BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001O03

Length=544
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006353111.1|  PREDICTED: acetolactate synthase small subun...    171   4e-47   Solanum tuberosum [potatoes]
ref|XP_004251994.1|  PREDICTED: acetolactate synthase small subun...    164   2e-44   Solanum lycopersicum
ref|XP_009625351.1|  PREDICTED: acetolactate synthase small subun...    163   3e-44   Nicotiana tomentosiformis
ref|XP_009625350.1|  PREDICTED: acetolactate synthase small subun...    162   6e-44   Nicotiana tomentosiformis
ref|XP_009782836.1|  PREDICTED: acetolactate synthase small subun...    158   2e-42   Nicotiana sylvestris
ref|XP_009782832.1|  PREDICTED: acetolactate synthase small subun...    158   3e-42   Nicotiana sylvestris
gb|EYU17620.1|  hypothetical protein MIMGU_mgv1a005378mg                156   2e-41   Erythranthe guttata [common monkey flower]
gb|EYU36664.1|  hypothetical protein MIMGU_mgv1a005401mg                154   1e-40   Erythranthe guttata [common monkey flower]
ref|XP_002310395.2|  hypothetical protein POPTR_0007s00700g             153   2e-40   
dbj|BAH56811.1|  AT2G31810                                              148   4e-40   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011005277.1|  PREDICTED: acetolactate synthase small subun...    151   1e-39   Populus euphratica
ref|XP_007033634.1|  ACT domain-containing small subunit of aceto...    150   2e-39   
ref|XP_011047624.1|  PREDICTED: acetolactate synthase small subun...    150   2e-39   Populus euphratica
ref|XP_010242460.1|  PREDICTED: acetolactate synthase small subun...    149   4e-39   Nelumbo nucifera [Indian lotus]
ref|XP_002279286.1|  PREDICTED: acetolactate synthase small subun...    149   4e-39   Vitis vinifera
ref|XP_011085048.1|  PREDICTED: acetolactate synthase small subun...    149   8e-39   Sesamum indicum [beniseed]
ref|NP_850174.1|  ACT domain-containing small subunit of acetolac...    146   4e-38   Arabidopsis thaliana [mouse-ear cress]
emb|CAN67345.1|  hypothetical protein VITISV_030337                     140   5e-38   Vitis vinifera
ref|NP_850172.1|  ACT domain-containing small subunit of acetolac...    146   6e-38   Arabidopsis thaliana [mouse-ear cress]
gb|AAD32291.1|  putative acetolactate synthase                          146   6e-38   Arabidopsis thaliana [mouse-ear cress]
gb|KJB27748.1|  hypothetical protein B456_005G007600                    144   7e-38   Gossypium raimondii
ref|XP_009406425.1|  PREDICTED: acetolactate synthase small subun...    145   1e-37   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHG22544.1|  Acetolactate synthase small subunit                     145   1e-37   Gossypium arboreum [tree cotton]
ref|XP_011460628.1|  PREDICTED: acetolactate synthase small subun...    145   2e-37   Fragaria vesca subsp. vesca
ref|XP_010414082.1|  PREDICTED: acetolactate synthase small subun...    144   3e-37   Camelina sativa [gold-of-pleasure]
ref|XP_002529819.1|  acetolactate synthase, putative                    144   3e-37   Ricinus communis
ref|XP_008394267.1|  PREDICTED: acetolactate synthase small subun...    143   3e-37   
ref|XP_008367825.1|  PREDICTED: acetolactate synthase small subun...    144   3e-37   
gb|KJB27747.1|  hypothetical protein B456_005G007600                    144   3e-37   Gossypium raimondii
ref|XP_008394268.1|  PREDICTED: acetolactate synthase small subun...    143   3e-37   
ref|XP_007212091.1|  hypothetical protein PRUPE_ppa005063mg             144   4e-37   
ref|XP_002879344.1|  hypothetical protein ARALYDRAFT_482103             144   5e-37   
ref|XP_006446199.1|  hypothetical protein CICLE_v10015044mg             144   5e-37   Citrus clementina [clementine]
ref|XP_006446200.1|  hypothetical protein CICLE_v10015044mg             144   5e-37   
ref|XP_010070426.1|  PREDICTED: acetolactate synthase small subun...    144   5e-37   Eucalyptus grandis [rose gum]
gb|KCW59207.1|  hypothetical protein EUGRSUZ_H01869                     144   5e-37   Eucalyptus grandis [rose gum]
emb|CDY15367.1|  BnaC04g42560D                                          144   6e-37   Brassica napus [oilseed rape]
ref|XP_009141188.1|  PREDICTED: acetolactate synthase small subun...    143   6e-37   Brassica rapa
emb|CDY19107.1|  BnaA04g18470D                                          143   6e-37   Brassica napus [oilseed rape]
ref|XP_008394266.1|  PREDICTED: acetolactate synthase small subun...    143   8e-37   
emb|CDY34514.1|  BnaC04g12850D                                          143   8e-37   Brassica napus [oilseed rape]
ref|XP_008225227.1|  PREDICTED: acetolactate synthase small subun...    143   8e-37   Prunus mume [ume]
ref|XP_006410309.1|  hypothetical protein EUTSA_v10016569mg             143   9e-37   Eutrema salsugineum [saltwater cress]
ref|XP_010650733.1|  PREDICTED: acetolactate synthase small subun...    142   1e-36   Vitis vinifera
gb|KDP35124.1|  hypothetical protein JCGZ_10658                         142   1e-36   Jatropha curcas
ref|XP_008383971.1|  PREDICTED: acetolactate synthase small subun...    142   2e-36   
ref|XP_010510152.1|  PREDICTED: acetolactate synthase small subun...    142   2e-36   Camelina sativa [gold-of-pleasure]
ref|XP_008354318.1|  PREDICTED: acetolactate synthase small subun...    142   2e-36   
emb|CDX79442.1|  BnaC03g17780D                                          142   2e-36   
ref|XP_010557051.1|  PREDICTED: acetolactate synthase small subun...    142   2e-36   Tarenaya hassleriana [spider flower]
ref|XP_004157152.1|  PREDICTED: uncharacterized protein LOC101232287    135   2e-36   
emb|CDX84757.1|  BnaA03g14730D                                          142   2e-36   
ref|XP_009366239.1|  PREDICTED: acetolactate synthase small subun...    142   3e-36   Pyrus x bretschneideri [bai li]
ref|XP_004504413.1|  PREDICTED: acetolactate synthase small subun...    141   3e-36   
emb|CAX48742.1|  acetohydroxyacid synthase regulatory subunit 1 p...    141   3e-36   Eupatorium cannabinum [hemp agrimony]
ref|XP_009132818.1|  PREDICTED: acetolactate synthase small subun...    141   3e-36   Brassica rapa
ref|XP_004490063.1|  PREDICTED: acetolactate synthase small subun...    141   3e-36   Cicer arietinum [garbanzo]
emb|CDP08089.1|  unnamed protein product                                141   5e-36   Coffea canephora [robusta coffee]
gb|KGN66641.1|  hypothetical protein Csa_1G652240                       134   6e-36   Cucumis sativus [cucumbers]
ref|XP_004490062.1|  PREDICTED: acetolactate synthase small subun...    141   6e-36   
ref|XP_009144047.1|  PREDICTED: acetolactate synthase small subun...    140   7e-36   Brassica rapa
ref|XP_010039380.1|  PREDICTED: acetolactate synthase small subun...    139   9e-36   
emb|CDY42070.1|  BnaA05g11160D                                          140   9e-36   Brassica napus [oilseed rape]
ref|XP_009144045.1|  PREDICTED: acetolactate synthase small subun...    140   9e-36   Brassica rapa
ref|XP_006294093.1|  hypothetical protein CARUB_v10023086mg             140   1e-35   Capsella rubella
ref|XP_006470698.1|  PREDICTED: acetolactate synthase small subun...    140   1e-35   Citrus sinensis [apfelsine]
gb|KDO50434.1|  hypothetical protein CISIN_1g047033mg                   140   1e-35   Citrus sinensis [apfelsine]
ref|XP_007028127.1|  Valine-tolerant 1 isoform 2                        139   1e-35   
ref|XP_010469676.1|  PREDICTED: acetolactate synthase small subun...    140   1e-35   Camelina sativa [gold-of-pleasure]
ref|XP_002266924.2|  PREDICTED: acetolactate synthase small subun...    139   2e-35   Vitis vinifera
ref|XP_007201965.1|  hypothetical protein PRUPE_ppa004716mg             139   2e-35   Prunus persica
ref|XP_007028126.1|  ACT domain-containing small subunit of aceto...    139   3e-35   
ref|XP_009351614.1|  PREDICTED: acetolactate synthase small subun...    138   4e-35   Pyrus x bretschneideri [bai li]
gb|KDO77106.1|  hypothetical protein CISIN_1g0114911mg                  136   5e-35   Citrus sinensis [apfelsine]
gb|AFW62902.1|  LOW QUALITY PROTEIN: hypothetical protein ZEAMMB7...    134   5e-35   
ref|XP_003524233.1|  PREDICTED: acetolactate synthase small subun...    138   6e-35   Glycine max [soybeans]
dbj|BAH19535.1|  AT5G16290                                              137   8e-35   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003532793.1|  PREDICTED: acetolactate synthase small subun...    137   8e-35   Glycine max [soybeans]
ref|NP_197133.1|  acetolactate synthase small subunit 1                 137   8e-35   Arabidopsis thaliana [mouse-ear cress]
gb|KDO77103.1|  hypothetical protein CISIN_1g0114911mg                  136   9e-35   Citrus sinensis [apfelsine]
ref|XP_002871713.1|  hypothetical protein ARALYDRAFT_488480             137   1e-34   
ref|XP_007159564.1|  hypothetical protein PHAVU_002G248000g             137   1e-34   Phaseolus vulgaris [French bean]
gb|EMT17230.1|  Acetolactate synthase small subunit                     137   1e-34   
ref|XP_010469674.1|  PREDICTED: acetolactate synthase small subun...    137   1e-34   Camelina sativa [gold-of-pleasure]
gb|EEC67965.1|  hypothetical protein OsI_35716                          137   2e-34   Oryza sativa Indica Group [Indian rice]
gb|AAX96859.1|  acetolactate synthase, small subunit, putative          137   2e-34   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008243055.1|  PREDICTED: acetolactate synthase small subun...    136   2e-34   Prunus mume [ume]
ref|XP_006468633.1|  PREDICTED: acetolactate synthase small subun...    136   2e-34   Citrus sinensis [apfelsine]
ref|XP_011010159.1|  PREDICTED: acetolactate synthase small subun...    136   3e-34   Populus euphratica
ref|XP_010524340.1|  PREDICTED: acetolactate synthase small subun...    136   3e-34   Tarenaya hassleriana [spider flower]
ref|XP_006448524.1|  hypothetical protein CICLE_v10015040mg             136   3e-34   Citrus clementina [clementine]
ref|XP_003576101.1|  PREDICTED: acetolactate synthase small subun...    135   3e-34   Brachypodium distachyon [annual false brome]
ref|XP_002311270.2|  hypothetical protein POPTR_0008s07820g             135   4e-34   
ref|XP_006448525.1|  hypothetical protein CICLE_v10015040mg             135   4e-34   Citrus clementina [clementine]
gb|EPS72034.1|  hypothetical protein M569_02723                         134   5e-34   Genlisea aurea
gb|KGN49589.1|  hypothetical protein Csa_5G013280                       135   5e-34   Cucumis sativus [cucumbers]
ref|XP_008371723.1|  PREDICTED: acetolactate synthase small subun...    135   5e-34   
gb|KFK31180.1|  hypothetical protein AALP_AA6G079200                    135   6e-34   Arabis alpina [alpine rockcress]
gb|KHN48087.1|  Acetolactate synthase small subunit                     135   6e-34   Glycine soja [wild soybean]
ref|XP_008450270.1|  PREDICTED: acetolactate synthase small subun...    135   6e-34   Cucumis melo [Oriental melon]
gb|KFK31179.1|  hypothetical protein AALP_AA6G079200                    135   7e-34   Arabis alpina [alpine rockcress]
ref|XP_008450269.1|  PREDICTED: acetolactate synthase small subun...    135   7e-34   Cucumis melo [Oriental melon]
ref|XP_008383599.1|  PREDICTED: acetolactate synthase small subun...    135   7e-34   
emb|CAN61470.1|  hypothetical protein VITISV_043824                     134   8e-34   Vitis vinifera
ref|XP_009778724.1|  PREDICTED: acetolactate synthase small subun...    130   9e-34   Nicotiana sylvestris
ref|XP_004288733.1|  PREDICTED: acetolactate synthase small subun...    134   1e-33   Fragaria vesca subsp. vesca
ref|XP_004139096.1|  PREDICTED: uncharacterized protein LOC101208212    134   1e-33   Cucumis sativus [cucumbers]
ref|XP_008677344.1|  PREDICTED: acetolactate synthase/ amino acid...    134   1e-33   Zea mays [maize]
dbj|BAM75181.1|  B3-type transcription factor                           136   1e-33   Ricinus communis
ref|XP_009126106.1|  PREDICTED: acetolactate synthase small subun...    134   2e-33   Brassica rapa
emb|CDX85509.1|  BnaA02g03040D                                          134   2e-33   
ref|XP_006353245.1|  PREDICTED: acetolactate synthase small subun...    134   2e-33   Solanum tuberosum [potatoes]
ref|XP_008443657.1|  PREDICTED: acetolactate synthase small subun...    134   2e-33   Cucumis melo [Oriental melon]
ref|NP_001151166.1|  acetolactate synthase/ amino acid binding pr...    134   2e-33   Zea mays [maize]
ref|XP_004953051.1|  PREDICTED: acetolactate synthase small subun...    134   2e-33   Setaria italica
emb|CDY38123.1|  BnaC02g06500D                                          133   2e-33   Brassica napus [oilseed rape]
ref|XP_010672487.1|  PREDICTED: acetolactate synthase small subun...    134   2e-33   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003629945.1|  Acetolactate synthase small subunit                133   2e-33   Medicago truncatula
ref|XP_002452423.1|  hypothetical protein SORBIDRAFT_04g025560          134   2e-33   Sorghum bicolor [broomcorn]
ref|XP_008243054.1|  PREDICTED: acetolactate synthase small subun...    133   3e-33   Prunus mume [ume]
ref|XP_004159602.1|  PREDICTED: uncharacterized LOC101212902            132   3e-33   
gb|KHG18039.1|  Acetolactate synthase small subunit                     133   3e-33   Gossypium arboreum [tree cotton]
gb|KJB78878.1|  hypothetical protein B456_013G024000                    133   4e-33   Gossypium raimondii
ref|XP_006400166.1|  hypothetical protein EUTSA_v10016107mg             132   4e-33   Eutrema salsugineum [saltwater cress]
ref|XP_009352938.1|  PREDICTED: acetolactate synthase small subun...    132   4e-33   Pyrus x bretschneideri [bai li]
ref|XP_004149627.1|  PREDICTED: uncharacterized protein LOC101212902    132   5e-33   Cucumis sativus [cucumbers]
ref|XP_010109954.1|  hypothetical protein L484_011796                   132   6e-33   Morus notabilis
ref|XP_003572704.1|  PREDICTED: acetolactate synthase small subun...    132   7e-33   Brachypodium distachyon [annual false brome]
ref|XP_010453787.1|  PREDICTED: acetolactate synthase small subun...    132   7e-33   Camelina sativa [gold-of-pleasure]
ref|XP_008643958.1|  PREDICTED: uncharacterized protein LOC100381...    132   7e-33   Zea mays [maize]
tpg|DAA41907.1|  TPA: hypothetical protein ZEAMMB73_831035              132   9e-33   
ref|XP_006286862.1|  hypothetical protein CARUB_v10003921mg             132   9e-33   Capsella rubella
ref|NP_001146158.1|  uncharacterized protein LOC100279727               132   9e-33   Zea mays [maize]
dbj|BAJ92239.1|  predicted protein                                      132   1e-32   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMS53688.1|  Acetolactate synthase small subunit                     130   1e-32   Triticum urartu
gb|EMT12300.1|  Acetolactate synthase small subunit                     130   1e-32   
ref|XP_004250085.1|  PREDICTED: acetolactate synthase small subun...    131   2e-32   Solanum lycopersicum
ref|XP_006858758.1|  hypothetical protein AMTR_s00066p00141740          131   2e-32   Amborella trichopoda
ref|XP_010492512.1|  PREDICTED: acetolactate synthase small subun...    131   2e-32   Camelina sativa [gold-of-pleasure]
ref|XP_009604733.1|  PREDICTED: acetolactate synthase small subun...    130   2e-32   Nicotiana tomentosiformis
emb|CDP04139.1|  unnamed protein product                                130   2e-32   Coffea canephora [robusta coffee]
ref|XP_008349232.1|  PREDICTED: acetolactate synthase small subun...    130   2e-32   
ref|XP_011014725.1|  PREDICTED: acetolactate synthase small subun...    130   2e-32   Populus euphratica
ref|XP_002449227.1|  hypothetical protein SORBIDRAFT_05g006620          130   3e-32   Sorghum bicolor [broomcorn]
ref|XP_004504201.1|  PREDICTED: acetolactate synthase small subun...    130   3e-32   Cicer arietinum [garbanzo]
ref|XP_009404280.1|  PREDICTED: acetolactate synthase small subun...    130   3e-32   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006664907.1|  PREDICTED: acetolactate synthase small subun...    129   4e-32   Oryza brachyantha
gb|EYU39756.1|  hypothetical protein MIMGU_mgv1a005187mg                130   4e-32   Erythranthe guttata [common monkey flower]
ref|XP_009404279.1|  PREDICTED: acetolactate synthase small subun...    130   4e-32   Musa acuminata subsp. malaccensis [pisang utan]
gb|EAZ36982.1|  hypothetical protein OsJ_21322                          129   4e-32   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011014719.1|  PREDICTED: acetolactate synthase small subun...    129   4e-32   Populus euphratica
ref|XP_010420316.1|  PREDICTED: acetolactate synthase small subun...    129   6e-32   Camelina sativa [gold-of-pleasure]
ref|XP_011014695.1|  PREDICTED: acetolactate synthase small subun...    129   6e-32   Populus euphratica
ref|XP_011014712.1|  PREDICTED: acetolactate synthase small subun...    129   8e-32   Populus euphratica
ref|XP_010558579.1|  PREDICTED: acetolactate synthase small subun...    129   9e-32   Tarenaya hassleriana [spider flower]
ref|XP_006663345.1|  PREDICTED: acetolactate synthase small subun...    128   1e-31   
ref|XP_011084704.1|  PREDICTED: acetolactate synthase small subun...    128   2e-31   Sesamum indicum [beniseed]
ref|XP_011084705.1|  PREDICTED: acetolactate synthase small subun...    128   2e-31   Sesamum indicum [beniseed]
ref|XP_008667813.1|  PREDICTED: uncharacterized protein LOC100279...    127   3e-31   Zea mays [maize]
ref|XP_010911692.1|  PREDICTED: acetolactate synthase small subun...    124   4e-31   Elaeis guineensis
ref|XP_010673855.1|  PREDICTED: acetolactate synthase small subun...    127   6e-31   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008800993.1|  PREDICTED: acetolactate synthase small subun...    126   9e-31   Phoenix dactylifera
ref|XP_008800984.1|  PREDICTED: acetolactate synthase small subun...    126   9e-31   
ref|XP_002979412.1|  hypothetical protein SELMODRAFT_111081             125   9e-31   
ref|XP_002977907.1|  hypothetical protein SELMODRAFT_107328             125   1e-30   
ref|XP_001773408.1|  predicted protein                                  124   3e-30   
ref|XP_002316167.1|  hypothetical protein POPTR_0010s18560g             121   4e-29   
gb|KJB38012.1|  hypothetical protein B456_006G233200                    117   1e-28   Gossypium raimondii
ref|XP_010466593.1|  PREDICTED: acetolactate synthase small subun...    119   2e-28   Camelina sativa [gold-of-pleasure]
gb|AFK41430.1|  unknown                                                 119   2e-28   Lotus japonicus
gb|KJB38011.1|  hypothetical protein B456_006G233200                    117   3e-28   Gossypium raimondii
gb|KJB38010.1|  hypothetical protein B456_006G233200                    117   4e-28   Gossypium raimondii
ref|XP_006446198.1|  hypothetical protein CICLE_v10015044mg             115   6e-27   
ref|XP_002514772.1|  acetolactate synthase, putative                    115   1e-26   
gb|AAV65364.1|  plastid acetolactate synthase small subunit             108   8e-26   Prototheca wickerhamii
ref|XP_011400735.1|  Acetolactate synthase small subunit                110   5e-25   Auxenochlorella protothecoides
sp|Q9SMC2.1|ILVH_NICPL  RecName: Full=Acetolactate synthase small...    108   1e-24   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
gb|KCW46079.1|  hypothetical protein EUGRSUZ_L00052                     108   2e-24   Eucalyptus grandis [rose gum]
gb|KCW46078.1|  hypothetical protein EUGRSUZ_L00052                     108   2e-24   Eucalyptus grandis [rose gum]
gb|KCW46077.1|  hypothetical protein EUGRSUZ_L00052                     107   2e-24   Eucalyptus grandis [rose gum]
gb|KCW59209.1|  hypothetical protein EUGRSUZ_H01869                     107   2e-24   Eucalyptus grandis [rose gum]
ref|XP_010101349.1|  Acetolactate synthase small subunit                107   5e-24   
gb|KDO59634.1|  hypothetical protein CISIN_1g0181982mg                  104   1e-23   Citrus sinensis [apfelsine]
gb|KDO39820.1|  hypothetical protein CISIN_1g015044mg                   104   3e-23   Citrus sinensis [apfelsine]
ref|XP_006441155.1|  hypothetical protein CICLE_v10020491mg             104   3e-23   Citrus clementina [clementine]
ref|XP_009144046.1|  PREDICTED: acetolactate synthase small subun...    104   3e-23   
ref|XP_006491983.1|  PREDICTED: protease Do-like 1, chloroplastic...    104   3e-23   Citrus sinensis [apfelsine]
gb|ACN35790.1|  unknown                                               99.4    1e-22   Zea mays [maize]
gb|KDD76489.1|  hypothetical protein H632_c209p2                        101   9e-22   Helicosporidium sp. ATCC 50920
ref|XP_011464846.1|  PREDICTED: LOW QUALITY PROTEIN: acetolactate...  99.4    1e-21   Fragaria vesca subsp. vesca
ref|XP_001700185.1|  acetolactate synthase, small subunit             99.8    3e-21   Chlamydomonas reinhardtii
ref|XP_005648800.1|  acetolactate synthase                              100   5e-21   Coccomyxa subellipsoidea C-169
gb|EEE57346.1|  hypothetical protein OsJ_07472                        98.6    5e-21   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002948458.1|  hypothetical protein VOLCADRAFT_73781            98.6    1e-20   Volvox carteri f. nagariensis
ref|XP_005851575.1|  hypothetical protein CHLNCDRAFT_29593            97.1    1e-20   Chlorella variabilis
gb|EEC73569.1|  hypothetical protein OsI_08011                        98.6    1e-20   Oryza sativa Indica Group [Indian rice]
emb|CEF99544.1|  Acetolactate synthase, small subunit, C-terminal     97.4    3e-20   Ostreococcus tauri
ref|XP_003081855.1|  Acetolactate synthase, small subunit (ISS)       97.4    3e-20   
ref|XP_001420250.1|  predicted protein                                95.5    1e-19   Ostreococcus lucimarinus CCE9901
ref|XP_003061628.1|  predicted protein                                92.8    2e-18   Micromonas pusilla CCMP1545
ref|NP_850173.2|  ACT domain-containing small subunit of acetolac...  90.5    4e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010414083.1|  PREDICTED: acetolactate synthase small subun...  90.5    4e-18   
ref|XP_010557052.1|  PREDICTED: acetolactate synthase small subun...  90.1    6e-18   Tarenaya hassleriana [spider flower]
gb|KDO59632.1|  hypothetical protein CISIN_1g0414212mg                84.0    5e-17   Citrus sinensis [apfelsine]
ref|WP_013255317.1|  acetolactate synthase                            82.4    3e-16   Sediminispirochaeta smaragdinae
ref|WP_038653708.1|  acetolactate synthase                            81.3    7e-16   Prochlorococcus sp. MIT 0801
ref|WP_011294852.1|  acetolactate synthase                            81.3    7e-16   Prochlorococcus marinus
ref|WP_020613267.1|  acetolactate synthase                            80.9    1e-15   Sediminispirochaeta bajacaliforniensis
ref|WP_028952581.1|  acetolactate synthase                            80.9    2e-15   Synechococcus sp. CC9616
ref|WP_009631788.1|  acetolactate synthase, small subunit             80.1    2e-15   Synechocystis sp. PCC 7509
ref|WP_012598844.1|  acetolactate synthase                            80.1    3e-15   Cyanothece sp. PCC 7424
ref|WP_012195782.1|  acetolactate synthase                            80.1    3e-15   Prochlorococcus marinus
dbj|BAI88928.1|  acetolactate synthase III small subunit              80.1    3e-15   Arthrospira platensis NIES-39
gb|ABB17340.1|  acetolactate synthase                                 79.3    4e-15   Coleofasciculus chthonoplastes IPPAS B-270
ref|WP_026073042.1|  acetolactate synthase                            79.3    5e-15   Nodosilinea nodulosa
ref|WP_006453777.1|  acetolactate synthase                            79.3    5e-15   Synechococcus sp. PCC 7335
ref|WP_023066701.1|  acetolactate synthase, small subunit             79.0    6e-15   Lyngbya aestuarii
gb|AHF64430.1|  acetolactate synthase, small subunit                  79.0    6e-15   Synechococcus sp. WH 8109
ref|WP_019508465.1|  acetolactate synthase                            79.0    6e-15   Pleurocapsa sp. PCC 7319
ref|WP_027843130.1|  acetolactate synthase                            79.0    6e-15   Mastigocoleus testarum
ref|WP_035993822.1|  acetolactate synthase                            78.6    7e-15   Leptolyngbya sp. KIOST-1
ref|WP_011056724.1|  MULTISPECIES: acetolactate synthase              78.6    8e-15   Thermosynechococcus
emb|CBN54307.1|  acetolactate synthase 3 regulatory subunit [ [       79.0    8e-15   [Oscillatoria] sp. PCC 6506
ref|WP_038545989.1|  acetolactate synthase                            78.6    9e-15   Synechococcus sp. KORDI-100
ref|WP_035154634.1|  acetolactate synthase                            78.6    9e-15   Calothrix sp. 336/3
emb|CCI18700.1|  Acetolactate synthase small subunit                  78.6    1e-14   Microcystis aeruginosa PCC 9807
ref|WP_007098346.1|  acetolactate synthase                            78.6    1e-14   Synechococcus sp. RS9916
ref|WP_011618839.1|  acetolactate synthase                            78.6    1e-14   Synechococcus
gb|AFY41657.1|  acetolactate synthase, small subunit                  78.6    1e-14   Nostoc sp. PCC 7107
gb|EKV00810.1|  acetolactate synthase, small subunit                  78.6    1e-14   Leptolyngbya sp. PCC 7375
emb|CCI14937.1|  Acetolactate synthase small subunit                  78.6    1e-14   Microcystis aeruginosa PCC 9806
ref|WP_007100311.1|  acetolactate synthase                            78.2    1e-14   Synechococcus sp. RS9917
ref|WP_017660939.1|  acetolactate synthase                            78.2    1e-14   Geitlerinema sp. PCC 7105
ref|WP_011933543.1|  acetolactate synthase                            78.2    1e-14   Synechococcus sp. WH 7803
ref|WP_011376800.1|  acetolactate synthase                            78.2    1e-14   Prochlorococcus marinus
ref|WP_036020223.1|  acetolactate synthase                            78.2    1e-14   Leptolyngbya sp. PCC 7375
ref|WP_006041820.1|  acetolactate synthase                            77.8    1e-14   Synechococcus sp. WH 7805
ref|WP_015125829.1|  acetolactate synthase small subunit              77.8    1e-14   Synechococcus sp. PCC 6312
ref|WP_015227737.1|  acetolactate synthase small subunit              77.8    2e-14   Halothece sp. PCC 7418
ref|WP_017313402.1|  MULTISPECIES: acetolactate synthase              77.8    2e-14   Hapalosiphonaceae
ref|WP_016859689.1|  acetolactate synthase                            77.8    2e-14   Fischerella muscicola
ref|WP_015195236.1|  acetolactate synthase, small subunit             77.8    2e-14   Stanieria cyanosphaera
ref|WP_015189621.1|  acetolactate synthase, small subunit             77.8    2e-14   Gloeocapsa sp. PCC 7428
ref|WP_011127547.1|  acetolactate synthase                            77.8    2e-14   Synechococcus
ref|WP_011498832.1|  acetolactate synthase                            77.4    2e-14   Methanococcoides burtonii
ref|WP_013322899.1|  acetolactate synthase                            77.8    2e-14   Cyanothece sp. PCC 7822
ref|WP_011364939.1|  acetolactate synthase                            77.8    2e-14   Synechococcus
ref|WP_038553682.1|  acetolactate synthase                            77.8    2e-14   Synechococcus sp. KORDI-52
ref|WP_023076484.1|  acetolactate small subunit                       77.8    2e-14   Leptolyngbya sp. Heron Island J
ref|WP_018130638.1|  acetolactate synthase                            77.4    2e-14   Effusibacillus pohliae
ref|WP_025961335.1|  acetolactate synthase                            77.4    2e-14   
ref|WP_015205120.1|  acetolactate synthase small subunit              77.4    2e-14   Crinalium epipsammum
ref|WP_006852196.1|  acetolactate synthase                            77.4    2e-14   Synechococcus sp. WH 8016
ref|WP_028946400.1|  acetolactate synthase                            77.4    2e-14   Synechocystis sp. PCC 6714
gb|KCZ72887.1|  acetolactate synthase, small subunit                  77.4    2e-14   Candidatus Methanoperedens nitroreducens
ref|WP_011141136.1|  acetolactate synthase                            77.4    2e-14   Gloeobacter violaceus
dbj|BAM54375.1|  acetolactate synthase 3 regulatory subunit           77.4    2e-14   Bacillus subtilis BEST7613
ref|WP_015230978.1|  acetolactate synthase small subunit              77.4    2e-14   Dactylococcopsis salina
ref|WP_010873502.1|  acetolactate synthase                            77.4    2e-14   
emb|CCH67841.1|  Acetolactate synthase small subunit                  77.4    2e-14   Richelia intracellularis HH01
ref|WP_014407139.1|  acetolactate synthase                            77.0    3e-14   Synechocystis
ref|WP_044304865.1|  acetolactate synthase                            77.0    3e-14   Richelia intracellularis
ref|WP_036914369.1|  MULTISPECIES: acetolactate synthase              77.0    3e-14   Prochlorococcus
ref|WP_006277889.1|  acetolactate synthase                            77.0    3e-14   Cylindrospermopsis
ref|WP_006527479.1|  acetolactate synthase, small subunit             77.0    3e-14   Gloeocapsa sp. PCC 73106
ref|WP_015145546.1|  acetolactate synthase small subunit              77.0    3e-14   Pleurocapsales
ref|WP_028309200.1|  acetolactate synthase                            77.0    3e-14   Desulfitibacter alkalitolerans
ref|WP_044500522.1|  acetolactate synthase                            77.0    3e-14   Nostoc sp. PCC 7107
gb|EPZ66113.1|  acetolactate synthase small subunit ilvN              75.5    3e-14   Mycobacterium tuberculosis '98-R604 INH-RIF-EM'
ref|WP_015180717.1|  acetolactate synthase small subunit              77.0    3e-14   Microcoleus sp. PCC 7113
ref|WP_003927744.1|  acetolactate synthase                            77.0    3e-14   Mycolicibacterium thermoresistibile
gb|ACB49979.1|  acetolactate synthase small subunit                   77.0    4e-14   Cyanothece sp. ATCC 51142
ref|WP_043692189.1|  acetolactate synthase                            76.6    4e-14   Synechococcus sp. KORDI-49
ref|WP_017294692.1|  acetolactate synthase                            76.6    4e-14   Geminocystis herdmanii
ref|WP_027717595.1|  acetolactate synthase                            76.6    4e-14   Desulfovirgula thermocuniculi
ref|WP_011305258.1|  acetolactate synthase                            76.6    4e-14   Methanosarcina barkeri
ref|WP_006618438.1|  acetolactate synthase                            76.6    4e-14   Arthrospira platensis
ref|WP_009790304.1|  acetolactate synthase                            76.6    4e-14   Synechococcus sp. BL107
ref|WP_011825509.1|  acetolactate synthase                            76.6    4e-14   
ref|WP_017740695.1|  acetolactate synthase                            76.6    4e-14   
gb|KIE11579.1|  acetolactate synthase                                 76.6    4e-14   
ref|WP_009787902.1|  acetolactate synthase                            76.6    4e-14   
ref|WP_015051056.1|  acetolactate synthase                            76.6    4e-14   
ref|WP_011130547.1|  acetolactate synthase                            76.6    4e-14   
ref|WP_011611481.1|  acetolactate synthase                            76.6    4e-14   
gb|AFE14144.1|  acetolactate synthase 3 regulatory subunit            76.6    4e-14   
ref|WP_011936109.1|  acetolactate synthase                            76.6    5e-14   
ref|WP_015196808.1|  acetolactate synthase small subunit              76.6    5e-14   
dbj|BAB76326.1|  acetolactate synthase                                76.6    5e-14   
ref|WP_013897834.1|  acetolactate synthase                            76.3    5e-14   
ref|WP_041456726.1|  MULTISPECIES: acetolactate synthase              76.3    5e-14   
ref|WP_019487064.1|  MULTISPECIES: acetolactate synthase              76.3    5e-14   
ref|WP_037218077.1|  acetolactate synthase                            76.3    5e-14   
ref|WP_019867009.1|  acetolactate synthase                            76.3    5e-14   
ref|WP_006625441.1|  MULTISPECIES: acetolactate synthase              76.3    6e-14   
ref|WP_032518375.1|  acetolactate synthase                            76.3    6e-14   
gb|EAZ92294.1|  acetolactate synthase small subunit                   76.3    6e-14   
ref|WP_009342538.1|  acetolactate synthase                            76.3    6e-14   
ref|WP_010302742.1|  acetolactate synthase                            76.3    6e-14   
ref|WP_025930661.1|  acetolactate synthase                            76.3    6e-14   
ref|WP_012008031.1|  MULTISPECIES: acetolactate synthase              76.3    6e-14   
ref|WP_011818754.1|  MULTISPECIES: acetolactate synthase              76.3    6e-14   
ref|WP_026732404.1|  acetolactate synthase                            76.3    6e-14   
ref|WP_008188861.1|  acetolactate synthase                            76.3    6e-14   
ref|WP_012626204.1|  acetolactate synthase                            75.9    7e-14   
ref|WP_016875905.1|  acetolactate synthase                            75.9    7e-14   
ref|WP_033437557.1|  acetolactate synthase                            75.9    7e-14   
ref|WP_009547809.1|  MULTISPECIES: acetolactate synthase              75.9    7e-14   
ref|WP_015108799.1|  acetolactate synthase small subunit              76.3    7e-14   
ref|WP_036481766.1|  acetolactate synthase                            75.9    7e-14   
ref|WP_036902537.1|  acetolactate synthase                            75.9    7e-14   
ref|WP_015052687.1|  acetolactate synthase                            75.9    7e-14   
ref|WP_026786440.1|  MULTISPECIES: acetolactate synthase              75.9    7e-14   
ref|WP_015219133.1|  acetolactate synthase small subunit              75.9    7e-14   
ref|WP_034424029.1|  acetolactate synthase                            75.5    8e-14   
ref|WP_039887977.1|  acetolactate synthase                            75.9    8e-14   
ref|WP_041622928.1|  acetolactate synthase                            75.9    8e-14   
ref|WP_010315670.1|  acetolactate synthase                            75.9    8e-14   
ref|WP_039728011.1|  MULTISPECIES: acetolactate synthase              75.9    8e-14   
ref|WP_009756687.1|  MULTISPECIES: acetolactate synthase              75.9    8e-14   
ref|WP_015104554.1|  Acetolactate synthase small subunit              75.9    8e-14   
ref|WP_019474688.1|  acetolactate synthase                            75.9    8e-14   
ref|WP_013147330.1|  acetolactate synthase                            75.5    9e-14   
ref|WP_015171191.1|  acetolactate synthase small subunit              75.9    9e-14   
ref|WP_025738309.1|  acetolactate synthase                            75.5    9e-14   
ref|WP_035832248.1|  acetolactate synthase                            75.9    9e-14   
ref|WP_006508477.1|  acetolactate synthase, small subunit             75.9    9e-14   
ref|WP_016870148.1|  acetolactate synthase                            75.9    9e-14   
gb|AFZ05551.1|  acetolactate synthase, small subunit                  75.9    9e-14   
ref|WP_012408560.1|  acetolactate synthase                            75.5    9e-14   
gb|EGK83985.1|  acetolactate synthase, small subunit                  75.9    9e-14   
ref|WP_042685047.1|  acetolactate synthase                            75.5    9e-14   
ref|WP_017322778.1|  acetolactate synthase                            75.5    9e-14   
ref|WP_009767679.1|  acetolactate synthase, small subunit             75.9    9e-14   
ref|WP_030479767.1|  acetolactate synthase                            75.5    9e-14   
ref|WP_017793653.1|  acetolactate synthase                            75.5    1e-13   
ref|WP_030467896.1|  acetolactate synthase                            75.5    1e-13   
dbj|GAL94295.1|  acetolactate synthase small subunit                  75.5    1e-13   
ref|WP_028051312.1|  acetolactate synthase                            75.5    1e-13   
ref|WP_040931574.1|  acetolactate synthase                            75.5    1e-13   
ref|WP_015139015.1|  acetolactate synthase small subunit              75.5    1e-13   
ref|WP_002732118.1|  acetolactate synthase                            75.5    1e-13   
ref|WP_040935206.1|  acetolactate synthase                            75.5    1e-13   
ref|WP_002743360.1|  MULTISPECIES: acetolactate synthase              75.5    1e-13   
ref|WP_017715305.1|  acetolactate synthase                            75.5    1e-13   
ref|WP_039716657.1|  acetolactate synthase                            75.5    1e-13   
ref|WP_011343452.1|  acetolactate synthase                            75.5    1e-13   
ref|WP_008314262.1|  acetolactate synthase, small subunit             75.5    1e-13   
ref|WP_043999720.1|  acetolactate synthase                            75.5    1e-13   
ref|WP_017303099.1|  acetolactate synthase                            75.5    1e-13   
ref|WP_015164258.1|  acetolactate synthase small subunit              75.5    1e-13   
ref|WP_024971071.1|  acetolactate synthase                            75.5    1e-13   
ref|WP_005356988.1|  MULTISPECIES: acetolactate synthase              75.1    1e-13   
ref|WP_044510618.1|  acetolactate synthase                            75.1    1e-13   
ref|WP_026099569.1|  acetolactate synthase                            75.5    1e-13   
ref|WP_036920271.1|  acetolactate synthase                            75.1    1e-13   
ref|WP_015154365.1|  acetolactate synthase small subunit              75.1    1e-13   
ref|WP_036532119.1|  acetolactate synthase                            75.1    1e-13   
ref|WP_035798716.1|  acetolactate synthase                            75.1    1e-13   
ref|WP_017319158.1|  acetolactate synthase                            75.1    1e-13   
ref|WP_015146637.1|  acetolactate synthase small subunit              75.1    1e-13   
ref|WP_014257070.1|  acetolactate synthase [                          75.1    1e-13   
ref|NP_050708.1|  acetohydroxyacid synthase small subunit             75.1    1e-13   
ref|WP_019492237.1|  acetolactate synthase                            75.1    1e-13   
ref|WP_029955291.1|  acetolactate synthase                            75.1    1e-13   
ref|WP_018397129.1|  acetolactate synthase                            75.1    1e-13   
ref|WP_025939160.1|  acetolactate synthase                            75.1    1e-13   
ref|WP_017286074.1|  acetolactate synthase                            75.1    1e-13   
ref|NP_045137.1|  acetohydroxyacid synthase small subunit             75.1    2e-13   
ref|WP_024356226.1|  acetolactate synthase                            74.7    2e-13   
ref|WP_006171772.1|  acetolactate synthase                            75.1    2e-13   
ref|WP_015411261.1|  Acetolactate synthase small subunit              74.7    2e-13   
ref|WP_011032620.1|  acetolactate synthase                            74.7    2e-13   
ref|WP_017885123.1|  acetolactate synthase                            74.7    2e-13   
ref|WP_011876669.1|  acetolactate synthase                            74.7    2e-13   
ref|WP_011559307.1|  MULTISPECIES: acetolactate synthase              74.7    2e-13   
ref|WP_023882914.1|  acetolactate synthase                            72.8    2e-13   
ref|WP_041285150.1|  acetolactate synthase                            74.7    2e-13   
ref|WP_015083282.1|  acetolactate synthase small subunit              74.7    2e-13   
ref|WP_031650721.1|  acetolactate synthase                            74.7    2e-13   
gb|AGL00152.1|  acetolactate synthase, small subunit                  74.7    2e-13   
ref|WP_011132788.1|  acetolactate synthase                            74.7    2e-13   
ref|WP_025133213.1|  acetolactate synthase                            74.7    2e-13   
ref|WP_011023691.1|  acetolactate synthase                            74.3    2e-13   
ref|WP_006910483.1|  acetolactate synthase                            74.7    2e-13   
ref|WP_023846216.1|  acetolactate synthase, small subunit             74.3    2e-13   
ref|WP_022128648.1|  acetolactate synthase small subunit              74.3    2e-13   
ref|WP_011125403.1|  MULTISPECIES: acetolactate synthase              74.3    2e-13   
ref|WP_012282598.1|  acetolactate synthase                            74.3    2e-13   
ref|WP_031709230.1|  acetolactate synthase                            74.3    2e-13   
ref|WP_036896778.1|  acetolactate synthase                            74.3    2e-13   
gb|EFP33545.1|  acetolactate synthase small subunit ilvN              74.3    2e-13   
ref|WP_003415167.1|  MULTISPECIES: acetolactate synthase              74.3    2e-13   
ref|WP_015291113.1|  Acetolactate synthase III, thiamin-dependent...  74.3    2e-13   
ref|WP_008259035.1|  MULTISPECIES: acetolactate synthase              74.3    2e-13   
ref|WP_038435957.1|  acetolactate synthase                            74.3    3e-13   
ref|WP_003878744.1|  MULTISPECIES: acetolactate synthase              74.3    3e-13   
ref|WP_015926776.1|  acetolactate synthase [                          74.3    3e-13   
ref|WP_038537044.1|  MULTISPECIES: acetolactate synthase              74.3    3e-13   
ref|WP_003889211.1|  acetolactate synthase                            74.3    3e-13   
ref|WP_031697933.1|  acetolactate synthase                            74.3    3e-13   
ref|WP_036467934.1|  acetolactate synthase                            74.3    3e-13   
ref|WP_033726150.1|  acetolactate synthase                            74.3    3e-13   
ref|WP_042912741.1|  acetolactate synthase                            74.3    3e-13   
ref|WP_040196301.1|  acetolactate synthase                            74.3    3e-13   
ref|WP_033431530.1|  acetolactate synthase                            74.3    3e-13   
ref|WP_042333780.1|  acetolactate synthase                            73.9    3e-13   
ref|WP_023879636.1|  acetolactate synthase                            73.9    3e-13   
ref|WP_007171315.1|  acetolactate synthase                            73.9    3e-13   
ref|WP_006103562.1|  acetolactate synthase                            73.9    3e-13   
ref|WP_026256239.1|  acetolactate synthase                            73.9    3e-13   
ref|WP_011820626.1|  acetolactate synthase                            73.9    3e-13   
ref|YP_008144692.1|  acetolactate synthase small subunit              73.9    3e-13   
ref|YP_002327535.1|  acetolactate synthase small subunit              74.3    3e-13   
ref|WP_011359483.1|  acetolactate synthase                            73.9    3e-13   
ref|WP_042542404.1|  acetolactate synthase                            73.9    3e-13   
ref|WP_029017916.1|  acetolactate synthase                            73.9    3e-13   
ref|WP_007775537.1|  MULTISPECIES: acetolactate synthase              73.9    4e-13   
ref|WP_007304707.1|  acetolactate synthase                            73.9    4e-13   
gb|AIY89502.1|  Acetolactate synthase small subunit                   73.9    4e-13   
ref|WP_043564016.1|  acetolactate synthase                            73.9    4e-13   
ref|WP_019502773.1|  acetolactate synthase                            73.9    4e-13   
ref|WP_035996987.1|  acetolactate synthase                            73.9    4e-13   
gb|KGK97747.1|  acetolactate synthase                                 73.6    4e-13   
ref|WP_027403392.1|  acetolactate synthase                            73.9    4e-13   
ref|WP_015158120.1|  acetolactate synthase, small subunit             73.9    4e-13   
ref|WP_013497241.1|  acetolactate synthase                            73.6    4e-13   
ref|WP_013413135.1|  acetolactate synthase                            73.6    4e-13   
ref|WP_020025316.1|  MULTISPECIES: acetolactate synthase              73.6    4e-13   
ref|WP_020024702.1|  acetolactate synthase                            73.6    4e-13   
ref|WP_020027416.1|  acetolactate synthase                            73.6    4e-13   
gb|KIJ82940.1|  acetolactate synthase                                 73.9    4e-13   
ref|WP_012595734.1|  MULTISPECIES: acetolactate synthase              73.6    5e-13   
ref|WP_010681301.1|  acetolactate synthase                            73.6    5e-13   
ref|WP_015223783.1|  acetolactate synthase small subunit              73.6    5e-13   
ref|WP_036918354.1|  MULTISPECIES: acetolactate synthase              73.6    5e-13   
ref|WP_018938864.1|  MULTISPECIES: acetolactate synthase              73.6    5e-13   
ref|WP_022360840.1|  hypothetical protein                             73.6    5e-13   
ref|WP_015804712.1|  acetolactate synthase                            73.6    5e-13   
ref|WP_023372174.1|  acetolactate synthase                            73.6    5e-13   
ref|WP_031732398.1|  acetolactate synthase                            73.6    5e-13   
ref|WP_027356889.1|  acetolactate synthase                            73.6    5e-13   
ref|WP_003922119.1|  acetolactate synthase                            73.2    6e-13   
ref|WP_018946895.1|  MULTISPECIES: acetolactate synthase              73.2    6e-13   
ref|WP_013823910.1|  acetolactate synthase                            73.2    6e-13   
ref|YP_003002120.1|  acetolactate synthase small subunit              73.2    6e-13   
gb|EEC58015.1|  acetolactate synthase, small subunit [                73.2    6e-13   
ref|WP_021955892.1|  acetolactate synthase small subunit              73.2    6e-13   
gb|AIY46078.2|  Acetolactate synthase small subunit                   73.6    6e-13   
gb|KDE54705.1|  acetolactate synthase                                 73.2    6e-13   
ref|WP_036439402.1|  acetolactate synthase                            73.2    6e-13   
ref|WP_013074977.1|  acetolactate synthase                            73.2    6e-13   
ref|WP_014705193.1|  acetolactate synthase                            73.2    6e-13   
ref|WP_014868187.1|  acetolactate synthase                            73.2    6e-13   
gb|AJO68499.1|  acetohydroxyacid synthase small subunit               73.2    7e-13   
ref|WP_003513130.1|  acetolactate synthase                            73.2    7e-13   
ref|WP_003881154.1|  MULTISPECIES: acetolactate synthase              73.2    7e-13   
ref|WP_015359056.1|  MULTISPECIES: acetolactate synthase small su...  73.2    7e-13   
ref|WP_037545046.1|  acetolactate synthase                            73.6    7e-13   
ref|WP_028084672.1|  acetolactate synthase                            73.2    7e-13   
ref|WP_015213275.1|  acetolactate synthase, small subunit             73.2    7e-13   
ref|WP_004629443.1|  MULTISPECIES: acetolactate synthase, small s...  73.2    7e-13   
ref|WP_014707231.1|  acetolactate synthase                            73.2    7e-13   
ref|WP_041040884.1|  acetolactate synthase                            73.2    7e-13   
ref|WP_016950575.1|  acetolactate synthase                            73.2    7e-13   
ref|WP_021911420.1|  acetolactate synthase small subunit              72.8    7e-13   
ref|WP_019343133.1|  MULTISPECIES: acetolactate synthase              73.2    7e-13   
ref|WP_010908486.1|  acetolactate synthase                            73.2    7e-13   
ref|WP_027438132.1|  acetolactate synthase                            72.8    8e-13   
ref|WP_013190466.1|  acetolactate synthase                            73.2    8e-13   
ref|WP_015126609.1|  acetolactate synthase small subunit              73.2    8e-13   
ref|WP_013037303.1|  acetolactate synthase                            72.8    8e-13   
ref|WP_015209539.1|  acetolactate synthase, small subunit             72.8    8e-13   
ref|WP_015738272.1|  acetolactate synthase                            72.8    8e-13   
ref|WP_036411930.1|  acetolactate synthase                            72.8    8e-13   
ref|WP_029366053.1|  acetolactate synthase                            72.8    8e-13   
ref|WP_028587126.1|  acetolactate synthase                            72.8    9e-13   
ref|WP_027877472.1|  acetolactate synthase                            72.8    9e-13   
ref|WP_008292265.1|  acetolactate synthase                            72.8    9e-13   
ref|WP_036406804.1|  acetolactate synthase                            72.8    9e-13   
ref|WP_015325139.1|  acetolactate synthase, small subunit             72.8    9e-13   
ref|WP_017222762.1|  acetolactate synthase                            72.8    9e-13   
ref|WP_018205332.1|  MULTISPECIES: hypothetical protein               72.8    9e-13   
ref|WP_008410933.1|  putative acetolactate synthase small subunit     72.8    1e-12   
ref|WP_019624564.1|  MULTISPECIES: acetolactate synthase              72.8    1e-12   
ref|WP_019441678.1|  acetolactate synthase                            72.8    1e-12   
ref|WP_018863770.1|  acetolactate synthase                            72.8    1e-12   
ref|WP_038290690.1|  acetolactate synthase [                          72.8    1e-12   
ref|WP_012106997.1|  acetolactate synthase                            72.8    1e-12   
ref|WP_018941635.1|  acetolactate synthase                            72.4    1e-12   
ref|WP_040688882.1|  acetolactate synthase                            72.8    1e-12   
ref|WP_013289783.1|  acetolactate synthase                            72.8    1e-12   
ref|WP_012983148.1|  MULTISPECIES: acetolactate synthase              72.4    1e-12   
ref|WP_041587884.1|  acetolactate synthase                            72.4    1e-12   
ref|WP_025328160.1|  MULTISPECIES: acetolactate synthase 3 regula...  72.4    1e-12   
ref|WP_005341183.1|  acetolactate synthase                            72.4    1e-12   
ref|WP_017651464.1|  acetolactate synthase                            72.8    1e-12   
ref|WP_018138394.1|  MULTISPECIES: acetolactate synthase              72.4    1e-12   
ref|WP_003875005.1|  acetolactate synthase                            72.4    1e-12   
gb|ADG81247.1|  acetolactate synthase, small subunit                  72.8    1e-12   



