS  276
             RNP   VR M++DD  KE+   P T ++        PP  +    +       D+ +FS
Sbjct  33   NRNPLVGVRCMAQDDPIKEESPLPSTSATPPQTPLYSPPPLSKPKVST---KFGDLLAFS  89

Query  277  GPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQG  456
            GP PERINGRLAM+GF AA+ +EL  G ++FAQIS+GGV WFLG+TALLTLAS+IPLF+G
Sbjct  90   GPAPERINGRLAMVGFVAAIAVELLKGENVFAQISDGGVGWFLGTTALLTLASMIPLFKG  149

Query  457  VTAESKSKGLMTADAEIWNGRFAM  528
            + AESKSKG MT+DAE+WNGRFAM
Sbjct  150  IRAESKSKGFMTSDAELWNGRFAM  173



>ref|XP_010435087.1| PREDICTED: early light-induced protein 2, chloroplastic-like 
isoform X1 [Camelina sativa]
Length=192

 Score =   150 bits (380),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 86/174 (49%), Positives = 117/174 (67%), Gaps = 7/174 (4%)
 Frame = +1

Query  7    MQSILGSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEsst  186
            MQS+  +P     +RN     + ++     +RN    VR M++ D  KE  + P T +S 
Sbjct  8    MQSVFAAPSGGLSSRN-----IRNTNQLFFKRNAPVGVRCMAQGDPIKEDSSVPSTSTSA  62

Query  187  tapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDL  366
              P+  P P P  K    +     D+ +FSGP PERINGRLAM+GF AA+ +EL+ G ++
Sbjct  63   AQPQMPPSPPPVSKPKVST--KFGDLLAFSGPAPERINGRLAMVGFVAAIAVELSKGENV  120

Query  367  FAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            FAQIS+GGV WFLG+TALLT+AS++PLF+G+ AE+KSKGLMT+DAE+WNGRFAM
Sbjct  121  FAQISDGGVGWFLGTTALLTVASMVPLFKGIRAEAKSKGLMTSDAELWNGRFAM  174



>emb|CDY46608.1| BnaCnng14300D [Brassica napus]
Length=196

 Score =   150 bits (380),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 88/177 (50%), Positives = 121/177 (68%), Gaps = 5/177 (3%)
 Frame = +1

Query  1    VVMQSILGSPVTSFK-NRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTE  177
            V MQS+    + + K N N   +   +   P L+RN    V+ M+E +  K++ + P T 
Sbjct  6    VNMQSVFACGLATRKINTN---KLFFAGNFPNLKRNYPVGVKCMAEGEPMKDE-SAPSTS  61

Query  178  ssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANG  357
            ++      + PP P P    K ST   D+ +FSGP PERINGRLAM+GF AA+ +EL+ G
Sbjct  62   AAKPLSSSSSPPPPPPPTKPKVSTKFSDLLAFSGPAPERINGRLAMVGFVAALAVELSKG  121

Query  358  GDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
             ++ AQIS+GGV+WFLG+TA+LTLAS++PLF+G+TAESKSKG MT+DAE+WNGRFAM
Sbjct  122  ENVLAQISDGGVSWFLGTTAILTLASLVPLFKGITAESKSKGFMTSDAELWNGRFAM  178



>ref|XP_010440410.1| PREDICTED: early light-induced protein 2, chloroplastic-like 
[Camelina sativa]
Length=190

 Score =   150 bits (379),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 87/174 (50%), Positives = 117/174 (67%), Gaps = 9/174 (5%)
 Frame = +1

Query  7    MQSILGSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEsst  186
            MQS+  +P      RN     + ++     +RN    VR M++ D  KE  + P T ++ 
Sbjct  8    MQSVFAAPSGGLSTRN-----IRNTKQLFFKRNAPVGVRCMAQGDPIKEDSSVPSTSAAQ  62

Query  187  tapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDL  366
                P+PPP   PKV+        D+ +FSGP PERINGRLAM+GF AA+ +EL+ G ++
Sbjct  63   PQMPPSPPPVSKPKVST----KFRDLLAFSGPAPERINGRLAMVGFVAAIAVELSKGENV  118

Query  367  FAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            FAQIS+GGV WFLG+TALLTLAS++PLF+G+ AE+KSKG MT+DAE+WNGRFAM
Sbjct  119  FAQISDGGVGWFLGTTALLTLASMVPLFKGIRAEAKSKGFMTSDAELWNGRFAM  172



>gb|ABU98942.1| early light-induced protein 5 [Rhododendron catawbiense]
Length=177

 Score =   150 bits (378),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 83/177 (47%), Positives = 109/177 (62%), Gaps = 26/177 (15%)
 Frame = +1

Query  4    VMQSILGSPVTSFKNRNGVSQFVPSS--YLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTE  177
            VMQSI+ SPVT      G+S+ +P S  YLPR  RN   LVR M++    +E  + P  +
Sbjct  6    VMQSIMVSPVTGVAKGTGLSRTIPRSCCYLPRQGRNSGMLVRCMAKGGQKEEAGSPPKAK  65

Query  178  ssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANG  357
                                     L+D+ +F GP PERINGRLAMIGF AA+ +EL+ G
Sbjct  66   V------------------------LFDLLAFKGPAPERINGRLAMIGFVAAIAVELSKG  101

Query  358  GDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
             D+FAQISNGG+ WFL +T +L++AS+IPL  GV+ ESKSK   ++DAE+ NGRFAM
Sbjct  102  EDVFAQISNGGIPWFLLTTGVLSVASLIPLSNGVSVESKSKPFWSSDAEMLNGRFAM  158



>ref|XP_010450013.1| PREDICTED: early light-induced protein 2, chloroplastic-like 
[Camelina sativa]
Length=190

 Score =   150 bits (378),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 87/174 (50%), Positives = 117/174 (67%), Gaps = 9/174 (5%)
 Frame = +1

Query  7    MQSILGSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEsst  186
            MQS+  SP     +RN     +  +     +RN    VR M++ D  KE  + P T ++ 
Sbjct  8    MQSVFASPSGGLSSRN-----IRKTSQLFFKRNAPVGVRCMAQGDPIKEDSSVPSTSAAQ  62

Query  187  tapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDL  366
                P+PPP   PKV+        D+ +FSGP PERINGRLAM+GF AA+ +EL+ G ++
Sbjct  63   PQMPPSPPPVSKPKVST----KFRDLLAFSGPAPERINGRLAMVGFVAAIAVELSKGENV  118

Query  367  FAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            FAQIS+GGV WFLG++ALLTLAS++PLF+G+ AE+KSKG MT+DAE+WNGRFAM
Sbjct  119  FAQISDGGVGWFLGTSALLTLASMVPLFKGIRAEAKSKGFMTSDAELWNGRFAM  172



>emb|CDY10312.1| BnaC05g29670D [Brassica napus]
Length=195

 Score =   150 bits (379),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 81/148 (55%), Positives = 109/148 (74%), Gaps = 0/148 (0%)
 Frame = +1

Query  85   LPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEssttapkptpppspapkvaaksstNLWDV  264
             P L+RN    VR M+E +  K++ T   + + +     +PPP P P    K +T   D+
Sbjct  30   FPNLKRNFPVGVRCMAEGEPMKDESTPSTSAAQSLPKSSSPPPPPPPPTTPKVNTKFSDL  89

Query  265  FSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNGGVTWFLGSTALLTLASVIP  444
             +FSGP PERINGRLAM+GF AA+ +EL+ G ++FAQIS+ GV+WFLG+TA+LTLAS++P
Sbjct  90   LAFSGPAPERINGRLAMVGFVAALAVELSKGENVFAQISDDGVSWFLGTTAILTLASLVP  149

Query  445  LFQGVTAESKSKGLMTADAEIWNGRFAM  528
            LFQG+TAESKSKG MT++AE+WNGRFAM
Sbjct  150  LFQGITAESKSKGFMTSNAELWNGRFAM  177



>gb|EYU41436.1| hypothetical protein MIMGU_mgv1a014191mg [Erythranthe guttata]
Length=198

 Score =   150 bits (379),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 96/172 (56%), Positives = 118/172 (69%), Gaps = 9/172 (5%)
 Frame = +1

Query  22   GSPVTSFKNRNGVSQ-FVPS--SYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEsstta  192
            GSPV +   +  +SQ F PS  + LP ++RN  F VRSM+E D  KE    P    +T A
Sbjct  15   GSPVAT--RKAALSQGFGPSNLALLP-MKRNMKFSVRSMAEGDEIKE---VPAAAPATAA  68

Query  193  pkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFA  372
                 PP P P    K  T+ +D+F+FSGP PE+INGRLAM+GF AA+G ELA+G DLFA
Sbjct  69   TPKLTPPPPPPPAKPKVGTDFFDIFAFSGPAPEKINGRLAMVGFVAALGAELASGQDLFA  128

Query  373  QISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            Q+S GG  WFLG++ LLT ASVIPLF+GVTAESKS+G  T+D E WNGRFAM
Sbjct  129  QVSEGGFPWFLGTSILLTFASVIPLFKGVTAESKSEGFFTSDVETWNGRFAM  180



>ref|XP_002885526.1| early light-inducable protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61785.1| early light-inducable protein [Arabidopsis lyrata subsp. lyrata]
Length=183

 Score =   149 bits (377),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 85/174 (49%), Positives = 117/174 (67%), Gaps = 16/174 (9%)
 Frame = +1

Query  7    MQSILGSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEsst  186
            MQS+    +T+ +  NG   F   ++ P L+RN    VR M+E +  K + + P +    
Sbjct  8    MQSVFAGGLTT-RKINGNKLFFAGTF-PSLKRNYPVGVRCMAEGEP-KNEDSAPTS----  60

Query  187  tapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDL  366
                     +  P    K ST   D+ +FSGP PERINGRLAM+GF AA+ +EL+ G ++
Sbjct  61   ---------AAPPPTKPKVSTKFSDLLAFSGPAPERINGRLAMVGFVAALAVELSKGENV  111

Query  367  FAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            FAQIS+GGV+WFLG+TA+LTLAS++PLF+G+TAESKS G+MT+DAE+WNGRFAM
Sbjct  112  FAQISDGGVSWFLGTTAILTLASLVPLFKGITAESKSDGIMTSDAELWNGRFAM  165



>ref|XP_006285275.1| hypothetical protein CARUB_v10006649mg [Capsella rubella]
 gb|EOA18173.1| hypothetical protein CARUB_v10006649mg [Capsella rubella]
Length=192

 Score =   149 bits (377),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 87/174 (50%), Positives = 116/174 (67%), Gaps = 7/174 (4%)
 Frame = +1

Query  7    MQSILGSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEsst  186
            MQS+  +P     +RN     + ++     +RN    VR M++    KE P+ P T +S 
Sbjct  8    MQSVFAAPSGGLSSRN-----IRNTNQIFFKRNAPVGVRCMAQGGPIKEDPSVPSTSTSA  62

Query  187  tapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDL  366
            T P+  P P P  K    +     D+ +FSGP PERINGRLAM+GF AA+ +EL+ G ++
Sbjct  63   TQPQMPPSPPPVSKPKVST--KFRDLLAFSGPAPERINGRLAMVGFVAAIAVELSKGENV  120

Query  367  FAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
             AQIS+GGV WFLG+TALLT+AS+IPLFQG+ AE+KSKG MT+DAE+WNGRFAM
Sbjct  121  LAQISDGGVGWFLGTTALLTMASMIPLFQGIRAEAKSKGFMTSDAELWNGRFAM  174



>ref|XP_006285225.1| hypothetical protein CARUB_v10006584mg [Capsella rubella]
 gb|EOA18123.1| hypothetical protein CARUB_v10006584mg [Capsella rubella]
Length=191

 Score =   149 bits (376),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 84/174 (48%), Positives = 115/174 (66%), Gaps = 8/174 (5%)
 Frame = +1

Query  7    MQSILGSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEsst  186
            MQS+  +P     +RN     + ++     +RN     R M++ D  KE P+ P T ++ 
Sbjct  8    MQSVFAAPSGGLSSRN-----IRNTNQLFFKRNAPVGFRCMAQGDPIKEDPSVPSTSAAQ  62

Query  187  tapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDL  366
                P+PPP  +    +       D+ +FSGP PERINGRLAM+GF AA+ +EL+ G ++
Sbjct  63   PQMPPSPPPPVSKPKVST---KFGDLLAFSGPAPERINGRLAMVGFVAAIAVELSKGENV  119

Query  367  FAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
             AQIS+GGV WFLG+TALLTLAS+IPLF+G+ AE+KSKG MT+DAE+WNGRFAM
Sbjct  120  LAQISDGGVGWFLGTTALLTLASMIPLFKGIRAEAKSKGFMTSDAELWNGRFAM  173



>emb|CDY67220.1| BnaCnng53960D [Brassica napus]
 emb|CDY61075.1| BnaCnng37300D [Brassica napus]
 emb|CDX79257.1| BnaC06g20460D [Brassica napus]
Length=195

 Score =   149 bits (377),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 89/177 (50%), Positives = 122/177 (69%), Gaps = 10/177 (6%)
 Frame = +1

Query  7    MQSILGSPVTSFK-NRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQ--PTTPVTE  177
            MQS+    +T+ K N N   +   +     L+RN    VR M+E +  K++  P+T V++
Sbjct  8    MQSVFAGGLTTRKINTN---KLCFAGNFHNLKRNYPVGVRCMAEGEPMKDESAPSTSVSQ  64

Query  178  ssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANG  357
                +  P PPP   PKV+        D+ +FSGP PERINGRLAM+GF AA+ +EL+ G
Sbjct  65   PLPKSSSPPPPPPTKPKVST----KFSDLLAFSGPAPERINGRLAMVGFVAALAVELSKG  120

Query  358  GDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
             ++ AQIS+GGV+WFLG+ A+LTLAS++PLF+G+TAESKSKGLMT+DAE+WNGRFAM
Sbjct  121  ENVLAQISDGGVSWFLGTAAILTLASLVPLFKGITAESKSKGLMTSDAELWNGRFAM  177



>ref|XP_004289994.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
[Fragaria vesca subsp. vesca]
Length=192

 Score =   149 bits (376),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 93/180 (52%), Positives = 116/180 (64%), Gaps = 16/180 (9%)
 Frame = +1

Query  4    VMQSILGSPVT---SFKNRNGVSQFVPSSYLPRLQRNPSFL-VRSMSEDDAGKEQPTTPV  171
            VMQSILGS V    + KNR   SQ    S +P      S+L VRSM+ED   K+QPTT  
Sbjct  6    VMQSILGSSVAYGAAGKNR---SQMKLRSTVPASYAVSSYLRVRSMAEDGQ-KKQPTTVT  61

Query  172  TEssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELA  351
            T           P           ST   DVF+FSGP PERINGRLAM+GF AA+ +EL+
Sbjct  62   T-------ASKNPQPAEAPSPPPPSTKFSDVFAFSGPAPERINGRLAMVGFVAALAVELS  114

Query  352  NGGDLFAQISNG-GVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
             G D+FAQIS+G GV  F+G++ LL++AS++PL +GVT ESKS G+MT+DAE+WNGR AM
Sbjct  115  KGQDVFAQISSGSGVPLFIGTSVLLSVASLVPLLKGVTVESKSNGIMTSDAELWNGRLAM  174



>ref|XP_006588384.1| PREDICTED: uncharacterized protein LOC100306375 isoform X1 [Glycine 
max]
Length=191

 Score =   149 bits (375),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 89/174 (51%), Positives = 116/174 (67%), Gaps = 8/174 (5%)
 Frame = +1

Query  7    MQSILGSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEsst  186
            MQSIL +P+    + +  + F   +Y   ++RN    VRSM+E+    EQP+     +  
Sbjct  8    MQSILANPMIRISSGSRENHFGVPAY--HMRRNVGLRVRSMAEE----EQPSQ--PATPV  59

Query  187  tapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDL  366
            T P   P P P    + K ST   DV +FSGP PERINGRLAMIGF  AM +E+A G  +
Sbjct  60   TPPPAEPKPQPVSTPSPKVSTKFSDVLAFSGPAPERINGRLAMIGFVGAMAVEVAKGQGV  119

Query  367  FAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            F QISNGG+ WFLG++ +LTLAS+IPLFQG++ ESKSKG M++DAE+WNGRFAM
Sbjct  120  FEQISNGGIPWFLGTSVVLTLASLIPLFQGISVESKSKGFMSSDAELWNGRFAM  173



>gb|KCW84134.1| hypothetical protein EUGRSUZ_B01008 [Eucalyptus grandis]
Length=240

 Score =   150 bits (379),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 82/179 (46%), Positives = 110/179 (61%), Gaps = 23/179 (13%)
 Frame = +1

Query  1    VVMQSILGSPVTSFKNRNG---VSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPV  171
            ++M S+  SP T     +G   V    P+++ PRL       VR M+E+      P++ +
Sbjct  64   ILMHSVPVSPRTVVDISSGKSVVRGLFPANHSPRLAPRGGLHVRCMAEESKPDLNPSSKL  123

Query  172  TEssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELA  351
                +T                    +  DVF+FSGP PERINGRLAMIGF AA+ +EL+
Sbjct  124  KSKVST--------------------DFTDVFAFSGPAPERINGRLAMIGFVAAIAVELS  163

Query  352  NGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
             G DL AQIS GG+ WF+G++ LL++AS++PL QGVTAESKS GLMT+DAE+WNGRFAM
Sbjct  164  KGQDLSAQISGGGIPWFIGTSILLSVASLVPLLQGVTAESKSDGLMTSDAELWNGRFAM  222



>ref|XP_010034436.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
[Eucalyptus grandis]
Length=203

 Score =   149 bits (376),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 87/182 (48%), Positives = 116/182 (64%), Gaps = 7/182 (4%)
 Frame = +1

Query  1    VVMQSILGSPVTSFK---NRNGVSQFVPSSYLPRLQRNPSFLVRSMSED---DAGKEQPT  162
            V+++ I  SP  + +    R+ V    P+ Y+PR        VR M+E+   +   E P 
Sbjct  5    VLLRWIPASPSAAIEINFRRSVVRGHFPAYYVPRTAPRGGLRVRCMTEEIKPEGSTEIPA  64

Query  163  TPVTEssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMGM  342
            + V  +S T      P          S+ +  DVF+FSGP PERINGRLAMIGF AA+ +
Sbjct  65   SDVPSTSPTPTPTPTPIPTPKPKRKVST-SFTDVFAFSGPAPERINGRLAMIGFVAAIAV  123

Query  343  ELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRF  522
            EL+ G DLFAQIS+GG+ WFLG++ LL++AS++PLFQGVT ESKS GLMT+DAE+WNGR 
Sbjct  124  ELSKGQDLFAQISDGGIPWFLGTSVLLSVASLVPLFQGVTVESKSGGLMTSDAELWNGRL  183

Query  523  AM  528
            AM
Sbjct  184  AM  185



>ref|XP_010045776.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
[Eucalyptus grandis]
Length=166

 Score =   147 bits (372),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 82/180 (46%), Positives = 107/180 (59%), Gaps = 40/180 (22%)
 Frame = +1

Query  1    VVMQSILGSPVT----SFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTP  168
            ++M S+  SP T    SF+ ++ V  F P ++ PRL       V+ M++   G       
Sbjct  5    ILMHSVPASPRTVIDISFR-KSIVRGFFPVNHSPRLAPQVGLCVKCMTKVSTG-------  56

Query  169  VTEssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMGMEL  348
                                          DVF+FSGP PERINGRLAMIGF AA+ +EL
Sbjct  57   ----------------------------FTDVFAFSGPAPERINGRLAMIGFVAAIAVEL  88

Query  349  ANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            + G DLFAQIS GG+ WF+G++ LL++AS++PLFQGVTAESKS GLMT+DAE+WNGR AM
Sbjct  89   SKGQDLFAQISEGGIPWFIGTSVLLSVASLVPLFQGVTAESKSDGLMTSDAELWNGRLAM  148



>ref|NP_001237842.1| uncharacterized protein LOC100306375 [Glycine max]
 gb|ACU14515.1| unknown [Glycine max]
Length=182

 Score =   148 bits (374),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 89/174 (51%), Positives = 116/174 (67%), Gaps = 8/174 (5%)
 Frame = +1

Query  7    MQSILGSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEsst  186
            MQSIL +P+    + +  + F   +Y   ++RN    VRSM+E+    EQP+     +  
Sbjct  8    MQSILANPLIRISSGSRENHFGVPAY--HMRRNVGLRVRSMAEE----EQPSQ--PATPV  59