>ref|XP_006353111.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic-like 
[Solanum tuberosum]
Length=481

 Score =   171 bits (433),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 96/151 (64%), Positives = 111/151 (74%), Gaps = 8/151 (5%)
 Frame = +1

Query  100  MAAISTHSTL---FQRLKPPCDDLSFSRKLGFCTASPNIHVGKPKKLSVVFANAADGQHK  270
            MAA+S+HST    F  L     +L FS+ +GF T+ PN  +   K L VV A  AD +H 
Sbjct  1    MAAVSSHSTFNRPFVSLYSSIPNLGFSQVVGFSTSKPNFTLSNSKTL-VVSAIRADEKH-  58

Query  271  APSEITLSTSDPAPPTPRQKVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNK  450
            A  + +++TSD    + R  VRRHTI VFVGDESGMINRIAGVFARRGYNIESLAVGLNK
Sbjct  59   ANEDHSVTTSDS---STRTNVRRHTIQVFVGDESGMINRIAGVFARRGYNIESLAVGLNK  115

Query  451  DKALFTIVVSGTEAVLQNVMEQLQKLVNVLK  543
            DKALFT+VVSGTE VLQ VMEQLQKLVNV+K
Sbjct  116  DKALFTVVVSGTERVLQQVMEQLQKLVNVIK  146


 Score = 67.8 bits (164),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 50/71 (70%), Gaps = 2/71 (3%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQN  504
            +R HT+S+ V D  G++N + GVFARRGYNI+SLAVG  + + L   T VV GT+  +  
Sbjct  309  LRSHTLSMLVNDSPGVLNIVTGVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESVSK  368

Query  505  VMEQLQKLVNV  537
            +++QL KLV++
Sbjct  369  LVQQLYKLVDI  379



>ref|XP_004251994.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic 
[Solanum lycopersicum]
Length=481

 Score =   164 bits (414),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 94/151 (62%), Positives = 109/151 (72%), Gaps = 8/151 (5%)
 Frame = +1

Query  100  MAAISTHSTLFQ---RLKPPCDDLSFSRKLGFCTASPNIHVGKPKKLSVVFANAADGQHK  270
            MAA+S+HSTL +    L      L F   + F T+ PN  +  PK + +V A  AD +H 
Sbjct  1    MAAVSSHSTLNRPSISLYSSISHLGFPHVVRFSTSKPNFTLSNPKTI-LVSAIKADEKH-  58

Query  271  APSEITLSTSDPAPPTPRQKVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNK  450
            A  + +++TSD +  T    VRRHTI VFVGDESGMINRIAGVFARRGYNIESLAVGLNK
Sbjct  59   ANEDHSVTTSDSSTVT---NVRRHTIQVFVGDESGMINRIAGVFARRGYNIESLAVGLNK  115

Query  451  DKALFTIVVSGTEAVLQNVMEQLQKLVNVLK  543
            DKALFTIVVSGTE VLQ VMEQLQKLVNV+K
Sbjct  116  DKALFTIVVSGTERVLQQVMEQLQKLVNVIK  146


 Score = 67.8 bits (164),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 50/71 (70%), Gaps = 2/71 (3%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQN  504
            +R HT+S+ V D  G++N + GVFARRGYNI+SLAVG  + + L   T VV GT+  +  
Sbjct  309  LRSHTLSMLVNDSPGVLNIVTGVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESVSK  368

Query  505  VMEQLQKLVNV  537
            +++QL KLV++
Sbjct  369  LVQQLYKLVDI  379



>ref|XP_009625351.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic-like 
isoform X2 [Nicotiana tomentosiformis]
Length=454

 Score =   163 bits (413),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 97/153 (63%), Positives = 110/153 (72%), Gaps = 10/153 (7%)
 Frame = +1

Query  100  MAAISTH--STL---FQRLKPPCDDLSFSRKLGFCTASPNIHVGKPKKLSVVFANAADGQ  264
            MAA+STH  S+L   F  L      L FS+ + F T  P   + KPK + V+ A  ADG 
Sbjct  1    MAAVSTHFNSSLNKPFLSLYFSIPHLGFSQVVQFPTLKPKFPLSKPKTV-VISATKADGT  59

Query  265  HKAPSEITLSTSDPAPPTPRQKVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGL  444
            + A  + +L+T D    + RQK RRHTI VFVGDESGMINRIAGVFARRGYNIESLAVGL
Sbjct  60   Y-ANEDDSLTTFDS---SIRQKTRRHTIQVFVGDESGMINRIAGVFARRGYNIESLAVGL  115

Query  445  NKDKALFTIVVSGTEAVLQNVMEQLQKLVNVLK  543
            NKDKALFTIVVSGTE VLQ VMEQLQKLVNV+K
Sbjct  116  NKDKALFTIVVSGTERVLQQVMEQLQKLVNVIK  148


 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 48/68 (71%), Gaps = 2/68 (3%)
 Frame = +1

Query  340  HTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQNVME  513
            HT+S+ V D  G++N + GVFARRGYNI+SLAVG  + + L   T VV GT+  +  +++
Sbjct  285  HTLSMLVNDTPGVLNIVTGVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESVSKLVQ  344

Query  514  QLQKLVNV  537
            QL KLV++
Sbjct  345  QLYKLVDI  352



>ref|XP_009625350.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic-like 
isoform X1 [Nicotiana tomentosiformis]
Length=483

 Score =   162 bits (411),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 97/153 (63%), Positives = 110/153 (72%), Gaps = 10/153 (7%)
 Frame = +1

Query  100  MAAISTH--STL---FQRLKPPCDDLSFSRKLGFCTASPNIHVGKPKKLSVVFANAADGQ  264
            MAA+STH  S+L   F  L      L FS+ + F T  P   + KPK + V+ A  ADG 
Sbjct  1    MAAVSTHFNSSLNKPFLSLYFSIPHLGFSQVVQFPTLKPKFPLSKPKTV-VISATKADGT  59

Query  265  HKAPSEITLSTSDPAPPTPRQKVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGL  444
            + A  + +L+T D    + RQK RRHTI VFVGDESGMINRIAGVFARRGYNIESLAVGL
Sbjct  60   Y-ANEDDSLTTFDS---SIRQKTRRHTIQVFVGDESGMINRIAGVFARRGYNIESLAVGL  115

Query  445  NKDKALFTIVVSGTEAVLQNVMEQLQKLVNVLK  543
            NKDKALFTIVVSGTE VLQ VMEQLQKLVNV+K
Sbjct  116  NKDKALFTIVVSGTERVLQQVMEQLQKLVNVIK  148


 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 48/68 (71%), Gaps = 2/68 (3%)
 Frame = +1

Query  340  HTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQNVME  513
            HT+S+ V D  G++N + GVFARRGYNI+SLAVG  + + L   T VV GT+  +  +++
Sbjct  314  HTLSMLVNDTPGVLNIVTGVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESVSKLVQ  373

Query  514  QLQKLVNV  537
            QL KLV++
Sbjct  374  QLYKLVDI  381



>ref|XP_009782836.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic-like 
isoform X2 [Nicotiana sylvestris]
Length=454

 Score =   158 bits (400),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 95/153 (62%), Positives = 108/153 (71%), Gaps = 10/153 (7%)
 Frame = +1

Query  100  MAAIST--HSTL---FQRLKPPCDDLSFSRKLGFCTASPNIHVGKPKKLSVVFANAADGQ  264
            MAA+ST  +S+L   F  L      L FS+ + F T  P   +  PK + V+ A  ADG 
Sbjct  1    MAAVSTPFNSSLNKPFLSLYSSIPHLGFSQVVQFPTLKPKFLLSNPKTV-VISATKADGT  59

Query  265  HKAPSEITLSTSDPAPPTPRQKVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGL  444
              A  + +L+T D    + RQK RRHTI VFVGDESGMINRIAGVFARRGYNIESLAVGL
Sbjct  60   F-ANEDNSLTTFDS---SIRQKTRRHTIQVFVGDESGMINRIAGVFARRGYNIESLAVGL  115

Query  445  NKDKALFTIVVSGTEAVLQNVMEQLQKLVNVLK  543
            NKDKALFTIVVSGTE VLQ VMEQLQKLVNV+K
Sbjct  116  NKDKALFTIVVSGTERVLQQVMEQLQKLVNVIK  148


 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 50/71 (70%), Gaps = 2/71 (3%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQN  504
            +R HT+S+ V D  G++N + GVFARRGYNI+SLAVG  + + L   T VV GT+  +  
Sbjct  282  LRSHTLSMLVNDTPGVLNIVTGVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESVSK  341

Query  505  VMEQLQKLVNV  537
            +++QL KLV++
Sbjct  342  LVQQLYKLVDI  352



>ref|XP_009782832.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic-like 
isoform X1 [Nicotiana sylvestris]
Length=483

 Score =   158 bits (400),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 95/153 (62%), Positives = 108/153 (71%), Gaps = 10/153 (7%)
 Frame = +1

Query  100  MAAIST--HSTL---FQRLKPPCDDLSFSRKLGFCTASPNIHVGKPKKLSVVFANAADGQ  264
            MAA+ST  +S+L   F  L      L FS+ + F T  P   +  PK + V+ A  ADG 
Sbjct  1    MAAVSTPFNSSLNKPFLSLYSSIPHLGFSQVVQFPTLKPKFLLSNPKTV-VISATKADGT  59

Query  265  HKAPSEITLSTSDPAPPTPRQKVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGL  444
              A  + +L+T D    + RQK RRHTI VFVGDESGMINRIAGVFARRGYNIESLAVGL
Sbjct  60   F-ANEDNSLTTFDS---SIRQKTRRHTIQVFVGDESGMINRIAGVFARRGYNIESLAVGL  115

Query  445  NKDKALFTIVVSGTEAVLQNVMEQLQKLVNVLK  543
            NKDKALFTIVVSGTE VLQ VMEQLQKLVNV+K
Sbjct  116  NKDKALFTIVVSGTERVLQQVMEQLQKLVNVIK  148


 Score = 67.8 bits (164),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 50/71 (70%), Gaps = 2/71 (3%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQN  504
            +R HT+S+ V D  G++N + GVFARRGYNI+SLAVG  + + L   T VV GT+  +  
Sbjct  311  LRSHTLSMLVNDTPGVLNIVTGVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESVSK  370

Query  505  VMEQLQKLVNV  537
            +++QL KLV++
Sbjct  371  LVQQLYKLVDI  381



>gb|EYU17620.1| hypothetical protein MIMGU_mgv1a005378mg [Erythranthe guttata]
Length=486

 Score =   156 bits (394),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 89/155 (57%), Positives = 106/155 (68%), Gaps = 11/155 (7%)
 Frame = +1

Query  100  MAAISTHSTLFQRLKPPCDDLSFSRKLGFCTASPNIHVGKPKKLSVVFANAADGQHKAPS  279
            MAA++TH+TLF R     +DL     + F +   + +    K+   V A +A+G  +  +
Sbjct  1    MAAVATHATLF-RASTRSNDLIPKSDITFSSVKFSSYT---KRRVAVCAQSANGDSRQQN  56

Query  280  EITLSTSDPAPPTP-------RQKVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAV  438
            +  +S SD  P          R KV+RH ISVFVGDESGMINRIAGVFARRGYNIESLAV
Sbjct  57   DAVVSVSDSHPSAAATTNSAARSKVKRHAISVFVGDESGMINRIAGVFARRGYNIESLAV  116

Query  439  GLNKDKALFTIVVSGTEAVLQNVMEQLQKLVNVLK  543
            GLNKDKALFTIVVSGTE VL +VMEQLQKLVNVLK
Sbjct  117  GLNKDKALFTIVVSGTERVLHHVMEQLQKLVNVLK  151


 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 49/68 (72%), Gaps = 2/68 (3%)
 Frame = +1

Query  340  HTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQNVME  513
            HT+S+ V D  G++N + GVFARRGYNI+SLAVG ++ + L   T VV GT+  +  +++
Sbjct  317  HTLSMVVNDVPGVLNLVTGVFARRGYNIQSLAVGHSEVEGLSRITTVVPGTDESIGKLVQ  376

Query  514  QLQKLVNV  537
            QL KLV++
Sbjct  377  QLYKLVDL  384



>gb|EYU36664.1| hypothetical protein MIMGU_mgv1a005401mg [Erythranthe guttata]
Length=485

 Score =   154 bits (388),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 90/158 (57%), Positives = 103/158 (65%), Gaps = 17/158 (11%)
 Frame = +1

Query  100  MAAISTHSTLFQRLKPPCDDLSFSRKLGFCT----ASPNIHVGKPKKLSVVFANAADGQH  267
            MAA+STHSTLF  LK   + +  S     C+    +SPN  V        V   + D  H
Sbjct  1    MAAVSTHSTLFHELKTSRNLVHKSDVSSLCSVKFRSSPNRGVA-------VCPQSTDDDH  53

Query  268  KAPSEITLSTSDPAPPTPRQ------KVRRHTISVFVGDESGMINRIAGVFARRGYNIES  429
            K   +  LS  + +            KV+RHT+SVFVGDESGMINRIAGVFARRGYNIES
Sbjct  54   KRHDDAVLSVPESSFTASAASSSADPKVKRHTVSVFVGDESGMINRIAGVFARRGYNIES  113

Query  430  LAVGLNKDKALFTIVVSGTEAVLQNVMEQLQKLVNVLK  543
            LAVGLNKDKALFTIVVSGTE V+Q VMEQL+KLVNVLK
Sbjct  114  LAVGLNKDKALFTIVVSGTEKVIQQVMEQLKKLVNVLK  151


 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 48/68 (71%), Gaps = 2/68 (3%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQN  504
            +R HT+S+ V D  G++N + GVFARRGYNI+SLAVG  + + L   T VV GT+  +  
Sbjct  313  LRSHTLSMLVNDAPGVLNLVTGVFARRGYNIQSLAVGHAEIEGLSRITTVVPGTDESISK  372

Query  505  VMEQLQKL  528
            +++QL+KL
Sbjct  373  LLQQLRKL  380



>ref|XP_002310395.2| hypothetical protein POPTR_0007s00700g [Populus trichocarpa]
 gb|EEE90845.2| hypothetical protein POPTR_0007s00700g [Populus trichocarpa]
Length=490

 Score =   153 bits (387),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 86/128 (67%), Positives = 92/128 (72%), Gaps = 7/128 (5%)
 Frame = +1

Query  160  LSFSRKLGFCTASPNIHVGKPKKLSVVFANAADGQHKAPSEITLSTSDPAPPTPRQKVRR  339
            L FS+ L   T    I      KL V   N  D      ++ TLST+  AP T R K RR
Sbjct  32   LGFSKAL--ATTPLTISKSYQNKLRVSATNDND-----IADTTLSTNGSAPSTARSKARR  84

Query  340  HTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTEAVLQNVMEQL  519
            HTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKA+FTIVVSGTE VLQ V+EQL
Sbjct  85   HTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAMFTIVVSGTERVLQQVVEQL  144

Query  520  QKLVNVLK  543
            QKLVNVLK
Sbjct  145  QKLVNVLK  152


 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 49/71 (69%), Gaps = 2/71 (3%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQN  504
            ++ HT+S+ V D  G++N + GVFARRGYNI+SLAVG  + + L   T VV GT+  +  
Sbjct  318  LQSHTLSLLVNDHPGVLNIVTGVFARRGYNIQSLAVGHAETEGLSRITTVVPGTDESITK  377

Query  505  VMEQLQKLVNV  537
            +++QL KLV +
Sbjct  378  LVQQLYKLVEI  388



>dbj|BAH56811.1| AT2G31810 [Arabidopsis thaliana]
Length=264

 Score =   148 bits (373),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 87/159 (55%), Positives = 103/159 (65%), Gaps = 16/159 (10%)
 Frame = +1

Query  100  MAAISTHSTLFQR-LKPPCDD----------LSFSRKLGFCTASPNIHVGKPKKLSVVFA  246
            MAAIS  S+   R L+  C D          +SF  K+ + +   +    +  K    F 
Sbjct  1    MAAISVSSSPSIRCLRSACSDSSPALVSSTRVSFPAKISYLSGISSHRGDEMGKRMEGFV  60

Query  247  NAADGQHKAPSEITLSTSDPAPPTPRQKVRRHTISVFVGDESGMINRIAGVFARRGYNIE  426
             + DG+    S      S+ +  TP+ KVR+HTISVFVGDESGMINRIAGVFARRGYNIE
Sbjct  61   RSVDGKISDAS-----FSEASSATPKSKVRKHTISVFVGDESGMINRIAGVFARRGYNIE  115

Query  427  SLAVGLNKDKALFTIVVSGTEAVLQNVMEQLQKLVNVLK  543
            SLAVGLN+DKALFTIVV GTE VLQ V+EQLQKLVNVLK
Sbjct  116  SLAVGLNRDKALFTIVVCGTERVLQQVIEQLQKLVNVLK  154



>ref|XP_011005277.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like, 
partial [Populus euphratica]
Length=475

 Score =   151 bits (381),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 85/128 (66%), Positives = 91/128 (71%), Gaps = 7/128 (5%)
 Frame = +1

Query  160  LSFSRKLGFCTASPNIHVGKPKKLSVVFANAADGQHKAPSEITLSTSDPAPPTPRQKVRR  339
            L FS+ L   T    I      KL V   N  D      ++  LST+  AP T R K RR
Sbjct  20   LCFSKAL--ATTPLTISKSYQNKLRVSATNDND-----IADTALSTNGSAPSTARSKARR  72

Query  340  HTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTEAVLQNVMEQL  519
            HTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKA+FTIVVSGTE VLQ V+EQL
Sbjct  73   HTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAIFTIVVSGTERVLQQVVEQL  132

Query  520  QKLVNVLK  543
            QKLVNVLK
Sbjct  133  QKLVNVLK  140


 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 49/71 (69%), Gaps = 2/71 (3%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQN  504
            ++ HT+S+ V D  G++N + GVFARRGYNI+SLAVG  + + L   T VV GT+  +  
Sbjct  303  LQSHTLSLLVNDHPGVLNIVTGVFARRGYNIQSLAVGHAETEGLSRITTVVPGTDESITK  362

Query  505  VMEQLQKLVNV  537
            +++QL KLV +
Sbjct  363  LVQQLYKLVEI  373



>ref|XP_007033634.1| ACT domain-containing small subunit of acetolactate synthase 
protein [Theobroma cacao]
 gb|EOY04560.1| ACT domain-containing small subunit of acetolactate synthase 
protein [Theobroma cacao]
Length=478

 Score =   150 bits (379),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 94/153 (61%), Positives = 104/153 (68%), Gaps = 15/153 (10%)
 Frame = +1

Query  100  MAAISTHSTLFQRLKPPCDD----LSFSRKLGFCTASPNIHVGKPKKLSVVFANAADGQH  267
            MAA+ST        KP  D     + F  ++G   +    HV  P+KL V+   + D   
Sbjct  1    MAALSTPHLPIHCSKPESDSAWKAICFPARIGRSIS----HV--PRKL-VLSPRSVD---  50

Query  268  KAPSEITLSTSDPAPPTP-RQKVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGL  444
            K  S  T S + P P TP R KVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGL
Sbjct  51   KKISNNTFSANGPVPSTPTRSKVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGL  110

Query  445  NKDKALFTIVVSGTEAVLQNVMEQLQKLVNVLK  543
            NKDKALFTIVVSGTE VLQ V+EQLQKLVNV K
Sbjct  111  NKDKALFTIVVSGTERVLQQVVEQLQKLVNVWK  143


 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 48/68 (71%), Gaps = 2/68 (3%)
 Frame = +1

Query  340  HTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQNVME  513
            HT+S+ V D  G++N + GVFARRGYNI+SLAVG  + + L   T VV GT+  +  +++
Sbjct  309  HTLSMLVNDSPGVLNIVTGVFARRGYNIQSLAVGHAETEGLSRITTVVPGTDESISKLVQ  368

Query  514  QLQKLVNV  537
            QL KLV++
Sbjct  369  QLYKLVDL  376



>ref|XP_011047624.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like 
[Populus euphratica]
Length=521

 Score =   150 bits (380),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 85/128 (66%), Positives = 91/128 (71%), Gaps = 7/128 (5%)
 Frame = +1

Query  160  LSFSRKLGFCTASPNIHVGKPKKLSVVFANAADGQHKAPSEITLSTSDPAPPTPRQKVRR  339
            L FS+ L   T    I      KL V   N  D      ++  LST+  AP T R K RR
Sbjct  66   LGFSKAL--ATTPLTISKSYQNKLRVSATNDND-----IADTALSTNGSAPSTARSKARR  118

Query  340  HTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTEAVLQNVMEQL  519
            HTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKA+FTIVVSGTE VLQ V+EQL
Sbjct  119  HTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAIFTIVVSGTERVLQQVVEQL  178

Query  520  QKLVNVLK  543
            QKLVNVLK
Sbjct  179  QKLVNVLK  186


 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 49/71 (69%), Gaps = 2/71 (3%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQN  504
            ++ HT+S+ V D  G++N + GVFARRGYNI+SLAVG  + + L   T VV GT+  +  
Sbjct  349  LQSHTLSLLVNDHPGVLNIVTGVFARRGYNIQSLAVGHAETEGLSRITTVVPGTDESITK  408

Query  505  VMEQLQKLVNV  537
            +++QL KLV +
Sbjct  409  LVQQLYKLVEI  419



>ref|XP_010242460.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like 
[Nelumbo nucifera]
Length=482

 Score =   149 bits (377),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 89/153 (58%), Positives = 104/153 (68%), Gaps = 10/153 (7%)
 Frame = +1

Query  100  MAAISTHSTLFQRLKPPCDDL----SFSRKLGFCTASPNIHVGKPKKLSV-VFANAADGQ  264
            MAA+S     F   KP C ++    SFSR L F   + ++   K ++  +     +A G+
Sbjct  1    MAALSVQPVRFNTTKP-CSEVGCNRSFSRTLDFPRTAFDL-TSKSRRFELRKLEVSASGE  58

Query  265  HKAPSEITLSTSDPAPPTPRQKVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGL  444
                +   L  S  AP + R KVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGL
Sbjct  59   SSIGA---LPVSQSAPSSARSKVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGL  115

Query  445  NKDKALFTIVVSGTEAVLQNVMEQLQKLVNVLK  543
            NKD+ALFTIVVSGTE VLQ V+EQL KLVNVLK
Sbjct  116  NKDRALFTIVVSGTERVLQQVVEQLLKLVNVLK  148


 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 50/71 (70%), Gaps = 2/71 (3%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQN  504
            +R HT+S+ V D  G++N + GVFARRGYNI+SLAVG  + + +   T VV GT+  +  
Sbjct  310  LRSHTLSMLVSDSPGVLNLVTGVFARRGYNIQSLAVGPAEKEGISRITTVVPGTDESIGK  369

Query  505  VMEQLQKLVNV  537
            +++QL KL+N+
Sbjct  370  LVQQLYKLINI  380



>ref|XP_002279286.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic 
isoform X1 [Vitis vinifera]
 emb|CBI24729.3| unnamed protein product [Vitis vinifera]
Length=482

 Score =   149 bits (377),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 82/128 (64%), Positives = 94/128 (73%), Gaps = 2/128 (2%)
 Frame = +1

Query  160  LSFSRKLGFCTASPNIHVGKPKKLSVVFANAADGQHKAPSEITLSTSDPAPPTPRQKVRR  339
            L FSR L        +   +  KL V  ++A +G     ++ T + ++PAP   R KVRR
Sbjct  20   LGFSRALWLSLPISKLKNPQLGKLVVSASSAENGV--GFNDKTAAVANPAPSAARSKVRR  77

Query  340  HTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTEAVLQNVMEQL  519
            HTISVFVGDESGMINRIAGVFARRGYNI+SLAVGLNKDKALFTIVVSGTE VLQ V+EQL
Sbjct  78   HTISVFVGDESGMINRIAGVFARRGYNIDSLAVGLNKDKALFTIVVSGTERVLQQVVEQL  137

Query  520  QKLVNVLK  543
             KLVNVLK
Sbjct  138  HKLVNVLK  145


 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 51/71 (72%), Gaps = 2/71 (3%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQN  504
            +R HT+S+ V +  G++N + GVFARRGYNI+SLAVG  + + L   T VV GT+  +  
Sbjct  308  LRSHTLSMVVNNAPGVLNLVTGVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESINK  367

Query  505  VMEQLQKLVNV  537
            +++QL+KL+++
Sbjct  368  LVQQLKKLIDL  378



>ref|XP_011085048.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic-like 
[Sesamum indicum]
Length=476

 Score =   149 bits (375),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 78/102 (76%), Positives = 83/102 (81%), Gaps = 2/102 (2%)
 Frame = +1

Query  238  VFANAADGQHKAPSEITLSTSDPAPPTPRQKVRRHTISVFVGDESGMINRIAGVFARRGY  417
            V+A  A G  +  +   LS SDP     R KV+RHTISVFVGDESGMINRIAGVFARRGY
Sbjct  43   VYAQTAHGDKQ--NHHLLSVSDPPLAATRPKVKRHTISVFVGDESGMINRIAGVFARRGY  100

Query  418  NIESLAVGLNKDKALFTIVVSGTEAVLQNVMEQLQKLVNVLK  543
            NIESLAVGLN+DKALFTIVVSGTE VLQ VMEQLQKLVNVLK
Sbjct  101  NIESLAVGLNRDKALFTIVVSGTERVLQQVMEQLQKLVNVLK  142


 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 50/71 (70%), Gaps = 2/71 (3%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDK--ALFTIVVSGTEAVLQN  504
            +R HT+ + V D  G++N + GVFARRGYNI+SLAVG  + +  +  T VV GT+  ++ 
Sbjct  304  LRSHTLFLVVNDAPGVLNLVTGVFARRGYNIQSLAVGHAEVEGHSRITTVVPGTDESIRK  363

Query  505  VMEQLQKLVNV  537
            +++QL KLV+V
Sbjct  364  LVQQLYKLVDV  374



>ref|NP_850174.1| ACT domain-containing small subunit of acetolactate synthase 
protein [Arabidopsis thaliana]
 gb|AEC08588.1| ACT domain-containing small subunit of acetolactate synthase 
protein [Arabidopsis thaliana]
Length=469

 Score =   146 bits (369),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 87/159 (55%), Positives = 103/159 (65%), Gaps = 16/159 (10%)
 Frame = +1

Query  100  MAAISTHSTLFQR-LKPPCDD----------LSFSRKLGFCTASPNIHVGKPKKLSVVFA  246
            MAAIS  S+   R L+  C D          +SF  K+ + +   +    +  K    F 
Sbjct  1    MAAISVSSSPSIRCLRSACSDSSPALVSSTRVSFPAKISYLSGISSHRGDEMGKRMEGFV  60

Query  247  NAADGQHKAPSEITLSTSDPAPPTPRQKVRRHTISVFVGDESGMINRIAGVFARRGYNIE  426
             + DG+    S      S+ +  TP+ KVR+HTISVFVGDESGMINRIAGVFARRGYNIE
Sbjct  61   RSVDGKISDAS-----FSEASSATPKSKVRKHTISVFVGDESGMINRIAGVFARRGYNIE  115

Query  427  SLAVGLNKDKALFTIVVSGTEAVLQNVMEQLQKLVNVLK  543
            SLAVGLN+DKALFTIVV GTE VLQ V+EQLQKLVNVLK
Sbjct  116  SLAVGLNRDKALFTIVVCGTERVLQQVIEQLQKLVNVLK  154


 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 49/71 (69%), Gaps = 2/71 (3%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQN  504
            +R HT+S+ V D  G++N + GVFARRGYNI+SLAVG  + K +   T V+  T+  +  
Sbjct  317  LRSHTLSLLVNDIPGVLNIVTGVFARRGYNIQSLAVGHAETKGISRITTVIPATDESVSK  376

Query  505  VMEQLQKLVNV  537
            +++QL KLV+V
Sbjct  377  LVQQLYKLVDV  387



>emb|CAN67345.1| hypothetical protein VITISV_030337 [Vitis vinifera]
Length=201

 Score =   140 bits (354),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 68/79 (86%), Positives = 73/79 (92%), Gaps = 0/79 (0%)
 Frame = +1

Query  307  APPTPRQKVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGT  486
            APP  R KV+RHTISVFVGDESG+INRIAGVFARRGYNIESLAVGLN+DKALFTIVVSGT
Sbjct  63   APPIQRSKVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNEDKALFTIVVSGT  122

Query  487  EAVLQNVMEQLQKLVNVLK  543
            E VL+ V+EQL KLVNVLK
Sbjct  123  ETVLRQVVEQLNKLVNVLK  141



>ref|NP_850172.1| ACT domain-containing small subunit of acetolactate synthase 
protein [Arabidopsis thaliana]
 sp|Q93YZ7.1|ILVH2_ARATH RecName: Full=Acetolactate synthase small subunit 2, chloroplastic; 
AltName: Full=Acetohydroxy-acid synthase small subunit; 
Short=AHAS; Short=ALS; Flags: Precursor [Arabidopsis thaliana]
 gb|AAL24267.1| At2g31810/F20M17.15 [Arabidopsis thaliana]
 gb|AAM65359.1| At2g31810/F20M17.15 [Arabidopsis thaliana]
 gb|AEC08586.1| ACT domain-containing small subunit of acetolactate synthase 
protein [Arabidopsis thaliana]
Length=491

 Score =   146 bits (369),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 87/159 (55%), Positives = 103/159 (65%), Gaps = 16/159 (10%)
 Frame = +1

Query  100  MAAISTHSTLFQR-LKPPCDD----------LSFSRKLGFCTASPNIHVGKPKKLSVVFA  246
            MAAIS  S+   R L+  C D          +SF  K+ + +   +    +  K    F 
Sbjct  1    MAAISVSSSPSIRCLRSACSDSSPALVSSTRVSFPAKISYLSGISSHRGDEMGKRMEGFV  60

Query  247  NAADGQHKAPSEITLSTSDPAPPTPRQKVRRHTISVFVGDESGMINRIAGVFARRGYNIE  426
             + DG+    S      S+ +  TP+ KVR+HTISVFVGDESGMINRIAGVFARRGYNIE
Sbjct  61   RSVDGKISDAS-----FSEASSATPKSKVRKHTISVFVGDESGMINRIAGVFARRGYNIE  115

Query  427  SLAVGLNKDKALFTIVVSGTEAVLQNVMEQLQKLVNVLK  543
            SLAVGLN+DKALFTIVV GTE VLQ V+EQLQKLVNVLK
Sbjct  116  SLAVGLNRDKALFTIVVCGTERVLQQVIEQLQKLVNVLK  154


 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 49/71 (69%), Gaps = 2/71 (3%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQN  504
            +R HT+S+ V D  G++N + GVFARRGYNI+SLAVG  + K +   T V+  T+  +  
Sbjct  317  LRSHTLSLLVNDIPGVLNIVTGVFARRGYNIQSLAVGHAETKGISRITTVIPATDESVSK  376

Query  505  VMEQLQKLVNV  537
            +++QL KLV+V
Sbjct  377  LVQQLYKLVDV  387



>gb|AAD32291.1| putative acetolactate synthase [Arabidopsis thaliana]
Length=484

 Score =   146 bits (368),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 87/159 (55%), Positives = 103/159 (65%), Gaps = 16/159 (10%)
 Frame = +1

Query  100  MAAISTHSTLFQR-LKPPCDD----------LSFSRKLGFCTASPNIHVGKPKKLSVVFA  246
            MAAIS  S+   R L+  C D          +SF  K+ + +   +    +  K    F 
Sbjct  1    MAAISVSSSPSIRCLRSACSDSSPALVSSTRVSFPAKISYLSGISSHRGDEMGKRMEGFV  60

Query  247  NAADGQHKAPSEITLSTSDPAPPTPRQKVRRHTISVFVGDESGMINRIAGVFARRGYNIE  426
             + DG+    S      S+ +  TP+ KVR+HTISVFVGDESGMINRIAGVFARRGYNIE
Sbjct  61   RSVDGKISDAS-----FSEASSATPKSKVRKHTISVFVGDESGMINRIAGVFARRGYNIE  115

Query  427  SLAVGLNKDKALFTIVVSGTEAVLQNVMEQLQKLVNVLK  543
            SLAVGLN+DKALFTIVV GTE VLQ V+EQLQKLVNVLK
Sbjct  116  SLAVGLNRDKALFTIVVCGTERVLQQVIEQLQKLVNVLK  154



>gb|KJB27748.1| hypothetical protein B456_005G007600 [Gossypium raimondii]
Length=371

 Score =   144 bits (364),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 83/119 (70%), Positives = 89/119 (75%), Gaps = 7/119 (6%)
 Frame = +1

Query  190  TASPNIHVGKPKKLSVVFANAADGQHKAPSEITLSTSDPAPPTP-RQKVRRHTISVFVGD  366
            T  P IHV  P+KL V    + D +    S      + P P TP R KVRRHTISVFVGD
Sbjct  32   TIRPIIHV--PRKL-VFTPKSVDDK---ISNSNFLANGPVPSTPTRSKVRRHTISVFVGD  85

Query  367  ESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTEAVLQNVMEQLQKLVNVLK  543
            ESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGT+ VLQ V+EQLQKLVNV K
Sbjct  86   ESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDRVLQQVVEQLQKLVNVWK  144


 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 48/68 (71%), Gaps = 2/68 (3%)
 Frame = +1

Query  340  HTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQNVME  513
            HT+S+ V D  G++N + GVFARRGYN++SLAVG  + + L   T VV GT+  +  +++
Sbjct  202  HTLSMLVNDSPGVLNLVTGVFARRGYNLQSLAVGHAEVEGLSRITTVVPGTDESISKLVQ  261

Query  514  QLQKLVNV  537
            QL KLV++
Sbjct  262  QLYKLVDM  269



>ref|XP_009406425.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=487

 Score =   145 bits (366),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 75/97 (77%), Positives = 77/97 (79%), Gaps = 0/97 (0%)
 Frame = +1

Query  253  ADGQHKAPSEITLSTSDPAPPTPRQKVRRHTISVFVGDESGMINRIAGVFARRGYNIESL  432
            A G  K   +   S +D     PR KVRRHTISVFVGDESGMINRIAGVFARRGYNIESL
Sbjct  55   ACGADKHSGDAVASVTDSPATKPRNKVRRHTISVFVGDESGMINRIAGVFARRGYNIESL  114

Query  433  AVGLNKDKALFTIVVSGTEAVLQNVMEQLQKLVNVLK  543
            AVGLNKDKALFTIVVSGT  VLQ VMEQL KLVNVLK
Sbjct  115  AVGLNKDKALFTIVVSGTNKVLQQVMEQLNKLVNVLK  151


 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 48/68 (71%), Gaps = 2/68 (3%)
 Frame = +1

Query  340  HTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQNVME  513
            HT+S+ V D  G++N + GVFARRGYNI+SLAVG  + + +   T VV GT+  +  +++
Sbjct  318  HTLSILVNDFPGVLNLVTGVFARRGYNIQSLAVGPAEKEGISRITTVVPGTDGSIGKLVQ  377

Query  514  QLQKLVNV  537
            QL KL++V
Sbjct  378  QLYKLIDV  385



>gb|KHG22544.1| Acetolactate synthase small subunit [Gossypium arboreum]
Length=469

 Score =   145 bits (366),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 84/119 (71%), Positives = 90/119 (76%), Gaps = 7/119 (6%)
 Frame = +1

Query  190  TASPNIHVGKPKKLSVVFANAADGQHKAPSEITLSTSDPAPPTP-RQKVRRHTISVFVGD  366
            T  P IHV  PKKL  VF+  +     + S      + P P TP R KVRRHTISVFVGD
Sbjct  32   TIRPIIHV--PKKL--VFSPKSVDDKISNSNFL--ANGPVPSTPTRSKVRRHTISVFVGD  85

Query  367  ESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTEAVLQNVMEQLQKLVNVLK  543
            ESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGT+ VLQ V+EQLQKLVNV K
Sbjct  86   ESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDRVLQQVVEQLQKLVNVWK  144



>ref|XP_011460628.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic 
[Fragaria vesca subsp. vesca]
Length=479

 Score =   145 bits (365),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 83/151 (55%), Positives = 103/151 (68%), Gaps = 7/151 (5%)
 Frame = +1

Query  91   AASMAAISTHSTLFQRLKPPCDDLSFSRKLGFCTASPNIHVGKPKKLSVVFANAADGQHK  270
            AAS+++    ++LF     PC  +   R  GF     ++ +G  + L      + D    
Sbjct  2    AASLSSPPCSTSLFT--PNPCFRVDLGR--GF---RKSLDLGHQRPLKFKSLASKDLVVS  54

Query  271  APSEITLSTSDPAPPTPRQKVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNK  450
            A +   +S +DPAP   R KV+RHTISVFVGDESG+INRIAGVFARRGYNIESLAVGLNK
Sbjct  55   ASTNNAVSVTDPAPSLIRSKVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNK  114

Query  451  DKALFTIVVSGTEAVLQNVMEQLQKLVNVLK  543
            D+ALFTIVVSGTE +LQ V+EQL KLVNV+K
Sbjct  115  DRALFTIVVSGTEKILQQVVEQLNKLVNVIK  145


 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 50/71 (70%), Gaps = 2/71 (3%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQN  504
            V+ HT+ + V D  G++N + GV +RRGYNI+SLAVG ++ + L   T VV GT+  +  
Sbjct  307  VQSHTLCMLVSDVPGVLNIVTGVISRRGYNIQSLAVGPSEKEGLSRITTVVPGTDDTITK  366

Query  505  VMEQLQKLVNV  537
            +++QL+KL+++
Sbjct  367  LVQQLRKLIDL  377