Query  187  tapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDL  366
            T P   P P P    + K ST   DV +FSGP PERINGRLAMIGF  AM +E+A G  +
Sbjct  60   TPPPAEPKPQPVSTPSPKVSTKFSDVLAFSGPAPERINGRLAMIGFVGAMAVEVAKGQGV  119

Query  367  FAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            F QISNGG+ WFLG++ +LTLAS+IPLFQG++ ESKSKG M++DAE+WNGRFAM
Sbjct  120  FEQISNGGIPWFLGTSVVLTLASLIPLFQGISVESKSKGFMSSDAELWNGRFAM  173



>ref|XP_003637637.1| Early light inducible protein [Medicago truncatula]
Length=160

 Score =   147 bits (372),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 83/149 (56%), Positives = 104/149 (70%), Gaps = 2/149 (1%)
 Frame = +1

Query  85   LPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEssttapkptpppspapkvaa-ksstNLWD  261
            +P  +RN S  VRSM+E+   KEQP  PV   + T+    PP        + K ST   D
Sbjct  1    MPSFRRNASLKVRSMAEEGQ-KEQPKVPVDPITPTSAPTPPPQPQPTYTRSPKMSTKFSD  59

Query  262  VFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNGGVTWFLGSTALLTLASVI  441
            + +F GP PERINGRLAMIGF AAMG+E+A G  LF QIS GG+ WFLG++ LL+LAS+I
Sbjct  60   LMAFGGPAPERINGRLAMIGFVAAMGVEIAKGQGLFDQISGGGIPWFLGTSVLLSLASLI  119

Query  442  PLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            P FQGV+ ESKSKG+M++DAE+WNGR AM
Sbjct  120  PFFQGVSVESKSKGVMSSDAELWNGRIAM  148



>gb|ABU98944.1| early light-induced protein 7 [Rhododendron catawbiense]
Length=194

 Score =   148 bits (374),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 89/176 (51%), Positives = 123/176 (70%), Gaps = 7/176 (4%)
 Frame = +1

Query  4    VMQSILGSPVTSFKNRNGVSQFVPS-SYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEs  180
            VMQSIL SPV       G ++  P+  ++P  +R+ S +VR  +E+  G+++   P    
Sbjct  6    VMQSILVSPVAGVAKGLGSNRLRPAYRHMPHQRRSSSVVVRCTAEN--GQKEQAVPAA--  61

Query  181  sttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGG  360
              T   P+P P P P   AK+ST+ +DVF+FSGP PERINGRLAMIGF AA+ +EL+ G 
Sbjct  62   --TPSTPSPLPIPPPPPKAKASTDFFDVFAFSGPAPERINGRLAMIGFVAAIAVELSKGE  119

Query  361  DLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            D+FAQI+NGG+ WF+ +T +L++AS+IPLF GVT ESKS+   ++DAE+WNGRFAM
Sbjct  120  DVFAQIANGGIPWFVLTTGVLSVASLIPLFSGVTVESKSRPFWSSDAEMWNGRFAM  175



>ref|XP_010279260.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
isoform X2 [Nelumbo nucifera]
Length=145

 Score =   146 bits (369),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 67/90 (74%), Positives = 81/90 (90%), Gaps = 0/90 (0%)
 Frame = +1

Query  259  DVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNGGVTWFLGSTALLTLASV  438
            DV +FSGP PERINGRLAMIGF AAM +ELA G D+ AQ++NGG+TWFLG+TA+L+LAS+
Sbjct  38   DVLAFSGPAPERINGRLAMIGFVAAMAVELAKGDDVAAQLANGGLTWFLGTTAVLSLASL  97

Query  439  IPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            IPLF+GV  +SKSKGLMT+DAE+WNGRFAM
Sbjct  98   IPLFKGVDVQSKSKGLMTSDAELWNGRFAM  127



>gb|KHN02753.1| Early light-induced protein, chloroplastic [Glycine soja]
Length=191

 Score =   148 bits (373),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 90/174 (52%), Positives = 115/174 (66%), Gaps = 8/174 (5%)
 Frame = +1

Query  7    MQSILGSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEsst  186
            MQSIL +P+    + +  + F   +Y  R  RN    VRSM+E+    EQP+     +  
Sbjct  8    MQSILANPMIRISSGSRENHFGVPAYHRR--RNVGLRVRSMAEE----EQPSQ--PATPV  59

Query  187  tapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDL  366
            T P   P P P    + K ST   DV +FSGP PERINGRLAMIGF  AM +E+A G  +
Sbjct  60   TPPPAEPKPQPVSTPSPKVSTKFSDVLAFSGPAPERINGRLAMIGFVGAMAVEVAKGQGV  119

Query  367  FAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            F QISNGG+ WFLG++ +LTLAS+IPLFQG++ ESKSKG M++DAE+WNGRFAM
Sbjct  120  FEQISNGGIPWFLGTSVVLTLASLIPLFQGISVESKSKGFMSSDAELWNGRFAM  173



>emb|CAB10248.1| light induced protein like [Arabidopsis thaliana]
 emb|CAB78511.1| light induced protein like [Arabidopsis thaliana]
Length=318

 Score =   151 bits (382),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 87/174 (50%), Positives = 115/174 (66%), Gaps = 6/174 (3%)
 Frame = +1

Query  7    MQSILGSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEsst  186
            MQS+  +P      RN     + ++     +R     VR M++ D  KE P+ P T +S 
Sbjct  8    MQSVFAAPSGVLTTRN-----IRNTNQLFFKRIAPVGVRCMAQGDPIKEDPSVPSTSTSA  62

Query  187  tapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDL  366
            T P+    P P       S+    D+ +FSGP PERINGRLAM+GF AA+ MEL+ G ++
Sbjct  63   TPPQMPQSPPPPVSKPKVST-KFGDLLAFSGPAPERINGRLAMVGFVAAIAMELSKGENV  121

Query  367  FAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            FAQIS+GGV WFLG+TALLTLAS++PLF+G+ AE+KSKG MT+DAE+WNGRFAM
Sbjct  122  FAQISDGGVGWFLGTTALLTLASMVPLFKGIRAEAKSKGFMTSDAELWNGRFAM  175



>ref|XP_010034506.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
[Eucalyptus grandis]
Length=181

 Score =   147 bits (372),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 81/179 (45%), Positives = 110/179 (61%), Gaps = 23/179 (13%)
 Frame = +1

Query  1    VVMQSILGSPVTSFKNRNG---VSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPV  171
            ++M S+  SP T     +G   V    P+++ PRL       VR M+E+      P++ +
Sbjct  5    ILMHSVPVSPRTVVDISSGKSVVRGLFPANHSPRLAPRGGLHVRCMAEESKPDLNPSSKL  64

Query  172  TEssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELA  351
                +T                    +  +VF+FSGP PERINGRLAMIGF AA+ +EL+
Sbjct  65   KSKVST--------------------DFTNVFAFSGPAPERINGRLAMIGFVAAIAVELS  104

Query  352  NGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
             G DL AQIS GG+ WF+G++ LL++AS++PL QGVTAESKS GLMT+DAE+WNGRFAM
Sbjct  105  KGQDLSAQISGGGIPWFIGTSILLSVASLVPLLQGVTAESKSDGLMTSDAELWNGRFAM  163



>gb|KFK39567.1| hypothetical protein AALP_AA3G261100 [Arabis alpina]
Length=195

 Score =   148 bits (373),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 89/175 (51%), Positives = 122/175 (70%), Gaps = 6/175 (3%)
 Frame = +1

Query  7    MQSILGSPVTSFK-NRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEss  183
            MQS+    +++ K N N   +   +   P L RN    VR M+E++  KE  +TP T ++
Sbjct  8    MQSVFAGGLSTRKINTN---KLFFARNFPNLVRNYPVGVRCMAEEEPIKED-STPSTSAA  63

Query  184  ttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGD  363
               PK   PP+P P     S+    D+ +FSGP PERINGRLAM+GF AA+ +EL+ G +
Sbjct  64   QPLPKSPSPPTPTPTKPKVST-KFRDLLAFSGPAPERINGRLAMVGFVAALAVELSKGEN  122

Query  364  LFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            +FAQIS+GGV+WFLG+TA+LTLAS++PLF+G+T ESKS G+MT+DAE+WNGRFAM
Sbjct  123  VFAQISDGGVSWFLGTTAILTLASLVPLFKGITVESKSDGIMTSDAELWNGRFAM  177



>ref|XP_010043035.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
isoform X1 [Eucalyptus grandis]
 gb|KCW85052.1| hypothetical protein EUGRSUZ_B01896 [Eucalyptus grandis]
Length=181

 Score =   147 bits (372),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 81/179 (45%), Positives = 111/179 (62%), Gaps = 23/179 (13%)
 Frame = +1

Query  1    VVMQSILGSP--VTSFKNRNGVSQ-FVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPV  171
            ++M S+  SP  V    +R  V +   P+++ PRL       VR M+E+      P++ +
Sbjct  5    ILMHSVPVSPRTVVDISSRKSVVRGLFPANHSPRLAPRGGLHVRCMAEESKPDLNPSSKL  64

Query  172  TEssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELA  351
                +T                    +  +VF+FSGP PERINGRLAMIGF AA+ +EL+
Sbjct  65   KSKVST--------------------DFTNVFAFSGPAPERINGRLAMIGFVAAIAVELS  104

Query  352  NGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
             G DL AQIS GG+ WF+G++ LL++AS++PL QGVTAESKS GLMT+DAE+WNGRFAM
Sbjct  105  KGQDLSAQISGGGIPWFVGTSILLSVASLVPLLQGVTAESKSDGLMTSDAELWNGRFAM  163



>ref|XP_010043036.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
isoform X2 [Eucalyptus grandis]
 gb|KCW85051.1| hypothetical protein EUGRSUZ_B01896 [Eucalyptus grandis]
Length=181

 Score =   147 bits (371),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 81/179 (45%), Positives = 110/179 (61%), Gaps = 23/179 (13%)
 Frame = +1

Query  1    VVMQSILGSP--VTSFKNRNGVSQ-FVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPV  171
            ++M S+  SP  V    +R  V +   P+++ PRL       VR M+E+      P++ +
Sbjct  5    ILMHSVPVSPRTVVDISSRKSVVRGLFPANHSPRLAPRGGLHVRCMAEESKPDLNPSSKL  64

Query  172  TEssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELA  351
                +T                    +  DVF+FSGP PERINGRLAMIGF AA+ +EL+
Sbjct  65   KSKVST--------------------DFTDVFAFSGPAPERINGRLAMIGFVAAIAVELS  104

Query  352  NGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
             G DL  QIS GG+ WF+G++ LL++AS++PL QGVTAESKS GLMT+DAE+WNGRFAM
Sbjct  105  KGQDLSDQISGGGIPWFVGTSILLSVASLVPLLQGVTAESKSDGLMTSDAELWNGRFAM  163



>gb|KFK23556.1| hypothetical protein AALP_AAs41881U000200 [Arabis alpina]
Length=194

 Score =   147 bits (372),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 79/145 (54%), Positives = 107/145 (74%), Gaps = 1/145 (1%)
 Frame = +1

Query  94   LQRNPSFLVRSMSEDDAGKEQPTTPVTEssttapkptpppspapkvaaksstNLWDVFSF  273
             +RN S +V+ M++DD  KE  ++P + ++      +P P P       S+    D+ +F
Sbjct  33   FKRNASMVVKCMAQDDLIKENSSSPSSSAAQPQIPSSPLPPPPVSKPKVST-KFGDLLAF  91

Query  274  SGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQ  453
            SGP PERINGRLAM+GF AA+ +EL+ G ++FAQIS+GGV WFLG+TALLTLAS++PLF+
Sbjct  92   SGPAPERINGRLAMVGFVAAIAVELSKGENVFAQISDGGVGWFLGTTALLTLASMVPLFK  151

Query  454  GVTAESKSKGLMTADAEIWNGRFAM  528
            G+ AESKSKG MT+DAE+WNGRFAM
Sbjct  152  GIRAESKSKGFMTSDAELWNGRFAM  176



>gb|ABU98943.1| early light-induced protein 6 [Rhododendron catawbiense]
Length=182

 Score =   147 bits (370),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 84/179 (47%), Positives = 114/179 (64%), Gaps = 25/179 (14%)
 Frame = +1

Query  4    VMQSILGSPVTSFKNR-NGVSQ-FVP--SSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPV  171
            VMQSI+ SP T    +  G+S+  +P  S YLPR  RN   LVR M++    +E  T+P 
Sbjct  6    VMQSIMVSPATGVATKGTGLSRSTIPRSSCYLPRQGRNSGALVRCMAKGGQKEEVGTSPK  65

Query  172  TEssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELA  351
             +  T                     + +++ +FSGPGPERINGRLAM+GF AA+ +EL+
Sbjct  66   AKVRT---------------------DFFNLLAFSGPGPERINGRLAMVGFVAAIAVELS  104

Query  352  NGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
             G D+FAQISNGG+ WFL +T +L++AS+IPL  GV+ ESKSK   ++DAE+WNGRFAM
Sbjct  105  KGEDVFAQISNGGIPWFLLTTGVLSVASLIPLSNGVSVESKSKPFWSSDAEMWNGRFAM  163



>ref|XP_009135830.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
[Brassica rapa]
Length=195

 Score =   147 bits (371),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 87/177 (49%), Positives = 120/177 (68%), Gaps = 10/177 (6%)
 Frame = +1

Query  7    MQSILGSPVTSFK-NRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQ--PTTPVTE  177
            MQS+    +T+ K N N   +   +     L+RN    VR M+E +  K++  P+T  ++
Sbjct  8    MQSVFAGGLTTCKINTN---KLCFAGNFHNLKRNYPVGVRCMAEGEPMKDESAPSTSASQ  64

Query  178  ssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANG  357
                +  P PPP   PKV+        D+ +FSGP PERINGRLAM+GF AA+ +EL+ G
Sbjct  65   PLPKSSSPPPPPPTKPKVST----KFSDLLAFSGPAPERINGRLAMVGFVAALAVELSKG  120

Query  358  GDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
             ++ AQIS+GGV+WFLG+ A+LTLAS++PLF+G+TAESKSKG MT+DAE+WNGRFAM
Sbjct  121  ENILAQISDGGVSWFLGTAAILTLASLVPLFKGITAESKSKGFMTSDAELWNGRFAM  177



>emb|CDX92959.1| BnaA03g36810D [Brassica napus]
Length=195

 Score =   147 bits (371),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 87/177 (49%), Positives = 120/177 (68%), Gaps = 10/177 (6%)
 Frame = +1

Query  7    MQSILGSPVTSFK-NRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQ--PTTPVTE  177
            MQS+    +T+ K N N   +   +     L+RN    VR M+E +  K++  P+T  ++
Sbjct  8    MQSVFAGGLTTCKINTN---KLCFAGNFHNLKRNYPVGVRCMAEGEPIKDESAPSTSASQ  64

Query  178  ssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANG  357
                +  P PPP   PKV+        D+ +FSGP PERINGRLAM+GF AA+ +EL+ G
Sbjct  65   PLPKSSSPPPPPPTKPKVST----KFSDLLAFSGPAPERINGRLAMVGFVAALAVELSKG  120

Query  358  GDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
             ++ AQIS+GGV+WFLG+ A+LTLAS++PLF+G+TAESKSKG MT+DAE+WNGRFAM
Sbjct  121  ENILAQISDGGVSWFLGTAAILTLASLVPLFKGITAESKSKGFMTSDAELWNGRFAM  177



>gb|KCW84135.1| hypothetical protein EUGRSUZ_B01008 [Eucalyptus grandis]
 gb|KCW84136.1| hypothetical protein EUGRSUZ_B01008 [Eucalyptus grandis]
Length=240

 Score =   148 bits (374),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 81/179 (45%), Positives = 110/179 (61%), Gaps = 23/179 (13%)
 Frame = +1

Query  1    VVMQSILGSPVTSFKNRNG---VSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPV  171
            ++M S+  SP T     +G   V    P+++ PRL       VR M+E+      P++ +
Sbjct  64   ILMHSVPVSPRTVVDISSGKSVVRGLFPANHSPRLAPRGGLHVRCMAEESKPDLNPSSKL  123

Query  172  TEssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELA  351
                +T                    +  +VF+FSGP PERINGRLAMIGF AA+ +EL+
Sbjct  124  KSKVST--------------------DFTNVFAFSGPAPERINGRLAMIGFVAAIAVELS  163

Query  352  NGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
             G DL AQIS GG+ WF+G++ LL++AS++PL QGVTAESKS GLMT+DAE+WNGRFAM
Sbjct  164  KGQDLSAQISGGGIPWFIGTSILLSVASLVPLLQGVTAESKSDGLMTSDAELWNGRFAM  222



>gb|KHG26201.1| Early light-induced, chloroplastic [Gossypium arboreum]
Length=193

 Score =   147 bits (370),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 82/175 (47%), Positives = 109/175 (62%), Gaps = 10/175 (6%)
 Frame = +1

Query  7    MQSIL-GSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEss  183
            MQS+L  SP+T   ++  + QF     +PR QR  +  VR ++E+   KE   T  T   
Sbjct  10   MQSLLLASPMTGLASKRQMVQFYNVKRMPRFQRKLNLQVRCLAEEGDQKEPMPTARTPEP  69

Query  184  ttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGD  363
              +P P  P                DVF+FSGP PERINGRLAM+GF AAM MEL+ G D
Sbjct  70   KPSPPPVSPKLST---------KFSDVFAFSGPAPERINGRLAMVGFVAAMAMELSKGQD  120

Query  364  LFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            +  QISNGG+  F+G++ +L+LAS+IPLF+G T ES+S   M++DAE+WNGRFAM
Sbjct  121  VLTQISNGGIPLFVGTSIVLSLASLIPLFRGETVESRSGQFMSSDAELWNGRFAM  175



>ref|XP_010034491.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
[Eucalyptus grandis]
 ref|XP_010034497.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
[Eucalyptus grandis]
 gb|KCW84140.1| hypothetical protein EUGRSUZ_B01008 [Eucalyptus grandis]
Length=178

 Score =   146 bits (368),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 84/179 (47%), Positives = 110/179 (61%), Gaps = 26/179 (15%)
 Frame = +1

Query  1    VVMQSILGSP--VTSFKNRNGVSQ-FVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPV  171
            ++M S+  SP  V    +R  V +   P+S  PRL       VR M+++      P+   
Sbjct  5    ILMHSVPVSPRTVVDISSRKSVVRGLFPASNSPRLSPRGGLHVRCMAKESKPDLNPSK--  62

Query  172  TEssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELA  351
                                 +K ST+  DVF+FSGP PERINGRLAMIGF AA+ +EL+
Sbjct  63   ---------------------SKVSTDFTDVFAFSGPAPERINGRLAMIGFVAAIAVELS  101

Query  352  NGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
             G DL AQIS GG+ WF+G++ LL++AS++PL QGVTAESKS GLMT+DAE+WNGRFAM
Sbjct  102  KGQDLSAQISGGGIPWFIGTSILLSVASLVPLLQGVTAESKSDGLMTSDAELWNGRFAM  160



>ref|XP_004289995.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
[Fragaria vesca subsp. vesca]
Length=192

 Score =   146 bits (369),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 93/182 (51%), Positives = 118/182 (65%), Gaps = 20/182 (11%)
 Frame = +1

Query  4    VMQSILGSPVT---SFKNRN--GVSQFVPSSYLPRLQRNPSFL-VRSMSEDDAGKEQPTT  165
            VMQSILGS V    + KNR+   +   VP+SY        S+L VRSM+ED   K+QPTT
Sbjct  6    VMQSILGSSVAYGAAGKNRSLMKLQGTVPASY-----PVSSYLRVRSMAEDGQ-KKQPTT  59

Query  166  PVTEssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMGME  345
              T           P           ST   DVF+FSGP PERINGRLAM+GF AA+ +E
Sbjct  60   VTT-------ASKNPQPAEAPSPPPPSTKFSDVFAFSGPAPERINGRLAMVGFVAALAVE  112

Query  346  LANGGDLFAQISNG-GVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRF  522
            L+ G D+FAQIS+G GV  F+G++ LL++AS++PL +GVT ESKS G+MT+DAE+WNGR 
Sbjct  113  LSKGQDVFAQISSGSGVPLFIGTSVLLSVASLVPLLKGVTVESKSNGIMTSDAELWNGRL  172

Query  523  AM  528
            AM
Sbjct  173  AM  174



>ref|XP_011028244.1| PREDICTED: early light-induced protein 1, chloroplastic-like, 
partial [Populus euphratica]
Length=132

 Score =   144 bits (363),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 64/90 (71%), Positives = 83/90 (92%), Gaps = 0/90 (0%)
 Frame = +1