>ref|XP_010414082.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like 
isoform X1 [Camelina sativa]
Length=492

 Score =   144 bits (364),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 88/161 (55%), Positives = 104/161 (65%), Gaps = 19/161 (12%)
 Frame = +1

Query  100  MAAISTHSTLFQR-LKPPCDD----------LSFSRKLGFCTASPNIHVGKPKKLSVVFA  246
            MAAIS  S+   R L+  C D          +SF  K+ + +   +    +  K      
Sbjct  1    MAAISVSSSPSLRCLRSACSDSSPALVSSTRVSFPSKVSYLSGKSSNRGEEMGKRMDGIV  60

Query  247  NAADGQHKAPSEITLSTSDPAPP--TPRQKVRRHTISVFVGDESGMINRIAGVFARRGYN  420
             + DG+      I+ ++S P  P  TP  KVR+HTISVFVGDESGMINRIAGVFARRGYN
Sbjct  61   RSVDGK------ISDASSFPEAPSSTPNSKVRKHTISVFVGDESGMINRIAGVFARRGYN  114

Query  421  IESLAVGLNKDKALFTIVVSGTEAVLQNVMEQLQKLVNVLK  543
            IESLAVGLN+DKALFTIVV GTE VLQ V+EQLQKLVNVLK
Sbjct  115  IESLAVGLNRDKALFTIVVCGTERVLQQVIEQLQKLVNVLK  155


 Score = 67.0 bits (162),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 49/71 (69%), Gaps = 2/71 (3%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQN  504
            +R HT+S+ V D  G++N + GVFARRGYNI+SLAVG  + K +   T VV  T+  +  
Sbjct  318  LRSHTLSLLVNDVPGVLNIVTGVFARRGYNIQSLAVGHAETKGISRITTVVPATDESVSK  377

Query  505  VMEQLQKLVNV  537
            +++QL KLV+V
Sbjct  378  LVQQLNKLVDV  388



>ref|XP_002529819.1| acetolactate synthase, putative [Ricinus communis]
 gb|EEF32568.1| acetolactate synthase, putative [Ricinus communis]
Length=493

 Score =   144 bits (364),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 78/109 (72%), Positives = 88/109 (81%), Gaps = 3/109 (3%)
 Frame = +1

Query  217  KPKKLSVVFANAADGQHKAPSEITLSTSDPAPPTPRQKVRRHTISVFVGDESGMINRIAG  396
            +P++  +V A A    HK  + ++ + S PA  T   KVRRHTISVFVGDESGMINRIAG
Sbjct  53   QPRRKFIVSATA--DSHKDDTVLSSNGSVPAAAT-LSKVRRHTISVFVGDESGMINRIAG  109

Query  397  VFARRGYNIESLAVGLNKDKALFTIVVSGTEAVLQNVMEQLQKLVNVLK  543
            VFARRGYNIESLAVGLNKDKALFTIVVSGTE VLQ V+EQLQKLVNV+K
Sbjct  110  VFARRGYNIESLAVGLNKDKALFTIVVSGTERVLQQVVEQLQKLVNVMK  158


 Score = 67.4 bits (163),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 51/71 (72%), Gaps = 2/71 (3%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQN  504
            +R HT+S+ V D  G++N + G+FARRGYN++SLAVG ++ + L   T VV GT+  +  
Sbjct  321  LRSHTLSMLVNDSPGVLNIVTGIFARRGYNVQSLAVGHSETEGLSRITTVVPGTDESISK  380

Query  505  VMEQLQKLVNV  537
            +++QL KL+++
Sbjct  381  LVQQLYKLIDL  391



>ref|XP_008394267.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like 
isoform X2 [Malus domestica]
Length=408

 Score =   143 bits (361),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 78/114 (68%), Positives = 86/114 (75%), Gaps = 12/114 (11%)
 Frame = +1

Query  214  GKPKKLSV----VFANAADGQHKAPSEITLSTSDPAPPTPRQKVRRHTISVFVGDESGMI  381
            G+PK+L+V    V  N AD           S++   P T R KVRRHTISVFVGDESGMI
Sbjct  52   GRPKQLAVSARSVDENIADN--------AFSSNGSPPSTARSKVRRHTISVFVGDESGMI  103

Query  382  NRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTEAVLQNVMEQLQKLVNVLK  543
            NRIAGVFARRGYNIESLAVGLN+DKALFTIVVSGTE VL+ V+EQL KLVNV K
Sbjct  104  NRIAGVFARRGYNIESLAVGLNRDKALFTIVVSGTERVLRQVIEQLNKLVNVXK  157


 Score = 61.6 bits (148),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 49/71 (69%), Gaps = 2/71 (3%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLN--KDKALFTIVVSGTEAVLQN  504
            +R HT+S+ V D  G++  + GVFARRGYNI+SLAVG    + ++  T VV GT+  +  
Sbjct  320  LRSHTLSMLVNDVPGVLYILTGVFARRGYNIQSLAVGHAEVEGQSRITTVVPGTDESISK  379

Query  505  VMEQLQKLVNV  537
            +++QL KLV++
Sbjct  380  LVQQLYKLVDI  390



>ref|XP_008367825.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like 
[Malus domestica]
Length=492

 Score =   144 bits (363),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 78/114 (68%), Positives = 87/114 (76%), Gaps = 12/114 (11%)
 Frame = +1

Query  214  GKPKKLSV----VFANAADGQHKAPSEITLSTSDPAPPTPRQKVRRHTISVFVGDESGMI  381
            G+PK+L+V    V  N AD           S++   P T R KVRRHTISVFVGDESGMI
Sbjct  52   GRPKQLAVSARSVDENIADN--------AFSSNGSPPSTXRSKVRRHTISVFVGDESGMI  103

Query  382  NRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTEAVLQNVMEQLQKLVNVLK  543
            NRIAGVFARRGYNIESLAVGLN+DKALFTIVVSGTE VL+ V+EQL KLVNV+K
Sbjct  104  NRIAGVFARRGYNIESLAVGLNRDKALFTIVVSGTERVLRQVIEQLNKLVNVIK  157


 Score = 61.6 bits (148),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 49/71 (69%), Gaps = 2/71 (3%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLN--KDKALFTIVVSGTEAVLQN  504
            +R HT+S+ V D  G++  + GVFARRGYNI+SLAVG    + ++  T VV GT+  +  
Sbjct  320  LRSHTLSMLVNDVPGVLYILTGVFARRGYNIQSLAVGHAEVEGQSRITTVVPGTDESISK  379

Query  505  VMEQLQKLVNV  537
            +++QL KLV++
Sbjct  380  LVQQLYKLVDI  390



>gb|KJB27747.1| hypothetical protein B456_005G007600 [Gossypium raimondii]
Length=479

 Score =   144 bits (363),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 82/119 (69%), Positives = 87/119 (73%), Gaps = 7/119 (6%)
 Frame = +1

Query  190  TASPNIHVGKPKKLSVVFANAADGQHKAPSEITLSTSDPAPPTP-RQKVRRHTISVFVGD  366
            T  P IHV  P+KL     +  D      S      + P P TP R KVRRHTISVFVGD
Sbjct  32   TIRPIIHV--PRKLVFTPKSVDD----KISNSNFLANGPVPSTPTRSKVRRHTISVFVGD  85

Query  367  ESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTEAVLQNVMEQLQKLVNVLK  543
            ESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGT+ VLQ V+EQLQKLVNV K
Sbjct  86   ESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDRVLQQVVEQLQKLVNVWK  144


 Score = 65.1 bits (157),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 48/68 (71%), Gaps = 2/68 (3%)
 Frame = +1

Query  340  HTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQNVME  513
            HT+S+ V D  G++N + GVFARRGYN++SLAVG  + + L   T VV GT+  +  +++
Sbjct  310  HTLSMLVNDSPGVLNLVTGVFARRGYNLQSLAVGHAEVEGLSRITTVVPGTDESISKLVQ  369

Query  514  QLQKLVNV  537
            QL KLV++
Sbjct  370  QLYKLVDM  377



>ref|XP_008394268.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like 
isoform X3 [Malus domestica]
Length=402

 Score =   143 bits (361),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 78/114 (68%), Positives = 86/114 (75%), Gaps = 12/114 (11%)
 Frame = +1

Query  214  GKPKKLSV----VFANAADGQHKAPSEITLSTSDPAPPTPRQKVRRHTISVFVGDESGMI  381
            G+PK+L+V    V  N AD           S++   P T R KVRRHTISVFVGDESGMI
Sbjct  52   GRPKQLAVSARSVDENIADN--------AFSSNGSPPSTARSKVRRHTISVFVGDESGMI  103

Query  382  NRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTEAVLQNVMEQLQKLVNVLK  543
            NRIAGVFARRGYNIESLAVGLN+DKALFTIVVSGTE VL+ V+EQL KLVNV K
Sbjct  104  NRIAGVFARRGYNIESLAVGLNRDKALFTIVVSGTERVLRQVIEQLNKLVNVXK  157


 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 49/71 (69%), Gaps = 2/71 (3%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLN--KDKALFTIVVSGTEAVLQN  504
            +R HT+S+ V D  G++  + GVFARRGYNI+SLAVG    + ++  T VV GT+  +  
Sbjct  320  LRSHTLSMLVNDVPGVLYILTGVFARRGYNIQSLAVGHAEVEGQSRITTVVPGTDESISK  379

Query  505  VMEQLQKLVNV  537
            +++QL KLV++
Sbjct  380  LVQQLYKLVDI  390



>ref|XP_007212091.1| hypothetical protein PRUPE_ppa005063mg [Prunus persica]
 gb|EMJ13290.1| hypothetical protein PRUPE_ppa005063mg [Prunus persica]
Length=479

 Score =   144 bits (362),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 70/91 (77%), Positives = 79/91 (87%), Gaps = 0/91 (0%)
 Frame = +1

Query  271  APSEITLSTSDPAPPTPRQKVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNK  450
            A ++  +S +DP P   R KV+RHTISVFVGDESG+INRIAGVFARRGYNIESLAVGLNK
Sbjct  54   ASTDNAVSVTDPVPSLTRSKVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNK  113

Query  451  DKALFTIVVSGTEAVLQNVMEQLQKLVNVLK  543
            DKALFTIVVSGTE VL+ V+EQL KLVNV+K
Sbjct  114  DKALFTIVVSGTEKVLRQVVEQLNKLVNVIK  144


 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 49/71 (69%), Gaps = 2/71 (3%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQN  504
            V+ HT+S+ V D  G++N + GV +RRGYNI+SLAVG  + + L   T VV GT+  +  
Sbjct  307  VQSHTLSMIVNDCPGVLNIVTGVMSRRGYNIQSLAVGPAEKEGLSRITTVVPGTDDSITK  366

Query  505  VMEQLQKLVNV  537
            +++QL KL+++
Sbjct  367  LVQQLHKLIDL  377



>ref|XP_002879344.1| hypothetical protein ARALYDRAFT_482103 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH55603.1| hypothetical protein ARALYDRAFT_482103 [Arabidopsis lyrata subsp. 
lyrata]
Length=492

 Score =   144 bits (362),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 87/159 (55%), Positives = 103/159 (65%), Gaps = 16/159 (10%)
 Frame = +1

Query  100  MAAISTHSTLFQR-LKPPCDD----------LSFSRKLGFCTASPNIHVGKPKKLSVVFA  246
            MAAIS  S+   R L+  C D          +SF  K+ + +   +    +  K    F 
Sbjct  1    MAAISVSSSPSLRCLRSACSDSSPSLVSSTRVSFPAKISYLSGQSSHRGEEMGKRMEGFV  60

Query  247  NAADGQHKAPSEITLSTSDPAPPTPRQKVRRHTISVFVGDESGMINRIAGVFARRGYNIE  426
             + DG+    S      S+ +  TP+ KVR+HTISVFVGDESGMINRIAGVFARRGYNIE
Sbjct  61   RSVDGKISDAS-----YSEASSTTPKSKVRKHTISVFVGDESGMINRIAGVFARRGYNIE  115

Query  427  SLAVGLNKDKALFTIVVSGTEAVLQNVMEQLQKLVNVLK  543
            SLAVGLN+DKALFTIVV GTE VLQ V+EQLQKLVNVLK
Sbjct  116  SLAVGLNRDKALFTIVVCGTERVLQQVIEQLQKLVNVLK  154


 Score = 61.6 bits (148),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 49/72 (68%), Gaps = 3/72 (4%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIES-LAVGLNKDKAL--FTIVVSGTEAVLQ  501
            +R HT+S+ V D  G++N + GVFARRGYNI++ LAVG  + K +   T VV  T+  + 
Sbjct  317  LRSHTLSLLVNDTPGVLNIVTGVFARRGYNIQAYLAVGHAETKGISRITTVVPATDESIS  376

Query  502  NVMEQLQKLVNV  537
             +++QL KLV+V
Sbjct  377  KLVQQLYKLVDV  388



>ref|XP_006446199.1| hypothetical protein CICLE_v10015044mg [Citrus clementina]
 gb|ESR59439.1| hypothetical protein CICLE_v10015044mg [Citrus clementina]
Length=488

 Score =   144 bits (362),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 78/109 (72%), Positives = 87/109 (80%), Gaps = 8/109 (7%)
 Frame = +1

Query  217  KPKKLSVVFANAADGQHKAPSEITLSTSDPAPPTPRQKVRRHTISVFVGDESGMINRIAG  396
            +PKKL+V    +A   ++  +E T ++    P T R  VRRHTISVFVGDESGMINRIAG
Sbjct  54   EPKKLAV----SARSANENITEGTFTS----PSTNRTNVRRHTISVFVGDESGMINRIAG  105

Query  397  VFARRGYNIESLAVGLNKDKALFTIVVSGTEAVLQNVMEQLQKLVNVLK  543
            VFARRGYNIESLAVGLNKDKALFTIVV GT+ VLQ VMEQLQKLVNVLK
Sbjct  106  VFARRGYNIESLAVGLNKDKALFTIVVYGTDKVLQQVMEQLQKLVNVLK  154


 Score = 67.8 bits (164),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 49/71 (69%), Gaps = 2/71 (3%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQN  504
            +R HT+S+ V D  G++N + GVFARRGYNI+SLAVG  + + L   T VV  T+  +  
Sbjct  316  LRSHTLSMLVNDSPGVLNIVTGVFARRGYNIQSLAVGHAETEGLSRITTVVPATDESISK  375

Query  505  VMEQLQKLVNV  537
            +M+QL KL+++
Sbjct  376  LMQQLYKLIDL  386



>ref|XP_006446200.1| hypothetical protein CICLE_v10015044mg [Citrus clementina]
 gb|ESR59440.1| hypothetical protein CICLE_v10015044mg [Citrus clementina]
Length=469

 Score =   144 bits (362),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 78/109 (72%), Positives = 87/109 (80%), Gaps = 8/109 (7%)
 Frame = +1

Query  217  KPKKLSVVFANAADGQHKAPSEITLSTSDPAPPTPRQKVRRHTISVFVGDESGMINRIAG  396
            +PKKL+V    +A   ++  +E T +    +P T R  VRRHTISVFVGDESGMINRIAG
Sbjct  54   EPKKLAV----SARSANENITEGTFT----SPSTNRTNVRRHTISVFVGDESGMINRIAG  105

Query  397  VFARRGYNIESLAVGLNKDKALFTIVVSGTEAVLQNVMEQLQKLVNVLK  543
            VFARRGYNIESLAVGLNKDKALFTIVV GT+ VLQ VMEQLQKLVNVLK
Sbjct  106  VFARRGYNIESLAVGLNKDKALFTIVVYGTDKVLQQVMEQLQKLVNVLK  154


 Score = 67.4 bits (163),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 49/71 (69%), Gaps = 2/71 (3%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQN  504
            +R HT+S+ V D  G++N + GVFARRGYNI+SLAVG  + + L   T VV  T+  +  
Sbjct  316  LRSHTLSMLVNDSPGVLNIVTGVFARRGYNIQSLAVGHAETEGLSRITTVVPATDESISK  375

Query  505  VMEQLQKLVNV  537
            +M+QL KL+++
Sbjct  376  LMQQLYKLIDL  386



>ref|XP_010070426.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic-like 
[Eucalyptus grandis]
 gb|KCW59208.1| hypothetical protein EUGRSUZ_H01869 [Eucalyptus grandis]
Length=487

 Score =   144 bits (362),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 71/77 (92%), Positives = 72/77 (94%), Gaps = 0/77 (0%)
 Frame = +1

Query  313  PTPRQKVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTEA  492
            P  R KVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKD+ALFTIVVSGTE 
Sbjct  76   PVARPKVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDRALFTIVVSGTER  135

Query  493  VLQNVMEQLQKLVNVLK  543
            VLQ VMEQLQKLVNVLK
Sbjct  136  VLQQVMEQLQKLVNVLK  152


 Score = 67.0 bits (162),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 51/71 (72%), Gaps = 2/71 (3%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQN  504
            +R HT+S+ V D  G++N I GVF+RRGYNI+SLAVG ++ + L   T VV GT+  +  
Sbjct  315  LRSHTLSMIVNDAPGVLNIITGVFSRRGYNIQSLAVGHSEVEGLSRITTVVPGTDESISK  374

Query  505  VMEQLQKLVNV  537
            +++QL KLV++
Sbjct  375  LVQQLYKLVDL  385



>gb|KCW59207.1| hypothetical protein EUGRSUZ_H01869 [Eucalyptus grandis]
Length=487

 Score =   144 bits (362),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 71/77 (92%), Positives = 72/77 (94%), Gaps = 0/77 (0%)
 Frame = +1

Query  313  PTPRQKVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTEA  492
            P  R KVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKD+ALFTIVVSGTE 
Sbjct  76   PVARPKVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDRALFTIVVSGTER  135

Query  493  VLQNVMEQLQKLVNVLK  543
            VLQ VMEQLQKLVNVLK
Sbjct  136  VLQQVMEQLQKLVNVLK  152


 Score = 67.0 bits (162),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 51/71 (72%), Gaps = 2/71 (3%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQN  504
            +R HT+S+ V D  G++N I GVF+RRGYNI+SLAVG ++ + L   T VV GT+  +  
Sbjct  315  LRSHTLSMIVNDAPGVLNIITGVFSRRGYNIQSLAVGHSEVEGLSRITTVVPGTDESISK  374

Query  505  VMEQLQKLVNV  537
            +++QL KLV++
Sbjct  375  LVQQLYKLVDL  385



>emb|CDY15367.1| BnaC04g42560D [Brassica napus]
Length=487

 Score =   144 bits (362),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 71/82 (87%), Positives = 74/82 (90%), Gaps = 0/82 (0%)
 Frame = +1

Query  298  SDPAPPTPRQKVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVV  477
            SD    TP  KVR+HTISVFVGDESGMINRIAGVFARRGYNIESLAVGLN+DKALFTIVV
Sbjct  69   SDAPLTTPESKVRKHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNRDKALFTIVV  128

Query  478  SGTEAVLQNVMEQLQKLVNVLK  543
            SGTE VLQ V+EQLQKLVNVLK
Sbjct  129  SGTERVLQQVIEQLQKLVNVLK  150


 Score = 64.7 bits (156),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 49/71 (69%), Gaps = 2/71 (3%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQN  504
            +R HT+S+ V D  G++N + GVF+RRGYNI+SLAVG  + + +   T VV  T+  +  
Sbjct  313  LRSHTLSLLVNDVPGVLNLVTGVFSRRGYNIQSLAVGHAETEGISRITTVVPATDESVSK  372

Query  505  VMEQLQKLVNV  537
            +++QL KLV+V
Sbjct  373  LVQQLYKLVDV  383



>ref|XP_009141188.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like 
[Brassica rapa]
Length=487

 Score =   143 bits (361),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 71/82 (87%), Positives = 74/82 (90%), Gaps = 0/82 (0%)
 Frame = +1

Query  298  SDPAPPTPRQKVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVV  477
            SD    TP  KVR+HTISVFVGDESGMINRIAGVFARRGYNIESLAVGLN+DKALFTIVV
Sbjct  69   SDAPLTTPESKVRKHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNRDKALFTIVV  128

Query  478  SGTEAVLQNVMEQLQKLVNVLK  543
            SGTE VLQ V+EQLQKLVNVLK
Sbjct  129  SGTERVLQQVIEQLQKLVNVLK  150


 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 49/71 (69%), Gaps = 2/71 (3%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQN  504
            +R HT+S+ V D  G++N I GVFARRGYNI+SLAVG  + + +   T VV  T+  +  
Sbjct  313  LRSHTLSLLVNDVPGVLNLITGVFARRGYNIQSLAVGHAETEGISRITTVVPATDESVSK  372

Query  505  VMEQLQKLVNV  537
            +++QL KL++V
Sbjct  373  LVQQLYKLIDV  383



>emb|CDY19107.1| BnaA04g18470D [Brassica napus]
Length=488

 Score =   143 bits (361),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 71/82 (87%), Positives = 74/82 (90%), Gaps = 0/82 (0%)
 Frame = +1

Query  298  SDPAPPTPRQKVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVV  477
            SD    TP  KVR+HTISVFVGDESGMINRIAGVFARRGYNIESLAVGLN+DKALFTIVV
Sbjct  69   SDAPLTTPESKVRKHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNRDKALFTIVV  128

Query  478  SGTEAVLQNVMEQLQKLVNVLK  543
            SGTE VLQ V+EQLQKLVNVLK
Sbjct  129  SGTERVLQQVIEQLQKLVNVLK  150


 Score = 58.5 bits (140),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 49/72 (68%), Gaps = 3/72 (4%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIES-LAVGLNKDKAL--FTIVVSGTEAVLQ  501
            +R HT+S+ V D  G++N + GVF+RRGYNI++ LAVG  + + +   T VV  T+  + 
Sbjct  313  LRSHTLSLLVNDVPGVLNLVTGVFSRRGYNIQAFLAVGHAETEGISRITTVVPATDESVS  372

Query  502  NVMEQLQKLVNV  537
             +++QL KLV+V
Sbjct  373  KLVQQLYKLVDV  384



>ref|XP_008394266.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like 
isoform X1 [Malus domestica]
Length=492

 Score =   143 bits (361),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 78/114 (68%), Positives = 86/114 (75%), Gaps = 12/114 (11%)
 Frame = +1

Query  214  GKPKKLSV----VFANAADGQHKAPSEITLSTSDPAPPTPRQKVRRHTISVFVGDESGMI  381
            G+PK+L+V    V  N AD           S++   P T R KVRRHTISVFVGDESGMI
Sbjct  52   GRPKQLAVSARSVDENIADN--------AFSSNGSPPSTARSKVRRHTISVFVGDESGMI  103

Query  382  NRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTEAVLQNVMEQLQKLVNVLK  543
            NRIAGVFARRGYNIESLAVGLN+DKALFTIVVSGTE VL+ V+EQL KLVNV K
Sbjct  104  NRIAGVFARRGYNIESLAVGLNRDKALFTIVVSGTERVLRQVIEQLNKLVNVXK  157


 Score = 61.6 bits (148),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 49/71 (69%), Gaps = 2/71 (3%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLN--KDKALFTIVVSGTEAVLQN  504
            +R HT+S+ V D  G++  + GVFARRGYNI+SLAVG    + ++  T VV GT+  +  
Sbjct  320  LRSHTLSMLVNDVPGVLYILTGVFARRGYNIQSLAVGHAEVEGQSRITTVVPGTDESISK  379

Query  505  VMEQLQKLVNV  537
            +++QL KLV++
Sbjct  380  LVQQLYKLVDI  390



>emb|CDY34514.1| BnaC04g12850D [Brassica napus]
Length=468

 Score =   143 bits (360),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 70/84 (83%), Positives = 76/84 (90%), Gaps = 0/84 (0%)
 Frame = +1

Query  292  STSDPAPPTPRQKVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTI  471
            + SD +  TP  KVR+HTISVFVGDESGMINRIAGVFARRGYNI+SLAVGLN+DKALFTI
Sbjct  61   NVSDASSATPNSKVRKHTISVFVGDESGMINRIAGVFARRGYNIQSLAVGLNRDKALFTI  120

Query  472  VVSGTEAVLQNVMEQLQKLVNVLK  543
            VVSGTE VLQ V+EQLQKLVNVLK
Sbjct  121  VVSGTERVLQQVIEQLQKLVNVLK  144



>ref|XP_008225227.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic-like 
[Prunus mume]
Length=479

 Score =   143 bits (360),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 70/91 (77%), Positives = 79/91 (87%), Gaps = 0/91 (0%)
 Frame = +1

Query  271  APSEITLSTSDPAPPTPRQKVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNK  450
            A ++  +S +DP P   R KV+RHTISVFVGDESG+INRIAGVFARRGYNIESLAVGLNK
Sbjct  54   ASTDNAVSVTDPVPSLIRSKVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNK  113

Query  451  DKALFTIVVSGTEAVLQNVMEQLQKLVNVLK  543
            DKALFTIVVSGTE VL+ V+EQL KLVNV+K
Sbjct  114  DKALFTIVVSGTEKVLRQVVEQLNKLVNVIK  144


 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 49/71 (69%), Gaps = 2/71 (3%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQN  504
            V+ HT+S+ V D  G++N + GV +RRGYNI+SLAVG  + + L   T VV GT+  +  
Sbjct  307  VQSHTLSMIVNDCPGVLNIVTGVMSRRGYNIQSLAVGPAEKEGLSRITTVVPGTDDSITK  366

Query  505  VMEQLQKLVNV  537
            +++QL KL+++
Sbjct  367  LVQQLHKLIDL  377



>ref|XP_006410309.1| hypothetical protein EUTSA_v10016569mg [Eutrema salsugineum]
 gb|ESQ51762.1| hypothetical protein EUTSA_v10016569mg [Eutrema salsugineum]
Length=491

 Score =   143 bits (360),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 73/98 (74%), Positives = 81/98 (83%), Gaps = 5/98 (5%)
 Frame = +1

Query  250  AADGQHKAPSEITLSTSDPAPPTPRQKVRRHTISVFVGDESGMINRIAGVFARRGYNIES  429
            + DG+   PS      S+ +  TP+ KVR+HTISVFVGDESGMINRIAGVFARRGYNIES
Sbjct  62   SVDGKISDPS-----FSEASSATPKSKVRKHTISVFVGDESGMINRIAGVFARRGYNIES  116

Query  430  LAVGLNKDKALFTIVVSGTEAVLQNVMEQLQKLVNVLK  543
            LAVGLN+DKALFTIVV GTE VLQ V+EQLQKLVNVLK
Sbjct  117  LAVGLNRDKALFTIVVCGTERVLQQVIEQLQKLVNVLK  154


 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 49/71 (69%), Gaps = 2/71 (3%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQN  504
            +R HT+S+ V D  G++N + GVFARRGYNI+SLAVG  + + +   T VV  T+  +  
Sbjct  317  LRSHTLSLLVNDAPGVLNIVTGVFARRGYNIQSLAVGHAETEGISRITTVVPATDESVSK  376

Query  505  VMEQLQKLVNV  537
            +++QL KLV+V
Sbjct  377  LVQQLYKLVDV  387



>ref|XP_010650733.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic 
isoform X2 [Vitis vinifera]
Length=480

 Score =   142 bits (359),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 81/128 (63%), Positives = 93/128 (73%), Gaps = 4/128 (3%)
 Frame = +1

Query  160  LSFSRKLGFCTASPNIHVGKPKKLSVVFANAADGQHKAPSEITLSTSDPAPPTPRQKVRR  339
            L FSR L        +   +  KL V  ++A +G     ++ T + ++PAP   R  VRR
Sbjct  20   LGFSRALWLSLPISKLKNPQLGKLVVSASSAENGV--GFNDKTAAVANPAPSAAR--VRR  75

Query  340  HTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTEAVLQNVMEQL  519
            HTISVFVGDESGMINRIAGVFARRGYNI+SLAVGLNKDKALFTIVVSGTE VLQ V+EQL
Sbjct  76   HTISVFVGDESGMINRIAGVFARRGYNIDSLAVGLNKDKALFTIVVSGTERVLQQVVEQL  135

Query  520  QKLVNVLK  543
             KLVNVLK
Sbjct  136  HKLVNVLK  143


 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 51/71 (72%), Gaps = 2/71 (3%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQN  504
            +R HT+S+ V +  G++N + GVFARRGYNI+SLAVG  + + L   T VV GT+  +  
Sbjct  306  LRSHTLSMVVNNAPGVLNLVTGVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESINK  365

Query  505  VMEQLQKLVNV  537
            +++QL+KL+++
Sbjct  366  LVQQLKKLIDL  376



>gb|KDP35124.1| hypothetical protein JCGZ_10658 [Jatropha curcas]
Length=483

 Score =   142 bits (359),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 91/155 (59%), Positives = 104/155 (67%), Gaps = 14/155 (9%)
 Frame = +1

Query  100  MAAISTHS-TLFQRLKPPCDDLSFSRKLG------FCTASPNIHVGKPKKLSVVFANAAD  258
            MAA S+ S T     KP     + +   G        T + N H  + +KL VV A AAD
Sbjct  1    MAATSSTSFTTIHTHKPSASAFALNSAFGAPSSLAISTCTTN-HYHRRRKL-VVSATAAD  58

Query  259  GQHKAPSEITLSTSDPAPPTPRQKVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAV  438
              +   + ++ S+      T  +KVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAV
Sbjct  59   NHNNISTSVSSSSI-----TLSKKVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAV  113

Query  439  GLNKDKALFTIVVSGTEAVLQNVMEQLQKLVNVLK  543
            GLNKDKALFTIVVSGTE VLQ V+EQLQKLVNVLK
Sbjct  114  GLNKDKALFTIVVSGTEKVLQQVVEQLQKLVNVLK  148


 Score = 67.0 bits (162),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 50/71 (70%), Gaps = 2/71 (3%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQN  504
            +R HT+S+ V D  G++N + GVFARRGYNI+SLAVG ++ + +   T VV GT+  +  
Sbjct  311  LRSHTLSMLVNDAPGVLNIVTGVFARRGYNIQSLAVGHSETEGISRITTVVPGTDESISK  370

Query  505  VMEQLQKLVNV  537
            +++QL KLV +
Sbjct  371  LVQQLYKLVEL  381



>ref|XP_008383971.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like 
[Malus domestica]
Length=489

 Score =   142 bits (358),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 86/132 (65%), Positives = 95/132 (72%), Gaps = 7/132 (5%)
 Frame = +1

Query  160  LSFSRKLGF-CTASPN---IHVGKPKKLSVVFANAADGQHKAPSEITLSTSDPAPPTPRQ  327
            L FS  L F  T+S +   IH     K   V A + D Q+ A S    S++   P T R 
Sbjct  26   LGFSETLLFPLTSSASRSIIHSHDRHKQLAVSARSFD-QNIADS--AFSSNGSPPSTTRS  82

Query  328  KVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTEAVLQNV  507
            KVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTE VL+ V
Sbjct  83   KVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTETVLRLV  142

Query  508  MEQLQKLVNVLK  543
            +EQL KLVNV+K
Sbjct  143  IEQLNKLVNVMK  154


 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 49/71 (69%), Gaps = 2/71 (3%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQN  504
            +R HT+S+ V D  G++  I GVFARRGYNI+SLAVG  + + L   T VV GT+  +  
Sbjct  317  LRSHTLSMLVNDIPGVLYIITGVFARRGYNIQSLAVGXAEAEGLSRITTVVPGTDESISK  376

Query  505  VMEQLQKLVNV  537
            +++QL KLV+V
Sbjct  377  LVQQLYKLVDV  387



>ref|XP_010510152.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic 
[Camelina sativa]
 ref|XP_010510153.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic 
[Camelina sativa]
Length=492

 Score =   142 bits (358),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 86/159 (54%), Positives = 101/159 (64%), Gaps = 15/159 (9%)
 Frame = +1

Query  100  MAAISTHSTLFQR-LKPPCDD----------LSFSRKLGFCTASPNIHVGKPKKLSVVFA  246
            MAAIS  S+   R L+  C D          +SF  K+ + +   +    +  K      
Sbjct  1    MAAISVSSSPSLRCLRSACSDSSPALVSSTRVSFPSKVSYLSGKSSNRGEEMGKRIDGIV  60

Query  247  NAADGQHKAPSEITLSTSDPAPPTPRQKVRRHTISVFVGDESGMINRIAGVFARRGYNIE  426
             + DG+    S    S  + +  TP  KVR+HTISVFVGDESGMINRIAGVFARRGYNIE
Sbjct  61   RSVDGKISDAS----SFPEASSATPNSKVRKHTISVFVGDESGMINRIAGVFARRGYNIE  116

Query  427  SLAVGLNKDKALFTIVVSGTEAVLQNVMEQLQKLVNVLK  543
            SLAVGLN+DKALFTIVV GTE VLQ V+EQLQKLVNVLK
Sbjct  117  SLAVGLNRDKALFTIVVCGTERVLQQVIEQLQKLVNVLK  155


 Score = 67.0 bits (162),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 49/71 (69%), Gaps = 2/71 (3%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQN  504
            +R HT+S+ V D  G++N + GVFARRGYNI+SLAVG  + K +   T VV  T+  +  
Sbjct  318  LRSHTLSLLVNDVPGVLNIVTGVFARRGYNIQSLAVGHAETKGISRITTVVPATDESVSK  377

Query  505  VMEQLQKLVNV  537
            +++QL KLV+V
Sbjct  378  LVQQLNKLVDV  388



>ref|XP_008354318.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like 
[Malus domestica]
Length=489

 Score =   142 bits (358),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 86/132 (65%), Positives = 95/132 (72%), Gaps = 7/132 (5%)
 Frame = +1

Query  160  LSFSRKLGF-CTASPN---IHVGKPKKLSVVFANAADGQHKAPSEITLSTSDPAPPTPRQ  327
            L FS  L F  T+S +   IH     K   V A + D Q+ A S    S++   P T R 
Sbjct  26   LGFSETLLFPLTSSASRSIIHSHDRHKQLAVSARSFD-QNIADS--AFSSNGSPPSTTRS  82

Query  328  KVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTEAVLQNV  507
            KVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTE VL+ V
Sbjct  83   KVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTETVLRLV  142

Query  508  MEQLQKLVNVLK  543
            +EQL KLVNV+K
Sbjct  143  IEQLNKLVNVMK  154


 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 49/71 (69%), Gaps = 2/71 (3%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQN  504
            +R HT+S+ V D  G++  I GVFARRGYNI+SLAVG  + + L   T VV GT+  +  
Sbjct  317  LRSHTLSMLVNDIPGVLYIITGVFARRGYNIQSLAVGHAEAEGLSRITTVVPGTDESISK  376

Query  505  VMEQLQKLVNV  537
            +++QL KLV+V
Sbjct  377  LVQQLYKLVDV  387



>emb|CDX79442.1| BnaC03g17780D [Brassica napus]
Length=471

 Score =   142 bits (358),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 71/79 (90%), Positives = 74/79 (94%), Gaps = 2/79 (3%)
 Frame = +1

Query  307  APPTPRQKVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGT  486
            APPT   KVR+HTISVFVGDESGMINRIAGVFARRGYNIESLAVGLN+DKALFTIVVSGT
Sbjct  71   APPT--SKVRKHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNRDKALFTIVVSGT  128

Query  487  EAVLQNVMEQLQKLVNVLK  543
            E VLQ V+EQLQKLVNVLK
Sbjct  129  ERVLQQVIEQLQKLVNVLK  147



>ref|XP_010557051.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like 
isoform X1 [Tarenaya hassleriana]
Length=489

 Score =   142 bits (358),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 86/159 (54%), Positives = 99/159 (62%), Gaps = 16/159 (10%)
 Frame = +1

Query  100  MAAISTHST-LFQRLKPPCDD----------LSFSRKLGFCTASPNIHVGKPKKLSVVFA  246
            MAAIST S    + L+  C +          LSF  K+ +        +    K  VV  
Sbjct  1    MAAISTASAPSLRSLRSSCPESALAIGSRKLLSFPTKISYPLTQSTNSIHDECKRMVVSV  60

Query  247  NAADGQHKAPSEITLSTSDPAPPTPRQKVRRHTISVFVGDESGMINRIAGVFARRGYNIE  426
             + D Q    S      S P+  T + KV++H ISVFVGDESGMINRIAGVFARRGYNIE
Sbjct  61   RSVDEQISDKS-----FSAPSSTTQKSKVKKHAISVFVGDESGMINRIAGVFARRGYNIE  115

Query  427  SLAVGLNKDKALFTIVVSGTEAVLQNVMEQLQKLVNVLK  543
            SLAVGLN+DKALFTIVV GTE VLQ V+EQLQKLVNVLK
Sbjct  116  SLAVGLNRDKALFTIVVCGTERVLQQVIEQLQKLVNVLK  154


 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 49/71 (69%), Gaps = 2/71 (3%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVG--LNKDKALFTIVVSGTEAVLQN  504
            +R HT+S+ V D  G++N + GVFARRGYNI+SLAVG    + ++  T V+  T+  +  
Sbjct  317  LRSHTLSLLVNDAPGVLNLVTGVFARRGYNIQSLAVGHAETEGRSRITTVIPATDESISK  376

Query  505  VMEQLQKLVNV  537
            +++QL KLV+V
Sbjct  377  LVQQLYKLVDV  387



>ref|XP_004157152.1| PREDICTED: uncharacterized protein LOC101232287 [Cucumis sativus]
Length=150

 Score =   135 bits (339),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 66/91 (73%), Positives = 78/91 (86%), Gaps = 0/91 (0%)
 Frame = +1

Query  271  APSEITLSTSDPAPPTPRQKVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNK  450
            A ++  ++ +D + P+ R  V RHTISVFVGDESG+INRIAGVFARRGYNIESLAVGLNK
Sbjct  56   AVNDNAVTVTDSSRPSIRSTVMRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNK  115

Query  451  DKALFTIVVSGTEAVLQNVMEQLQKLVNVLK  543
            DKALFTIVV+GTE VL+ V+EQL KLVNV+K
Sbjct  116  DKALFTIVVTGTENVLRQVVEQLNKLVNVIK  146



>emb|CDX84757.1| BnaA03g14730D [Brassica napus]
Length=467

 Score =   142 bits (357),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 71/79 (90%), Positives = 74/79 (94%), Gaps = 2/79 (3%)
 Frame = +1

Query  307  APPTPRQKVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGT  486
            APPT   KVR+HTISVFVGDESGMINRIAGVFARRGYNIESLAVGLN+DKALFTIVVSGT
Sbjct  67   APPT--SKVRKHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNRDKALFTIVVSGT  124

Query  487  EAVLQNVMEQLQKLVNVLK  543
            E VLQ V+EQLQKLVNVLK
Sbjct  125  ERVLQQVIEQLQKLVNVLK  143



>ref|XP_009366239.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic 
[Pyrus x bretschneideri]
Length=489

 Score =   142 bits (357),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 84/132 (64%), Positives = 94/132 (71%), Gaps = 7/132 (5%)
 Frame = +1

Query  160  LSFSRKLGF-CTASPN---IHVGKPKKLSVVFANAADGQHKAPSEITLSTSDPAPPTPRQ  327
            L FS  L F  T+S +   IH     K   V A + D   +  S+   S++   P T R 
Sbjct  26   LGFSETLLFPLTSSASRSIIHSHDRHKQLAVSARSFD---QNISDSGFSSNGSPPSTARS  82

Query  328  KVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTEAVLQNV  507
            KVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTE VL+ V
Sbjct  83   KVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTETVLRLV  142

Query  508  MEQLQKLVNVLK  543
            +EQL KLVNV+K
Sbjct  143  IEQLNKLVNVMK  154


 Score = 65.1 bits (157),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 49/71 (69%), Gaps = 2/71 (3%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQN  504
            +R HT+S+ V D  G++  I GVFARRGYNI+SLAVG  + + L   T VV GT+  +  
Sbjct  317  LRSHTLSMLVNDIPGVLYIITGVFARRGYNIQSLAVGHAEAEGLSRITTVVPGTDESISK  376

Query  505  VMEQLQKLVNV  537
            +++QL KLV++
Sbjct  377  LVQQLYKLVDI  387



>ref|XP_004504413.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like 
[Cicer arietinum]
Length=424

 Score =   141 bits (355),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 75/115 (65%), Positives = 86/115 (75%), Gaps = 8/115 (7%)
 Frame = +1

Query  199  PNIHVGKPKKLSVVFANAADGQHKAPSEITLSTSDPAPPTPRQKVRRHTISVFVGDESGM  378
            P     +  KL++  A +AD         T+S++ P     R KVRRHTISVFVGDESGM
Sbjct  34   PTTSTPRRNKLTLSAATSAD--------TTVSSNGPVTSPSRSKVRRHTISVFVGDESGM  85

Query  379  INRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTEAVLQNVMEQLQKLVNVLK  543
            INRIAGVFARRGYNIESLAVGLN+D+ALF+IVVSGT  VLQ V+EQLQKLVNVLK
Sbjct  86   INRIAGVFARRGYNIESLAVGLNQDRALFSIVVSGTNRVLQQVVEQLQKLVNVLK  140


 Score = 66.6 bits (161),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 50/71 (70%), Gaps = 2/71 (3%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQN  504
            +R HT+S+ V D  G++N + GVFARRGYNI+SLAVG ++ + +   T VV GT+  +  
Sbjct  252  IRSHTLSMLVNDAPGVLNCVTGVFARRGYNIQSLAVGHSEVEGVSRLTTVVPGTDESISK  311

Query  505  VMEQLQKLVNV  537
            +++QL KLV +
Sbjct  312  LVQQLYKLVEL  322



>emb|CAX48742.1| acetohydroxyacid synthase regulatory subunit 1 precursor [Eupatorium 
cannabinum]
Length=475

 Score =   141 bits (356),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 88/152 (58%), Positives = 102/152 (67%), Gaps = 18/152 (12%)
 Frame = +1

Query  103  AAISTHST--LFQRLKPPCDDLSFSRKL--GFCTASPNIHVGKPKKLSVVFANAADGQHK  270
            A +ST+S   +  R KP   +L  S K   G  +++P     K      +F  A++G   
Sbjct  3    AVVSTYSAGLIHSRGKPSSFNLLPSSKTFDGLLSSNP-----KTFHFKRLFVQASNG---  54

Query  271  APSEITLSTS-DPAPPTPRQKVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLN  447
                 T+ST+ D      R KVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLN
Sbjct  55   -----TVSTAVDSTSSMARPKVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLN  109

Query  448  KDKALFTIVVSGTEAVLQNVMEQLQKLVNVLK  543
            KDKALFTIVVSGTE VL+ VM+QL KLVNVLK
Sbjct  110  KDKALFTIVVSGTERVLEQVMKQLLKLVNVLK  141


 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 50/71 (70%), Gaps = 2/71 (3%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLN--KDKALFTIVVSGTEAVLQN  504
            +R HT+S+ V D  G++N + GVF RRGYNI+SLAVG    + ++  T VV GT+  ++ 
Sbjct  303  LRSHTLSIVVNDSPGVLNIVTGVFTRRGYNIQSLAVGHAEVEGRSRITTVVPGTDESIRK  362

Query  505  VMEQLQKLVNV  537
            +++QL KL++V
Sbjct  363  LVQQLYKLIDV  373



>ref|XP_009132818.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like 
[Brassica rapa]
Length=480

 Score =   141 bits (356),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 71/79 (90%), Positives = 74/79 (94%), Gaps = 2/79 (3%)
 Frame = +1

Query  307  APPTPRQKVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGT  486
            APPT   KVR+HTISVFVGDESGMINRIAGVFARRGYNIESLAVGLN+DKALFTIVVSGT
Sbjct  67   APPT--SKVRKHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNRDKALFTIVVSGT  124

Query  487  EAVLQNVMEQLQKLVNVLK  543
            E VLQ V+EQLQKLVNVLK
Sbjct  125  ERVLQQVIEQLQKLVNVLK  143


 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 49/71 (69%), Gaps = 2/71 (3%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQN  504
            +R HT+S+ V D  G++N + GVFARRGYNI+SLAVG  + + +   T VV  T+  +  
Sbjct  306  LRSHTLSLLVNDVPGVLNLVTGVFARRGYNIQSLAVGHAEAQGISRITTVVPATDESVSK  365

Query  505  VMEQLQKLVNV  537
            +++QL KLV+V
Sbjct  366  LVQQLYKLVDV  376



>ref|XP_004490063.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like 
isoform X2 [Cicer arietinum]
Length=475

 Score =   141 bits (356),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 79/127 (62%), Positives = 91/127 (72%), Gaps = 9/127 (7%)
 Frame = +1

Query  166  FSRKLGFCTAS-PNIHVGKPKKLSVVFANAADGQHKAPSEITLSTSDPAPPTPRQKVRRH  342
            FS +L   T   P     +  KL++  A +AD         T+S++ P     R KVRRH
Sbjct  22   FSLQLNSTTLFFPTTSTPRRNKLTLSAATSAD--------TTVSSNGPVTSPSRSKVRRH  73

Query  343  TISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTEAVLQNVMEQLQ  522
            TISVFVGDESGMINRIAGVFARRGYNIESLAVGLN+D+ALF+IVVSGT  VLQ V+EQLQ
Sbjct  74   TISVFVGDESGMINRIAGVFARRGYNIESLAVGLNQDRALFSIVVSGTNRVLQQVVEQLQ  133

Query  523  KLVNVLK  543
            KLVNVLK
Sbjct  134  KLVNVLK  140


 Score = 67.0 bits (162),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 50/71 (70%), Gaps = 2/71 (3%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQN  504
            +R HT+S+ V D  G++N + GVFARRGYNI+SLAVG ++ + +   T VV GT+  +  
Sbjct  303  IRSHTLSMLVNDAPGVLNCVTGVFARRGYNIQSLAVGHSEVEGVSRLTTVVPGTDESISK  362

Query  505  VMEQLQKLVNV  537
            +++QL KLV +
Sbjct  363  LVQQLYKLVEL  373



>emb|CDP08089.1| unnamed protein product [Coffea canephora]
Length=506

 Score =   141 bits (355),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 69/76 (91%), Positives = 71/76 (93%), Gaps = 0/76 (0%)
 Frame = +1

Query  316  TPRQKVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTEAV  495
            T R KVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVV GT+ V
Sbjct  96   TTRPKVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVCGTDTV  155

Query  496  LQNVMEQLQKLVNVLK  543
            LQ VMEQLQKLVNV+K
Sbjct  156  LQQVMEQLQKLVNVIK  171


 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 50/71 (70%), Gaps = 2/71 (3%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQN  504
            +R HT+S+ V D  G++N + GVFARRGYNI+SLAVG  + + L   T VV GT+A +  
Sbjct  334  LRSHTLSMLVNDTPGVLNIVTGVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDASISK  393

Query  505  VMEQLQKLVNV  537
            +++QL KLV +
Sbjct  394  LVQQLSKLVEL  404



>gb|KGN66641.1| hypothetical protein Csa_1G652240 [Cucumis sativus]
Length=181

 Score =   134 bits (338),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 66/91 (73%), Positives = 78/91 (86%), Gaps = 0/91 (0%)
 Frame = +1

Query  271  APSEITLSTSDPAPPTPRQKVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNK  450
            A ++  ++ +D + P+ R  V RHTISVFVGDESG+INRIAGVFARRGYNIESLAVGLNK
Sbjct  56   AVNDNAVTVTDSSRPSIRSTVMRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNK  115

Query  451  DKALFTIVVSGTEAVLQNVMEQLQKLVNVLK  543
            DKALFTIVV+GTE VL+ V+EQL KLVNV+K
Sbjct  116  DKALFTIVVTGTENVLRQVVEQLNKLVNVIK  146



>ref|XP_004490062.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like 
isoform X1 [Cicer arietinum]
Length=564

 Score =   141 bits (355),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 75/115 (65%), Positives = 86/115 (75%), Gaps = 8/115 (7%)
 Frame = +1

Query  199  PNIHVGKPKKLSVVFANAADGQHKAPSEITLSTSDPAPPTPRQKVRRHTISVFVGDESGM  378
            P     +  KL++  A +AD         T+S++ P     R KVRRHTISVFVGDESGM
Sbjct  34   PTTSTPRRNKLTLSAATSAD--------TTVSSNGPVTSPSRSKVRRHTISVFVGDESGM  85

Query  379  INRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTEAVLQNVMEQLQKLVNVLK  543
            INRIAGVFARRGYNIESLAVGLN+D+ALF+IVVSGT  VLQ V+EQLQKLVNVLK
Sbjct  86   INRIAGVFARRGYNIESLAVGLNQDRALFSIVVSGTNRVLQQVVEQLQKLVNVLK  140


 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 50/71 (70%), Gaps = 2/71 (3%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQN  504
            +R HT+S+ V D  G++N + GVFARRGYNI+SLAVG ++ + +   T VV GT+  +  
Sbjct  303  IRSHTLSMLVNDAPGVLNCVTGVFARRGYNIQSLAVGHSEVEGVSRLTTVVPGTDESISK  362

Query  505  VMEQLQKLVNV  537
            +++QL KLV +
Sbjct  363  LVQQLYKLVEL  373



>ref|XP_009144047.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic 
isoform X3 [Brassica rapa]
Length=446

 Score =   140 bits (353),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 68/76 (89%), Positives = 72/76 (95%), Gaps = 0/76 (0%)
 Frame = +1

Query  316  TPRQKVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTEAV  495
            TP  KVR+HTISVFVGDESGMINRIAGVFARRGYNI+SLAVGLN+DKALFTIVVSGTE V
Sbjct  59   TPNSKVRKHTISVFVGDESGMINRIAGVFARRGYNIQSLAVGLNRDKALFTIVVSGTERV  118

Query  496  LQNVMEQLQKLVNVLK  543
            LQ V+EQLQKLVNVLK
Sbjct  119  LQQVIEQLQKLVNVLK  134


 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 49/71 (69%), Gaps = 2/71 (3%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQN  504
            +R HT+S+ V D  G++N + GVFARRGYNI+SLAVG  + + +   T VV  T+  +  
Sbjct  297  LRSHTLSLLVNDVPGVLNLVTGVFARRGYNIQSLAVGHAETEGISRITTVVPATDESVSK  356

Query  505  VMEQLQKLVNV  537
            +++QL KLV+V
Sbjct  357  LVQQLYKLVDV  367



>ref|XP_010039380.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like 
[Eucalyptus grandis]
Length=423

 Score =   139 bits (351),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 69/78 (88%), Positives = 71/78 (91%), Gaps = 0/78 (0%)
 Frame = +1

Query  310  PPTPRQKVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTE  489
            P     +VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKD+ALFTIVVSGTE
Sbjct  11   PCWDDSRVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDRALFTIVVSGTE  70

Query  490  AVLQNVMEQLQKLVNVLK  543
             VLQ VMEQLQKLVNVLK
Sbjct  71   RVLQQVMEQLQKLVNVLK  88


 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 51/71 (72%), Gaps = 2/71 (3%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQN  504
            +R HT+S+ V D  G++N I GVF+RRGYNI+SLAVG ++ + L   T VV GT+  +  
Sbjct  251  LRSHTLSMIVKDAPGVLNIITGVFSRRGYNIQSLAVGHSEVEGLSRITTVVPGTDESISK  310

Query  505  VMEQLQKLVNV  537
            +++QL KLV++
Sbjct  311  LVQQLYKLVDL  321



>emb|CDY42070.1| BnaA05g11160D [Brassica napus]
Length=469

 Score =   140 bits (353),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 68/76 (89%), Positives = 72/76 (95%), Gaps = 0/76 (0%)
 Frame = +1

Query  316  TPRQKVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTEAV  495
            TP  KVR+HTISVFVGDESGMINRIAGVFARRGYNI+SLAVGLN+DKALFTIVVSGTE V
Sbjct  70   TPNSKVRKHTISVFVGDESGMINRIAGVFARRGYNIQSLAVGLNRDKALFTIVVSGTERV  129

Query  496  LQNVMEQLQKLVNVLK  543
            LQ V+EQLQKLVNVLK
Sbjct  130  LQQVIEQLQKLVNVLK  145



>ref|XP_009144045.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic 
isoform X1 [Brassica rapa]
Length=457

 Score =   140 bits (352),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 68/76 (89%), Positives = 72/76 (95%), Gaps = 0/76 (0%)
 Frame = +1

Query  316  TPRQKVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTEAV  495
            TP  KVR+HTISVFVGDESGMINRIAGVFARRGYNI+SLAVGLN+DKALFTIVVSGTE V
Sbjct  59   TPNSKVRKHTISVFVGDESGMINRIAGVFARRGYNIQSLAVGLNRDKALFTIVVSGTERV  118

Query  496  LQNVMEQLQKLVNVLK  543
            LQ V+EQLQKLVNVLK
Sbjct  119  LQQVIEQLQKLVNVLK  134


 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 49/71 (69%), Gaps = 2/71 (3%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQN  504
            +R HT+S+ V D  G++N + GVFARRGYNI+SLAVG  + + +   T VV  T+  +  
Sbjct  297  LRSHTLSLLVNDVPGVLNLVTGVFARRGYNIQSLAVGHAETEGISRITTVVPATDESVSK  356

Query  505  VMEQLQKLVNV  537
            +++QL KLV+V
Sbjct  357  LVQQLYKLVDV  367



>ref|XP_006294093.1| hypothetical protein CARUB_v10023086mg [Capsella rubella]
 gb|EOA26991.1| hypothetical protein CARUB_v10023086mg [Capsella rubella]
Length=492

 Score =   140 bits (353),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 84/160 (53%), Positives = 102/160 (64%), Gaps = 17/160 (11%)
 Frame = +1

Query  100  MAAISTHSTLFQR-LKPPCDD-----------LSFSRKLGFCTASPNIHVGKPKKLSVVF  243
            MAAIS  S+   R L+  C D           +SF+ K+ + + + +    +  K     
Sbjct  1    MAAISVSSSPSLRCLRSACSDSPPALVSTTTRVSFAAKISYLSGNSSNRGEEMGKRMEGI  60

Query  244  ANAADGQHKAPSEITLSTSDPAPPTPRQKVRRHTISVFVGDESGMINRIAGVFARRGYNI  423
              + DG+    S       + +  TP+ KVR+HTISVFVGDESGMINRIAGVFARRGYNI
Sbjct  61   VRSVDGKISDAS-----FPEASSATPKSKVRKHTISVFVGDESGMINRIAGVFARRGYNI  115

Query  424  ESLAVGLNKDKALFTIVVSGTEAVLQNVMEQLQKLVNVLK  543
            ESLAVGLN+DKALFTIVV GTE VLQ V+EQL KLVNVLK
Sbjct  116  ESLAVGLNRDKALFTIVVCGTERVLQQVIEQLLKLVNVLK  155


 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 50/71 (70%), Gaps = 2/71 (3%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQN  504
            +R HT+S+ V D  G++N + GVFARRGYNI+SLAVG  + K +   T+VV  T+  +  
Sbjct  318  LRSHTLSLLVSDVPGVLNIVTGVFARRGYNIQSLAVGHAETKGISRITLVVPATDESVSK  377

Query  505  VMEQLQKLVNV  537
            +++QL KLV+V
Sbjct  378  LVQQLNKLVDV  388



>ref|XP_006470698.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like 
[Citrus sinensis]
Length=488

 Score =   140 bits (353),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 79/109 (72%), Positives = 87/109 (80%), Gaps = 8/109 (7%)
 Frame = +1

Query  217  KPKKLSVVFANAADGQHKAPSEITLSTSDPAPPTPRQKVRRHTISVFVGDESGMINRIAG  396
            +PKKL+V  A +AD   +  +E T ++      T R  VRRHTISVFVGDESGMINRIAG
Sbjct  54   EPKKLAVS-ARSAD---ENITEGTFTSRS----TNRTNVRRHTISVFVGDESGMINRIAG  105

Query  397  VFARRGYNIESLAVGLNKDKALFTIVVSGTEAVLQNVMEQLQKLVNVLK  543
            VFARRGYNIESLAVGLNKDKALFTIVV GT+ VLQ VMEQLQKLVNVLK
Sbjct  106  VFARRGYNIESLAVGLNKDKALFTIVVYGTDKVLQQVMEQLQKLVNVLK  154


 Score = 67.4 bits (163),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 49/71 (69%), Gaps = 2/71 (3%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQN  504
            +R HT+S+ V D  G++N + GVFARRGYNI+SLAVG  + + L   T VV  T+  +  
Sbjct  316  LRSHTLSMLVNDSPGVLNIVTGVFARRGYNIQSLAVGHAETEGLSRITTVVPATDESISK  375

Query  505  VMEQLQKLVNV  537
            +M+QL KL+++
Sbjct  376  LMQQLYKLIDL  386



>gb|KDO50434.1| hypothetical protein CISIN_1g047033mg, partial [Citrus sinensis]
Length=514

 Score =   140 bits (352),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 79/109 (72%), Positives = 87/109 (80%), Gaps = 8/109 (7%)
 Frame = +1

Query  217  KPKKLSVVFANAADGQHKAPSEITLSTSDPAPPTPRQKVRRHTISVFVGDESGMINRIAG  396
            +PKKL+V  A +AD   +  +E T ++      T R  VRRHTISVFVGDESGMINRIAG
Sbjct  68   EPKKLAVS-ARSAD---ENITEGTFTSRS----TNRTNVRRHTISVFVGDESGMINRIAG  119

Query  397  VFARRGYNIESLAVGLNKDKALFTIVVSGTEAVLQNVMEQLQKLVNVLK  543
            VFARRGYNIESLAVGLNKDKALFTIVV GT+ VLQ VMEQLQKLVNVLK
Sbjct  120  VFARRGYNIESLAVGLNKDKALFTIVVYGTDKVLQQVMEQLQKLVNVLK  168


 Score = 67.4 bits (163),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 49/71 (69%), Gaps = 2/71 (3%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQN  504
            +R HT+S+ V D  G++N + GVFARRGYNI+SLAVG  + + L   T VV  T+  +  
Sbjct  342  LRSHTLSMLVNDSPGVLNIVTGVFARRGYNIQSLAVGHAETEGLSRITTVVPATDESISK  401

Query  505  VMEQLQKLVNV  537
            +M+QL KL+++
Sbjct  402  LMQQLYKLIDL  412



>ref|XP_007028127.1| Valine-tolerant 1 isoform 2 [Theobroma cacao]
 gb|EOY08629.1| Valine-tolerant 1 isoform 2 [Theobroma cacao]
Length=402

 Score =   139 bits (349),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 84/154 (55%), Positives = 99/154 (64%), Gaps = 13/154 (8%)
 Frame = +1

Query  100  MAAISTHSTLFQRLKPPCDDLSFSRKL-GF-----CTASPNIHVGKPKKLSVVFANAADG  261
            MAA S   + +     P  +  FSRK  GF     C+   N    + + L VV A   D 
Sbjct  1    MAAASVSPSPYSTTTIPTQNPPFSRKTTGFLHLRQCSIYYNGFKARSRSLHVVSATT-DK  59

Query  262  QHKAPSEITLSTSDPAPPTPRQKVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVG  441
             +  P   T+S      P    KV+RHTISVFVGDESG+INRIAGVFARRGYNIESLAVG
Sbjct  60   ANALPLNETVS------PATASKVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVG  113