Query  259  DVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNGGVTWFLGSTALLTLASV  438
            D+ +FSGP PERINGRLAMIGF AAM +EL+ G DLF+QISNGGV+WF+G++ LL++AS+
Sbjct  25   DLLAFSGPAPERINGRLAMIGFVAAMAVELSKGQDLFSQISNGGVSWFVGTSILLSVASL  84

Query  439  IPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            IPLF+G++AESKS+G+MT+DAE+WNGRFAM
Sbjct  85   IPLFKGISAESKSEGVMTSDAEMWNGRFAM  114



>gb|KEH43789.1| early light-induced-like protein [Medicago truncatula]
Length=186

 Score =   146 bits (368),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 83/163 (51%), Positives = 108/163 (66%), Gaps = 18/163 (11%)
 Frame = +1

Query  49   RNGVSQF--VPSSYLPRLQRNPSFLVRSMSEDDAGKEQP-TTPVTEssttapkptpppsp  219
            R  V+QF  +PS Y+P  +RN S  VRSM+E+   KEQP  TP                 
Sbjct  21   RPRVNQFNNIPSVYMPSFKRNASLKVRSMAEEGQ-KEQPKVTP--------------QPA  65

Query  220  apkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNGGVTW  399
            +   + K ST   D+ +F G  PERINGRLAMIGF +AMG+ELA G  LF QIS GG+ W
Sbjct  66   STTRSPKISTKFSDLMAFGGAAPERINGRLAMIGFVSAMGVELAKGQGLFDQISGGGIPW  125

Query  400  FLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            FL ++ LLT+AS++PLF+GV+ ESKSKG+M+++AE+WNGR AM
Sbjct  126  FLYTSVLLTVASLVPLFEGVSVESKSKGIMSSNAELWNGRIAM  168



>gb|KHN15724.1| Early light-induced protein, chloroplastic [Glycine soja]
Length=178

 Score =   145 bits (366),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 87/175 (50%), Positives = 113/175 (65%), Gaps = 23/175 (13%)
 Frame = +1

Query  7    MQSILGSPVTSFKNRNGVSQF-VPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEss  183
            MQSIL +P+    + + V+QF VP+ ++   +RN    VRSM+E++   E P TPVT  S
Sbjct  8    MQSILANPMIRISSGSRVNQFGVPALHM---RRNVGLRVRSMAEEEQPSE-PATPVTPPS  63

Query  184  ttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGD  363
            +   KP                    V + S   PERINGRLAMIGF AAM +E+A G  
Sbjct  64   SIEGKPQ------------------PVSTPSAKSPERINGRLAMIGFVAAMAVEVAKGQG  105

Query  364  LFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            +  QISNGG+ WFLG++ +LTLAS+IPLFQGV+ ESKSKG M++DAE+WNGRFAM
Sbjct  106  VLEQISNGGIPWFLGTSVVLTLASLIPLFQGVSVESKSKGFMSSDAELWNGRFAM  160



>ref|XP_010045777.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
[Eucalyptus grandis]
 gb|KCW84131.1| hypothetical protein EUGRSUZ_B01006 [Eucalyptus grandis]
Length=181

 Score =   145 bits (366),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 83/179 (46%), Positives = 112/179 (63%), Gaps = 23/179 (13%)
 Frame = +1

Query  1    VVMQSILGSP--VTSFKNRNGVSQ-FVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPV  171
            ++M S+  SP  V    +R  + + F P ++ PRL       V+ M+++      P+   
Sbjct  5    ILMHSVPASPRTVIDISSRKYIVRGFFPVNHSPRLAPQVGLCVKCMTKEGKPDLNPSQ--  62

Query  172  TEssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELA  351
                              K  +K ST   DVF+FSGP PERINGRLAMIG+ AA+ +EL+
Sbjct  63   ------------------KSKSKVSTGFTDVFAFSGPAPERINGRLAMIGYVAAIVVELS  104

Query  352  NGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            NG DLFAQIS GG+ WF+G++ LL++AS++PLFQGVTAESKS GLMT+DAE+ NGR AM
Sbjct  105  NGQDLFAQISEGGIPWFIGTSILLSVASLVPLFQGVTAESKSDGLMTSDAELRNGRLAM  163



>gb|KJB38210.1| hypothetical protein B456_006G242600 [Gossypium raimondii]
Length=193

 Score =   145 bits (367),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 82/178 (46%), Positives = 110/178 (62%), Gaps = 16/178 (9%)
 Frame = +1

Query  7    MQSIL-GSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKE---QPTTPVT  174
            MQS+L  SP+T   ++  + QF     +PR QR  +  VR ++E+   KE     TTP  
Sbjct  10   MQSLLLASPMTGLGSKRQMVQFYNVKPMPRFQRKLNLQVRCLAEEGDQKEPMPAATTPEP  69

Query  175  EssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELAN  354
            + S     P                   DVF+FSGP PERINGRLAM+GF AA+ MEL+N
Sbjct  70   KQSPPRISPKVST------------KFSDVFAFSGPAPERINGRLAMVGFVAALAMELSN  117

Query  355  GGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            G D+  QISNGG+  F+G++ +L+LAS+IPLF+G T ES+S   M++DAE+WNGRFAM
Sbjct  118  GQDVLTQISNGGIPLFVGTSIVLSLASLIPLFRGETVESRSGQFMSSDAELWNGRFAM  175



>gb|KCW84133.1| hypothetical protein EUGRSUZ_B010071, partial [Eucalyptus grandis]
Length=151

 Score =   144 bits (363),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 66/90 (73%), Positives = 80/90 (89%), Gaps = 0/90 (0%)
 Frame = +1

Query  259  DVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNGGVTWFLGSTALLTLASV  438
            DVF+FSGP PERINGRLAMIGF AA+ +EL+ G DLFAQIS+GG+ WFLG++ LL++AS+
Sbjct  44   DVFAFSGPAPERINGRLAMIGFVAAIAVELSKGQDLFAQISDGGIPWFLGTSVLLSVASL  103

Query  439  IPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            +PLFQGVT ESKS GLMT+DAE+WNGR AM
Sbjct  104  VPLFQGVTVESKSGGLMTSDAELWNGRLAM  133



>ref|XP_008341015.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
[Malus domestica]
Length=193

 Score =   145 bits (366),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 86/174 (49%), Positives = 120/174 (69%), Gaps = 5/174 (3%)
 Frame = +1

Query  7    MQSILGSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEsst  186
            MQS+L   V+S     G S+ V  S+L    +    +VRSM+E+   +EQP++ + E+S 
Sbjct  7    MQSLL---VSSVVYGAGKSRSVRVSHLVPANKYRHMVVRSMAENGQ-EEQPSSTIPEASK  62

Query  187  tapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDL  366
              P P  P    P+    S+     VF+FSGP PERINGRLAM+GF +A+ +EL+ G D+
Sbjct  63   IPPPPPTPXPFPPRPKKVST-KFSSVFAFSGPAPERINGRLAMVGFVSALAVELSKGQDV  121

Query  367  FAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            F+QIS+GGV+ FLG++ LL++ASVIPLF+GV+ ESKS G+MT+DAE+WNGR AM
Sbjct  122  FSQISDGGVSLFLGTSILLSVASVIPLFKGVSVESKSNGIMTSDAELWNGRLAM  175



>ref|XP_006406123.1| hypothetical protein EUTSA_v10021557mg [Eutrema salsugineum]
 gb|ESQ47576.1| hypothetical protein EUTSA_v10021557mg [Eutrema salsugineum]
Length=197

 Score =   145 bits (366),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 86/174 (49%), Positives = 116/174 (67%), Gaps = 2/174 (1%)
 Frame = +1

Query  7    MQSILGSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEsst  186
            MQS+    +T+   R   ++   +     L+RN    VR M+E D  K++ TTP T ++ 
Sbjct  8    MQSVFAGGLTT--RRINTNKLSFAGNFSNLKRNYPVGVRCMAEGDPMKDESTTPSTSAAQ  65

Query  187  tapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDL  366
              PK + PP P P    K ST L D+ +FSGP PERINGRLAM+GF AA+ +EL+ G ++
Sbjct  66   PMPKASSPPPPPPPTKPKVSTKLGDLLAFSGPAPERINGRLAMVGFVAALAVELSKGENV  125

Query  367  FAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
              QIS+GGV+WFL +TA+ T AS +PL +G+TAESKSKGL T+DAE+ NGRFAM
Sbjct  126  LTQISDGGVSWFLVTTAIFTFASFVPLLKGITAESKSKGLFTSDAELLNGRFAM  179



>ref|XP_010525221.1| PREDICTED: early light-induced protein 1, chloroplastic isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010525223.1| PREDICTED: early light-induced protein 1, chloroplastic isoform 
X2 [Tarenaya hassleriana]
Length=198

 Score =   145 bits (366),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 86/175 (49%), Positives = 118/175 (67%), Gaps = 3/175 (2%)
 Frame = +1

Query  7    MQSILGSPVT-SFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEss  183
            MQS+   P T S       ++F  +  +P  +RN S +VR M+E +  +E  + P + S 
Sbjct  8    MQSVFTGPATGSVTQGMKSNRFCLAGTVPGFKRNASMVVRCMAEGEPTRED-SAP-SSSP  65

Query  184  ttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGD  363
              A  P     P+P    K ST   DV +FSGP PERINGRLAM+GF AA+ +EL+ G +
Sbjct  66   AGATPPEIKSKPSPPPKPKVSTKFSDVLAFSGPAPERINGRLAMVGFVAALAVELSKGEN  125

Query  364  LFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            + AQ+S+GGV WF+G++ALLT+AS++PLF+GV+AESKS GLMT+DAE+WNGR AM
Sbjct  126  VLAQLSDGGVGWFVGTSALLTVASLVPLFKGVSAESKSGGLMTSDAELWNGRLAM  180



>gb|KCW85053.1| hypothetical protein EUGRSUZ_B01896 [Eucalyptus grandis]
Length=181

 Score =   144 bits (364),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 83/179 (46%), Positives = 109/179 (61%), Gaps = 23/179 (13%)
 Frame = +1

Query  1    VVMQSILGSPVTSFKNRNGVSQ---FVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPV  171
            ++M SI  SP T+    + +S      P++  PRL       VR M+E+      P+  +
Sbjct  5    ILMHSITASPRTAINISSRISVVRGLFPANRSPRLAPRGGLRVRCMAEESKPDLNPSPKL  64

Query  172  TEssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELA  351
                                  K ST+  DVF+FSGP PERINGRLAMIGF AA+ +EL+
Sbjct  65   K--------------------WKVSTDFTDVFAFSGPAPERINGRLAMIGFVAAIAVELS  104

Query  352  NGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
             G DL  QIS GG+ WF+G++ LL++AS++PL QGVTAESKS GLMT+DAE+WNGRFAM
Sbjct  105  KGQDLSDQISGGGIPWFVGTSILLSVASLVPLLQGVTAESKSDGLMTSDAELWNGRFAM  163



>gb|ABU98941.1| early light-induced protein 4 [Rhododendron catawbiense]
Length=164

 Score =   144 bits (363),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 80/176 (45%), Positives = 107/176 (61%), Gaps = 36/176 (20%)
 Frame = +1

Query  4    VMQSILGSPVTSFKNRNGVSQFVP-SSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEs  180
            VMQSIL SPVT      G+S+ +P + YLPR  RN   LVR M++               
Sbjct  6    VMQSILVSPVTGVAKGAGLSRTIPRTCYLPRQGRNSGMLVRCMAK---------------  50

Query  181  sttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGG  360
                                +  + +D+ +FSGPGPERINGRLAM+GF AA+ +EL+ G 
Sbjct  51   --------------------ARIDFFDLLAFSGPGPERINGRLAMVGFVAAIAVELSKGE  90

Query  361  DLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            D+FAQISNGG+ WFL +T +L++AS+IPL  GV+ ES+SK   ++DAE+ NGRFAM
Sbjct  91   DVFAQISNGGIPWFLLTTGVLSVASLIPLSSGVSVESRSKPFWSSDAEMLNGRFAM  146



>gb|AAL32038.1|AF439279_1 early light-induced protein-like protein [Retama raetam]
Length=141

 Score =   143 bits (361),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 87/127 (69%), Gaps = 5/127 (4%)
 Frame = +1

Query  148  KEQPTTPVTEssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFA  327
            KEQP TPV         P                   DV +FSGP PERINGRLAMIGF 
Sbjct  2    KEQPATPVAPPPLPQSPPPASTRSPKIST-----KFTDVLAFSGPAPERINGRLAMIGFV  56

Query  328  AAMGMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEI  507
            AA+ +ELA G D+FAQISNGG+ WFLG++ +L+LAS+IPLF+GV+ ESKS G M++DAEI
Sbjct  57   AAIAVELAKGQDVFAQISNGGILWFLGTSVVLSLASLIPLFRGVSVESKSGGFMSSDAEI  116

Query  508  WNGRFAM  528
            WNGRFAM
Sbjct  117  WNGRFAM  123



>ref|NP_188923.1| chlorophyll A-B binding, early light-inducible protein [Arabidopsis 
thaliana]
 sp|P93735.1|ELIP1_ARATH RecName: Full=Early light-induced protein 1, chloroplastic; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAB88391.1| early light-induced protein [Arabidopsis thaliana]
 dbj|BAB01259.1| early light-inducable protein-like [Arabidopsis thaliana]
 gb|AAL09799.1| AT3g22840/MWI23_21 [Arabidopsis thaliana]
 gb|AAL77679.1| AT3g22840/MWI23_21 [Arabidopsis thaliana]
 gb|AAM19939.1| AT3g22840/MWI23_21 [Arabidopsis thaliana]
 gb|AAM62548.1| early light-induced protein [Arabidopsis thaliana]
 gb|AEE76682.1| chlorophyll A-B binding, early light-inducible protein [Arabidopsis 
thaliana]
Length=195

 Score =   144 bits (364),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 85/176 (48%), Positives = 116/176 (66%), Gaps = 8/176 (5%)
 Frame = +1

Query  7    MQSILGSPVTSFK-NRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPT-TPVTEs  180
            MQS+    +T+ K N N   +   +   P L+RN    VR M+E     E  +  P T +
Sbjct  8    MQSVFAGGLTTRKINTN---KLFSAGSFPNLKRNYPVGVRCMAEGGPTNEDSSPAPSTSA  64

Query  181  sttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGG  360
            +   PK   PP P     +       D+ +FSGP PERINGRLAM+GF AA+ +EL+ G 
Sbjct  65   AQPLPKSPSPPPPMKPKVST---KFSDLLAFSGPAPERINGRLAMVGFVAALAVELSKGE  121

Query  361  DLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            ++ AQIS+GGV+WFLG+TA+LTLAS++PLF+G++ ESKSKG+MT+DAE+WNGRFAM
Sbjct  122  NVLAQISDGGVSWFLGTTAILTLASLVPLFKGISVESKSKGIMTSDAELWNGRFAM  177



>ref|XP_009371939.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
[Pyrus x bretschneideri]
Length=193

 Score =   144 bits (363),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 87/177 (49%), Positives = 123/177 (69%), Gaps = 11/177 (6%)
 Frame = +1

Query  7    MQSILGSPVT--SFKNRN-GVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTE  177
            MQS+L S V   + K+R+  VS  VP++   R+      +VRS +E+   +E+P++ + E
Sbjct  7    MQSLLASSVVYGAGKSRSVRVSHLVPANRFRRM------VVRSTAENGQ-EERPSSSIPE  59

Query  178  ssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANG  357
            +S   P P  P    P+    S+    DVF+FSGP PERINGRLAM+GF +A+ +EL+ G
Sbjct  60   ASKIPPPPPTPTPFPPRPKKAST-KFSDVFAFSGPAPERINGRLAMVGFVSALAVELSKG  118

Query  358  GDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
             D+F+QIS+GGV+ FLG++ LL++AS IPLF+GV+ ESKS GLMT+DAE+WNGR AM
Sbjct  119  QDVFSQISDGGVSLFLGTSILLSVASAIPLFKGVSVESKSNGLMTSDAELWNGRLAM  175



>emb|CDY42783.1| BnaC01g22830D [Brassica napus]
Length=189

 Score =   144 bits (362),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 66/90 (73%), Positives = 81/90 (90%), Gaps = 0/90 (0%)
 Frame = +1

Query  259  DVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNGGVTWFLGSTALLTLASV  438
            D+ +FSGP PERINGRLAM+GF AA+ +EL+ G ++FAQIS+GGV WFLG+TALLTLAS+
Sbjct  82   DLLAFSGPAPERINGRLAMVGFVAAIAVELSKGENVFAQISDGGVGWFLGTTALLTLASM  141

Query  439  IPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            IPLF+G+ AESKSKG MT+DAE+WNGRFAM
Sbjct  142  IPLFKGIRAESKSKGFMTSDAELWNGRFAM  171



>gb|KEH43787.1| early light-induced-like protein [Medicago truncatula]
Length=182

 Score =   143 bits (361),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 74/153 (48%), Positives = 101/153 (66%), Gaps = 14/153 (9%)
 Frame = +1

Query  70   VPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEssttapkptpppspapkvaaksst  249
            +PS Y+P  +RN +  VRSM+E+   ++   TP                 +   + K ST
Sbjct  26   IPSVYMPSFRRNANLKVRSMAEEAQKEQSKVTP--------------QPASTTRSPKIST  71

Query  250  NLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNGGVTWFLGSTALLTL  429
               D+ +F G  PERINGRLAMIGF +AMG+ELA G  LF QIS GG+ WFL ++ LLT+
Sbjct  72   KFSDLMAFGGAAPERINGRLAMIGFVSAMGVELAKGQGLFDQISGGGIPWFLYTSVLLTV  131

Query  430  ASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            AS++PLF+GV+ ESKSKG+M+++AE+WNGR AM
Sbjct  132  ASLVPLFEGVSVESKSKGIMSSNAELWNGRIAM  164



>ref|XP_008438620.1| PREDICTED: early light-induced protein 1, chloroplastic [Cucumis 
melo]
Length=192

 Score =   142 bits (359),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 80/175 (46%), Positives = 114/175 (65%), Gaps = 6/175 (3%)
 Frame = +1

Query  4    VMQSILGSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEss  183
            VMQSI  S  +    R   ++ +P++     +   +F VR   E+D  +EQ        S
Sbjct  6    VMQSIPSSTASRGVYRTTTNRLLPAAVRLCSRNTGAFRVRCTGEEDQ-REQAIP-----S  59

Query  184  ttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGD  363
            +  P P          +  +ST   D+ +FSGPGPERINGRLAMIGF AA+ +E++ G D
Sbjct  60   SIPPSPPKLEPAPSSTSKVTSTKFTDILAFSGPGPERINGRLAMIGFVAALAVEVSKGQD  119

Query  364  LFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            +F QI+NGG+ WF+G++ +LTLAS+IPLF+GV+AES SKG+M+++AE+WNGRFAM
Sbjct  120  VFEQIANGGIPWFVGTSVVLTLASLIPLFKGVSAESNSKGIMSSNAELWNGRFAM  174



>gb|KCW84141.1| hypothetical protein EUGRSUZ_B01008 [Eucalyptus grandis]
Length=129

 Score =   140 bits (353),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 65/90 (72%), Positives = 79/90 (88%), Gaps = 0/90 (0%)
 Frame = +1

Query  259  DVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNGGVTWFLGSTALLTLASV  438
            DVF+FSGP PERINGRLAMIGF AA+ +EL+ G DL AQIS GG+ WF+G++ LL++AS+
Sbjct  22   DVFAFSGPAPERINGRLAMIGFVAAIAVELSKGQDLSAQISGGGIPWFIGTSILLSVASL  81

Query  439  IPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            +PL QGVTAESKS GLMT+DAE+WNGRFAM
Sbjct  82   VPLLQGVTAESKSDGLMTSDAELWNGRFAM  111



>ref|XP_006286322.1| hypothetical protein CARUB_v100071911mg, partial [Capsella rubella]
 gb|EOA19220.1| hypothetical protein CARUB_v100071911mg, partial [Capsella rubella]
Length=114

 Score =   140 bits (352),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 63/90 (70%), Positives = 80/90 (89%), Gaps = 0/90 (0%)
 Frame = +1

Query  259  DVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNGGVTWFLGSTALLTLASV  438
            D+ +FSGP PERINGRLAM+GF AA+ +EL+ G ++ AQIS+GGV WF+G+TALLTLAS+
Sbjct  7    DLLAFSGPAPERINGRLAMVGFVAAIAVELSKGENVLAQISDGGVGWFIGTTALLTLASM  66