Query  442  LNKDKALFTIVVSGTEAVLQNVMEQLQKLVNVLK  543
            LNKDKA+FTIVVSGTE +L+ V+EQL KLVNV+K
Sbjct  114  LNKDKAIFTIVVSGTEMILRQVVEQLNKLVNVIK  147


 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 49/73 (67%), Gaps = 2/73 (3%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQN  504
            ++ HT+S+ V D  G++N + GV +RRGYNI+SLAVG  +   L   T VV GT   +  
Sbjct  230  LQSHTLSMVVNDTPGVLNVVTGVISRRGYNIQSLAVGPAERDELSRITTVVPGTNETIGK  289

Query  505  VMEQLQKLVNVLK  543
            +++QLQKLV++ +
Sbjct  290  LVQQLQKLVDLYE  302



>ref|XP_010469676.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like 
isoform X2 [Camelina sativa]
Length=491

 Score =   140 bits (352),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 68/76 (89%), Positives = 71/76 (93%), Gaps = 0/76 (0%)
 Frame = +1

Query  316  TPRQKVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTEAV  495
            TP  KVR+HTISVFVGDESGMINRIAGVFARRGYNIESLAVGLN+DKALFTIVV GTE V
Sbjct  79   TPTSKVRKHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNRDKALFTIVVCGTERV  138

Query  496  LQNVMEQLQKLVNVLK  543
            LQ V+EQLQKLVNVLK
Sbjct  139  LQQVIEQLQKLVNVLK  154


 Score = 67.0 bits (162),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 49/71 (69%), Gaps = 2/71 (3%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQN  504
            +R HT+S+ V D  G++N + GVFARRGYNI+SLAVG  + K +   T VV  T+  +  
Sbjct  317  LRSHTLSLLVNDVPGVLNIVTGVFARRGYNIQSLAVGHAETKGISRITTVVPATDESVSK  376

Query  505  VMEQLQKLVNV  537
            +++QL KLV+V
Sbjct  377  LVQQLNKLVDV  387



>ref|XP_002266924.2| PREDICTED: acetolactate synthase small subunit 2, chloroplastic 
[Vitis vinifera]
 ref|XP_010646454.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic 
[Vitis vinifera]
 ref|XP_010646455.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic 
[Vitis vinifera]
 emb|CBI23353.3| unnamed protein product [Vitis vinifera]
Length=476

 Score =   139 bits (351),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 68/79 (86%), Positives = 73/79 (92%), Gaps = 0/79 (0%)
 Frame = +1

Query  307  APPTPRQKVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGT  486
            APP  R KV+RHTISVFVGDESG+INRIAGVFARRGYNIESLAVGLN+DKALFTIVVSGT
Sbjct  63   APPIQRSKVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNEDKALFTIVVSGT  122

Query  487  EAVLQNVMEQLQKLVNVLK  543
            E VL+ V+EQL KLVNVLK
Sbjct  123  ETVLRQVVEQLNKLVNVLK  141


 Score = 61.2 bits (147),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 49/71 (69%), Gaps = 2/71 (3%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVG--LNKDKALFTIVVSGTEAVLQN  504
            +R HT+S+ V D  G++N + GV +RR YNI+SLAVG    + ++  T VV GT+  +  
Sbjct  304  LRSHTLSMLVNDTPGVLNIVTGVISRRSYNIQSLAVGPAEMEGRSHITTVVPGTDESISK  363

Query  505  VMEQLQKLVNV  537
            +++QLQKL+++
Sbjct  364  LVQQLQKLIDL  374



>ref|XP_007201965.1| hypothetical protein PRUPE_ppa004716mg [Prunus persica]
 gb|EMJ03164.1| hypothetical protein PRUPE_ppa004716mg [Prunus persica]
Length=494

 Score =   139 bits (351),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 69/85 (81%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = +1

Query  289  LSTSDPAPPTPRQKVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFT  468
             S++  +P   R KVRRH ISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFT
Sbjct  75   FSSNGSSPLASRSKVRRHAISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFT  134

Query  469  IVVSGTEAVLQNVMEQLQKLVNVLK  543
            IVVSGTE VL+ V+EQL KLVNVLK
Sbjct  135  IVVSGTETVLRQVIEQLNKLVNVLK  159


 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 48/71 (68%), Gaps = 2/71 (3%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQN  504
            +R HT+S+ V D  G++  + GVFARRGYNI+SLAVG  + + L   T VV GT+  +  
Sbjct  322  LRSHTLSMLVNDVPGVLYIVTGVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISK  381

Query  505  VMEQLQKLVNV  537
            +++QL KL ++
Sbjct  382  LVQQLYKLADI  392



>ref|XP_007028126.1| ACT domain-containing small subunit of acetolactate synthase 
protein isoform 1 [Theobroma cacao]
 gb|EOY08628.1| ACT domain-containing small subunit of acetolactate synthase 
protein isoform 1 [Theobroma cacao]
Length=482

 Score =   139 bits (349),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 84/154 (55%), Positives = 99/154 (64%), Gaps = 13/154 (8%)
 Frame = +1

Query  100  MAAISTHSTLFQRLKPPCDDLSFSRKL-GF-----CTASPNIHVGKPKKLSVVFANAADG  261
            MAA S   + +     P  +  FSRK  GF     C+   N    + + L VV A   D 
Sbjct  1    MAAASVSPSPYSTTTIPTQNPPFSRKTTGFLHLRQCSIYYNGFKARSRSLHVVSATT-DK  59

Query  262  QHKAPSEITLSTSDPAPPTPRQKVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVG  441
             +  P   T+S      P    KV+RHTISVFVGDESG+INRIAGVFARRGYNIESLAVG
Sbjct  60   ANALPLNETVS------PATASKVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVG  113

Query  442  LNKDKALFTIVVSGTEAVLQNVMEQLQKLVNVLK  543
            LNKDKA+FTIVVSGTE +L+ V+EQL KLVNV+K
Sbjct  114  LNKDKAIFTIVVSGTEMILRQVVEQLNKLVNVIK  147


 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 49/73 (67%), Gaps = 2/73 (3%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQN  504
            ++ HT+S+ V D  G++N + GV +RRGYNI+SLAVG  +   L   T VV GT   +  
Sbjct  310  LQSHTLSMVVNDTPGVLNVVTGVISRRGYNIQSLAVGPAERDELSRITTVVPGTNETIGK  369

Query  505  VMEQLQKLVNVLK  543
            +++QLQKLV++ +
Sbjct  370  LVQQLQKLVDLYE  382



>ref|XP_009351614.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic-like 
[Pyrus x bretschneideri]
Length=479

 Score =   138 bits (348),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 68/85 (80%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = +1

Query  289  LSTSDPAPPTPRQKVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFT  468
            +S SD  P     KV+RHTISVFVGDESG+INRIAGVFARRGYNIESLAVGLNKDKALFT
Sbjct  60   VSVSDSVPSLTSSKVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFT  119

Query  469  IVVSGTEAVLQNVMEQLQKLVNVLK  543
            IVVSGTE VL+ V+EQL KLVNV+K
Sbjct  120  IVVSGTEKVLRQVVEQLNKLVNVIK  144


 Score = 67.0 bits (162),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 49/71 (69%), Gaps = 2/71 (3%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQN  504
            VR HT+S+ V D  G++N + GV +RRGYNI+SLAVG  + + L   T VV GTE  +  
Sbjct  307  VRSHTLSMIVNDSPGVLNIVTGVISRRGYNIQSLAVGPAEKEGLSRITTVVPGTEDSISK  366

Query  505  VMEQLQKLVNV  537
            +++QL KL+++
Sbjct  367  LVQQLHKLIDL  377



>gb|KDO77106.1| hypothetical protein CISIN_1g0114911mg [Citrus sinensis]
Length=349

 Score =   136 bits (343),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 72/107 (67%), Positives = 81/107 (76%), Gaps = 6/107 (6%)
 Frame = +1

Query  223  KKLSVVFANAADGQHKAPSEITLSTSDPAPPTPRQKVRRHTISVFVGDESGMINRIAGVF  402
            KKL +V A+ +   +  P       S   PP    KV+RHTISVFVGDESG+INRIAGVF
Sbjct  47   KKLQLVTASGSTSNNALP------VSQSVPPITASKVKRHTISVFVGDESGIINRIAGVF  100

Query  403  ARRGYNIESLAVGLNKDKALFTIVVSGTEAVLQNVMEQLQKLVNVLK  543
            ARRGYNIESLAVGLN DKALFTIVVSGTE VL+ V+EQL KLVNV+K
Sbjct  101  ARRGYNIESLAVGLNVDKALFTIVVSGTERVLRQVVEQLNKLVNVIK  147



>gb|AFW62902.1| LOW QUALITY PROTEIN: hypothetical protein ZEAMMB73_432211 [Zea 
mays]
Length=250

 Score =   134 bits (337),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 66/73 (90%), Positives = 68/73 (93%), Gaps = 0/73 (0%)
 Frame = +1

Query  322  RQKVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTEAVLQ  501
            R KVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGT+ VL 
Sbjct  74   RDKVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDRVLN  133

Query  502  NVMEQLQKLVNVL  540
             V+EQL KLVNVL
Sbjct  134  QVIEQLNKLVNVL  146



>ref|XP_003524233.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like 
[Glycine max]
Length=476

 Score =   138 bits (347),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 67/74 (91%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +1

Query  322  RQKVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTEAVLQ  501
            R KVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLN+D+ALFTIVVSGT+ VL+
Sbjct  68   RSKVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNEDRALFTIVVSGTDKVLR  127

Query  502  NVMEQLQKLVNVLK  543
             VMEQLQKLVNVLK
Sbjct  128  QVMEQLQKLVNVLK  141


 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 49/71 (69%), Gaps = 2/71 (3%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQN  504
            +R HT+S+ V D  G++N + GVFARRGYNI+SLAVG  + + L   T VV GT+  +  
Sbjct  304  IRSHTLSMLVNDAPGVLNIVTGVFARRGYNIQSLAVGHAEVEGLSRLTTVVPGTDESISK  363

Query  505  VMEQLQKLVNV  537
            +++QL KLV +
Sbjct  364  LVQQLYKLVEL  374



>dbj|BAH19535.1| AT5G16290 [Arabidopsis thaliana]
Length=477

 Score =   137 bits (346),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 81/155 (52%), Positives = 103/155 (66%), Gaps = 18/155 (12%)
 Frame = +1

Query  100  MAAISTHSTLFQ-RLKPPCDDLSFSRKLGFCTASPN------IHVGKPKKLSVVFANAAD  258
            MAA +T ++LF  RL     +  +    GF   +PN      I  G+  + + V + A+ 
Sbjct  1    MAATTTATSLFSSRLHFQNQNQGY----GFPAKTPNSLQVNQIIDGRKMRNATVLSAAS-  55

Query  259  GQHKAPSEITLSTSDPAPPTPRQKVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAV  438
                  ++  ++T+    PT   +VRRHTISVFVGDESG+INRIAGVFARRGYNIESLAV
Sbjct  56   ------TDKAITTAQSVAPTACDRVRRHTISVFVGDESGIINRIAGVFARRGYNIESLAV  109

Query  439  GLNKDKALFTIVVSGTEAVLQNVMEQLQKLVNVLK  543
            GLN+DKALFTIVV GT+ VLQ V+EQL KLVNV+K
Sbjct  110  GLNEDKALFTIVVLGTDKVLQQVVEQLNKLVNVIK  144


 Score = 61.2 bits (147),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 48/71 (68%), Gaps = 2/71 (3%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQN  504
            +R HT+S+ V +  G++N I G  +RRGYNI+SLAVG  + + L   T V+ GT+  +  
Sbjct  305  LRSHTLSLLVANVPGVLNLITGAISRRGYNIQSLAVGPAEKEGLSRITTVIPGTDENIDK  364

Query  505  VMEQLQKLVNV  537
            ++ QLQKL+++
Sbjct  365  LVRQLQKLIDL  375



>ref|XP_003532793.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like 
[Glycine max]
Length=474

 Score =   137 bits (346),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 67/74 (91%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +1

Query  322  RQKVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTEAVLQ  501
            R KVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLN+D+ALFTIVVSGT+ VL+
Sbjct  66   RSKVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNEDRALFTIVVSGTDKVLR  125

Query  502  NVMEQLQKLVNVLK  543
             VMEQLQKLVNVLK
Sbjct  126  QVMEQLQKLVNVLK  139


 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 49/71 (69%), Gaps = 2/71 (3%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQN  504
            +R HT+S+ V D  G++N + GVFARRGYNI+SLAVG  + + L   T VV GT+  +  
Sbjct  302  IRSHTLSMLVNDAPGVLNIVTGVFARRGYNIQSLAVGHAEVEGLSRLTTVVPGTDESISK  361

Query  505  VMEQLQKLVNV  537
            +++QL KLV +
Sbjct  362  LVQQLYKLVEL  372



>ref|NP_197133.1| acetolactate synthase small subunit 1 [Arabidopsis thaliana]
 ref|NP_850829.1| acetolactate synthase small subunit 1 [Arabidopsis thaliana]
 sp|Q9FFF4.1|ILVH1_ARATH RecName: Full=Acetolactate synthase small subunit 1, chloroplastic; 
AltName: Full=Acetohydroxy-acid synthase small subunit; 
Short=AHAS; Short=ALS; AltName: Full=Protein valine-tolerant 
1; Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB09596.1| acetolactate synthase-like protein [Arabidopsis thaliana]
 gb|AAY25401.1| At5g16290 [Arabidopsis thaliana]
 dbj|BAE98982.1| acetolactate synthase-like protein [Arabidopsis thaliana]
 gb|AED92272.1| acetolactate synthase small subunit 1 [Arabidopsis thaliana]
 gb|AED92273.1| acetolactate synthase small subunit 1 [Arabidopsis thaliana]
Length=477

 Score =   137 bits (346),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 81/155 (52%), Positives = 103/155 (66%), Gaps = 18/155 (12%)
 Frame = +1

Query  100  MAAISTHSTLFQ-RLKPPCDDLSFSRKLGFCTASPN------IHVGKPKKLSVVFANAAD  258
            MAA +T ++LF  RL     +  +    GF   +PN      I  G+  + + V + A+ 
Sbjct  1    MAATTTATSLFSSRLHFQNQNQGY----GFPAKTPNSLQVNQIIDGRKMRNATVLSAAS-  55

Query  259  GQHKAPSEITLSTSDPAPPTPRQKVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAV  438
                  ++  ++T+    PT   +VRRHTISVFVGDESG+INRIAGVFARRGYNIESLAV
Sbjct  56   ------TDKAITTAQSVAPTACDRVRRHTISVFVGDESGIINRIAGVFARRGYNIESLAV  109

Query  439  GLNKDKALFTIVVSGTEAVLQNVMEQLQKLVNVLK  543
            GLN+DKALFTIVV GT+ VLQ V+EQL KLVNV+K
Sbjct  110  GLNEDKALFTIVVLGTDKVLQQVVEQLNKLVNVIK  144


 Score = 61.2 bits (147),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 48/71 (68%), Gaps = 2/71 (3%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQN  504
            +R HT+S+ V +  G++N I G  +RRGYNI+SLAVG  + + L   T V+ GT+  +  
Sbjct  305  LRSHTLSLLVANVPGVLNLITGAISRRGYNIQSLAVGPAEKEGLSRITTVIPGTDENIDK  364

Query  505  VMEQLQKLVNV  537
            ++ QLQKL+++
Sbjct  365  LVRQLQKLIDL  375



>gb|KDO77103.1| hypothetical protein CISIN_1g0114911mg, partial [Citrus sinensis]
 gb|KDO77104.1| hypothetical protein CISIN_1g0114911mg, partial [Citrus sinensis]
 gb|KDO77105.1| hypothetical protein CISIN_1g0114911mg, partial [Citrus sinensis]
Length=384

 Score =   136 bits (343),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 72/107 (67%), Positives = 81/107 (76%), Gaps = 6/107 (6%)
 Frame = +1

Query  223  KKLSVVFANAADGQHKAPSEITLSTSDPAPPTPRQKVRRHTISVFVGDESGMINRIAGVF  402
            KKL +V A+ +   +  P       S   PP    KV+RHTISVFVGDESG+INRIAGVF
Sbjct  47   KKLQLVTASGSTSNNALP------VSQSVPPITASKVKRHTISVFVGDESGIINRIAGVF  100

Query  403  ARRGYNIESLAVGLNKDKALFTIVVSGTEAVLQNVMEQLQKLVNVLK  543
            ARRGYNIESLAVGLN DKALFTIVVSGTE VL+ V+EQL KLVNV+K
Sbjct  101  ARRGYNIESLAVGLNVDKALFTIVVSGTERVLRQVVEQLNKLVNVIK  147


 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/71 (41%), Positives = 48/71 (68%), Gaps = 2/71 (3%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQN  504
            +R HT+S+ V +  G++N + GV +RRGYNI+SLAVG  + + L   T VV GT+  +  
Sbjct  312  LRSHTLSMLVNNTPGVLNIVTGVISRRGYNIQSLAVGPAEKEGLSCITTVVPGTDESIGK  371

Query  505  VMEQLQKLVNV  537
            +++ L KL+++
Sbjct  372  LVQLLHKLIDL  382



>ref|XP_002871713.1| hypothetical protein ARALYDRAFT_488480 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47972.1| hypothetical protein ARALYDRAFT_488480 [Arabidopsis lyrata subsp. 
lyrata]
Length=476

 Score =   137 bits (345),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 80/154 (52%), Positives = 103/154 (67%), Gaps = 18/154 (12%)
 Frame = +1

Query  100  MAAISTHSTLFQRLKPPCDDLSFSRKLGFCTASPN------IHVGKPKKLSVVFANAADG  261
            MAA +T ++LF     P    + ++  GF   +PN      I  G+  + + V + A+  
Sbjct  1    MAATATAASLF-----PSYFQNQNKVYGFPAKTPNSLQVTPIIDGRKMRNATVLSAAS--  53

Query  262  QHKAPSEITLSTSDPAPPTPRQKVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVG  441
                 ++  ++T+    PT   +VRRHTISVFVGDESG+INRIAGVFARRGYNIESLAVG
Sbjct  54   -----TDKAITTAQSIAPTACDRVRRHTISVFVGDESGIINRIAGVFARRGYNIESLAVG  108

Query  442  LNKDKALFTIVVSGTEAVLQNVMEQLQKLVNVLK  543
            LN+DKALFTIVV GT+ VLQ V+EQL KLVNV+K
Sbjct  109  LNEDKALFTIVVLGTDKVLQQVVEQLNKLVNVIK  142


 Score = 61.6 bits (148),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 48/71 (68%), Gaps = 2/71 (3%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQN  504
            +R HT+S+ V +  G++N I G  +RRGYNI+SLAVG  + + L   T V+ GT+  +  
Sbjct  304  LRSHTLSLLVANVPGVLNLITGAISRRGYNIQSLAVGPAEKEGLSRITTVIPGTDENIDK  363

Query  505  VMEQLQKLVNV  537
            ++ QLQKL+++
Sbjct  364  LVRQLQKLIDL  374



>ref|XP_007159564.1| hypothetical protein PHAVU_002G248000g [Phaseolus vulgaris]
 gb|ESW31558.1| hypothetical protein PHAVU_002G248000g [Phaseolus vulgaris]
Length=473

 Score =   137 bits (344),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 67/74 (91%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = +1

Query  322  RQKVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTEAVLQ  501
            R KVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLN+D+ALFTIVVSGT+ VL 
Sbjct  65   RSKVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNEDRALFTIVVSGTDKVLL  124

Query  502  NVMEQLQKLVNVLK  543
             VMEQLQKLVNVLK
Sbjct  125  QVMEQLQKLVNVLK  138


 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 49/71 (69%), Gaps = 2/71 (3%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQN  504
            +R HT+S+ V D  G++N + GVFARRGYNI+SLAVG  + + L   T VV GT+  +  
Sbjct  301  IRSHTLSMLVNDSPGVLNIVTGVFARRGYNIQSLAVGHAEVEGLSRLTTVVPGTDETISK  360

Query  505  VMEQLQKLVNV  537
            +++QL KLV +
Sbjct  361  LVQQLYKLVEL  371



>gb|EMT17230.1| Acetolactate synthase small subunit [Aegilops tauschii]
Length=472

 Score =   137 bits (344),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 67/81 (83%), Positives = 73/81 (90%), Gaps = 1/81 (1%)
 Frame = +1

Query  304  PAPPTPRQKV-RRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVS  480
            P PP PR+ V +RHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVS
Sbjct  57   PVPPHPRRSVVKRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVS  116

Query  481  GTEAVLQNVMEQLQKLVNVLK  543
            GTE +L  V+EQL KLVNV++
Sbjct  117  GTEKILTQVVEQLYKLVNVIQ  137


 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 46/70 (66%), Gaps = 2/70 (3%)
 Frame = +1

Query  340  HTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQNVME  513
            HT+S+ V D  G++N + GVFARRGYNI+SLAVG  +       T VV G +  +  +++
Sbjct  302  HTLSILVNDSPGVLNVVTGVFARRGYNIQSLAVGPAEKTGTSRITTVVPGNDESIAKLVQ  361

Query  514  QLQKLVNVLK  543
            QL KL++V +
Sbjct  362  QLYKLIDVYE  371



>ref|XP_010469674.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like 
isoform X1 [Camelina sativa]
 ref|XP_010469675.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like 
isoform X1 [Camelina sativa]
Length=492

 Score =   137 bits (344),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 87/160 (54%), Positives = 103/160 (64%), Gaps = 17/160 (11%)
 Frame = +1

Query  100  MAAISTHSTLFQR-LKPPCDD----------LSFSRKLGFCTA-SPNIHVGKPKKLSVVF  243
            MAAIS  S+   R L+  C D          +SF  K+ + +  S N      K++  + 
Sbjct  1    MAAISVSSSPSLRCLRSACSDSSPAFVSSTRVSFPAKVSYLSGKSLNRGEEMGKRMDGI-  59

Query  244  ANAADGQHKAPSEITLSTSDPAPPTPRQKVRRHTISVFVGDESGMINRIAGVFARRGYNI  423
              + DG+    S    S+S P       +VR+HTISVFVGDESGMINRIAGVFARRGYNI
Sbjct  60   VRSVDGKISDSSFPGASSSTPTS----NRVRKHTISVFVGDESGMINRIAGVFARRGYNI  115

Query  424  ESLAVGLNKDKALFTIVVSGTEAVLQNVMEQLQKLVNVLK  543
            ESLAVGLN+DKALFTIVV GTE VLQ V+EQLQKLVNVLK
Sbjct  116  ESLAVGLNRDKALFTIVVCGTERVLQQVIEQLQKLVNVLK  155


 Score = 67.0 bits (162),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 49/71 (69%), Gaps = 2/71 (3%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQN  504
            +R HT+S+ V D  G++N + GVFARRGYNI+SLAVG  + K +   T VV  T+  +  
Sbjct  318  LRSHTLSLLVNDVPGVLNIVTGVFARRGYNIQSLAVGHAETKGISRITTVVPATDESVSK  377

Query  505  VMEQLQKLVNV  537
            +++QL KLV+V
Sbjct  378  LVQQLNKLVDV  388



>gb|EEC67965.1| hypothetical protein OsI_35716 [Oryza sativa Indica Group]
Length=476

 Score =   137 bits (344),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 65/81 (80%), Positives = 74/81 (91%), Gaps = 1/81 (1%)
 Frame = +1

Query  304  PAPPTPRQKV-RRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVS  480
            P PP+PR  + +RHT+SVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVS
Sbjct  61   PVPPSPRGSIIKRHTLSVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVS  120

Query  481  GTEAVLQNVMEQLQKLVNVLK  543
            GTE +L+ V+EQL KLVNV++
Sbjct  121  GTEKILKQVVEQLNKLVNVIQ  141


 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/70 (43%), Positives = 48/70 (69%), Gaps = 2/70 (3%)
 Frame = +1

Query  340  HTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQNVME  513
            H++S+ V D +G++N + GVF+RRGYNI+SLAVG  + +     T VV GT+  +  ++ 
Sbjct  307  HSLSILVNDFTGVLNVVTGVFSRRGYNIQSLAVGPAEKEGTSRITTVVPGTDESIAKLVH  366

Query  514  QLQKLVNVLK  543
            QL KL++V +
Sbjct  367  QLYKLIDVYE  376



>gb|AAX96859.1| acetolactate synthase, small subunit, putative [Oryza sativa 
Japonica Group]
 gb|ABA92419.1| acetolactate synthase small subunit, putative, expressed [Oryza 
sativa Japonica Group]
Length=476

 Score =   137 bits (344),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 65/81 (80%), Positives = 74/81 (91%), Gaps = 1/81 (1%)
 Frame = +1

Query  304  PAPPTPRQKV-RRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVS  480
            P PP+PR  + +RHT+SVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVS
Sbjct  61   PVPPSPRGSIIKRHTLSVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVS  120

Query  481  GTEAVLQNVMEQLQKLVNVLK  543
            GTE +L+ V+EQL KLVNV++
Sbjct  121  GTEKILKQVVEQLNKLVNVIQ  141


 Score = 61.2 bits (147),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 30/70 (43%), Positives = 47/70 (67%), Gaps = 2/70 (3%)
 Frame = +1

Query  340  HTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQNVME  513
            H++S+ V D  G++N + GVF+RRGYNI+SLAVG  + +     T VV GT+  +  ++ 
Sbjct  307  HSLSILVNDFPGVLNVVTGVFSRRGYNIQSLAVGPAEKEGTSRITTVVPGTDESIAKLVH  366

Query  514  QLQKLVNVLK  543
            QL KL++V +
Sbjct  367  QLYKLIDVYE  376



>ref|XP_008243055.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic 
isoform X2 [Prunus mume]
Length=494

 Score =   136 bits (343),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 67/74 (91%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = +1

Query  322  RQKVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTEAVLQ  501
            R KVRRH ISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTE VL+
Sbjct  86   RSKVRRHAISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTETVLR  145

Query  502  NVMEQLQKLVNVLK  543
             V+EQL KLVNVLK
Sbjct  146  QVIEQLNKLVNVLK  159


 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 48/71 (68%), Gaps = 2/71 (3%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQN  504
            +R HT+S+ V D  G++  + GVFARRGYNI+SLAVG  + + L   T VV GT+  +  
Sbjct  322  LRSHTLSMLVNDVPGVLYIVTGVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISK  381

Query  505  VMEQLQKLVNV  537
            +++QL KL ++
Sbjct  382  LVQQLYKLADI  392



>ref|XP_006468633.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic-like 
[Citrus sinensis]
Length=484

 Score =   136 bits (343),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 72/107 (67%), Positives = 81/107 (76%), Gaps = 6/107 (6%)
 Frame = +1

Query  223  KKLSVVFANAADGQHKAPSEITLSTSDPAPPTPRQKVRRHTISVFVGDESGMINRIAGVF  402
            KKL +V A+ +   +  P       S   PP    KV+RHTISVFVGDESG+INRIAGVF
Sbjct  47   KKLQLVTASGSTSNNALP------VSQSVPPITASKVKRHTISVFVGDESGIINRIAGVF  100

Query  403  ARRGYNIESLAVGLNKDKALFTIVVSGTEAVLQNVMEQLQKLVNVLK  543
            ARRGYNIESLAVGLN DKALFTIVVSGTE VL+ V+EQL KLVNV+K
Sbjct  101  ARRGYNIESLAVGLNVDKALFTIVVSGTERVLRQVVEQLNKLVNVIK  147


 Score = 58.5 bits (140),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 29/71 (41%), Positives = 48/71 (68%), Gaps = 2/71 (3%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQN  504
            +R HT+S+ V +  G++N + GV +RRGYNI+SLAVG  + + L   T VV GT+  +  
Sbjct  312  LRSHTLSMLVNNTPGVLNIVTGVISRRGYNIQSLAVGPAEKEGLSRITTVVPGTDESIGK  371

Query  505  VMEQLQKLVNV  537
            +++ L KL+++
Sbjct  372  LVQLLHKLIDL  382



>ref|XP_011010159.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic 
[Populus euphratica]
Length=490

 Score =   136 bits (342),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 66/85 (78%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = +1

Query  289  LSTSDPAPPTPRQKVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFT  468
            +S +D  P   R K++RHTISVFVGDESG+INRIAGVFARRGYNIESLAVGLNKDKALFT
Sbjct  63   VSVADSVPTVTRSKLQRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFT  122

Query  469  IVVSGTEAVLQNVMEQLQKLVNVLK  543
            IVV GTE VL+ V+EQL KLVNV+K
Sbjct  123  IVVCGTEKVLRQVVEQLNKLVNVIK  147


 Score = 61.2 bits (147),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 29/71 (41%), Positives = 50/71 (70%), Gaps = 2/71 (3%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQN  504
            +R HT+S+ V +  G++N + GV +RRGYNI+SLAVG  +++ L   T V+ GT+  +  
Sbjct  318  LRSHTLSMLVNNCPGVLNIVTGVISRRGYNIQSLAVGPAEEEGLSRITTVIPGTDDSIGK  377

Query  505  VMEQLQKLVNV  537
            +++QL KL+++
Sbjct  378  LVQQLHKLIDL  388



>ref|XP_010524340.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic-like 
[Tarenaya hassleriana]
Length=489

 Score =   136 bits (342),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 65/84 (77%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = +1

Query  292  STSDPAPPTPRQKVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTI  471
            + S+   P  R++VRRHTISVFVGDESG+INRIAGVFARRGYNIESLAVGLN+DKALFTI
Sbjct  71   AASESVAPAGRERVRRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNEDKALFTI  130

Query  472  VVSGTEAVLQNVMEQLQKLVNVLK  543
            VV GT+ VLQ V+EQL KLVNV+K
Sbjct  131  VVIGTDKVLQQVVEQLNKLVNVIK  154


 Score = 58.2 bits (139),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 46/70 (66%), Gaps = 2/70 (3%)
 Frame = +1