Query  439  IPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            +PLFQG+ AE+KSKG MT+DAE+WNGRFAM
Sbjct  67   VPLFQGIRAEAKSKGFMTSDAELWNGRFAM  96



>ref|XP_009341096.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
[Pyrus x bretschneideri]
 ref|XP_009341098.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
[Pyrus x bretschneideri]
 ref|XP_009343967.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
[Pyrus x bretschneideri]
Length=193

 Score =   142 bits (358),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 86/177 (49%), Positives = 121/177 (68%), Gaps = 11/177 (6%)
 Frame = +1

Query  7    MQSILGSPVT--SFKNRNG-VSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTE  177
            MQS+L + V   + K+R+  V   VP+       R    +VRSM+E+  G+E+ ++    
Sbjct  7    MQSLLANSVVYGAGKSRSARVIHLVPA------NRYRHMVVRSMAEN--GQEEQSSSTIP  58

Query  178  ssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANG  357
             ++  P P P  +P+P    K ST   DVF+FSGP PERINGRLAM+GF +A+ +EL+ G
Sbjct  59   EASKTPLPPPTATPSPPPPKKVSTKFSDVFAFSGPAPERINGRLAMVGFVSALAVELSKG  118

Query  358  GDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
             D+F QIS+GGV+ FL ++ LL++ASVIPLF+GV+ ESKS G+MT+DAE+WNGR AM
Sbjct  119  QDVFTQISDGGVSLFLATSILLSVASVIPLFKGVSVESKSNGIMTSDAELWNGRLAM  175



>gb|KCW84137.1| hypothetical protein EUGRSUZ_B01008 [Eucalyptus grandis]
Length=239

 Score =   143 bits (361),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 81/179 (45%), Positives = 109/179 (61%), Gaps = 24/179 (13%)
 Frame = +1

Query  1    VVMQSILGSPVTSFKNRNG---VSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPV  171
            ++M S+  SP T     +G   V    P+++ PRL       VR M+E       P++ +
Sbjct  64   ILMHSVPVSPRTVVDISSGKSVVRGLFPANHSPRLAPRGGLHVRCMAESKP-DLNPSSKL  122

Query  172  TEssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELA  351
                +T                    +  +VF+FSGP PERINGRLAMIGF AA+ +EL+
Sbjct  123  KSKVST--------------------DFTNVFAFSGPAPERINGRLAMIGFVAAIAVELS  162

Query  352  NGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
             G DL AQIS GG+ WF+G++ LL++AS++PL QGVTAESKS GLMT+DAE+WNGRFAM
Sbjct  163  KGQDLSAQISGGGIPWFIGTSILLSVASLVPLLQGVTAESKSDGLMTSDAELWNGRFAM  221



>ref|XP_009375990.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
[Pyrus x bretschneideri]
 ref|XP_009375991.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
[Pyrus x bretschneideri]
Length=193

 Score =   142 bits (357),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 85/174 (49%), Positives = 117/174 (67%), Gaps = 5/174 (3%)
 Frame = +1

Query  7    MQSILGSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEsst  186
            MQS+L S V       G S+ V  S+L    R    +VRS +E+   +E+P++ + E+S 
Sbjct  7    MQSLLASSVV---YGAGKSRSVRVSHLVPANRFRHMVVRSTAENGQ-EERPSSTIPEASK  62

Query  187  tapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDL  366
              P P  P    P+    S+    DVF+FSGP PERINGRLAM+GF +A+ +EL+ G D+
Sbjct  63   IPPPPPTPTPFPPRPKKAST-KFSDVFAFSGPAPERINGRLAMVGFVSALAVELSKGQDV  121

Query  367  FAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            F+QIS+GGV+ FLG++ LL++AS IPLF+GV+ ESKS G MT+DAE+WNGR AM
Sbjct  122  FSQISDGGVSLFLGTSILLSVASAIPLFKGVSVESKSNGFMTSDAELWNGRLAM  175



>ref|XP_010034484.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
[Eucalyptus grandis]
 gb|KCW84139.1| hypothetical protein EUGRSUZ_B01008 [Eucalyptus grandis]
 gb|KCW84142.1| hypothetical protein EUGRSUZ_B01008 [Eucalyptus grandis]
Length=181

 Score =   141 bits (356),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 79/179 (44%), Positives = 107/179 (60%), Gaps = 23/179 (13%)
 Frame = +1

Query  1    VVMQSILGSP--VTSFKNRNGVSQ-FVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPV  171
            ++M S+  SP  V    +R  V +   P+S  PRL       VR M+++      P+  +
Sbjct  5    ILMHSVPVSPRTVVDISSRKSVVRGLFPASNSPRLSPRGGLHVRCMAKESKPDLNPSPNL  64

Query  172  TEssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELA  351
                +T                       DVF+FSGP PERINGRLAMIGF AA+ +EL+
Sbjct  65   KSKVST--------------------GFTDVFAFSGPAPERINGRLAMIGFVAAIAVELS  104

Query  352  NGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
             G DLFAQIS GG+ WF+G++ LL++AS++PL QGVT ESKS G+MT++AE+WNGR AM
Sbjct  105  KGQDLFAQISEGGIPWFIGTSILLSVASLVPLLQGVTVESKSDGVMTSNAELWNGRLAM  163



>ref|XP_004292245.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
[Fragaria vesca subsp. vesca]
Length=196

 Score =   142 bits (357),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 93/181 (51%), Positives = 120/181 (66%), Gaps = 16/181 (9%)
 Frame = +1

Query  7    MQSILGSPVT----SFKNRNGVSQF-VPSSYLPRLQRNPSFL-VRSMSEDDAGKEQPTTP  168
            MQSILGS +       KNR+   QF VP+S   +     S+L VRSM+ED   K+QPTT 
Sbjct  7    MQSILGSSIAYGAAGNKNRSVNLQFTVPASSAVQ-----SYLRVRSMTEDGQ-KKQPTT-  59

Query  169  VTEssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMGMEL  348
            VT++S   P    P              L DV +FSGP PERINGRLAM+GF AA+ +EL
Sbjct  60   VTKASKNPPPAAAPSPSPSPPPPSP--KLSDVLAFSGPAPERINGRLAMVGFVAALVVEL  117

Query  349  ANGGDLFAQISNG-GVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFA  525
            + G D+FAQISNG GV  F+G++ LL++AS++PL +GV+ ESKS G+MT+DAE+WNGR A
Sbjct  118  SKGQDVFAQISNGPGVPLFIGTSVLLSVASLVPLLKGVSVESKSDGIMTSDAELWNGRLA  177

Query  526  M  528
            M
Sbjct  178  M  178



>ref|XP_010676775.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
[Beta vulgaris subsp. vulgaris]
Length=197

 Score =   141 bits (356),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 86/183 (47%), Positives = 121/183 (66%), Gaps = 17/183 (9%)
 Frame = +1

Query  7    MQSILGSPVTSFKNRNGVSQFV-PSSYLPRLQRNPSFLVRSMSED--------DAGKEQP  159
            MQS+L +PV SF N + ++  V P  + PR+    +F V+ M+E+        D+G  + 
Sbjct  5    MQSLLANPVGSFANGSRMTSMVSPLGFYPRMSNRVNFAVKCMAEEGGQGEPKLDSGLPKT  64

Query  160  TTPVTEssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMG  339
            T P+          +P P+P PK   K ST+  D+F+FSGP PERINGRLAMIGF AA+ 
Sbjct  65   TPPMA--------ASPTPTPTPKPQPKVSTSFADLFAFSGPAPERINGRLAMIGFVAAIA  116

Query  340  MELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGR  519
            +EL+ G DLF+QIS+GG   FL ++ LL++AS++PLF+G  AE+K+ GLM A+AE+WNGR
Sbjct  117  VELSKGTDLFSQISDGGAQSFLATSILLSVASLVPLFKGKRAEAKTDGLMNANAELWNGR  176

Query  520  FAM  528
             AM
Sbjct  177  VAM  179



>ref|XP_008224237.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
isoform X1 [Prunus mume]
Length=189

 Score =   140 bits (352),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 85/175 (49%), Positives = 115/175 (66%), Gaps = 11/175 (6%)
 Frame = +1

Query  7    MQSI-LGSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEss  183
            MQSI L + + ++  RN  S  V    +P L R P+  VRSM++D   KEQP+T VT +S
Sbjct  7    MQSIFLANNLVAYGARNNKS--VGPFSVPALHRYPNMKVRSMAKD-GKKEQPST-VTNAS  62

Query  184  ttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGD  363
               P    P                D+ +FSGP PERINGRLAM+GF +A+ +EL  G D
Sbjct  63   KNPPPSNTPVPSKVST------KFSDLLAFSGPAPERINGRLAMVGFVSALAVELFKGQD  116

Query  364  LFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            +FAQIS+GGV+ F+G++ LL++AS+IPLF+GV+ ESKS G+MT+DAE+ NGR AM
Sbjct  117  VFAQISDGGVSLFVGTSILLSVASLIPLFKGVSVESKSDGIMTSDAELLNGRLAM  171



>gb|ADV19257.1| putative cold-inducible protein-like protein [Helleborus orientalis]
Length=148

 Score =   139 bits (349),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 77/148 (52%), Positives = 94/148 (64%), Gaps = 18/148 (12%)
 Frame = +1

Query  85   LPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEssttapkptpppspapkvaaksstNLWDV  264
            +PR QR+    VR M+E+    EQ T P                       K  T   DV
Sbjct  1    MPRQQRSGCMQVRCMAEEKL-PEQSTPP-----------------PAPKVNKVITRFSDV  42

Query  265  FSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNGGVTWFLGSTALLTLASVIP  444
             +FSGP PERINGRLAMIGF AA+  ELA G D+ AQI+NGG+ WF+G++ +LT AS+IP
Sbjct  43   LAFSGPAPERINGRLAMIGFVAAIAAELAKGDDVVAQIANGGLPWFVGTSVVLTFASLIP  102

Query  445  LFQGVTAESKSKGLMTADAEIWNGRFAM  528
            LF+GV+ ESKSKG MTADAE+ NGRFAM
Sbjct  103  LFKGVSVESKSKGPMTADAEMLNGRFAM  130



>ref|XP_007224626.1| hypothetical protein PRUPE_ppa026587mg [Prunus persica]
 gb|EMJ25825.1| hypothetical protein PRUPE_ppa026587mg [Prunus persica]
Length=189

 Score =   139 bits (351),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 78/149 (52%), Positives = 107/149 (72%), Gaps = 9/149 (6%)
 Frame = +1

Query  85   LPRLQR-NPSFLVRSMSEDDAGKEQPTTPVTEssttapkptpppspapkvaaksstNLWD  261
            +P L R +P   VRSM++D   KEQP+T VT +S + P P  P      +         D
Sbjct  31   VPALHRYSPPMRVRSMAKDGQ-KEQPST-VTNASKSPPPPLTPLPSKASI------KFSD  82

Query  262  VFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNGGVTWFLGSTALLTLASVI  441
            +F+FSGP PERINGRLAM+GF +A+ +EL NG D+FAQISNGGV+ F+ ++ LL++AS++
Sbjct  83   LFAFSGPAPERINGRLAMVGFVSALAVELYNGQDVFAQISNGGVSLFVATSILLSVASLV  142

Query  442  PLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            PLF+GV+ ESKS+G+MT+DAE+ NGR AM
Sbjct  143  PLFKGVSVESKSEGIMTSDAELLNGRLAM  171



>ref|XP_007225903.1| hypothetical protein PRUPE_ppa011907mg [Prunus persica]
 gb|EMJ27102.1| hypothetical protein PRUPE_ppa011907mg [Prunus persica]
Length=191

 Score =   139 bits (351),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 80/174 (46%), Positives = 109/174 (63%), Gaps = 7/174 (4%)
 Frame = +1

Query  7    MQSILGSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEsst  186
            MQSI  +   ++  R   S  V     P L+  P  +  S    D  K+QP+T VT +S 
Sbjct  7    MQSIFLASSVAYGARKNKSVGVSHLVAPTLRSYPHMMRVSSMAKDGQKKQPST-VTNASK  65

Query  187  tapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDL  366
              P     P P             D+F+FSGP PERINGRLAM+GF +A+ +EL+NG D+
Sbjct  66   VPPPSPSSPPPKVST------KFSDLFAFSGPAPERINGRLAMVGFVSALAVELSNGQDV  119

Query  367  FAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            FAQISNGGV+ F+ ++ LL++AS++PLF+GV+ ESKS G+MT+DAE+ NGR AM
Sbjct  120  FAQISNGGVSLFVATSILLSVASLVPLFKGVSVESKSDGIMTSDAELLNGRLAM  173



>gb|KCW84143.1| hypothetical protein EUGRSUZ_B01008 [Eucalyptus grandis]
Length=132

 Score =   137 bits (345),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 62/90 (69%), Positives = 78/90 (87%), Gaps = 0/90 (0%)
 Frame = +1

Query  259  DVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNGGVTWFLGSTALLTLASV  438
            DVF+FSGP PERINGRLAMIGF AA+ +EL+ G DLFAQIS GG+ WF+G++ LL++AS+
Sbjct  25   DVFAFSGPAPERINGRLAMIGFVAAIAVELSKGQDLFAQISEGGIPWFIGTSILLSVASL  84

Query  439  IPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            +PL QGVT ESKS G+MT++AE+WNGR AM
Sbjct  85   VPLLQGVTVESKSDGVMTSNAELWNGRLAM  114



>ref|XP_008224234.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
[Prunus mume]
Length=149

 Score =   137 bits (346),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 62/90 (69%), Positives = 79/90 (88%), Gaps = 0/90 (0%)
 Frame = +1

Query  259  DVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNGGVTWFLGSTALLTLASV  438
            DVF+FSGP PERINGRLAM+GF +AM +EL+ G D+FAQIS+GGV+ FL ++ LL++ASV
Sbjct  42   DVFAFSGPAPERINGRLAMVGFVSAMAVELSKGQDVFAQISDGGVSVFLATSILLSVASV  101

Query  439  IPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            IPLF+GV+ ESKS G+MT+DAE+WNGR AM
Sbjct  102  IPLFKGVSVESKSDGIMTSDAELWNGRLAM  131



>ref|XP_010676773.1| PREDICTED: early light-induced protein 2, chloroplastic-like 
[Beta vulgaris subsp. vulgaris]
Length=175

 Score =   137 bits (346),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 78/176 (44%), Positives = 112/176 (64%), Gaps = 27/176 (15%)
 Frame = +1

Query  7    MQS-ILGSPVTSFKNRNGVSQFV-PSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEs  180
            MQS +L +PV +  N + ++  V P  + PR+ +  +F V+ M+ D+  K +P   V+  
Sbjct  7    MQSGLLVNPVGALSNGSRMTYMVSPLGFNPRMTKRVNFEVKCMAGDEP-KPKPQPKVS--  63

Query  181  sttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGG  360
                                  T+  D+F+FSGP PERINGRLAMIGF AA+ +EL+ G 
Sbjct  64   ----------------------TSFGDLFAFSGPAPERINGRLAMIGFVAAVAVELSKGT  101

Query  361  DLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            DLF+QISNGG  +F+G++ LL++AS++PLFQG  AE+K+ GLM A+AE+WNGR AM
Sbjct  102  DLFSQISNGGAEYFIGTSILLSVASLVPLFQGQRAEAKTDGLMNANAELWNGRIAM  157



>gb|EPS65382.1| early light inducible protein [Genlisea aurea]
Length=166

 Score =   137 bits (344),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 64/93 (69%), Positives = 78/93 (84%), Gaps = 0/93 (0%)
 Frame = +1

Query  250  NLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNGGVTWFLGSTALLTL  429
             L  +F+F GPGPERINGRLAMIGF AA+G E A+G DL  Q+ NGGV+WFL ++A+LTL
Sbjct  56   TLSRIFAFGGPGPERINGRLAMIGFVAAIGAEFASGQDLSEQLQNGGVSWFLATSAVLTL  115

Query  430  ASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            AS++PLFQGVTAES S  LM++DAE+WNGRFAM
Sbjct  116  ASLVPLFQGVTAESTSGALMSSDAELWNGRFAM  148



>ref|XP_008224236.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
[Prunus mume]
Length=192

 Score =   137 bits (345),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 80/163 (49%), Positives = 106/163 (65%), Gaps = 12/163 (7%)
 Frame = +1

Query  43   KNRN-GVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEssttapkptpppsp  219
            KN++ GVS  V     P L   P  +  S    D  K+QP+T VT +S   P     P P
Sbjct  23   KNKSVGVSHLVA----PTLHSYPHMMRVSSMARDGQKKQPST-VTNASKVPPPSPSSPPP  77

Query  220  apkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNGGVTW  399
                       L D+F+FSGP PERINGRLAM+GF +A+ +EL NG D+FAQISNGGV+ 
Sbjct  78   KVSA------KLSDLFAFSGPAPERINGRLAMVGFVSALAVELYNGQDVFAQISNGGVSL  131

Query  400  FLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            F+ ++ LL++AS+IPLF+GV+ ES+S G+MT+DAE+ NGR AM
Sbjct  132  FVATSILLSVASLIPLFKGVSVESRSDGIMTSDAELLNGRLAM  174



>gb|ACJ09655.1| putative cold-inducible protein [Cupressus sempervirens]
Length=165

 Score =   136 bits (343),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 83/178 (47%), Positives = 104/178 (58%), Gaps = 34/178 (19%)
 Frame = +1

Query  25   SPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGK----------EQPTTPVT  174
            SPV+    R   SQ  P SY+PRLQRN    VR M+EDD              QP +P  
Sbjct  2    SPVSGVTARARFSQ-TPCSYVPRLQRNAGMQVRCMAEDDHKDVTPITTPPPTSQPISPPP  60

Query  175  EssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELAN  354
            +   +                       DV +FSG  PERINGRLAMIGF AAM +EL+N
Sbjct  61   KPKVSTKS--------------------DVLAFSGCAPERINGRLAMIGFVAAMAVELSN  100

Query  355  GGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
              D+ AQISNGGV W+  S  +LTLAS+IPLF+G + ES+S+ +M++DAE+WNGRFAM
Sbjct  101  -EDVLAQISNGGVPWYRTSI-VLTLASLIPLFKGGSVESRSE-IMSSDAELWNGRFAM  155



>gb|KDP40234.1| hypothetical protein JCGZ_02232 [Jatropha curcas]
Length=194

 Score =   137 bits (344),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 81/178 (46%), Positives = 110/178 (62%), Gaps = 17/178 (10%)
 Frame = +1

Query  13   SILGSPVTSFKNRNGVS-QFVPSSYLPRLQRNPSFLVRSMSE-----DDAGKEQPTTPVT  174
            ++   P      R  VS +F+ + Y+PR  R     V+ M+E      +  K QPT PV 
Sbjct  10   AVFAGPALRVSTRARVSGRFLATPYVPRPGRVAYTPVKCMAEGYQKEQEVEKIQPTEPV-  68

Query  175  EssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELAN  354
                        P P P    K ST   DV +F+GP PERINGRLAM+GF AA+ +E+A 
Sbjct  69   ----------GAPKPKPTPPPKFSTKFSDVLAFAGPAPERINGRLAMVGFVAAIAVEVAK  118

Query  355  GGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            G D FAQ+S+GG+  F+G++ +L+LAS+IPLF+GV+ ESKS G MT++AE+WNGRFAM
Sbjct  119  GQDFFAQLSDGGIPLFVGTSIVLSLASLIPLFKGVSVESKSDGFMTSNAELWNGRFAM  176



>ref|XP_007226151.1| hypothetical protein PRUPE_ppa014920mg [Prunus persica]
 gb|EMJ27350.1| hypothetical protein PRUPE_ppa014920mg [Prunus persica]
Length=189

 Score =   135 bits (339),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 75/148 (51%), Positives = 101/148 (68%), Gaps = 8/148 (5%)
 Frame = +1

Query  85   LPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEssttapkptpppspapkvaaksstNLWDV  264
            +P L R P+  VRSM +D   KEQP+T VT +S   P    P              + D+
Sbjct  32   VPALHRYPNMRVRSMVKD-GKKEQPST-VTNASKNPPPSNTPFPSKVST------KISDL  83

Query  265  FSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNGGVTWFLGSTALLTLASVIP  444
             +FSGP PERINGRLAM+GF +A+ +EL  G D+FAQIS+GG + F+G++ LL++AS+IP
Sbjct  84   LAFSGPAPERINGRLAMVGFVSALAVELFKGQDVFAQISDGGFSLFVGTSILLSVASLIP  143

Query  445  LFQGVTAESKSKGLMTADAEIWNGRFAM  528
            LF+GV+ ESKS G+MT+DAE+ NGR AM
Sbjct  144  LFKGVSVESKSDGIMTSDAELLNGRLAM  171



>ref|XP_010935701.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
isoform X2 [Elaeis guineensis]
Length=160

 Score =   134 bits (336),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 60/90 (67%), Positives = 78/90 (87%), Gaps = 0/90 (0%)
 Frame = +1

Query  259  DVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNGGVTWFLGSTALLTLASV  438
            D+ +FSGP PERINGRLAM+GF +A+ +ELA G DL AQ+ NGG+ WF G+ ALL++AS+
Sbjct  53   DMLAFSGPAPERINGRLAMVGFVSALAVELAKGDDLAAQLMNGGLPWFAGTAALLSVASL  112

Query  439  IPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            +PLF+GV+A+S+S GLMTADAE+WNGRFAM
Sbjct  113  VPLFKGVSAQSQSGGLMTADAELWNGRFAM  142



>ref|XP_010935694.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
isoform X1 [Elaeis guineensis]
Length=187

 Score =   134 bits (338),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 60/90 (67%), Positives = 78/90 (87%), Gaps = 0/90 (0%)
 Frame = +1

Query  259  DVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNGGVTWFLGSTALLTLASV  438
            D+ +FSGP PERINGRLAM+GF +A+ +ELA G DL AQ+ NGG+ WF G+ ALL++AS+
Sbjct  80   DMLAFSGPAPERINGRLAMVGFVSALAVELAKGDDLAAQLMNGGLPWFAGTAALLSVASL  139

Query  439  IPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            +PLF+GV+A+S+S GLMTADAE+WNGRFAM
Sbjct  140  VPLFKGVSAQSQSGGLMTADAELWNGRFAM  169



>ref|XP_009337531.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
[Pyrus x bretschneideri]
Length=197

 Score =   134 bits (337),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 82/178 (46%), Positives = 111/178 (62%), Gaps = 5/178 (3%)
 Frame = +1

Query  1    VVMQSILGSPVTSFKNRNGVSQF-VPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTE  177
            + MQSI  S V     ++ V+Q  VP++Y P   R  + +    +  D  KEQPTT +T+
Sbjct  5    ISMQSICTSSVAYGVGKSIVNQLIVPANYAPINLRKLAHMRVIATAKDEQKEQPTT-ITD  63

Query  178  ssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANG  357
            +S  +      P P P           DV +FSGP PERIN RLAM+GF AA+  EL+ G
Sbjct  64   ASENSEPAPSSPLPPPPPKVSP--KFSDVLAFSGPAPERINNRLAMVGFVAALAAELSKG  121

Query  358  GDLFAQISNGG-VTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
             D+FAQIS G  +  FL ++ LL++AS++PLF+GV+ ESKS+GLMT DAE+WNGR AM
Sbjct  122  QDVFAQISKGSRIPLFLCTSILLSVASLVPLFKGVSVESKSEGLMTLDAELWNGRLAM  179



>ref|XP_010923519.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
[Elaeis guineensis]
Length=189

 Score =   134 bits (336),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 61/90 (68%), Positives = 76/90 (84%), Gaps = 0/90 (0%)
 Frame = +1

Query  259  DVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNGGVTWFLGSTALLTLASV  438
            DV +FSGP PERINGRLAMIGF +A+ +ELA G DL  Q+ NGG+ WF G+ ALL++AS+
Sbjct  82   DVLAFSGPAPERINGRLAMIGFVSALAVELARGDDLATQLMNGGLPWFAGTAALLSVASL  141

Query  439  IPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            +PLF+GV+A+SKS  LMTADAE+WNGRFAM
Sbjct  142  VPLFKGVSAQSKSGRLMTADAELWNGRFAM  171



>emb|CAA63338.1| unnamed protein product [Helianthus annuus]
Length=174

 Score =   133 bits (334),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 75/145 (52%), Positives = 102/145 (70%), Gaps = 13/145 (9%)
 Frame = +1

Query  97   QRNPSF-LVRSMSEDDAGKEQPTTPVTEssttapkptpppspapkvaaksstNLWDVFSF  273
            +RN +F +VR MS+D    +QP+T  +++ +  P P P P  +            DV +F
Sbjct  24   RRNINFAVVRCMSQD----QQPSTDASKTPSAPPPPPPAPKVST--------KFSDVLAF  71

Query  274  SGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQ  453
             GP PERINGRLAMIGF +AM +EL+NG D+FAQIS+GGV  F+ +  +L++AS++PLF+
Sbjct  72   GGPAPERINGRLAMIGFVSAMTVELSNGQDVFAQISHGGVPAFVATRLVLSVASLVPLFK  131

Query  454  GVTAESKSKGLMTADAEIWNGRFAM  528
            GV AESKS GLMT+DAE+WNGR AM
Sbjct  132  GVRAESKSNGLMTSDAELWNGRAAM  156



>ref|XP_009413904.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
 ref|XP_009413905.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=184

 Score =   133 bits (335),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 59/90 (66%), Positives = 76/90 (84%), Gaps = 0/90 (0%)
 Frame = +1

Query  259  DVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNGGVTWFLGSTALLTLASV  438
            D+ +FSGP PERINGRLAMIGF +A+ +EL  G DL AQ++NGG+ WF G+ ALL+ AS+
Sbjct  77   DILAFSGPAPERINGRLAMIGFVSAIAVELTRGDDLVAQLANGGLPWFAGTAALLSAASL  136

Query  439  IPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            +PLF+GV+ +SKS G+MTADAE+WNGRFAM
Sbjct  137  VPLFKGVSVQSKSSGVMTADAELWNGRFAM  166



>ref|XP_010676774.1| PREDICTED: early light-induced protein 2, chloroplastic-like 
[Beta vulgaris subsp. vulgaris]
Length=198

 Score =   132 bits (333),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 81/176 (46%), Positives = 123/176 (70%), Gaps = 2/176 (1%)
 Frame = +1

Query  7    MQSILGSPVTSFKNRNGVSQFVPS-SYLPRLQRNPSFLVRSMSEDDA-GKEQPTTPVTEs  180
            MQS+L +PV +  N + +++   +  + PR+ +  +F V+ M+++   G+ +  + + ++
Sbjct  5    MQSLLVNPVGAVANGSRMTRVTYALGFNPRMSKRVNFGVKCMADEKVEGEPKLDSGLPKT  64

Query  181  sttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGG  360
            + T   PTP P+P PK   K ST+  D+F+FSGP PERINGRLAMIGF AA+ +E + G 
Sbjct  65   NPTTVSPTPTPTPTPKPQPKVSTSFGDLFAFSGPAPERINGRLAMIGFVAAVAVEASKGT  124

Query  361  DLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            DLF QIS+GG  WFL ++ LL++AS++PLF+G  AE+K+ GLM A+AE+WNGR AM
Sbjct  125  DLFTQISDGGAQWFLATSILLSVASLVPLFKGKRAEAKTDGLMNANAELWNGRVAM  180



>gb|AGH13359.1| early light-inducible protein, partial [Helianthus annuus]
Length=113

 Score =   130 bits (326),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 60/90 (67%), Positives = 77/90 (86%), Gaps = 0/90 (0%)
 Frame = +1

Query  259  DVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNGGVTWFLGSTALLTLASV  438
            DV +F GP PERINGRLAMIGF +AM +EL+NG D+FAQIS+GGV  F+ ++ +L++AS+
Sbjct  7    DVLAFGGPAPERINGRLAMIGFVSAMAVELSNGQDVFAQISHGGVPAFVATSLVLSVASL  66

Query  439  IPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            +PLF+GV AESKS GLMT+DAE+WNGR AM
Sbjct  67   VPLFKGVRAESKSSGLMTSDAELWNGRAAM  96



>ref|XP_008786056.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
[Phoenix dactylifera]
Length=193

 Score =   132 bits (332),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 76/154 (49%), Positives = 100/154 (65%), Gaps = 10/154 (6%)
 Frame = +1

Query  76   SSYLPRLQRNP-SFLVRSMSEDD--AGKEQPTTPVTEssttapkptpppspapkvaakss  246
            S+YL   QR   +  +R  +ED     +E+ T PVT S   A  P  P +          
Sbjct  29   STYLLPHQRAAGAMRIRCQAEDQPQVQREEQTIPVTPSQQPAQTPPKPKAKEST------  82

Query  247  tNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNGGVTWFLGSTALLT  426
                D+ +FSGP PERINGRLAM+GF +A+ +ELA G  L  Q+ NGG+ WF G+ ALL+
Sbjct  83   -KFSDMLAFSGPAPERINGRLAMVGFVSALAVELARGDGLATQLMNGGLPWFAGTAALLS  141

Query  427  LASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            +AS++PLF+GV+A+SKS GLMTADAE+WNGRFAM
Sbjct  142  VASLVPLFKGVSAQSKSGGLMTADAELWNGRFAM  175



>ref|XP_008391008.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
[Malus domestica]
Length=192

 Score =   132 bits (332),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 74/147 (50%), Positives = 106/147 (72%), Gaps = 7/147 (5%)
 Frame = +1

Query  88   PRLQRNPSFLVRSMSEDDAGKEQPTTPVTEssttapkptpppspapkvaaksstNLWDVF  267
            P +   P   + SM++D   K+QP+T +TE+S ++ + TP PSP             ++F
Sbjct  35   PTVHSYPQIRICSMAKDGQ-KKQPST-ITEASKSSSRXTPSPSPGKVST-----KFSELF  87

Query  268  SFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPL  447
            +FSGP PERINGRLAM+GF +A+ +EL+ G D+FAQISNGG++ FLG++ LL++AS+IPL
Sbjct  88   AFSGPVPERINGRLAMVGFVSALAVELSKGQDVFAQISNGGISLFLGTSILLSVASLIPL  147

Query  448  FQGVTAESKSKGLMTADAEIWNGRFAM  528
             +GV+ ESKS G+MT+DAE+ NGR AM
Sbjct  148  LKGVSVESKSDGIMTSDAELINGRLAM  174



>gb|AGH13354.1| early light-inducible protein, partial [Helianthus annuus]
 gb|AGH13355.1| early light-inducible protein, partial [Helianthus annuus]
 gb|AGH13357.1| early light-inducible protein, partial [Helianthus annuus]
 gb|AGH13358.1| early light-inducible protein, partial [Helianthus annuus]
Length=113

 Score =   129 bits (325),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 60/90 (67%), Positives = 77/90 (86%), Gaps = 0/90 (0%)
 Frame = +1

Query  259  DVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNGGVTWFLGSTALLTLASV  438
            DV +F GP PERINGRLAMIGF +AM +EL+NG D+FAQIS+GGV  F+ ++ +L++AS+
Sbjct  7    DVLAFGGPAPERINGRLAMIGFVSAMAVELSNGQDVFAQISHGGVPAFVATSLVLSVASL  66

Query  439  IPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            +PLF+GV AESKS GLMT+DAE+WNGR AM
Sbjct  67   VPLFKGVRAESKSNGLMTSDAELWNGRAAM  96



>ref|XP_006838940.1| hypothetical protein AMTR_s00002p00270470 [Amborella trichopoda]
 gb|ERN01509.1| hypothetical protein AMTR_s00002p00270470 [Amborella trichopoda]
Length=192

 Score =   131 bits (330),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 58/90 (64%), Positives = 77/90 (86%), Gaps = 0/90 (0%)
 Frame = +1

Query  259  DVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNGGVTWFLGSTALLTLASV  438
            D+ +FSGPGPERINGRLAM+GF +A+G+ELA G D+ +Q+++GG+ WF+GS+A+LTLAS+
Sbjct  83   DILAFSGPGPERINGRLAMVGFVSALGVELARGNDVASQLASGGLWWFVGSSAVLTLASL  142

Query  439  IPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            IPL +GV  ESK  G+M  +AEIWNGRFAM
Sbjct  143  IPLLKGVDVESKKNGIMNPEAEIWNGRFAM  172



>ref|XP_009343962.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
[Pyrus x bretschneideri]
Length=199

 Score =   130 bits (328),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 78/160 (49%), Positives = 107/160 (67%), Gaps = 2/160 (1%)
 Frame = +1

Query  55   GVSQFVPSSYL--PRLQRNPSFLVRSMSEDDAGKEQPTTPVTEssttapkptpppspapk  228
            G ++ V  S+L  P +   P   + SM++D   K+  T      ++  P P PPPS    
Sbjct  22   GKNKSVRMSHLVAPTVHSYPQIRICSMAKDSQKKQPSTVTQASKNSPPPPPPPPPSTPSP  81

Query  229  vaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNGGVTWFLG  408
               K ST   D+F FSGP  ERINGRLAM+GF +A+ +EL+ G D+FAQISNGG++ FLG
Sbjct  82   SPGKVSTKFSDLFGFSGPVLERINGRLAMVGFVSALAVELSMGQDVFAQISNGGISLFLG  141

Query  409  STALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            ++ LL++AS+IPLF+GV+ ESKS G+MT+DAE+ NGR AM
Sbjct  142  TSILLSVASLIPLFKGVSVESKSDGIMTSDAELINGRLAM  181



>gb|ABK22971.1| unknown [Picea sitchensis]
Length=193

 Score =   130 bits (327),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 69/137 (50%), Positives = 98/137 (72%), Gaps = 6/137 (4%)
 Frame = +1

Query  118  VRSMSEDDAGKEQPTTPVTEssttapkptpppspapkvaaksstNLWDVFSFSGPGPERI  297
            V+ M+E D   ++  TP T+S+T  P P PP                D+F+FSGP PE I
Sbjct  44   VKCMAEADPQPKESVTPSTQSTTRIPPPPPPAPKKVST------KFGDIFAFSGPAPETI  97

Query  298  NGRLAMIGFAAAMGMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKS  477
            NGRLAM+GF +A+G+ELA+G DLF+Q++ GGV+ F+GS  +L+LAS+IP+F+GV+ ESKS
Sbjct  98   NGRLAMLGFVSAVGVELASGKDLFSQLATGGVSLFVGSAVVLSLASLIPMFKGVSTESKS  157

Query  478  KGLMTADAEIWNGRFAM  528
            + +M++ AE+WNGRFAM
Sbjct  158  QAIMSSRAEMWNGRFAM  174



>ref|XP_008224238.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
isoform X2 [Prunus mume]
Length=183

 Score =   130 bits (326),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 81/175 (46%), Positives = 109/175 (62%), Gaps = 17/175 (10%)
 Frame = +1

Query  7    MQSI-LGSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEss  183
            MQSI L + + ++  RN  S  V    +P L R P+         D  KEQP+T VT +S
Sbjct  7    MQSIFLANNLVAYGARNNKS--VGPFSVPALHRYPNM-------KDGKKEQPST-VTNAS  56

Query  184  ttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGD  363
               P    P                D+ +FSGP PERINGRLAM+GF +A+ +EL  G D
Sbjct  57   KNPPPSNTPVPSKVST------KFSDLLAFSGPAPERINGRLAMVGFVSALAVELFKGQD  110

Query  364  LFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            +FAQIS+GGV+ F+G++ LL++AS+IPLF+GV+ ESKS G+MT+DAE+ NGR AM
Sbjct  111  VFAQISDGGVSLFVGTSILLSVASLIPLFKGVSVESKSDGIMTSDAELLNGRLAM  165



>ref|XP_008360362.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
isoform X1 [Malus domestica]
Length=193

 Score =   130 bits (326),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 77/147 (52%), Positives = 103/147 (70%), Gaps = 6/147 (4%)
 Frame = +1

Query  88   PRLQRNPSFLVRSMSEDDAGKEQPTTPVTEssttapkptpppspapkvaaksstNLWDVF  267
            P +   P   + SM++D   K+QP+T VT +S   P P P PSP  + +        D+F
Sbjct  35   PTVHSYPPIRICSMAKDGQ-KKQPST-VTNASKYPPPPPPTPSPGKQAST----KFSDLF  88

Query  268  SFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPL  447
            +FSGP PERINGRLAM+GF +A+  EL  G D+FAQISNGGV+ FLG++ LLT+AS+IPL
Sbjct  89   AFSGPVPERINGRLAMVGFVSAIATELYKGQDVFAQISNGGVSLFLGTSILLTVASLIPL  148

Query  448  FQGVTAESKSKGLMTADAEIWNGRFAM  528
            F+G++ ES+S G+MT DAE+ NGR AM
Sbjct  149  FKGLSVESESDGIMTPDAELINGRLAM  175



>ref|XP_008360363.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
isoform X2 [Malus domestica]
Length=192

 Score =   130 bits (326),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 77/147 (52%), Positives = 101/147 (69%), Gaps = 7/147 (5%)
 Frame = +1

Query  88   PRLQRNPSFLVRSMSEDDAGKEQPTTPVTEssttapkptpppspapkvaaksstNLWDVF  267
            P +   P   + SM++D   K+QP+T VT +S   P P P PSP             D+F
Sbjct  35   PTVHSYPPIRICSMAKDGQ-KKQPST-VTNASKYPPPPPPTPSPGKAST-----KFSDLF  87

Query  268  SFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPL  447
            +FSGP PERINGRLAM+GF +A+  EL  G D+FAQISNGGV+ FLG++ LLT+AS+IPL
Sbjct  88   AFSGPVPERINGRLAMVGFVSAIATELYKGQDVFAQISNGGVSLFLGTSILLTVASLIPL  147

Query  448  FQGVTAESKSKGLMTADAEIWNGRFAM  528
            F+G++ ES+S G+MT DAE+ NGR AM
Sbjct  148  FKGLSVESESDGIMTPDAELINGRLAM  174



>ref|XP_009343966.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
isoform X2 [Pyrus x bretschneideri]
Length=193

 Score =   129 bits (325),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 58/90 (64%), Positives = 77/90 (86%), Gaps = 0/90 (0%)
 Frame = +1

Query  259  DVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNGGVTWFLGSTALLTLASV  438
            D+F+FSGP PERINGRLAM+GF +A+ +EL+ G D+FAQISNGGV+ FLG++ L+T+AS+
Sbjct  86   DLFAFSGPVPERINGRLAMVGFVSALAVELSKGQDVFAQISNGGVSLFLGTSILITVASL  145

Query  439  IPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            IPLF G++ ES+S G+MT DAE+ NGR AM
Sbjct  146  IPLFNGLSVESESDGIMTPDAELINGRLAM  175



>ref|XP_009343965.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
isoform X1 [Pyrus x bretschneideri]
Length=194

 Score =   129 bits (324),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 58/90 (64%), Positives = 77/90 (86%), Gaps = 0/90 (0%)
 Frame = +1

Query  259  DVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNGGVTWFLGSTALLTLASV  438
            D+F+FSGP PERINGRLAM+GF +A+ +EL+ G D+FAQISNGGV+ FLG++ L+T+AS+
Sbjct  87   DLFAFSGPVPERINGRLAMVGFVSALAVELSKGQDVFAQISNGGVSLFLGTSILITVASL  146

Query  439  IPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            IPLF G++ ES+S G+MT DAE+ NGR AM
Sbjct  147  IPLFNGLSVESESDGIMTPDAELINGRLAM  176



>ref|XP_009341094.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
isoform X1 [Pyrus x bretschneideri]
 ref|XP_009341099.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
isoform X1 [Pyrus x bretschneideri]
Length=194

 Score =   129 bits (324),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 58/90 (64%), Positives = 77/90 (86%), Gaps = 0/90 (0%)
 Frame = +1

Query  259  DVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNGGVTWFLGSTALLTLASV  438
            D+F+FSGP PERINGRLAM+GF +A+ +EL+ G D+FAQISNGGV+ FLG++ L+T+AS+
Sbjct  87   DLFAFSGPVPERINGRLAMVGFVSALAVELSKGQDVFAQISNGGVSLFLGTSILITVASL  146

Query  439  IPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            IPLF G++ ES+S G+MT DAE+ NGR AM
Sbjct  147  IPLFNGLSVESESDGIMTPDAELINGRLAM  176



>ref|XP_009341095.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
isoform X2 [Pyrus x bretschneideri]
 ref|XP_009341100.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
isoform X2 [Pyrus x bretschneideri]
Length=193

 Score =   129 bits (324),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 58/90 (64%), Positives = 77/90 (86%), Gaps = 0/90 (0%)
 Frame = +1

Query  259  DVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNGGVTWFLGSTALLTLASV  438
            D+F+FSGP PERINGRLAM+GF +A+ +EL+ G D+FAQISNGGV+ FLG++ L+T+AS+
Sbjct  86   DLFAFSGPVPERINGRLAMVGFVSALAVELSKGQDVFAQISNGGVSLFLGTSILITVASL  145