Query  334  RRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQNV  507
            R  T+S+ V +  G++N I GV +RRGYNI+SLAVG  + + +   T V+  T+ ++  +
Sbjct  318  RSRTLSILVNNSPGVLNEITGVISRRGYNIQSLAVGPAEKEGISRITTVIPATDEMISKL  377

Query  508  MEQLQKLVNV  537
            + QL KLV++
Sbjct  378  VRQLHKLVDL  387



>ref|XP_006448524.1| hypothetical protein CICLE_v10015040mg [Citrus clementina]
 gb|ESR61764.1| hypothetical protein CICLE_v10015040mg [Citrus clementina]
Length=489

 Score =   136 bits (342),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 71/107 (66%), Positives = 81/107 (76%), Gaps = 6/107 (6%)
 Frame = +1

Query  223  KKLSVVFANAADGQHKAPSEITLSTSDPAPPTPRQKVRRHTISVFVGDESGMINRIAGVF  402
            KKL +V A+ +   +  P       +   PP    KV+RHTISVFVGDESG+INRIAGVF
Sbjct  47   KKLQLVTASGSSSNNALP------VTQSVPPITASKVKRHTISVFVGDESGIINRIAGVF  100

Query  403  ARRGYNIESLAVGLNKDKALFTIVVSGTEAVLQNVMEQLQKLVNVLK  543
            ARRGYNIESLAVGLN DKALFTIVVSGTE VL+ V+EQL KLVNV+K
Sbjct  101  ARRGYNIESLAVGLNVDKALFTIVVSGTERVLRQVVEQLNKLVNVIK  147


 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/71 (41%), Positives = 48/71 (68%), Gaps = 2/71 (3%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQN  504
            +R HT+S+ V +  G++N + GV +RRGYNI+SLAVG  + + L   T VV GT+  +  
Sbjct  312  LRSHTLSMLVNNTPGVLNIVTGVISRRGYNIQSLAVGPAEKEGLSRITTVVPGTDESIGK  371

Query  505  VMEQLQKLVNV  537
            +++ L KL+++
Sbjct  372  LVQLLHKLIDL  382



>ref|XP_003576101.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like 
[Brachypodium distachyon]
Length=474

 Score =   135 bits (341),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 66/81 (81%), Positives = 73/81 (90%), Gaps = 1/81 (1%)
 Frame = +1

Query  304  PAPPTPRQK-VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVS  480
            P PP PR   V+RHT+SVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVS
Sbjct  60   PVPPRPRGSIVKRHTLSVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVS  119

Query  481  GTEAVLQNVMEQLQKLVNVLK  543
            GTE +L+ V+EQL KLVNV++
Sbjct  120  GTEKILKQVVEQLNKLVNVIQ  140


 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 45/68 (66%), Gaps = 2/68 (3%)
 Frame = +1

Query  340  HTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQNVME  513
            HT+S+ V D  G++N + GVF+RRGYNI+SLAVG  +   +   T VV G +  +  ++ 
Sbjct  305  HTLSILVNDVPGVLNVVTGVFSRRGYNIQSLAVGPAEKLGISRITTVVPGNDESIAKLVH  364

Query  514  QLQKLVNV  537
            QL KL++V
Sbjct  365  QLYKLIDV  372



>ref|XP_002311270.2| hypothetical protein POPTR_0008s07820g [Populus trichocarpa]
 gb|EEE88637.2| hypothetical protein POPTR_0008s07820g [Populus trichocarpa]
Length=490

 Score =   135 bits (341),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 82/155 (53%), Positives = 97/155 (63%), Gaps = 13/155 (8%)
 Frame = +1

Query  91   AASMAAISTHSTLFQRLKPPCDDLS----FSRKLGFCTASPNIHVGKPKKLSVVFANAAD  258
            AAS+   ST  T     + PC  L     FSRK     +S  +H  +P       A    
Sbjct  2    AASVPQCSTRITT----QTPCSKLDSVGGFSRK-----SSGFVHFLRPSVWKSNNAVKVS  52

Query  259  GQHKAPSEITLSTSDPAPPTPRQKVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAV  438
                  +   +S +D  P   R +++RHTISVFVGDESG+INRIAGVFARRGYNIESLAV
Sbjct  53   CSISKENGSAVSVADSVPTVTRSRLQRHTISVFVGDESGIINRIAGVFARRGYNIESLAV  112

Query  439  GLNKDKALFTIVVSGTEAVLQNVMEQLQKLVNVLK  543
            GLNKDKALFTIVV GTE VL+ V+EQL KLVNV+K
Sbjct  113  GLNKDKALFTIVVCGTENVLRQVVEQLNKLVNVIK  147


 Score = 61.2 bits (147),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 29/71 (41%), Positives = 50/71 (70%), Gaps = 2/71 (3%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQN  504
            +R HT+S+ V +  G++N + GV +RRGYNI+SLAVG  +++ L   T V+ GT+  +  
Sbjct  318  LRSHTLSMLVNNCPGVLNIVTGVISRRGYNIQSLAVGPAEEEGLSRITTVIPGTDESIGK  377

Query  505  VMEQLQKLVNV  537
            +++QL KL+++
Sbjct  378  LVQQLHKLIDL  388



>ref|XP_006448525.1| hypothetical protein CICLE_v10015040mg [Citrus clementina]
 gb|ESR61765.1| hypothetical protein CICLE_v10015040mg [Citrus clementina]
Length=484

 Score =   135 bits (341),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 71/107 (66%), Positives = 81/107 (76%), Gaps = 6/107 (6%)
 Frame = +1

Query  223  KKLSVVFANAADGQHKAPSEITLSTSDPAPPTPRQKVRRHTISVFVGDESGMINRIAGVF  402
            KKL +V A+ +   +  P       +   PP    KV+RHTISVFVGDESG+INRIAGVF
Sbjct  47   KKLQLVTASGSSSNNALP------VTQSVPPITASKVKRHTISVFVGDESGIINRIAGVF  100

Query  403  ARRGYNIESLAVGLNKDKALFTIVVSGTEAVLQNVMEQLQKLVNVLK  543
            ARRGYNIESLAVGLN DKALFTIVVSGTE VL+ V+EQL KLVNV+K
Sbjct  101  ARRGYNIESLAVGLNVDKALFTIVVSGTERVLRQVVEQLNKLVNVIK  147


 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 29/71 (41%), Positives = 48/71 (68%), Gaps = 2/71 (3%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQN  504
            +R HT+S+ V +  G++N + GV +RRGYNI+SLAVG  + + L   T VV GT+  +  
Sbjct  312  LRSHTLSMLVNNTPGVLNIVTGVISRRGYNIQSLAVGPAEKEGLSRITTVVPGTDESIGK  371

Query  505  VMEQLQKLVNV  537
            +++ L KL+++
Sbjct  372  LVQLLHKLIDL  382



>gb|EPS72034.1| hypothetical protein M569_02723, partial [Genlisea aurea]
Length=408

 Score =   134 bits (338),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 66/71 (93%), Positives = 69/71 (97%), Gaps = 0/71 (0%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTEAVLQNVM  510
            V+RHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTE VL +VM
Sbjct  1    VKRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTERVLHHVM  60

Query  511  EQLQKLVNVLK  543
            EQL+KLVNVLK
Sbjct  61   EQLKKLVNVLK  71


 Score = 67.8 bits (164),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 49/71 (69%), Gaps = 2/71 (3%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQN  504
            +R HT+S+ V D  G++N I GVFARRGYNI+SLAVG  +   L   T VV GT+  +  
Sbjct  233  LRSHTLSMLVNDAPGVLNLITGVFARRGYNIQSLAVGHAETDGLSRITTVVPGTDESIAK  292

Query  505  VMEQLQKLVNV  537
            +++QL KL+++
Sbjct  293  LLKQLNKLIDL  303



>gb|KGN49589.1| hypothetical protein Csa_5G013280 [Cucumis sativus]
Length=436

 Score =   135 bits (339),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 69/95 (73%), Positives = 75/95 (79%), Gaps = 0/95 (0%)
 Frame = +1

Query  259  GQHKAPSEITLSTSDPAPPTPRQKVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAV  438
            G +  PSE+ +            +VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAV
Sbjct  6    GLNCWPSEVCVEEKVGGASYLVPRVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAV  65

Query  439  GLNKDKALFTIVVSGTEAVLQNVMEQLQKLVNVLK  543
            GLNKDKAL TIVVSGTE VL+ V+EQL KLVNVLK
Sbjct  66   GLNKDKALLTIVVSGTEKVLEQVIEQLHKLVNVLK  100


 Score = 58.5 bits (140),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 47/71 (66%), Gaps = 2/71 (3%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQN  504
            +R HT+S+ V D  G++  I G+FARRGYNI+SLAVG  + + +   T VV GT+  +  
Sbjct  264  LRSHTLSMLVNDSPGVLYIITGLFARRGYNIQSLAVGHAEAEGISRITTVVPGTDESIYK  323

Query  505  VMEQLQKLVNV  537
            +++ L +L +V
Sbjct  324  LVQHLYRLADV  334



>ref|XP_008371723.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic-like, 
partial [Malus domestica]
Length=472

 Score =   135 bits (340),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 67/85 (79%), Positives = 73/85 (86%), Gaps = 0/85 (0%)
 Frame = +1

Query  289  LSTSDPAPPTPRQKVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFT  468
            +S SD  P     KV+RHTISVFVGDESG+INRIAGVFARRGYNIESLAVGLNKDKALFT
Sbjct  53   VSVSDSVPSLTSSKVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFT  112

Query  469  IVVSGTEAVLQNVMEQLQKLVNVLK  543
            IVVSGT  VL+ V+EQL KLVNV+K
Sbjct  113  IVVSGTGKVLRQVVEQLNKLVNVIK  137


 Score = 64.3 bits (155),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 48/71 (68%), Gaps = 2/71 (3%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQN  504
            V+ HT+S+ V D  G++N + GV +RRGYNI+SLAVG  +   L   T VV GTE  +  
Sbjct  300  VQSHTLSMIVNDSPGVLNIVTGVISRRGYNIQSLAVGPAEKXGLSRITTVVPGTEDSISK  359

Query  505  VMEQLQKLVNV  537
            +++QL KL+++
Sbjct  360  LVQQLHKLIDL  370



>gb|KFK31180.1| hypothetical protein AALP_AA6G079200 [Arabis alpina]
Length=491

 Score =   135 bits (340),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 66/72 (92%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = +1

Query  328  KVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTEAVLQNV  507
            KVR+HTISVFVGDESGMINRIAGVFARRGYNIESLAVGLN+DKALFTIVV GTE VLQ V
Sbjct  83   KVRKHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNRDKALFTIVVCGTERVLQQV  142

Query  508  MEQLQKLVNVLK  543
            +EQLQKLVNVLK
Sbjct  143  IEQLQKLVNVLK  154


 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 49/71 (69%), Gaps = 2/71 (3%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQN  504
            +R HT+S+ V D  G++N + GVFARRGYNI+SLAVG  + K +   T V+  T+  +  
Sbjct  317  LRSHTLSLLVNDAPGVLNIVTGVFARRGYNIQSLAVGHAETKGISRITTVIPATDESVSK  376

Query  505  VMEQLQKLVNV  537
            +++QL KLV+V
Sbjct  377  LVQQLYKLVDV  387



>gb|KHN48087.1| Acetolactate synthase small subunit [Glycine soja]
Length=471

 Score =   135 bits (339),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 65/73 (89%), Positives = 71/73 (97%), Gaps = 0/73 (0%)
 Frame = +1

Query  325  QKVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTEAVLQN  504
            ++VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLN+D+ALFTIVVSGT+ VL+ 
Sbjct  64   KQVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNEDRALFTIVVSGTDKVLRQ  123

Query  505  VMEQLQKLVNVLK  543
            VMEQLQKLVNVLK
Sbjct  124  VMEQLQKLVNVLK  136


 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 49/71 (69%), Gaps = 2/71 (3%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQN  504
            +R HT+S+ V D  G++N + GVFARRGYNI+SLAVG  + + L   T VV GT+  +  
Sbjct  299  IRSHTLSMLVNDAPGVLNIVTGVFARRGYNIQSLAVGHAEVEGLSRLTTVVPGTDESISK  358

Query  505  VMEQLQKLVNV  537
            +++QL KLV +
Sbjct  359  LVQQLYKLVEL  369



>ref|XP_008450270.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like 
isoform X2 [Cucumis melo]
Length=443

 Score =   135 bits (339),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 66/71 (93%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTEAVLQNVM  510
            VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTE VL+ V+
Sbjct  89   VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTEKVLEQVI  148

Query  511  EQLQKLVNVLK  543
            EQL KLVNVLK
Sbjct  149  EQLHKLVNVLK  159


 Score = 61.2 bits (147),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 48/71 (68%), Gaps = 2/71 (3%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQN  504
            +R HT+S+ V D  G++  I G+FARRGYNI+SLAVG  + + +   T VV GT+  +  
Sbjct  271  LRSHTLSMLVNDSPGVLYIITGLFARRGYNIQSLAVGHAEAEGISRITTVVPGTDESIYK  330

Query  505  VMEQLQKLVNV  537
            +++QL +L +V
Sbjct  331  LVQQLYRLADV  341



>gb|KFK31179.1| hypothetical protein AALP_AA6G079200 [Arabis alpina]
Length=521

 Score =   135 bits (340),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 66/72 (92%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = +1

Query  328  KVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTEAVLQNV  507
            KVR+HTISVFVGDESGMINRIAGVFARRGYNIESLAVGLN+DKALFTIVV GTE VLQ V
Sbjct  113  KVRKHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNRDKALFTIVVCGTERVLQQV  172

Query  508  MEQLQKLVNVLK  543
            +EQLQKLVNVLK
Sbjct  173  IEQLQKLVNVLK  184


 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 49/71 (69%), Gaps = 2/71 (3%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQN  504
            +R HT+S+ V D  G++N + GVFARRGYNI+SLAVG  + K +   T V+  T+  +  
Sbjct  347  LRSHTLSLLVNDAPGVLNIVTGVFARRGYNIQSLAVGHAETKGISRITTVIPATDESVSK  406

Query  505  VMEQLQKLVNV  537
            +++QL KLV+V
Sbjct  407  LVQQLYKLVDV  417



>ref|XP_008450269.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like 
isoform X1 [Cucumis melo]
Length=495

 Score =   135 bits (339),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 66/71 (93%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTEAVLQNVM  510
            VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTE VL+ V+
Sbjct  89   VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTEKVLEQVI  148

Query  511  EQLQKLVNVLK  543
            EQL KLVNVLK
Sbjct  149  EQLHKLVNVLK  159


 Score = 61.6 bits (148),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 48/71 (68%), Gaps = 2/71 (3%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQN  504
            +R HT+S+ V D  G++  I G+FARRGYNI+SLAVG  + + +   T VV GT+  +  
Sbjct  323  LRSHTLSMLVNDSPGVLYIITGLFARRGYNIQSLAVGHAEAEGISRITTVVPGTDESIYK  382

Query  505  VMEQLQKLVNV  537
            +++QL +L +V
Sbjct  383  LVQQLYRLADV  393



>ref|XP_008383599.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic-like 
[Malus domestica]
Length=478

 Score =   135 bits (339),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 73/110 (66%), Positives = 84/110 (76%), Gaps = 8/110 (7%)
 Frame = +1

Query  214  GKPKKLSVVFANAADGQHKAPSEITLSTSDPAPPTPRQKVRRHTISVFVGDESGMINRIA  393
            GK  +L  +  +A+ G         +S SD  P +   KV+RHTISVFVGDESG+INRIA
Sbjct  41   GKSSELKKLVISASTGN-------AVSVSDSVP-SLTSKVKRHTISVFVGDESGIINRIA  92

Query  394  GVFARRGYNIESLAVGLNKDKALFTIVVSGTEAVLQNVMEQLQKLVNVLK  543
            GVFARRGYNIESLAVGLNKDKALFTIVVSGTE VL+ V+EQL KLVNV+K
Sbjct  93   GVFARRGYNIESLAVGLNKDKALFTIVVSGTEKVLRQVVEQLNKLVNVIK  142


 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 49/71 (69%), Gaps = 2/71 (3%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQN  504
            VR HT+S+ V D  G++N + GV +RRGYNI+SLAVG  + + L   T VV GT+  +  
Sbjct  306  VRSHTLSMIVNDYPGVLNTVTGVLSRRGYNIQSLAVGPAEVEGLSRITTVVPGTDDSISK  365

Query  505  VMEQLQKLVNV  537
            +++QL KL+++
Sbjct  366  LVQQLHKLIDL  376



>emb|CAN61470.1| hypothetical protein VITISV_043824 [Vitis vinifera]
Length=451

 Score =   134 bits (338),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 66/74 (89%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = +1

Query  322  RQKVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTEAVLQ  501
            + +VRRHTISVFVGDESGMINRIAGVFARRGYNI+SLAVGLNKDKALFTIVVSGTE VLQ
Sbjct  41   QSQVRRHTISVFVGDESGMINRIAGVFARRGYNIDSLAVGLNKDKALFTIVVSGTERVLQ  100

Query  502  NVMEQLQKLVNVLK  543
             V+EQL KLVNVLK
Sbjct  101  QVVEQLHKLVNVLK  114


 Score = 64.7 bits (156),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 51/71 (72%), Gaps = 2/71 (3%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQN  504
            +R HT+S+ V +  G++N + GVFARRGYNI+SLAVG  + + L   T VV GT+  +  
Sbjct  277  LRSHTLSMVVNNAPGVLNLVTGVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESINK  336

Query  505  VMEQLQKLVNV  537
            +++QL+KL+++
Sbjct  337  LVQQLKKLIDL  347



>ref|XP_009778724.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic-like 
[Nicotiana sylvestris]
Length=221

 Score =   130 bits (327),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 64/72 (89%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = +1

Query  328  KVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTEAVLQNV  507
            +V+ HTISVFVGDESG+INRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTE VLQ V
Sbjct  81   RVKCHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTEKVLQQV  140

Query  508  MEQLQKLVNVLK  543
            +EQL KLVNVLK
Sbjct  141  VEQLNKLVNVLK  152



>ref|XP_004288733.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like 
[Fragaria vesca subsp. vesca]
Length=510

 Score =   134 bits (338),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 65/78 (83%), Positives = 71/78 (91%), Gaps = 0/78 (0%)
 Frame = +1

Query  310  PPTPRQKVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTE  489
            PP+  + VRRH ISVFVGDESGMINRI+GVFARRGYNIESLAVGLNKDKALFTIVVSGT+
Sbjct  98   PPSTPKGVRRHAISVFVGDESGMINRISGVFARRGYNIESLAVGLNKDKALFTIVVSGTD  157

Query  490  AVLQNVMEQLQKLVNVLK  543
             VL+ V+EQL KLVNVLK
Sbjct  158  TVLRQVIEQLHKLVNVLK  175


 Score = 61.2 bits (147),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 48/71 (68%), Gaps = 2/71 (3%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLN--KDKALFTIVVSGTEAVLQN  504
            +R HT+S+ V D  G++  I GVFARRGYNI+SLAVG    + ++  T VV  T+  +  
Sbjct  338  LRSHTLSMLVNDVPGVLYIITGVFARRGYNIQSLAVGRAEVEGQSRITTVVPATDESISK  397

Query  505  VMEQLQKLVNV  537
            +++QL KLV+V
Sbjct  398  LVQQLYKLVDV  408



>ref|XP_004139096.1| PREDICTED: uncharacterized protein LOC101208212 [Cucumis sativus]
Length=480

 Score =   134 bits (337),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 66/91 (73%), Positives = 78/91 (86%), Gaps = 0/91 (0%)
 Frame = +1

Query  271  APSEITLSTSDPAPPTPRQKVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNK  450
            A ++  ++ +D + P+ R  V RHTISVFVGDESG+INRIAGVFARRGYNIESLAVGLNK
Sbjct  56   AVNDNAVTVTDSSRPSIRSTVMRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNK  115

Query  451  DKALFTIVVSGTEAVLQNVMEQLQKLVNVLK  543
            DKALFTIVV+GTE VL+ V+EQL KLVNV+K
Sbjct  116  DKALFTIVVTGTENVLRQVVEQLNKLVNVIK  146


 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 47/68 (69%), Gaps = 2/68 (3%)
 Frame = +1

Query  340  HTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQNVME  513
            HT+S+ V D  G++N + G+ +RRGYNI+SLAVG  + + L   T V+ GT+  +  +++
Sbjct  311  HTLSMLVNDYPGVLNVVTGIISRRGYNIQSLAVGHAEREGLSRITTVIPGTDESIGKLVQ  370

Query  514  QLQKLVNV  537
            QL KL+++
Sbjct  371  QLHKLIDL  378



>ref|XP_008677344.1| PREDICTED: acetolactate synthase/ amino acid binding protein 
isoform X1 [Zea mays]
Length=446

 Score =   134 bits (336),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 66/73 (90%), Positives = 68/73 (93%), Gaps = 0/73 (0%)
 Frame = +1

Query  322  RQKVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTEAVLQ  501
            R KVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGT+ VL 
Sbjct  74   RDKVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDRVLN  133

Query  502  NVMEQLQKLVNVL  540
             V+EQL KLVNVL
Sbjct  134  QVIEQLNKLVNVL  146


 Score = 67.4 bits (163),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 50/71 (70%), Gaps = 2/71 (3%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQN  504
            +R HT+S+ V D  G++N + GVFARRGYNI+SLAVG  + + +   T VV GT   ++ 
Sbjct  311  LRSHTLSILVNDCPGVLNIVTGVFARRGYNIQSLAVGPAEKEGISRITTVVPGTVESIEK  370

Query  505  VMEQLQKLVNV  537
            +++QL KL++V
Sbjct  371  LVQQLYKLIDV  381



>dbj|BAM75181.1| B3-type transcription factor [Ricinus communis]
Length=767

 Score =   136 bits (343),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 81/157 (52%), Positives = 102/157 (65%), Gaps = 22/157 (14%)
 Frame = +1

Query  100  MAAISTHSTLFQRLKPPCDDLSFSRK---LGFCTASPN------IHVGKPKKLSVVFANA  252
            MAA +T ++LF         L F  +    GF   +PN      I  G+  + + V + A
Sbjct  1    MAATTTATSLF------SSRLHFQNQNQGYGFPAKTPNSLQVNQIIDGRKMRNATVLSAA  54

Query  253  ADGQHKAPSEITLSTSDPAPPTPRQKVRRHTISVFVGDESGMINRIAGVFARRGYNIESL  432
            +       ++  ++T+    PT   +VRRHTISVFVGDESG+INRIAGVFARRGYNIESL
Sbjct  55   S-------TDKAITTAQSVAPTACDRVRRHTISVFVGDESGIINRIAGVFARRGYNIESL  107

Query  433  AVGLNKDKALFTIVVSGTEAVLQNVMEQLQKLVNVLK  543
            AVGLN+DKALFTIVV GT+ VLQ V+EQL KLVNV+K
Sbjct  108  AVGLNEDKALFTIVVLGTDKVLQQVVEQLNKLVNVIK  144


 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 48/71 (68%), Gaps = 2/71 (3%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQN  504
            +R HT+S+ V +  G++N I G  +RRGYNI+SLAVG  + + L   T V+ GT+  +  
Sbjct  305  LRSHTLSLLVANVPGVLNLITGAISRRGYNIQSLAVGPAEKEGLSRITTVIPGTDENIDK  364

Query  505  VMEQLQKLVNV  537
            ++ QLQKL+++
Sbjct  365  LVRQLQKLIDL  375



>ref|XP_009126106.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic 
[Brassica rapa]
Length=475

 Score =   134 bits (336),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 70/116 (60%), Positives = 84/116 (72%), Gaps = 8/116 (7%)
 Frame = +1

Query  220  PKKLSVVFANAADGQH--------KAPSEITLSTSDPAPPTPRQKVRRHTISVFVGDESG  375
            P K SV  +   DG+          A ++  ++T+     T   +VRRHTISVFVGDESG
Sbjct  26   PSKTSVQVSQIIDGRKMRSATLFSAASTDKAITTAQSVSSTACDRVRRHTISVFVGDESG  85

Query  376  MINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTEAVLQNVMEQLQKLVNVLK  543
            +INRIAGVFARRGYNIESLAVGLN+DKA+FTIVV GT+ VLQ V+EQL KLVNV+K
Sbjct  86   IINRIAGVFARRGYNIESLAVGLNEDKAMFTIVVLGTDKVLQQVVEQLNKLVNVIK  141


 Score = 62.0 bits (149),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 48/71 (68%), Gaps = 2/71 (3%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQN  504
            +R HT+S+ V +  G++N I G  +RRGYNI+SLAVG  + + L   T V+ GT+  +  
Sbjct  303  LRSHTLSILVANVPGVLNLITGAISRRGYNIQSLAVGPAEKEGLSRITTVIPGTDENIDK  362

Query  505  VMEQLQKLVNV  537
            ++ QLQKL+++
Sbjct  363  LVRQLQKLIDL  373



>emb|CDX85509.1| BnaA02g03040D [Brassica napus]
Length=475

 Score =   134 bits (336),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 70/116 (60%), Positives = 84/116 (72%), Gaps = 8/116 (7%)
 Frame = +1

Query  220  PKKLSVVFANAADGQH--------KAPSEITLSTSDPAPPTPRQKVRRHTISVFVGDESG  375
            P K SV  +   DG+          A ++  ++T+     T   +VRRHTISVFVGDESG
Sbjct  26   PSKTSVQVSQIIDGRKMRSATLFSAASTDKAITTAQSVSSTACDRVRRHTISVFVGDESG  85

Query  376  MINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTEAVLQNVMEQLQKLVNVLK  543
            +INRIAGVFARRGYNIESLAVGLN+DKA+FTIVV GT+ VLQ V+EQL KLVNV+K
Sbjct  86   IINRIAGVFARRGYNIESLAVGLNEDKAMFTIVVLGTDKVLQQVVEQLNKLVNVIK  141


 Score = 62.0 bits (149),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 48/71 (68%), Gaps = 2/71 (3%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQN  504
            +R HT+S+ V +  G++N I G  +RRGYNI+SLAVG  + + L   T V+ GT+  +  
Sbjct  303  LRSHTLSILVANVPGVLNLITGAISRRGYNIQSLAVGPAEKEGLSRITTVIPGTDENIDK  362

Query  505  VMEQLQKLVNV  537
            ++ QLQKL+++
Sbjct  363  LVRQLQKLIDL  373



>ref|XP_006353245.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic-like 
[Solanum tuberosum]
Length=490

 Score =   134 bits (336),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 77/122 (63%), Positives = 87/122 (71%), Gaps = 5/122 (4%)
 Frame = +1

Query  190  TASPNIHVGKPKKLSVVFANAADGQHKAPSEITLSTSDPAPPTP----RQKVRRHTISVF  357
            T+S N + G  KK S V   A+     +     +S +  AP TP      +V+ HTISVF
Sbjct  37   TSSRNFNFGL-KKFSPVNVIASSNGSGSTDNGAVSVTRTAPLTPPKPSSSRVKSHTISVF  95

Query  358  VGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTEAVLQNVMEQLQKLVNV  537
            VGDESG+INRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTE VLQ V+EQL KLVNV
Sbjct  96   VGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTEKVLQQVVEQLNKLVNV  155

Query  538  LK  543
             K
Sbjct  156  WK  157


 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 49/71 (69%), Gaps = 2/71 (3%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQN  504
            +R HT+S+ V +  G++N I+GV +RRGYN++SLAVG  + + L   T VV GT+  +  
Sbjct  318  IRSHTLSMLVNNAPGVLNLISGVISRRGYNVQSLAVGPAETEGLSRITTVVPGTDETIGK  377

Query  505  VMEQLQKLVNV  537
            +++Q  KL++V
Sbjct  378  LVKQFNKLIDV  388



>ref|XP_008443657.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic-like 
[Cucumis melo]
Length=480

 Score =   134 bits (336),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 66/91 (73%), Positives = 78/91 (86%), Gaps = 0/91 (0%)
 Frame = +1

Query  271  APSEITLSTSDPAPPTPRQKVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNK  450
            A ++  ++ +D + P+ R  V RHTISVFVGDESG+INRIAGVFARRGYNIESLAVGLNK
Sbjct  56   AVNDNAVTVTDSSRPSIRSTVMRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNK  115

Query  451  DKALFTIVVSGTEAVLQNVMEQLQKLVNVLK  543
            DKALFTIVV+GTE VL+ V+EQL KLVNV+K
Sbjct  116  DKALFTIVVTGTENVLRQVVEQLNKLVNVIK  146


 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 47/68 (69%), Gaps = 2/68 (3%)
 Frame = +1

Query  340  HTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQNVME  513
            HT+S+ V D  G++N + G+ +RRGYNI+SLAVG  + + L   T V+ GT+  +  +++
Sbjct  311  HTLSMLVNDYPGVLNVVTGIISRRGYNIQSLAVGHAERQGLSRITTVIPGTDESIGKLVQ  370

Query  514  QLQKLVNV  537
            QL KL+++
Sbjct  371  QLHKLIDL  378



>ref|NP_001151166.1| acetolactate synthase/ amino acid binding protein [Zea mays]
 gb|ACG41837.1| acetolactate synthase/ amino acid binding protein [Zea mays]
 gb|AFW62901.1| acetolactate synthase/ amino acid binding protein [Zea mays]
Length=483

 Score =   134 bits (336),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 66/73 (90%), Positives = 68/73 (93%), Gaps = 0/73 (0%)
 Frame = +1

Query  322  RQKVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTEAVLQ  501
            R KVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGT+ VL 
Sbjct  74   RDKVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDRVLN  133