Query  439  IPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            IPLF G++ ES+S G+MT DAE+ NGR AM
Sbjct  146  IPLFNGLSVESESDGIMTPDAELINGRLAM  175



>gb|AGH13356.1| early light-inducible protein, partial [Helianthus annuus]
Length=113

 Score =   126 bits (316),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 58/90 (64%), Positives = 75/90 (83%), Gaps = 0/90 (0%)
 Frame = +1

Query  259  DVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNGGVTWFLGSTALLTLASV  438
            DV +F GP PERINGRLAMIGF + M +EL+NG D+FA IS+GGV  F+ ++ +L++AS+
Sbjct  7    DVLAFGGPAPERINGRLAMIGFVSTMAVELSNGLDVFAHISHGGVPAFVATSLVLSVASL  66

Query  439  IPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            +PLF+GV AESKS GLMT+DAE+WNGR AM
Sbjct  67   VPLFKGVRAESKSSGLMTSDAELWNGRAAM  96



>ref|XP_008777102.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
[Phoenix dactylifera]
Length=176

 Score =   128 bits (321),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 57/90 (63%), Positives = 73/90 (81%), Gaps = 0/90 (0%)
 Frame = +1

Query  259  DVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNGGVTWFLGSTALLTLASV  438
            DV +FSGP PERINGRLAM+GF +A+ +EL  G DL AQ+ NGG+ WF  +  L ++AS+
Sbjct  69   DVLAFSGPAPERINGRLAMVGFVSALAVELVRGDDLAAQLMNGGLLWFAATAVLWSVASL  128

Query  439  IPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            +PLF+GV+ +SKS GLMTADAE+WNGRFAM
Sbjct  129  VPLFKGVSVQSKSDGLMTADAELWNGRFAM  158



>sp|Q01931.1|DS22_CRAPL RecName: Full=Desiccation stress protein DSP-22, chloroplastic; 
Flags: Precursor [Craterostigma plantagineum]
 emb|CAA47164.1| dsp-22 [Craterostigma plantagineum]
Length=199

 Score =   129 bits (323),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 77/175 (44%), Positives = 110/175 (63%), Gaps = 14/175 (8%)
 Frame = +1

Query  28   PVTSFKNRNGVSQFVPS-------SY-LPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEss  183
            P  S + ++ +++F P+       SY LP ++RN  F VRSM ED+  +EQ      ++ 
Sbjct  11   PAMSCRGQSTITRFGPNNLFLGKQSYELPLMRRNAKFTVRSMREDNEKEEQQQQKQQQTH  70

Query  184  ttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGD  363
               P  TP  +              D+FSF G  PERINGR AMIGF AA+G+ELA G D
Sbjct  71   DGGPDLTPNRTEVTTKRTV------DLFSFDGLAPERINGRSAMIGFVAAVGVELATGRD  124

Query  364  LFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            +F+Q+ NGGV WFL ++A+L LA++IP+++G++ E+K+ G   +DAEIWNGRFAM
Sbjct  125  VFSQVFNGGVMWFLLTSAVLVLATLIPIYRGLSPEAKNNGFWNSDAEIWNGRFAM  179



>ref|XP_009343974.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
[Pyrus x bretschneideri]
Length=174

 Score =   127 bits (320),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 58/90 (64%), Positives = 77/90 (86%), Gaps = 0/90 (0%)
 Frame = +1

Query  259  DVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNGGVTWFLGSTALLTLASV  438
            D+F+FSGP PERINGRLAM+GF +A+ +EL+ G D+FAQISNGGV+ FLG++ L+T+AS+
Sbjct  67   DLFAFSGPVPERINGRLAMVGFVSALAVELSKGQDVFAQISNGGVSLFLGTSILITVASL  126

Query  439  IPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            IPLF G++ ES+S G+MT DAE+ NGR AM
Sbjct  127  IPLFNGLSVESESDGIMTPDAELINGRLAM  156



>gb|ABK24316.1| unknown [Picea sitchensis]
Length=193

 Score =   128 bits (321),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 69/137 (50%), Positives = 96/137 (70%), Gaps = 6/137 (4%)
 Frame = +1

Query  118  VRSMSEDDAGKEQPTTPVTEssttapkptpppspapkvaaksstNLWDVFSFSGPGPERI  297
            V+ M+E D   ++  TP T+S+T  P P PP                DVF+FSGP PE I
Sbjct  44   VKCMAEADPQPKESVTPSTQSTTRIPPPPPPAPKKVST------KFGDVFAFSGPAPETI  97

Query  298  NGRLAMIGFAAAMGMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKS  477
            NGRLAM+GF +A+G+ELA+G DLF+Q++ GGV  F+GS  +L+ AS+IP+F+GV+ ESKS
Sbjct  98   NGRLAMLGFVSAVGVELASGKDLFSQLATGGVPLFVGSAVVLSFASLIPMFKGVSTESKS  157

Query  478  KGLMTADAEIWNGRFAM  528
            + +M++ AE+WNGRFAM
Sbjct  158  QAIMSSRAEMWNGRFAM  174



>gb|AEW08119.1| hypothetical protein 2_114_01, partial [Pinus radiata]
 gb|AFG63030.1| hypothetical protein 2_114_01, partial [Pinus taeda]
 gb|AFG63031.1| hypothetical protein 2_114_01, partial [Pinus taeda]
 gb|AFG63032.1| hypothetical protein 2_114_01, partial [Pinus taeda]
 gb|AFG63033.1| hypothetical protein 2_114_01, partial [Pinus taeda]
 gb|AFG63034.1| hypothetical protein 2_114_01, partial [Pinus taeda]
 gb|AFG63035.1| hypothetical protein 2_114_01, partial [Pinus taeda]
 gb|AFG63036.1| hypothetical protein 2_114_01, partial [Pinus taeda]
 gb|AFG63037.1| hypothetical protein 2_114_01, partial [Pinus taeda]
 gb|AFG63038.1| hypothetical protein 2_114_01, partial [Pinus taeda]
 gb|AFG63039.1| hypothetical protein 2_114_01, partial [Pinus taeda]
 gb|AFG63040.1| hypothetical protein 2_114_01, partial [Pinus taeda]
 gb|AFG63041.1| hypothetical protein 2_114_01, partial [Pinus taeda]
 gb|AFG63042.1| hypothetical protein 2_114_01, partial [Pinus taeda]
Length=126

 Score =   125 bits (315),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 57/90 (63%), Positives = 78/90 (87%), Gaps = 0/90 (0%)
 Frame = +1

Query  259  DVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNGGVTWFLGSTALLTLASV  438
            DVF+F GP PE INGRLAM+GF +A+G+E+A+G DLF+Q+++GGV  FLGS  LL++AS+
Sbjct  18   DVFAFGGPAPETINGRLAMLGFVSALGVEIASGRDLFSQLASGGVPLFLGSAILLSVASL  77

Query  439  IPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            IP+F+GV+ ESKS+ +M+A AE+WNGRFAM
Sbjct  78   IPMFKGVSTESKSQAIMSAGAEMWNGRFAM  107



>gb|ABR16737.1| unknown [Picea sitchensis]
Length=155

 Score =   126 bits (317),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 79/90 (88%), Gaps = 0/90 (0%)
 Frame = +1

Query  259  DVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNGGVTWFLGSTALLTLASV  438
            D+F+FSGP PE INGRLAM+GF +A+G+E+A+G DLF+Q++ GGV+ F+GS  +L+LAS+
Sbjct  47   DIFAFSGPAPETINGRLAMLGFVSAVGVEVASGKDLFSQLATGGVSLFVGSAVVLSLASL  106

Query  439  IPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            IP+F+GV+ ESKS+ +M++ AE+WNGRFAM
Sbjct  107  IPMFKGVSTESKSQAIMSSRAEMWNGRFAM  136



>gb|AFG63029.1| hypothetical protein 2_114_01, partial [Pinus taeda]
Length=126

 Score =   125 bits (315),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 57/90 (63%), Positives = 78/90 (87%), Gaps = 0/90 (0%)
 Frame = +1

Query  259  DVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNGGVTWFLGSTALLTLASV  438
            DVF+F GP PE INGRLAM+GF +A+G+E+A+G DLF+Q+++GGV  FLGS  LL++AS+
Sbjct  18   DVFAFGGPAPETINGRLAMLGFVSALGVEIASGRDLFSQLASGGVPLFLGSAILLSVASL  77

Query  439  IPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            IP+F+GV+ ESKS+ +M+A AE+WNGRFAM
Sbjct  78   IPMFKGVSTESKSQAIMSAGAEMWNGRFAM  107



>ref|XP_009341105.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
[Pyrus x bretschneideri]
 ref|XP_009341108.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
[Pyrus x bretschneideri]
Length=151

 Score =   125 bits (315),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 58/90 (64%), Positives = 77/90 (86%), Gaps = 0/90 (0%)
 Frame = +1

Query  259  DVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNGGVTWFLGSTALLTLASV  438
            D F+FSGP PERINGRLAM+GF +A+ +EL+ G D+FAQISNGG++ FLG++ LL++AS+
Sbjct  44   DWFAFSGPVPERINGRLAMVGFVSALAVELSKGQDVFAQISNGGISLFLGTSILLSVASL  103

Query  439  IPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            IPLF+ V+ ESKS G+MT+DAE+ NGR AM
Sbjct  104  IPLFKRVSVESKSDGIMTSDAELINGRLAM  133



>gb|ACN39996.1| unknown [Picea sitchensis]
 gb|ACN40868.1| unknown [Picea sitchensis]
Length=193

 Score =   127 bits (318),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 68/137 (50%), Positives = 96/137 (70%), Gaps = 6/137 (4%)
 Frame = +1

Query  118  VRSMSEDDAGKEQPTTPVTEssttapkptpppspapkvaaksstNLWDVFSFSGPGPERI  297
            V+ M+E D   ++  TP T+S+T  P P PP                DVF+FSGP PE I
Sbjct  44   VKCMAEADPQPKESVTPSTQSTTRIPPPPPPAPKKVST------KFGDVFAFSGPAPETI  97

Query  298  NGRLAMIGFAAAMGMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKS  477
            NGRLAM+GF +A+G+E+A+G DLF+Q++ GGV  F+GS  +L+ AS+IP+F+GV+ ESKS
Sbjct  98   NGRLAMLGFVSAVGVEVASGKDLFSQLATGGVPLFVGSAVVLSFASLIPMFKGVSTESKS  157

Query  478  KGLMTADAEIWNGRFAM  528
            + +M++ AE+WNGRFAM
Sbjct  158  QAIMSSRAEMWNGRFAM  174



>ref|XP_009341102.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
isoform X2 [Pyrus x bretschneideri]
Length=187

 Score =   125 bits (315),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 75/87 (86%), Gaps = 0/87 (0%)
 Frame = +1

Query  259  DVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNGGVTWFLGSTALLTLASV  438
            D+F+FSGP PERINGRLAM+GF +A+ +EL+ G D+FAQISNGGV+ FLG++ L+T+AS+
Sbjct  80   DLFAFSGPVPERINGRLAMVGFVSALAVELSKGQDVFAQISNGGVSLFLGTSILITVASL  139

Query  439  IPLFQGVTAESKSKGLMTADAEIWNGR  519
            IPLF G++ ES+S G+MT DAE+ NGR
Sbjct  140  IPLFNGLSVESESDGIMTPDAELINGR  166



>ref|XP_009341101.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
isoform X1 [Pyrus x bretschneideri]
Length=194

 Score =   125 bits (315),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 75/87 (86%), Gaps = 0/87 (0%)
 Frame = +1

Query  259  DVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNGGVTWFLGSTALLTLASV  438
            D+F+FSGP PERINGRLAM+GF +A+ +EL+ G D+FAQISNGGV+ FLG++ L+T+AS+
Sbjct  87   DLFAFSGPVPERINGRLAMVGFVSALAVELSKGQDVFAQISNGGVSLFLGTSILITVASL  146

Query  439  IPLFQGVTAESKSKGLMTADAEIWNGR  519
            IPLF G++ ES+S G+MT DAE+ NGR
Sbjct  147  IPLFNGLSVESESDGIMTPDAELINGR  173



>ref|XP_009341107.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
[Pyrus x bretschneideri]
Length=215

 Score =   126 bits (316),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 75/87 (86%), Gaps = 0/87 (0%)
 Frame = +1

Query  259  DVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNGGVTWFLGSTALLTLASV  438
            D+F+FSGP PERINGRLAM+GF +A+ +EL+ G D+FAQISNGGV+ FLG++ L+T+AS+
Sbjct  108  DLFAFSGPVPERINGRLAMVGFVSALAVELSKGQDVFAQISNGGVSLFLGTSILITVASL  167

Query  439  IPLFQGVTAESKSKGLMTADAEIWNGR  519
            IPLF G++ ES+S G+MT DAE+ NGR
Sbjct  168  IPLFNGLSVESESDGIMTPDAELINGR  194



>gb|ABR16462.1| unknown [Picea sitchensis]
Length=158

 Score =   123 bits (309),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 56/90 (62%), Positives = 76/90 (84%), Gaps = 0/90 (0%)
 Frame = +1

Query  259  DVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNGGVTWFLGSTALLTLASV  438
            DVF+FSGP PE INGRLAM+GF +A+G+ELA+G DLF+Q+ +GGV  F+GS  L T+AS+
Sbjct  50   DVFAFSGPAPETINGRLAMLGFVSAVGVELASGKDLFSQLGSGGVPLFVGSAVLFTVASL  109

Query  439  IPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            IP+F+GV+ ESKS+ +M+ +AE+ NGRFAM
Sbjct  110  IPMFKGVSKESKSEAIMSVEAEMLNGRFAM  139



>ref|XP_003557495.1| PREDICTED: high molecular mass early light-inducible protein 
HV58, chloroplastic-like [Brachypodium distachyon]
Length=188

 Score =   123 bits (308),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/93 (62%), Positives = 73/93 (78%), Gaps = 1/93 (1%)
 Frame = +1

Query  253  LWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNG-GVTWFLGSTALLTL  429
            +WD  +FSGP PERINGRLAM+GF AA+ +E A GG L +Q  +G G+ WFL +TALL++
Sbjct  76   VWDALAFSGPAPERINGRLAMVGFVAALSVEAARGGGLLSQAGSGAGLGWFLTTTALLSV  135

Query  430  ASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            AS++PL QG + ESKS G  TADAE+WNGRFAM
Sbjct  136  ASLVPLLQGQSVESKSSGFWTADAELWNGRFAM  168



>gb|ACN40010.1| unknown [Picea sitchensis]
Length=167

 Score =   122 bits (305),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 76/90 (84%), Gaps = 0/90 (0%)
 Frame = +1

Query  259  DVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNGGVTWFLGSTALLTLASV  438
            DVF+FSGP PE INGRLAM+GF +A+G+E+A+G DLF+Q++  GV  F+GS  +L+ AS+
Sbjct  59   DVFAFSGPAPETINGRLAMLGFVSAVGVEVASGKDLFSQLATVGVPLFVGSAVVLSFASL  118

Query  439  IPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            IP+F+GV+ ESKS+ +M++ AE+WNGRFAM
Sbjct  119  IPMFKGVSTESKSQAIMSSRAEMWNGRFAM  148



>gb|EMT18433.1| High molecular mass early light-inducible protein HV58, chloroplastic 
[Aegilops tauschii]
Length=184

 Score =   122 bits (306),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 69/155 (45%), Positives = 95/155 (61%), Gaps = 9/155 (6%)
 Frame = +1

Query  73   PSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEssttapkptpppspapkvaaksstN  252
            P+S+ P L R  + LVR+ +E D        P  E+++ +     P         K   N
Sbjct  16   PASWSPALTRQRALLVRAQTEPD------IEPTKETTSASTSSPTPTPSPVAPKPKPKAN  69

Query  253  --LWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNG-GVTWFLGSTALL  423
              +WD  +FSGP PERINGRLAM+GF AA+ +E A GG L  Q  +G G+ WFL + A+ 
Sbjct  70   PSVWDALAFSGPAPERINGRLAMVGFVAALSVEAARGGGLLDQAGSGAGLGWFLTTAAVF  129

Query  424  TLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            ++AS++PL QG + ESKS G+ +ADAE+WNGRFAM
Sbjct  130  SVASLVPLLQGQSVESKSSGVWSADAELWNGRFAM  164



>gb|ABK24238.1| unknown [Picea sitchensis]
Length=193

 Score =   121 bits (304),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 75/90 (83%), Gaps = 0/90 (0%)
 Frame = +1

Query  259  DVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNGGVTWFLGSTALLTLASV  438
            DVF+FSGP PE INGRLAM+GF +A+G+ELA+G DL +Q+ +GGV  F+GS  L ++AS+
Sbjct  85   DVFAFSGPAPETINGRLAMLGFVSAVGVELASGKDLLSQLGSGGVPLFVGSAVLFSVASL  144

Query  439  IPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            IP+F+GV+ ESKSK +M+ +AE+ NGRFAM
Sbjct  145  IPMFKGVSKESKSKAIMSVEAEMLNGRFAM  174



>gb|AFP90212.1| early light-induced protein, partial [Pinus armandii]
Length=120

 Score =   119 bits (298),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 56/90 (62%), Positives = 76/90 (84%), Gaps = 0/90 (0%)
 Frame = +1

Query  259  DVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNGGVTWFLGSTALLTLASV  438
            DVF+FSGP PE INGRLAM+GF +A+G+E+A+G DLF+Q++ GGV  FLGS  LL++ASV
Sbjct  21   DVFAFSGPAPETINGRLAMLGFVSAVGVEIASGRDLFSQLATGGVPLFLGSAILLSVASV  80

Query  439  IPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            IP+F+GV+ ESKS+ + ++ AE+ NGRFAM
Sbjct  81   IPMFKGVSKESKSQEIWSSGAEMLNGRFAM  110



>dbj|BAJ86766.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=211

 Score =   120 bits (301),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 79/178 (44%), Positives = 116/178 (65%), Gaps = 9/178 (5%)
 Frame = +1

Query  1    VVMQSILGSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEs  180
            +VM +++   ++SF     V +  P+SY P L R  + LVR+ +E D    +PT   T +
Sbjct  21   LVMTTMVA--LSSFAGAAAVGR--PASYSPALPRRRALLVRAQTEPDI---EPTKETTSA  73

Query  181  sttapkptpppspapkvaaksst-NLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANG  357
            ST++P P+P PSP        +  ++WD  +F+GP PERINGRLAM+GF AA+ +E A G
Sbjct  74   STSSPSPSPTPSPVAPKPKPKANPSVWDALAFTGPAPERINGRLAMVGFVAALSVEAARG  133

Query  358  GDLFAQISNG-GVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            G L  Q  +G G+ WFL + A+ ++AS++PL QG + ESK+ G+ +ADAE+WNGRFAM
Sbjct  134  GGLLDQAGSGAGLGWFLTTAAVFSVASLVPLLQGQSVESKNSGVWSADAELWNGRFAM  191



>dbj|BAJ97969.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=210

 Score =   120 bits (301),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 79/178 (44%), Positives = 116/178 (65%), Gaps = 9/178 (5%)
 Frame = +1

Query  1    VVMQSILGSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEs  180
            +VM +++   ++SF     V +  P+SY P L R  + LVR+ +E D    +PT   T +
Sbjct  20   LVMTTMVA--LSSFAGAAAVGR--PASYSPALPRRRALLVRAQTEPDI---EPTKETTSA  72

Query  181  sttapkptpppspapkvaaksst-NLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANG  357
            ST++P P+P PSP        +  ++WD  +F+GP PERINGRLAM+GF AA+ +E A G
Sbjct  73   STSSPSPSPTPSPVAPKPKPKANPSVWDALAFTGPAPERINGRLAMVGFVAALSVEAARG  132

Query  358  GDLFAQISNG-GVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            G L  Q  +G G+ WFL + A+ ++AS++PL QG + ESK+ G+ +ADAE+WNGRFAM
Sbjct  133  GGLLDQAGSGAGLGWFLTTAAVFSVASLVPLLQGQSVESKNSGVWSADAELWNGRFAM  190



>dbj|BAJ86949.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=192

 Score =   119 bits (299),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 73/94 (78%), Gaps = 1/94 (1%)
 Frame = +1

Query  250  NLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNG-GVTWFLGSTALLT  426
            ++WD  +FSGP PERINGRLAM+GF AA+ +E A GG L  Q+ +G G+ WFL + A+ +
Sbjct  79   SVWDALAFSGPAPERINGRLAMVGFVAALSVEAARGGGLLDQVGSGAGLGWFLTTAAVFS  138

Query  427  LASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            +AS++PL QG + ESKS G+ TADAE+WNGRFAM
Sbjct  139  VASLVPLVQGQSVESKSSGVWTADAELWNGRFAM  172



>gb|EMS57269.1| hypothetical protein TRIUR3_20794 [Triticum urartu]
Length=186

 Score =   119 bits (299),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 69/153 (45%), Positives = 99/153 (65%), Gaps = 3/153 (2%)
 Frame = +1

Query  73   PSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEssttapkptpppspapkvaaksstN  252
            P+S+ P L R  + L+R+ +E D   E      + S+++      P    PK   K++ +
Sbjct  16   PASWSPALPRRRALLIRAQTEPDI--ESTKETTSASTSSPTPTPTPSPVVPKPKPKANPS  73

Query  253  LWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNG-GVTWFLGSTALLTL  429
            +WD  +FSGP PERINGRLAM+GF AA+ +E A GG L  Q  +G G+ WFL + A+ ++
Sbjct  74   VWDALAFSGPAPERINGRLAMVGFVAALSVEAARGGGLLDQAGSGAGLGWFLTTAAVFSV  133

Query  430  ASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            AS++PL QG + ESKS G+ +ADAE+WNGRFAM
Sbjct  134  ASLVPLLQGQSVESKSSGVWSADAELWNGRFAM  166



>ref|XP_009586916.1| PREDICTED: early light-induced protein 2, chloroplastic-like, 
partial [Nicotiana tomentosiformis]
Length=115

 Score =   116 bits (290),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 72/91 (79%), Gaps = 1/91 (1%)
 Frame = +1

Query  259  DVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNGGVTWFLGSTALLTLASV  438
            D+F+FSGP  ERIN RLAMIGF AA+G E  +G ++FAQ+S+ G  WFLG++ALLTLAS+
Sbjct  7    DLFAFSGPALERINDRLAMIGFVAALGTEFGDGANIFAQLSSRGFAWFLGTSALLTLASL  66

Query  439  IPLFQGVTAES-KSKGLMTADAEIWNGRFAM  528
            IPLFQ + A+   +  +M+ DA+IWNGRFAM
Sbjct  67   IPLFQAIRAQKGYTSVIMSVDAKIWNGRFAM  97



>ref|XP_010228291.1| PREDICTED: high molecular mass early light-inducible protein 
HV58, chloroplastic-like [Brachypodium distachyon]
Length=193

 Score =   118 bits (296),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 73/94 (78%), Gaps = 1/94 (1%)
 Frame = +1

Query  250  NLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNG-GVTWFLGSTALLT  426
            ++WD  +FSGP PERINGRLAM+GF AA+ +E A GG L +Q  +G G+ WFL +TALL+
Sbjct  80   SVWDALAFSGPAPERINGRLAMVGFVAALSVEAARGGGLLSQAGSGAGLGWFLTTTALLS  139

Query  427  LASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            +AS++PL QG + ESKS    ++DAE+WNGRFAM
Sbjct  140  VASLVPLLQGQSVESKSTSFWSSDAELWNGRFAM  173



>ref|XP_002461536.1| hypothetical protein SORBIDRAFT_02g004380 [Sorghum bicolor]
 gb|EER98057.1| hypothetical protein SORBIDRAFT_02g004380 [Sorghum bicolor]
Length=244

 Score =   119 bits (299),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 52/93 (56%), Positives = 74/93 (80%), Gaps = 1/93 (1%)
 Frame = +1

Query  253  LWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNG-GVTWFLGSTALLTL  429
            LWD  +FSGP PERINGRLAM+GF +A+ +E + GG L +Q  +G G+TWF  + A+L++
Sbjct  132  LWDALAFSGPAPERINGRLAMVGFVSALAVEASRGGGLLSQAGSGSGLTWFAATAAVLSV  191

Query  430  ASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            AS++PL +G +AE++S  +M+ADAE+WNGRFAM
Sbjct  192  ASLVPLLKGDSAEARSGAVMSADAELWNGRFAM  224



>dbj|BAJ90265.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=192

 Score =   118 bits (295),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 72/94 (77%), Gaps = 1/94 (1%)
 Frame = +1

Query  250  NLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNGG-VTWFLGSTALLT  426
            ++WD  +FSGP PERINGRLAM+GF AA+ +E A GG L  Q+ +G  + WFL + A+ +
Sbjct  79   SVWDALAFSGPAPERINGRLAMVGFVAALSVEAARGGGLLDQVGSGARLGWFLTTAAVFS  138

Query  427  LASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            +AS++PL QG + ESKS G+ TADAE+WNGRFAM
Sbjct  139  VASLVPLLQGQSVESKSSGVWTADAELWNGRFAM  172



>ref|XP_003557497.1| PREDICTED: low molecular mass early light-inducible protein HV90, 
chloroplastic-like [Brachypodium distachyon]
Length=172

 Score =   117 bits (293),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 73/94 (78%), Gaps = 1/94 (1%)
 Frame = +1

Query  250  NLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNG-GVTWFLGSTALLT  426
            ++WD+ SFSGP PERINGRLAM+GF AA+ +E A GG L +Q  +G G+ WFL +TALL+
Sbjct  59   SVWDILSFSGPAPERINGRLAMVGFVAALSVEAARGGGLLSQAGSGAGMGWFLTTTALLS  118

Query  427  LASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            +AS++PL QG + ESKS    ++DAE+WNGR AM
Sbjct  119  VASLVPLLQGQSVESKSSAFWSSDAELWNGRAAM  152



>gb|EMT24337.1| High molecular mass early light-inducible protein HV58, chloroplastic 
[Aegilops tauschii]
Length=189

 Score =   117 bits (294),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 72/94 (77%), Gaps = 1/94 (1%)
 Frame = +1

Query  250  NLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNG-GVTWFLGSTALLT  426
            ++WD  +FSGP PERINGRLAM+GF AA+ +E A GG L  Q  +G G+ WFL + A+ +
Sbjct  76   SVWDALAFSGPAPERINGRLAMVGFVAALSVEAARGGGLLDQAGSGAGLGWFLTTAAVFS  135

Query  427  LASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            +AS++PL QG + ESKS G+ TADAE+WNGRFAM
Sbjct  136  VASLVPLLQGQSVESKSSGVWTADAELWNGRFAM  169



>ref|XP_004955632.1| PREDICTED: low molecular mass early light-inducible protein HV90, 
chloroplastic-like [Setaria italica]
Length=181

 Score =   117 bits (293),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 65/154 (42%), Positives = 96/154 (62%), Gaps = 23/154 (15%)
 Frame = +1

Query  70   VPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEssttapkptpppspapkvaaksst  249
            VP+S L   +R  + +VR+ +ED     +PTT   +++     P                
Sbjct  30   VPASALAPRRR--ALVVRAQAED----AEPTTEEPKAAKKPASP----------------  67

Query  250  NLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNG-GVTWFLGSTALLT  426
             LWD  +FSGP PERINGRLAM+GF +A+ +E + GG L +Q  +G G+ WF  + A+L+
Sbjct  68   GLWDALAFSGPAPERINGRLAMVGFVSALAVEASRGGGLLSQAGSGSGLAWFAATAAVLS  127

Query  427  LASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            +AS++PL +G +AE++S G M+ADAE+WNGRFAM
Sbjct  128  VASLVPLLKGDSAEARSGGFMSADAELWNGRFAM  161



>ref|XP_011463234.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
[Fragaria vesca subsp. vesca]
Length=158

 Score =   116 bits (290),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 82/163 (50%), Positives = 103/163 (63%), Gaps = 9/163 (6%)
 Frame = +1

Query  7    MQSILGSPVTSFKNRNGVSQFVPS--SYLPR-LQRNPSFLVRSMSEDDAGKEQPTT-PVT  174
            MQSILGS V     +N V+Q   S  +Y P  LQR  +  VRSM  D   KEQ TT P T
Sbjct  1    MQSILGSSVAYGACKNKVNQINVSAVTYAPSYLQRFSNMRVRSM--DGQNKEQQTTVPST  58

Query  175  EssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELAN  354
                 + +   P SP P  + K ST   D F+FSGP PERINGRLAM GF AA+ +EL+ 
Sbjct  59   ---LGSSQTPAPSSPLPPRSPKVSTTFSDTFAFSGPAPERINGRLAMAGFVAALAVELSK  115

Query  355  GGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKG  483
            G  +FAQ+ NGG+  FLG++ LL++AS++PL +GVT ESK KG
Sbjct  116  GQYVFAQLFNGGIPLFLGTSILLSVASLVPLLKGVTVESKQKG  158



>dbj|BAJ89047.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=193

 Score =   117 bits (292),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 71/94 (76%), Gaps = 1/94 (1%)
 Frame = +1

Query  250  NLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNG-GVTWFLGSTALLT  426
            ++WD  +FSGP PERINGRLAM+GF AA+ +E A GG L  Q  +G G+ WFL +  + +
Sbjct  80   SVWDALAFSGPAPERINGRLAMVGFVAALSVEAARGGGLLDQAGSGAGLGWFLATAGVFS  139

Query  427  LASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            LAS++PL QG + ESKS G+ +ADAE+WNGRFAM
Sbjct  140  LASLVPLLQGQSVESKSSGIWSADAELWNGRFAM  173



>ref|XP_004955631.1| PREDICTED: high molecular mass early light-inducible protein 
HV58, chloroplastic-like [Setaria italica]
Length=200

 Score =   117 bits (292),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 52/93 (56%), Positives = 74/93 (80%), Gaps = 1/93 (1%)
 Frame = +1

Query  253  LWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNG-GVTWFLGSTALLTL  429
            LWD  +FSGP PERINGRLAM+GF +A+ +E + GG L +Q  +G G+ WF  + A+L++
Sbjct  88   LWDALAFSGPAPERINGRLAMVGFVSALAVEASRGGGLLSQAGSGSGLAWFAATAAVLSV  147

Query  430  ASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            AS++PL +G +AE++S G+M+ADAE+WNGRFAM
Sbjct  148  ASLVPLLKGDSAEARSGGVMSADAELWNGRFAM  180



>dbj|BAJ90110.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ91617.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ91921.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=190

 Score =   116 bits (291),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 71/94 (76%), Gaps = 1/94 (1%)
 Frame = +1

Query  250  NLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNG-GVTWFLGSTALLT  426
            ++WD  +FSGP PERINGRLAM+GF AA+ +E A GG L  Q  +G G+ WFL +  LL+
Sbjct  77   SVWDALAFSGPAPERINGRLAMVGFVAALSVEAARGGGLLDQAGSGAGLGWFLVTAGLLS  136

Query  427  LASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            +AS++PL QG + ESKS G  +ADAE+WNGRFAM
Sbjct  137  VASLVPLLQGQSVESKSSGFWSADAELWNGRFAM  170



>ref|NP_001152683.1| early light-induced protein [Zea mays]
 gb|ACG48904.1| early light-induced protein [Zea mays]
Length=192

 Score =   116 bits (290),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 51/93 (55%), Positives = 73/93 (78%), Gaps = 1/93 (1%)
 Frame = +1

Query  253  LWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNG-GVTWFLGSTALLTL  429
            LWD  +FSGP PERINGRLAM+GF +A+ +E + GG L +Q  +G G+ WF  + A+L++
Sbjct  80   LWDALAFSGPAPERINGRLAMVGFVSALAVEASRGGGLLSQAGSGSGLAWFAATAAVLSV  139

Query  430  ASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            AS++PL +G +AE++S  +M+ADAE+WNGRFAM
Sbjct  140  ASLVPLLRGDSAEARSGAVMSADAELWNGRFAM  172



>ref|NP_001152927.1| early light-induced protein [Zea mays]
 gb|ACG25950.1| early light-induced protein [Zea mays]
Length=192

 Score =   116 bits (290),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 51/93 (55%), Positives = 73/93 (78%), Gaps = 1/93 (1%)
 Frame = +1

Query  253  LWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNG-GVTWFLGSTALLTL  429
            LWD  +FSGP PERINGRLAM+GF +A+ +E + GG L +Q  +G G+ WF  + A+L++
Sbjct  80   LWDALAFSGPAPERINGRLAMVGFVSALAVEASRGGGLLSQAGSGSGLAWFAATAAVLSV  139

Query  430  ASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            AS++PL +G +AE++S  +M+ADAE+WNGRFAM
Sbjct  140  ASLVPLLRGDSAEARSGAVMSADAELWNGRFAM  172



>ref|NP_001152703.1| early light-induced protein [Zea mays]
 gb|ACG49056.1| early light-induced protein [Zea mays]
Length=192

 Score =   116 bits (290),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 51/93 (55%), Positives = 73/93 (78%), Gaps = 1/93 (1%)
 Frame = +1

Query  253  LWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNG-GVTWFLGSTALLTL  429
            LWD  +FSGP PERINGRLAM+GF +A+ +E + GG L +Q  +G G+ WF  + A+L++
Sbjct  80   LWDALAFSGPAPERINGRLAMVGFVSALAVEASRGGGLLSQAGSGSGLAWFAATAAVLSV  139

Query  430  ASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            AS++PL +G +AE++S  +M+ADAE+WNGRFAM
Sbjct  140  ASLVPLLRGDSAEARSGAVMSADAELWNGRFAM  172



>gb|ACG24515.1| early light-induced protein [Zea mays]
Length=192

 Score =   116 bits (290),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 51/93 (55%), Positives = 73/93 (78%), Gaps = 1/93 (1%)
 Frame = +1

Query  253  LWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNG-GVTWFLGSTALLTL  429
            LWD  +FSGP PERINGRLAM+GF +A+ +E + GG L +Q  +G G+ WF  + A+L++
Sbjct  80   LWDALAFSGPAPERINGRLAMVGFVSALAVEASRGGGLLSQAGSGSGLAWFAATAAVLSV  139

Query  430  ASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            AS++PL +G +AE++S  +M+ADAE+WNGRFAM
Sbjct  140  ASLVPLLRGDSAEARSGAVMSADAELWNGRFAM  172



>ref|XP_004955633.1| PREDICTED: low molecular mass early light-inducible protein HV90, 
chloroplastic-like [Setaria italica]
Length=183

 Score =   115 bits (288),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 53/94 (56%), Positives = 69/94 (73%), Gaps = 1/94 (1%)
 Frame = +1

Query  250  NLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNG-GVTWFLGSTALLT  426
            ++WD  +FSGP PERINGRLAM+GF +A+ +E A G  L AQ+ NG G+TWF  +  +L+
Sbjct  70   SIWDTLAFSGPAPERINGRLAMVGFVSALAVEAARGDGLLAQVGNGAGLTWFAYTAVVLS  129

Query  427  LASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
             AS+ PL QG + E +S G MTADAE+WNGR AM
Sbjct  130  AASLAPLLQGESVEGRSGGFMTADAELWNGRLAM  163



>sp|P14895.1|ELI5_HORVU RecName: Full=High molecular mass early light-inducible protein 
HV58, chloroplastic; Short=ELIP; Flags: Precursor [Hordeum 
vulgare]
 emb|CAA33728.1| unnamed protein product [Hordeum vulgare subsp. vulgare]
Length=231

 Score =   116 bits (291),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 52/95 (55%), Positives = 71/95 (75%), Gaps = 2/95 (2%)
 Frame = +1

Query  250  NLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQIS--NGGVTWFLGSTALL  423
            ++WD  +FSGP PERINGRLAM+GF AA+ +E A GG L  Q+   + G+ WFL +  + 
Sbjct  117  SVWDALAFSGPAPERINGRLAMVGFVAALSVEAARGGGLLDQVGMWSSGLAWFLATAGVF  176

Query  424  TLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            ++AS++PL QG + ESKS G+ +ADAE+WNGRFAM
Sbjct  177  SVASLLPLLQGQSVESKSSGIWSADAELWNGRFAM  211



>ref|NP_001059030.1| Os07g0178800 [Oryza sativa Japonica Group]
 dbj|BAF20944.1| Os07g0178800 [Oryza sativa Japonica Group]
Length=192

 Score =   115 bits (287),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 52/93 (56%), Positives = 72/93 (77%), Gaps = 1/93 (1%)
 Frame = +1

Query  253  LWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNG-GVTWFLGSTALLTL  429
            LWDV +FSGP PERINGRLAM+GF +A+ +E + GG L  Q  +G G+ WF  +  +L+ 
Sbjct  80   LWDVLAFSGPAPERINGRLAMVGFVSALAVEASRGGGLLEQAGSGDGLAWFAATATVLSA  139

Query  430  ASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            AS++PL +G +AE++S G+M+ADAE+WNGRFAM
Sbjct  140  ASLVPLLRGESAEARSGGVMSADAELWNGRFAM  172



>dbj|BAD30330.1| putative low molecular mass early light-induced protein,chloroplast 
precursor (ELIP) [Oryza sativa Japonica Group]
 gb|EAZ38893.1| hypothetical protein OsJ_23312 [Oryza sativa Japonica Group]
Length=187

 Score =   115 bits (287),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 52/93 (56%), Positives = 72/93 (77%), Gaps = 1/93 (1%)
 Frame = +1

Query  253  LWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNG-GVTWFLGSTALLTL  429
            LWDV +FSGP PERINGRLAM+GF +A+ +E + GG L  Q  +G G+ WF  +  +L+ 
Sbjct  75   LWDVLAFSGPAPERINGRLAMVGFVSALAVEASRGGGLLEQAGSGDGLAWFAATATVLSA  134

Query  430  ASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            AS++PL +G +AE++S G+M+ADAE+WNGRFAM
Sbjct  135  ASLVPLLRGESAEARSGGVMSADAELWNGRFAM  167



>ref|XP_006379855.1| hypothetical protein POPTR_0008s15800g [Populus trichocarpa]
 ref|XP_006379856.1| hypothetical protein POPTR_0008s15800g [Populus trichocarpa]
 gb|ERP57652.1| hypothetical protein POPTR_0008s15800g [Populus trichocarpa]
 gb|ERP57653.1| hypothetical protein POPTR_0008s15800g [Populus trichocarpa]
Length=90

 Score =   111 bits (278),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 50/72 (69%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = +1

Query  313  MIGFAAAMGMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMT  492
            MIGF AAM +EL+ G DLF+QISNGGV+WF+G++ LL++AS++PLF+GV+AESKS G+MT
Sbjct  1    MIGFVAAMAVELSKGQDLFSQISNGGVSWFVGTSILLSVASLVPLFKGVSAESKSDGVMT  60

Query  493  ADAEIWNGRFAM  528
            +DAE+WNGRFAM
Sbjct  61   SDAEMWNGRFAM  72



>ref|XP_009622523.1| PREDICTED: early light-induced protein 2, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=200

 Score =   114 bits (286),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 70/91 (77%), Gaps = 1/91 (1%)
 Frame = +1

Query  259  DVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNGGVTWFLGSTALLTLASV  438
            D+F+FSGP  ERIN RLAMIGF AA G E  +G ++FAQ S+GG  WFLG++ALLTLAS+
Sbjct  92   DLFAFSGPALERINDRLAMIGFVAAFGTEFGDGANIFAQQSSGGFAWFLGTSALLTLASL  151

Query  439  IPLFQGVTAES-KSKGLMTADAEIWNGRFAM  528
            IPLFQ + AE   +  +++ DA+IWNGRF M
Sbjct  152  IPLFQAIRAEKGYTSVIVSVDAKIWNGRFVM  182



>ref|XP_009615000.1| PREDICTED: early light-induced protein 2, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=200

 Score =   114 bits (286),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 70/91 (77%), Gaps = 1/91 (1%)
 Frame = +1

Query  259  DVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNGGVTWFLGSTALLTLASV  438
            D+F+FSGP  ERIN RLAMIGF AA G E  +G ++FAQ S+GG  WFLG++ALLTLAS+
Sbjct  92   DLFAFSGPALERINDRLAMIGFVAAFGTEFGDGANIFAQQSSGGFAWFLGTSALLTLASL  151

Query  439  IPLFQGVTAES-KSKGLMTADAEIWNGRFAM  528
            IPLFQ + AE   +  +++ DA+IWNGRF M
Sbjct  152  IPLFQAIRAEKGYTSVIVSVDAKIWNGRFVM  182



>tpg|DAA42559.1| TPA: early light-induced protein [Zea mays]
Length=192

 Score =   113 bits (282),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 50/93 (54%), Positives = 73/93 (78%), Gaps = 1/93 (1%)
 Frame = +1

Query  253  LWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNG-GVTWFLGSTALLTL  429
            LWD  +FSGP PERINGRLAM+GF +A+ +E + GG L +Q  +G G+ WF  + A+L++
Sbjct  80   LWDALAFSGPAPERINGRLAMVGFVSALAVEASRGGGLLSQAGSGSGLAWFAATAAVLSV  139

Query  430  ASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            AS++PL +G +AE++S  +M+A+AE+WNGRFAM
Sbjct  140  ASLVPLLRGDSAEARSGAVMSANAELWNGRFAM  172



>ref|XP_004955634.1| PREDICTED: low molecular mass early light-inducible protein HV90, 
chloroplastic-like [Setaria italica]
Length=178

 Score =   112 bits (280),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/93 (57%), Positives = 66/93 (71%), Gaps = 1/93 (1%)
 Frame = +1

Query  253  LWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISN-GGVTWFLGSTALLTL  429
            LWD  +FSGP PERINGRLAM+GF +A+ +E A G  L AQ  N  G+TWF  +  +L+ 
Sbjct  66   LWDALAFSGPAPERINGRLAMVGFVSALAVEAARGDGLLAQAGNSAGLTWFAYTAIVLSA  125

Query  430  ASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            AS+ PL QG + E +S G MTADAE+WNGR AM
Sbjct  126  ASLAPLLQGESVEGRSGGFMTADAELWNGRLAM  158



>gb|AFP90187.1| early light-induced protein, partial [Pinus densata]
Length=120

 Score =   110 bits (275),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/93 (56%), Positives = 76/93 (82%), Gaps = 0/93 (0%)
 Frame = +1

Query  250  NLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNGGVTWFLGSTALLTL  429
            N  +VF+FSGP PE INGRLA++GF +A+ +E+A+G DL +Q+++GGV  F GS+ LLT 
Sbjct  18   NFKEVFAFSGPVPETINGRLAVLGFVSAIRVEIASGRDLISQLASGGVPLFSGSSLLLTF  77

Query  430  ASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            AS+IP+F+GV+ ESKS+ ++++ AE+ NGRFAM
Sbjct  78   ASLIPMFRGVSTESKSQEIISSGAEMSNGRFAM  110



>gb|EMT23518.1| hypothetical protein F775_14184 [Aegilops tauschii]
Length=230

 Score =   113 bits (282),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 53/94 (56%), Positives = 70/94 (74%), Gaps = 1/94 (1%)
 Frame = +1

Query  250  NLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNG-GVTWFLGSTALLT  426
            ++WD  +FSGP PERINGRLAM+GF AA+ +E A GG L  Q  +G G+ WFL +  + +
Sbjct  117  SVWDALAFSGPAPERINGRLAMVGFVAALTVEAARGGGLLDQAGSGVGLGWFLVTAGVFS  176

Query  427  LASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            +AS++PL QG + ESKS G  +ADAE+WNGRFAM
Sbjct  177  VASLVPLLQGQSVESKSSGFWSADAELWNGRFAM  210



>gb|EMS68027.1| hypothetical protein TRIUR3_23641 [Triticum urartu]
Length=188

 Score =   111 bits (277),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 51/94 (54%), Positives = 70/94 (74%), Gaps = 1/94 (1%)
 Frame = +1

Query  250  NLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNG-GVTWFLGSTALLT  426
            ++WD  +FSGP PERINGRLAM+GF AA+ +E A GG L  Q  +G G+ WFL +  + +
Sbjct  75   SVWDALAFSGPAPERINGRLAMVGFVAALSVEAARGGGLLDQAGSGAGLGWFLVTAGVFS  134

Query  427  LASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            +AS++PL QG + E+KS G+ + DAE+WNGRFAM
Sbjct  135  VASLVPLLQGQSVENKSSGVWSVDAELWNGRFAM  168



>ref|XP_003557498.1| PREDICTED: low molecular mass early light-inducible protein HV90, 
chloroplastic-like [Brachypodium distachyon]
Length=172

 Score =   110 bits (275),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 51/95 (54%), Positives = 73/95 (77%), Gaps = 2/95 (2%)
 Frame = +1

Query  250  NLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNG-GVTWFLGSTALLT  426
            ++WD+ SFSGP PERINGRLAM+GF  A+G+E   G  L +Q+ +G G  WF  + A+L+
Sbjct  58   SIWDILSFSGPAPERINGRLAMVGFVTALGVEAGRGDGLLSQLGSGTGQAWFAYTVAVLS  117

Query  427  LASVIPLFQGVTAESKSKG-LMTADAEIWNGRFAM  528
            +AS++PL QG +AE++  G +M+A+AE+WNGRFAM
Sbjct  118  VASLVPLLQGESAEARGAGKIMSANAELWNGRFAM  152



>ref|XP_002980561.1| LHC-related protein [Selaginella moellendorffii]
 gb|EFJ18212.1| LHC-related protein [Selaginella moellendorffii]
Length=197

 Score =   111 bits (277),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 70/164 (43%), Positives = 100/164 (61%), Gaps = 11/164 (7%)
 Frame = +1

Query  46   NRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEssttapkptpppspap  225
            +R+G S  V  SY    +R    + R+  E D+ +   T+PV +    A   TP  +P  
Sbjct  24   SRHGSSSIV--SY----RRIHPLVCRATKEGDSDQAAATSPVEKKVAAASPVTPIQTPPQ  77

Query  226  kvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNGGVTWFL  405
                ++  +  D+F+FSGP PE +NGRLAM+GF AA+G+ELA+G  L  Q+ NGG ++F+
Sbjct  78   PKKPEA--SFSDLFAFSGPVPEAVNGRLAMLGFTAALGVELASGRGLLGQLDNGGSSYFV  135

Query  406  GSTALLTLASVIPLFQGVTAESKSKGL---MTADAEIWNGRFAM  528
            G+  L TLAS++PLFQGV+ E  S G+    T+ AE WNGR AM
Sbjct  136  GAALLFTLASLVPLFQGVSIEKASGGIGGVFTSKAERWNGRAAM  179



>ref|XP_002976832.1| LHC-related protein [Selaginella moellendorffii]
 gb|EFJ21942.1| LHC-related protein [Selaginella moellendorffii]
Length=197

 Score =   110 bits (276),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 70/164 (43%), Positives = 99/164 (60%), Gaps = 11/164 (7%)
 Frame = +1

Query  46   NRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEssttapkptpppspap  225
            +R+G S  V  SY     R    + R+  E D+ +   T+PV +    A   TP  +P  
Sbjct  24   SRHGSSSIV--SY----SRIHPLVCRATKEGDSDQAAATSPVEKKVEAASPVTPIQTPPQ  77

Query  226  kvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNGGVTWFL  405
                ++  +  D+F+FSGP PE +NGRLAM+GF AA+G+ELA+G  L  Q+ NGG ++F+
Sbjct  78   PKKPET--SFLDLFAFSGPVPEAVNGRLAMLGFTAALGVELASGRGLLGQLDNGGSSYFV  135

Query  406  GSTALLTLASVIPLFQGVTAESKSKGL---MTADAEIWNGRFAM  528
            G+  L TLAS++PLFQGV+ E  S G+    T+ AE WNGR AM
Sbjct  136  GAALLFTLASLVPLFQGVSIEKASGGIGGVFTSKAERWNGRAAM  179



>ref|NP_001152179.1| early light-induced protein [Zea mays]
 gb|ACG46269.1| early light-induced protein [Zea mays]
Length=192

 Score =   110 bits (275),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 49/93 (53%), Positives = 72/93 (77%), Gaps = 1/93 (1%)
 Frame = +1

Query  253  LWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNG-GVTWFLGSTALLTL  429
            LWD  +FSGP PERINGRLAM+GF +A+ +E + GG L +Q  +G G+ WF  + A+L++
Sbjct  80   LWDALAFSGPAPERINGRLAMVGFVSALAVEASRGGGLLSQAGSGSGLAWFAATAAVLSV  139

Query  430  ASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            AS++PL +G +AE++S  +M+A+AE+WNGR AM
Sbjct  140  ASLVPLLRGDSAEARSGAVMSANAELWNGRXAM  172



>gb|EMS45625.1| hypothetical protein TRIUR3_10356 [Triticum urartu]
Length=167

 Score =   109 bits (273),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 50/94 (53%), Positives = 69/94 (73%), Gaps = 1/94 (1%)
 Frame = +1

Query  250  NLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNG-GVTWFLGSTALLT  426
            ++WD  +FSGP PERINGRLAM+GF  A+ +E   G  L +Q+ +G G  WF  S A+LT
Sbjct  56   SIWDALAFSGPAPERINGRLAMVGFVTALAVEAGRGDGLLSQLGSGTGQAWFAYSVAVLT  115

Query  427  LASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            +AS++PL QG +AE ++  +M A+AE+WNGRFAM
Sbjct  116  VASLVPLLQGESAEGRAGAIMNANAELWNGRFAM  149



>gb|EAY73277.1| hypothetical protein OsI_01151 [Oryza sativa Indica Group]
Length=202

 Score =   110 bits (275),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 73/94 (78%), Gaps = 1/94 (1%)
 Frame = +1

Query  250  NLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNG-GVTWFLGSTALLT  426
             LWDV +FSGP PERINGRLAM+GF +A+ +E + GG L  Q  +G G+ WF  + A+L+
Sbjct  89   KLWDVLAFSGPAPERINGRLAMVGFVSALAVEASRGGGLLDQAGSGSGLAWFAATAAVLS  148

Query  427  LASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
             AS++PL +G TAE++S G+M+ADAE+WNGRFAM
Sbjct  149  AASLVPLLRGETAEARSGGVMSADAELWNGRFAM  182



>gb|EMS65479.1| hypothetical protein TRIUR3_00475 [Triticum urartu]
Length=168

 Score =   109 bits (272),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 50/94 (53%), Positives = 70/94 (74%), Gaps = 1/94 (1%)
 Frame = +1

Query  250  NLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNG-GVTWFLGSTALLT  426
            ++WD  +FSGP PERINGRLAM+GF  A+ +E   G  L +Q+S+G G  WF  S A+L+
Sbjct  55   SIWDALAFSGPAPERINGRLAMVGFVTALAVEAGRGDGLLSQLSSGTGQAWFAYSVAVLS  114

Query  427  LASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            +AS++PL QG +AE ++  +M A+AE+WNGRFAM
Sbjct  115  VASLVPLLQGESAEGRAGTIMNANAELWNGRFAM  148



>gb|ACG27686.1| early light-induced protein [Zea mays]
 gb|ACG30109.1| early light-induced protein [Zea mays]
 gb|ACR36416.1| unknown [Zea mays]
 tpg|DAA59753.1| TPA: early light-induced protein [Zea mays]
Length=186

 Score =   109 bits (272),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 51/93 (55%), Positives = 67/93 (72%), Gaps = 1/93 (1%)
 Frame = +1

Query  253  LWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNG-GVTWFLGSTALLTL  429
            LWD  +FSGP PERINGRLAM+GF +A+ +E   G  + +Q  NG G+ WF  + A+L+ 
Sbjct  74   LWDALAFSGPAPERINGRLAMVGFVSALAVEATRGDGILSQAGNGAGLAWFAYTAAVLSA  133

Query  430  ASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            AS++PL QG +AE +S   MTADAE+WNGR AM
Sbjct  134  ASLVPLLQGESAEGRSGRFMTADAELWNGRLAM  166



>gb|ACG24151.1| early light-induced protein [Zea mays]
 gb|ACG26166.1| early light-induced protein [Zea mays]
Length=186

 Score =   109 bits (272),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 51/93 (55%), Positives = 67/93 (72%), Gaps = 1/93 (1%)
 Frame = +1

Query  253  LWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNG-GVTWFLGSTALLTL  429
            LWD  +FSGP PERINGRLAM+GF +A+ +E   G  + +Q  NG G+ WF  + A+L+ 
Sbjct  74   LWDALAFSGPAPERINGRLAMVGFVSALAVEATRGDGILSQAGNGAGLAWFAYTAAVLSA  133

Query  430  ASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            AS++PL QG +AE +S   MTADAE+WNGR AM
Sbjct  134  ASLVPLLQGESAEGRSGRFMTADAELWNGRLAM  166



>ref|XP_002461537.1| hypothetical protein SORBIDRAFT_02g004390 [Sorghum bicolor]
 gb|EER98058.1| hypothetical protein SORBIDRAFT_02g004390 [Sorghum bicolor]
Length=187

 Score =   109 bits (272),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 51/93 (55%), Positives = 66/93 (71%), Gaps = 1/93 (1%)
 Frame = +1

Query  253  LWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNG-GVTWFLGSTALLTL  429
             WD  +FSGP PERINGRLAM+GF +A+ +E   G  L +Q  NG G+ WF  +  +L+ 
Sbjct  75   FWDALAFSGPAPERINGRLAMVGFVSALAVEATRGDGLLSQAGNGAGLAWFAYTAVVLSA  134

Query  430  ASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            AS+ P+ QG +AES+S G MTADAE+WNGR AM
Sbjct  135  ASLAPVLQGESAESRSGGFMTADAELWNGRLAM  167



>ref|NP_001059029.1| Os07g0178700 [Oryza sativa Japonica Group]
 dbj|BAD30329.1| putative low molecular mass early light-induced protein,chloroplast 
precursor (ELIP) [Oryza sativa Japonica Group]
 dbj|BAF20943.1| Os07g0178700 [Oryza sativa Japonica Group]
 gb|EAZ02968.1| hypothetical protein OsI_25108 [Oryza sativa Indica Group]
 gb|EAZ38892.1| hypothetical protein OsJ_23311 [Oryza sativa Japonica Group]
Length=200

 Score =   109 bits (273),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 73/94 (78%), Gaps = 1/94 (1%)
 Frame = +1

Query  250  NLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQI-SNGGVTWFLGSTALLT  426
             LWDV +FSGP PERINGRLAM+GF +A+ +E + GG L  Q  S GG+ WF  + A+L+
Sbjct  87   GLWDVLAFSGPAPERINGRLAMVGFVSALAVEASRGGGLLEQAGSGGGLAWFAATAAVLS  146

Query  427  LASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
             AS++PL +G +AE++S G+M+ADAE+WNGRFAM
Sbjct  147  AASLVPLLRGESAEARSGGVMSADAELWNGRFAM  180



>ref|NP_001105051.1| early light-inducible protein ELIP [Zea mays]
 gb|AAK52823.1|AF365951_1 early light-inducible protein ELIP [Zea mays]
Length=182

 Score =   108 bits (270),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 49/92 (53%), Positives = 66/92 (72%), Gaps = 0/92 (0%)
 Frame = +1

Query  253  LWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNGGVTWFLGSTALLTLA  432
            LWD  +FSGP PERINGRLAM+GF +A+ +E   G  + +  +  G+ WF  + A+L+ A
Sbjct  71   LWDALAFSGPAPERINGRLAMVGFVSALAVEATRGDGILSPGNGAGLAWFAYTAAVLSAA  130

Query  433  SVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            S++PL QG +AE +S   MTADAE+WNGRFAM
Sbjct  131  SLVPLLQGESAEGRSGRFMTADAELWNGRFAM  162



>dbj|BAJ88670.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=172

 Score =   107 bits (268),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 48/94 (51%), Positives = 69/94 (73%), Gaps = 1/94 (1%)
 Frame = +1

Query  250  NLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNG-GVTWFLGSTALLT  426
            ++WD  +FSGP PERINGRLAM+GF  A+ +E   G  L +Q+ +G G  WF  + A+L+
Sbjct  59   SIWDAMAFSGPAPERINGRLAMVGFVTALAVEAGRGDGLLSQLGSGTGQAWFAYTVAVLS  118

Query  427  LASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            +AS++PL QG +AE ++  +M A+AE+WNGRFAM
Sbjct  119  MASLVPLLQGESAEGRAGAIMNANAELWNGRFAM  152



>gb|EAZ02969.1| hypothetical protein OsI_25109 [Oryza sativa Indica Group]
Length=187

 Score =   108 bits (269),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 53/93 (57%), Positives = 73/93 (78%), Gaps = 1/93 (1%)
 Frame = +1

Query  253  LWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNG-GVTWFLGSTALLTL  429
            LWDV +FSGP PERINGRLAM+GF +A+ +E + GG L  Q  +G G+ WF  + A+L+ 
Sbjct  75   LWDVLAFSGPAPERINGRLAMVGFVSALAVEASRGGGLLEQAGSGDGLAWFAATAAVLSA  134

Query  430  ASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            AS++PL +G +AE++S G+M+ADAE+WNGRFAM
Sbjct  135  ASLVPLLRGESAEARSGGVMSADAELWNGRFAM  167



>sp|P14896.1|ELI6_HORVU RecName: Full=Low molecular mass early light-inducible protein 
HV60, chloroplastic; Short=ELIP; Flags: Precursor [Hordeum 
vulgare]
 emb|CAA33726.1| unnamed protein product [Hordeum vulgare subsp. vulgare]
 dbj|BAK04255.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=167

 Score =   107 bits (268),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 48/94 (51%), Positives = 69/94 (73%), Gaps = 1/94 (1%)
 Frame = +1

Query  250  NLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNG-GVTWFLGSTALLT  426
            ++WD  +FSGP PERINGRLAM+GF  A+ +E   G  L +Q+ +G G  WF  + A+L+
Sbjct  54   SIWDAMAFSGPAPERINGRLAMVGFVTALAVEAGRGDGLLSQLGSGTGQAWFAYTVAMLS  113

Query  427  LASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            +AS++PL QG +AE ++  +M A+AE+WNGRFAM
Sbjct  114  MASLVPLLQGESAEGRAGAIMNANAELWNGRFAM  147



>dbj|BAJ86624.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ91978.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=173

 Score =   107 bits (268),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 48/94 (51%), Positives = 69/94 (73%), Gaps = 1/94 (1%)
 Frame = +1

Query  250  NLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNG-GVTWFLGSTALLT  426
            ++WD  +F+GP PERINGRLAM+GF  A+ +E   G  L +Q+ +G G  WF  S A+L+
Sbjct  60   SIWDALAFAGPAPERINGRLAMVGFVTALAVEAGRGDGLLSQLGSGTGQAWFAYSVAVLS  119

Query  427  LASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            +AS++PL QG +AE ++  +M A+AE+WNGRFAM
Sbjct  120  VASLVPLLQGESAEGRAGAIMNANAELWNGRFAM  153



>gb|EMS45333.1| hypothetical protein TRIUR3_35028 [Triticum urartu]
Length=232

 Score =   108 bits (271),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 50/94 (53%), Positives = 69/94 (73%), Gaps = 1/94 (1%)
 Frame = +1

Query  250  NLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNG-GVTWFLGSTALLT  426
            ++WD  +FSGP PERINGRLAM+GF  A+ +E   G  L +Q+ +G G  WF  S A+LT
Sbjct  119  SIWDALAFSGPAPERINGRLAMVGFVTALAVEAGRGDGLLSQLGSGTGQAWFAYSVAVLT  178

Query  427  LASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            +AS++PL QG +AE ++  +M A+AE+WNGRFAM
Sbjct  179  VASLVPLLQGESAEGRAGAIMNANAELWNGRFAM  212



>gb|ACI87755.1| putative early light-induced protein [Cupressus sempervirens]
Length=121

 Score =   105 bits (263),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 47/88 (53%), Positives = 72/88 (82%), Gaps = 0/88 (0%)
 Frame = +1

Query  259  DVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNGGVTWFLGSTALLTLASV  438
            D+F+FSGP PE INGR AM+GF +A+G+E+A+G DL +Q+++GG+ WF+ +  LLT AS+
Sbjct  14   DLFAFSGPVPEIINGRAAMLGFVSAIGVEVASGRDLLSQVNSGGLPWFVLTAGLLTAASL  73

Query  439  IPLFQGVTAESKSKGLMTADAEIWNGRF  522
            +PL +G++ ESKS+ + ++ AE+WNGRF
Sbjct  74   VPLSKGISTESKSQPIFSSSAEMWNGRF  101



>dbj|BAJ91644.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=172

 Score =   107 bits (267),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 48/94 (51%), Positives = 69/94 (73%), Gaps = 1/94 (1%)
 Frame = +1

Query  250  NLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNG-GVTWFLGSTALLT  426
            ++WD  +FSGP PERINGRLAM+GF  A+ +E   G  L +Q+ +G G  WF  + A+L+
Sbjct  59   SIWDAMAFSGPAPERINGRLAMVGFVTALAVEAGRGDGLLSQLGSGTGQAWFAYTVAVLS  118

Query  427  LASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  528
            +AS++PL QG +AE ++  +M A+AE+WNGRFAM
Sbjct  119  MASLVPLLQGESAEGRAGAIMNANAELWNGRFAM  152



Lambda      K        H        a         alpha
   0.318    0.133    0.392    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 559039970400