Query  502  NVMEQLQKLVNVL  540
             V+EQL KLVNVL
Sbjct  134  QVIEQLNKLVNVL  146


 Score = 67.4 bits (163),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 50/71 (70%), Gaps = 2/71 (3%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQN  504
            +R HT+S+ V D  G++N + GVFARRGYNI+SLAVG  + + +   T VV GT   ++ 
Sbjct  311  LRSHTLSILVNDCPGVLNIVTGVFARRGYNIQSLAVGPAEKEGISRITTVVPGTVESIEK  370

Query  505  VMEQLQKLVNV  537
            +++QL KL++V
Sbjct  371  LVQQLYKLIDV  381



>ref|XP_004953051.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like 
[Setaria italica]
Length=488

 Score =   134 bits (336),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 66/73 (90%), Positives = 68/73 (93%), Gaps = 0/73 (0%)
 Frame = +1

Query  322  RQKVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTEAVLQ  501
            R KVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGT+ VL 
Sbjct  78   RDKVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKVLN  137

Query  502  NVMEQLQKLVNVL  540
             V+EQL KLVNVL
Sbjct  138  QVIEQLNKLVNVL  150


 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 50/71 (70%), Gaps = 2/71 (3%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQN  504
            +R HT+S+ V D  G++N + GVFARRGYNI+SLAVG  + + +   T VV GT   ++ 
Sbjct  316  LRSHTLSILVNDCPGVLNIVTGVFARRGYNIQSLAVGPAEKEGISRITTVVPGTNESIEK  375

Query  505  VMEQLQKLVNV  537
            +++QL KL++V
Sbjct  376  LVQQLYKLIDV  386



>emb|CDY38123.1| BnaC02g06500D [Brassica napus]
Length=475

 Score =   133 bits (335),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 70/116 (60%), Positives = 84/116 (72%), Gaps = 8/116 (7%)
 Frame = +1

Query  220  PKKLSVVFANAADGQH--------KAPSEITLSTSDPAPPTPRQKVRRHTISVFVGDESG  375
            P K SV  +   DG+          A ++  ++T+     T   +VRRHTISVFVGDESG
Sbjct  26   PAKTSVQVSQIIDGRKMRSATLFSAASTDKAITTAQSVSSTACDRVRRHTISVFVGDESG  85

Query  376  MINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTEAVLQNVMEQLQKLVNVLK  543
            +INRIAGVFARRGYNIESLAVGLN+DKA+FTIVV GT+ VLQ V+EQL KLVNV+K
Sbjct  86   IINRIAGVFARRGYNIESLAVGLNEDKAMFTIVVLGTDKVLQQVVEQLNKLVNVIK  141


 Score = 61.6 bits (148),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 48/71 (68%), Gaps = 2/71 (3%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQN  504
            +R HT+S+ V +  G++N I G  +RRGYNI+SLAVG  + + L   T V+ GT+  +  
Sbjct  303  LRSHTLSILVANVPGVLNLITGAISRRGYNIQSLAVGPAEKEGLSRITTVIPGTDENIDK  362

Query  505  VMEQLQKLVNV  537
            ++ QLQKL+++
Sbjct  363  LVRQLQKLIDL  373



>ref|XP_010672487.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like 
[Beta vulgaris subsp. vulgaris]
Length=486

 Score =   134 bits (336),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 65/76 (86%), Positives = 69/76 (91%), Gaps = 0/76 (0%)
 Frame = +1

Query  316  TPRQKVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTEAV  495
            + R K  RHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLN+DKALFTIVVSGT+ V
Sbjct  76   STRSKAMRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNEDKALFTIVVSGTDKV  135

Query  496  LQNVMEQLQKLVNVLK  543
            L  VMEQLQKL+NVLK
Sbjct  136  LHQVMEQLQKLLNVLK  151


 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 48/68 (71%), Gaps = 2/68 (3%)
 Frame = +1

Query  340  HTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQNVME  513
            HT+S+ V D  G++N + G FARRGYNI+SLAVG  + K L   T VV+GT+  +  +++
Sbjct  317  HTLSMLVNDRPGVLNFVTGAFARRGYNIQSLAVGHAETKGLSRITTVVTGTDESISKLVQ  376

Query  514  QLQKLVNV  537
            Q+ KLV++
Sbjct  377  QIYKLVDI  384



>ref|XP_003629945.1| Acetolactate synthase small subunit [Medicago truncatula]
 gb|AET04421.1| acetolactate synthase, small subunit [Medicago truncatula]
Length=478

 Score =   133 bits (335),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 65/72 (90%), Positives = 70/72 (97%), Gaps = 0/72 (0%)
 Frame = +1

Query  328  KVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTEAVLQNV  507
            KVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLN+D+ALFTIVVSGT+ VL+ V
Sbjct  72   KVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNQDRALFTIVVSGTDRVLRQV  131

Query  508  MEQLQKLVNVLK  543
            +EQLQKLVNVLK
Sbjct  132  VEQLQKLVNVLK  143


 Score = 67.0 bits (162),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 50/71 (70%), Gaps = 2/71 (3%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQN  504
            +R HT+S+ V D  G++N + GVFARRGYNI+SLAVG ++ + +   T VV GT+  +  
Sbjct  306  IRSHTLSMLVNDAPGVLNIVTGVFARRGYNIQSLAVGHSEVEGISRLTTVVPGTDESISK  365

Query  505  VMEQLQKLVNV  537
            +++QL KLV +
Sbjct  366  LVQQLYKLVEL  376



>ref|XP_002452423.1| hypothetical protein SORBIDRAFT_04g025560 [Sorghum bicolor]
 gb|EES05399.1| hypothetical protein SORBIDRAFT_04g025560 [Sorghum bicolor]
Length=492

 Score =   134 bits (336),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 66/73 (90%), Positives = 68/73 (93%), Gaps = 0/73 (0%)
 Frame = +1

Query  322  RQKVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTEAVLQ  501
            R KVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGT+ VL 
Sbjct  82   RDKVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDRVLN  141

Query  502  NVMEQLQKLVNVL  540
             V+EQL KLVNVL
Sbjct  142  QVIEQLNKLVNVL  154


 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 50/71 (70%), Gaps = 2/71 (3%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQN  504
            +R HT+S+ V D  G++N + GVFARRGYNI+SLAVG  + + +   T VV GT   ++ 
Sbjct  320  LRSHTLSILVNDCPGVLNIVTGVFARRGYNIQSLAVGPAEKEGISRITTVVPGTVESIEK  379

Query  505  VMEQLQKLVNV  537
            +++QL KLV+V
Sbjct  380  LVQQLYKLVDV  390



>ref|XP_008243054.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic 
isoform X1 [Prunus mume]
Length=495

 Score =   133 bits (335),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 65/73 (89%), Positives = 68/73 (93%), Gaps = 0/73 (0%)
 Frame = +1

Query  325  QKVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTEAVLQN  504
             +VRRH ISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTE VL+ 
Sbjct  88   NRVRRHAISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTETVLRQ  147

Query  505  VMEQLQKLVNVLK  543
            V+EQL KLVNVLK
Sbjct  148  VIEQLNKLVNVLK  160


 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 48/71 (68%), Gaps = 2/71 (3%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQN  504
            +R HT+S+ V D  G++  + GVFARRGYNI+SLAVG  + + L   T VV GT+  +  
Sbjct  323  LRSHTLSMLVNDVPGVLYIVTGVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESISK  382

Query  505  VMEQLQKLVNV  537
            +++QL KL ++
Sbjct  383  LVQQLYKLADI  393



>ref|XP_004159602.1| PREDICTED: uncharacterized LOC101212902 [Cucumis sativus]
Length=412

 Score =   132 bits (333),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 65/71 (92%), Positives = 67/71 (94%), Gaps = 0/71 (0%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTEAVLQNVM  510
            VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL TIVVSGTE VL+ V+
Sbjct  83   VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALLTIVVSGTEKVLEQVI  142

Query  511  EQLQKLVNVLK  543
            EQL KLVNVLK
Sbjct  143  EQLHKLVNVLK  153


 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 47/71 (66%), Gaps = 2/71 (3%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQN  504
            +R HT+S+ V D  G++  I G+FARRGYNI+SLAVG  + + +   T VV GT+  +  
Sbjct  240  LRSHTLSMLVNDSPGVLYIITGLFARRGYNIQSLAVGHAEAEGISRITTVVPGTDESIYK  299

Query  505  VMEQLQKLVNV  537
            +++ L +L +V
Sbjct  300  LVQHLYRLADV  310



>gb|KHG18039.1| Acetolactate synthase small subunit [Gossypium arboreum]
Length=499

 Score =   133 bits (334),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 65/80 (81%), Positives = 74/80 (93%), Gaps = 1/80 (1%)
 Frame = +1

Query  307  APPTP-RQKVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSG  483
            +PPT  + +V+RHTISVFVGDESG+INRIAGVFARRGYNIESLAVGLNKDKALFTIVVSG
Sbjct  69   SPPTASKDRVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSG  128

Query  484  TEAVLQNVMEQLQKLVNVLK  543
            TE +L+ V+EQL KLVNV+K
Sbjct  129  TERILRQVVEQLNKLVNVIK  148


 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 49/73 (67%), Gaps = 2/73 (3%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQN  504
            +R HT+S+ V D  G++N + GV +RRGYNI+SLAVG  +   L   T V+ GT+  L  
Sbjct  327  LRSHTLSMIVNDSPGVLNVVTGVISRRGYNIQSLAVGPAEKDGLSRITTVIPGTDETLAK  386

Query  505  VMEQLQKLVNVLK  543
            + +QL+KLV++ +
Sbjct  387  LFQQLRKLVDLYE  399



>gb|KJB78878.1| hypothetical protein B456_013G024000 [Gossypium raimondii]
Length=483

 Score =   133 bits (334),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 65/80 (81%), Positives = 74/80 (93%), Gaps = 1/80 (1%)
 Frame = +1

Query  307  APPTP-RQKVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSG  483
            +PPT  + +V+RHTISVFVGDESG+INRIAGVFARRGYNIESLAVGLNKDKALFTIVVSG
Sbjct  69   SPPTASKDRVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSG  128

Query  484  TEAVLQNVMEQLQKLVNVLK  543
            TE +L+ V+EQL KLVNV+K
Sbjct  129  TERILRQVVEQLNKLVNVIK  148


 Score = 63.9 bits (154),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 49/73 (67%), Gaps = 2/73 (3%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQN  504
            +R HT+++ V D  G++N + GV +RRGYNI+SLAVG  +   L   T V+ GT+  L  
Sbjct  311  LRSHTLAMVVNDSPGVLNVVTGVISRRGYNIQSLAVGPAEKDGLSRITTVIPGTDETLAK  370

Query  505  VMEQLQKLVNVLK  543
            + +QL+KLV++ +
Sbjct  371  LFQQLRKLVDLYE  383



>ref|XP_006400166.1| hypothetical protein EUTSA_v10016107mg [Eutrema salsugineum]
 gb|ESQ41619.1| hypothetical protein EUTSA_v10016107mg [Eutrema salsugineum]
Length=479

 Score =   132 bits (333),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 65/91 (71%), Positives = 76/91 (84%), Gaps = 0/91 (0%)
 Frame = +1

Query  271  APSEITLSTSDPAPPTPRQKVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNK  450
            A ++  ++T  P   T   +VRRHTISVFVGDESG+INRIAGVFARRGYNIESLAVGLN+
Sbjct  56   ASTDKAVTTGQPVFSTACDRVRRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNE  115

Query  451  DKALFTIVVSGTEAVLQNVMEQLQKLVNVLK  543
            DKA+FTIVV GT+ VLQ V+EQL KLVNV+K
Sbjct  116  DKAMFTIVVLGTDKVLQQVVEQLNKLVNVIK  146


 Score = 61.6 bits (148),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 48/71 (68%), Gaps = 2/71 (3%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQN  504
            +R HT+S+ V +  G++N I G  +RRGYNI+SLAVG  + + L   T V+ GT+  +  
Sbjct  307  LRSHTLSILVTNVPGVLNLITGAISRRGYNIQSLAVGHAEKEGLSRITTVIPGTDENIDK  366

Query  505  VMEQLQKLVNV  537
            ++ QLQKL+++
Sbjct  367  LVRQLQKLIDL  377



>ref|XP_009352938.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic-like 
[Pyrus x bretschneideri]
Length=477

 Score =   132 bits (333),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 82/149 (55%), Positives = 96/149 (64%), Gaps = 10/149 (7%)
 Frame = +1

Query  100  MAAIST-HSTLFQRLKPPC-DDLSFSRKLGFCTASPNIHVGKPKKLSVVFANAADGQHKA  273
            MAA+S+  ST     KP   +D        F        V K  +L  +  +A+ G    
Sbjct  1    MAAVSSPFSTSLVAQKPSFPEDFRHGFSTSFDLGRQRPLVWKSSELKKLVVSASTGN---  57

Query  274  PSEITLSTSDPAPPTPRQKVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKD  453
                 +S SD  P +   KV+RHTISVFVGDESG+INRIAGVFARRGYNIESLAVGLNKD
Sbjct  58   ----AVSVSDSVP-SLTSKVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKD  112

Query  454  KALFTIVVSGTEAVLQNVMEQLQKLVNVL  540
            KALFTIVVSGTE VL+ V+EQL KLVNV+
Sbjct  113  KALFTIVVSGTEKVLRQVVEQLNKLVNVI  141


 Score = 64.7 bits (156),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 49/71 (69%), Gaps = 2/71 (3%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQN  504
            VR HT+S+ V D  G++N + GV +RRGYNI+SLAVG  + + L   T VV GT+  +  
Sbjct  305  VRSHTLSMIVNDYPGVLNTVTGVLSRRGYNIQSLAVGPAEMEGLSRITTVVPGTDDSISK  364

Query  505  VMEQLQKLVNV  537
            +++QL KL+++
Sbjct  365  LVQQLHKLIDL  375



>ref|XP_004149627.1| PREDICTED: uncharacterized protein LOC101212902 [Cucumis sativus]
Length=489

 Score =   132 bits (333),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 65/71 (92%), Positives = 67/71 (94%), Gaps = 0/71 (0%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTEAVLQNVM  510
            VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL TIVVSGTE VL+ V+
Sbjct  83   VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALLTIVVSGTEKVLEQVI  142

Query  511  EQLQKLVNVLK  543
            EQL KLVNVLK
Sbjct  143  EQLHKLVNVLK  153


 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 47/71 (66%), Gaps = 2/71 (3%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQN  504
            +R HT+S+ V D  G++  I G+FARRGYNI+SLAVG  + + +   T VV GT+  +  
Sbjct  317  LRSHTLSMLVNDSPGVLYIITGLFARRGYNIQSLAVGHAEAEGISRITTVVPGTDESIYK  376

Query  505  VMEQLQKLVNV  537
            +++ L +L +V
Sbjct  377  LVQHLYRLADV  387



>ref|XP_010109954.1| hypothetical protein L484_011796 [Morus notabilis]
 gb|EXC24930.1| hypothetical protein L484_011796 [Morus notabilis]
Length=512

 Score =   132 bits (333),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 65/77 (84%), Positives = 70/77 (91%), Gaps = 0/77 (0%)
 Frame = +1

Query  313  PTPRQKVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTEA  492
            P    KV+RHTISVFVGDESG+INRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTE 
Sbjct  88   PATLSKVQRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTEK  147

Query  493  VLQNVMEQLQKLVNVLK  543
            VL+ V+EQL KLVNV+K
Sbjct  148  VLRQVVEQLNKLVNVIK  164


 Score = 55.1 bits (131),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 29/73 (40%), Positives = 49/73 (67%), Gaps = 5/73 (7%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQN  504
            +R HT+S+ V D  G++N + GV +RRGYNI+SL VG  + + L   T V+ GT+   ++
Sbjct  326  LRSHTLSMLVNDYPGVLNIVTGVISRRGYNIQSLTVGHAEVEGLSRITTVIPGTD---ES  382

Query  505  VMEQLQKLVNVLK  543
            + + +Q+++N LK
Sbjct  383  IGKLVQEVLNFLK  395



>ref|XP_003572704.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like 
[Brachypodium distachyon]
Length=481

 Score =   132 bits (332),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 65/73 (89%), Positives = 68/73 (93%), Gaps = 0/73 (0%)
 Frame = +1

Query  322  RQKVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTEAVLQ  501
            R  VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGT+ VL+
Sbjct  71   RDTVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDRVLK  130

Query  502  NVMEQLQKLVNVL  540
             V+EQL KLVNVL
Sbjct  131  QVIEQLNKLVNVL  143


 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 50/70 (71%), Gaps = 2/70 (3%)
 Frame = +1

Query  340  HTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQNVME  513
            HT+S+ V D  G++N I GVFARRGY+I+SLAVG  + + +   T VV GT+  ++ +++
Sbjct  312  HTLSILVNDCPGVLNIITGVFARRGYSIQSLAVGRAEKEGISRITTVVPGTDESIEKLVQ  371

Query  514  QLQKLVNVLK  543
            QL KL++V K
Sbjct  372  QLYKLIDVHK  381



>ref|XP_010453787.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic 
[Camelina sativa]
Length=479

 Score =   132 bits (332),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 73/133 (55%), Positives = 93/133 (70%), Gaps = 13/133 (10%)
 Frame = +1

Query  163  SFSRKLGFCTASPN------IHVGKPKKLSVVFANAADGQHKAPSEITLSTSDPAPPTPR  324
            S ++  GF   SPN      I  G+  + + V ++A+       ++  ++T+    P   
Sbjct  21   SQNKGYGFQPKSPNSVKVTQIIDGRKMRNATVLSSAS-------TDKAITTAQSVAPRAC  73

Query  325  QKVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTEAVLQN  504
             +VRRHTISVFVGDESG+INRIAGVFARRGYNIESLAVGLN+DKALFTIVV GT+ VLQ 
Sbjct  74   DRVRRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNEDKALFTIVVLGTDKVLQQ  133

Query  505  VMEQLQKLVNVLK  543
            V+EQL K+VNV+K
Sbjct  134  VVEQLNKIVNVIK  146


 Score = 62.0 bits (149),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/70 (43%), Positives = 47/70 (67%), Gaps = 2/70 (3%)
 Frame = +1

Query  334  RRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQNV  507
            R HT+S+ V +  G++N I G  +RRGYNI+SLAVG  + + L   T V+ GT+  +  +
Sbjct  308  RSHTLSILVANAPGVLNLITGAISRRGYNIQSLAVGPAEKEGLSRITTVIPGTDDHIDKL  367

Query  508  MEQLQKLVNV  537
            + QLQKL+++
Sbjct  368  VRQLQKLIDL  377



>ref|XP_008643958.1| PREDICTED: uncharacterized protein LOC100381801 isoform X1 [Zea 
mays]
 gb|AFW72257.1| hypothetical protein ZEAMMB73_990877 [Zea mays]
Length=486

 Score =   132 bits (332),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 65/72 (90%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = +1

Query  322  RQKVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTEAVLQ  501
            R KVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGT+ VL 
Sbjct  78   RDKVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDMVLN  137

Query  502  NVMEQLQKLVNV  537
             V+EQL KLVNV
Sbjct  138  QVIEQLNKLVNV  149


 Score = 64.3 bits (155),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 47/68 (69%), Gaps = 2/68 (3%)
 Frame = +1

Query  340  HTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQNVME  513
            HT+S+ V D  G++N + GVFARRGYNI+SLAVG  + + +   T VV GT   +  +++
Sbjct  317  HTLSILVNDCPGVLNIVTGVFARRGYNIQSLAVGSAEKEGISRITTVVPGTVESIGKLVQ  376

Query  514  QLQKLVNV  537
            QL KL++V
Sbjct  377  QLYKLIDV  384



>tpg|DAA41907.1| TPA: hypothetical protein ZEAMMB73_831035 [Zea mays]
Length=476

 Score =   132 bits (331),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 64/81 (79%), Positives = 72/81 (89%), Gaps = 1/81 (1%)
 Frame = +1

Query  304  PAPP-TPRQKVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVS  480
            P PP + R  ++RHT+SVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVS
Sbjct  60   PVPPRSNRSVMKRHTLSVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVS  119

Query  481  GTEAVLQNVMEQLQKLVNVLK  543
            GT+ +L  V+EQL KLVNV+K
Sbjct  120  GTDKILNQVVEQLNKLVNVIK  140


 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 47/70 (67%), Gaps = 2/70 (3%)
 Frame = +1

Query  340  HTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQNVME  513
            HT+S+ V D  G++N + GVF+RRGYNI+SLAVG  + +     T VV GT+  +  ++ 
Sbjct  307  HTLSILVNDVPGVLNLVTGVFSRRGYNIQSLAVGPAEKEGTSRITTVVPGTDESIAKLVH  366

Query  514  QLQKLVNVLK  543
            QL KL++V +
Sbjct  367  QLYKLIDVYE  376



>ref|XP_006286862.1| hypothetical protein CARUB_v10003921mg [Capsella rubella]
 gb|EOA19760.1| hypothetical protein CARUB_v10003921mg [Capsella rubella]
Length=476

 Score =   132 bits (331),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 64/91 (70%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = +1

Query  271  APSEITLSTSDPAPPTPRQKVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNK  450
            A ++  ++ +    P    +VRRHTISVFVGDESG+INRIAGVFARRGYNIESLAVGLN+
Sbjct  54   ASTDKAVTAAQSVAPKASDRVRRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNE  113

Query  451  DKALFTIVVSGTEAVLQNVMEQLQKLVNVLK  543
            DKALFTIVV GT+ VLQ V+EQL KLVNV+K
Sbjct  114  DKALFTIVVLGTDKVLQQVVEQLNKLVNVIK  144


 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 48/71 (68%), Gaps = 2/71 (3%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQN  504
            +R HT+S+ V +  G++N I G  +RRGYNI+SLAVG  + + L   T V+ GT+  +  
Sbjct  304  IRSHTLSILVANVPGVLNLITGAISRRGYNIQSLAVGPAEKEGLSRITTVIPGTDDHIDK  363

Query  505  VMEQLQKLVNV  537
            ++ QLQKL+++
Sbjct  364  LVRQLQKLIDL  374



>ref|NP_001146158.1| uncharacterized protein LOC100279727 [Zea mays]
 gb|ACL53373.1| unknown [Zea mays]
Length=476

 Score =   132 bits (331),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 64/81 (79%), Positives = 72/81 (89%), Gaps = 1/81 (1%)
 Frame = +1

Query  304  PAPP-TPRQKVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVS  480
            P PP + R  ++RHT+SVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVS
Sbjct  60   PVPPRSNRSVMKRHTLSVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVS  119

Query  481  GTEAVLQNVMEQLQKLVNVLK  543
            GT+ +L  V+EQL KLVNV+K
Sbjct  120  GTDKILNQVVEQLNKLVNVIK  140


 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 47/70 (67%), Gaps = 2/70 (3%)
 Frame = +1

Query  340  HTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQNVME  513
            HT+S+ V D  G++N + GVF+RRGYNI+SLAVG  + +     T VV GT+  +  ++ 
Sbjct  307  HTLSILVNDVPGVLNLVTGVFSRRGYNIQSLAVGPAEKEGTSRITTVVPGTDESIAKLVH  366

Query  514  QLQKLVNVLK  543
            QL KL++V +
Sbjct  367  QLYKLIDVYE  376



>dbj|BAJ92239.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=473

 Score =   132 bits (331),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 66/75 (88%), Positives = 70/75 (93%), Gaps = 1/75 (1%)
 Frame = +1

Query  319  PRQ-KVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTEAV  495
            PR  +VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGT+ V
Sbjct  62   PRDCRVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDRV  121

Query  496  LQNVMEQLQKLVNVL  540
            L+ V+EQL KLVNVL
Sbjct  122  LKQVIEQLNKLVNVL  136


 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 51/73 (70%), Gaps = 2/73 (3%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQN  504
            +R HT+S+ V D  G++N I GVFARRGY+I+SLAVG  + + +   T VV GT+  +  
Sbjct  301  LRSHTLSILVNDCPGVLNIITGVFARRGYSIQSLAVGPAEKEGISRITTVVPGTDESIGK  360

Query  505  VMEQLQKLVNVLK  543
            +++QL KL++V K
Sbjct  361  LVQQLYKLIDVHK  373



>gb|EMS53688.1| Acetolactate synthase small subunit [Triticum urartu]
Length=384

 Score =   130 bits (328),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 64/71 (90%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = +1

Query  328  KVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTEAVLQNV  507
            +VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGT+ VL+ V
Sbjct  2    RVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDRVLKQV  61

Query  508  MEQLQKLVNVL  540
            +EQL KLVNVL
Sbjct  62   IEQLNKLVNVL  72


 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 52/73 (71%), Gaps = 2/73 (3%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQN  504
            +R HT+S+ V D  G++N I GVFARRGY+I+SLAVG  + + +   T VV GT+  ++ 
Sbjct  237  LRSHTLSILVNDCPGVLNIITGVFARRGYSIQSLAVGPAEKEGISRITTVVPGTDESIEK  296

Query  505  VMEQLQKLVNVLK  543
            +++QL KL++V K
Sbjct  297  LVQQLYKLIDVHK  309



>gb|EMT12300.1| Acetolactate synthase small subunit [Aegilops tauschii]
Length=432

 Score =   130 bits (328),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 64/71 (90%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = +1

Query  328  KVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTEAVLQNV  507
            +VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGT+ VL+ V
Sbjct  9    RVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDRVLKQV  68

Query  508  MEQLQKLVNVL  540
            +EQL KLVNVL
Sbjct  69   IEQLNKLVNVL  79


 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 52/73 (71%), Gaps = 2/73 (3%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQN  504
            +R HT+S+ V D  G++N I GVFARRGY+I+SLAVG  + + +   T VV GT+  ++ 
Sbjct  244  LRSHTLSILVNDCPGVLNIITGVFARRGYSIQSLAVGPAEKEGISRITTVVPGTDESIEK  303

Query  505  VMEQLQKLVNVLK  543
            +++QL KL++V K
Sbjct  304  LVQQLYKLIDVHK  316



>ref|XP_004250085.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic 
[Solanum lycopersicum]
Length=490

 Score =   131 bits (329),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 75/122 (61%), Positives = 85/122 (70%), Gaps = 5/122 (4%)
 Frame = +1

Query  190  TASPNIHVGKPKKLSVVFANAADGQHKAPSEITLSTSDPAPPTPRQ----KVRRHTISVF  357
            T S NI  G    L V    +++G     +   +  +  AP TP      +V+ HTISVF
Sbjct  37   TGSRNISFGFKNVLPVNVIASSNGSGSTDNG-AVYVARTAPVTPSSPASSRVKSHTISVF  95

Query  358  VGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTEAVLQNVMEQLQKLVNV  537
            VGDESG+INRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTE VLQ V+EQL KLVNV
Sbjct  96   VGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTEKVLQQVVEQLNKLVNV  155

Query  538  LK  543
             K
Sbjct  156  WK  157


 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 49/71 (69%), Gaps = 2/71 (3%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQN  504
            +R HT+S+ V +  G++N I+GV +RRGYN++SLAVG  + + L   T VV GT+  +  
Sbjct  318  IRSHTLSMLVNNAPGVLNLISGVISRRGYNVQSLAVGPAETEGLSRITTVVPGTDETIGK  377

Query  505  VMEQLQKLVNV  537
            +++Q  KL++V
Sbjct  378  LVKQFNKLIDV  388



>ref|XP_006858758.1| hypothetical protein AMTR_s00066p00141740 [Amborella trichopoda]
 gb|ERN20225.1| hypothetical protein AMTR_s00066p00141740 [Amborella trichopoda]
Length=496

 Score =   131 bits (329),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 66/81 (81%), Positives = 69/81 (85%), Gaps = 0/81 (0%)
 Frame = +1

Query  301  DPAPPTPRQKVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVS  480
            D AP     KV+RHTISVFVGDESGMINRIAGVFARRGYNI+SLAVGLN DKALFTIVVS
Sbjct  78   DAAPSRALNKVQRHTISVFVGDESGMINRIAGVFARRGYNIDSLAVGLNSDKALFTIVVS  137

Query  481  GTEAVLQNVMEQLQKLVNVLK  543
            GTE VL+ V  QL KLVNVLK
Sbjct  138  GTERVLRQVTNQLYKLVNVLK  158


 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 48/71 (68%), Gaps = 2/71 (3%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTI--VVSGTEAVLQN  504
            +R HT+S+ V D  G++N + G F+RRGYNI+SLAVG ++ + +  I  VV  T+  +  
Sbjct  324  LRSHTLSLLVNDCPGVLNIVTGCFSRRGYNIQSLAVGPSEREGISRIMTVVPATDESISK  383

Query  505  VMEQLQKLVNV  537
            ++ QL KL++V
Sbjct  384  LVRQLYKLIDV  394



>ref|XP_010492512.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic-like 
[Camelina sativa]
Length=479

 Score =   131 bits (329),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 72/127 (57%), Positives = 90/127 (71%), Gaps = 13/127 (10%)
 Frame = +1

Query  181  GFCTASPN------IHVGKPKKLSVVFANAADGQHKAPSEITLSTSDPAPPTPRQKVRRH  342
            GF   SPN      I  G+  + + V ++A+       ++  ++T+    P    +VRRH
Sbjct  27   GFPPKSPNSVKVTQIIDGRKMRNATVLSSAS-------TDKAITTAQSISPRACDRVRRH  79

Query  343  TISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTEAVLQNVMEQLQ  522
            TISVFVGDESG+INRIAGVFARRGYNIESLAVGLN+DKALFTIVV GT+ VLQ V+EQL 
Sbjct  80   TISVFVGDESGIINRIAGVFARRGYNIESLAVGLNEDKALFTIVVLGTDKVLQQVVEQLN  139

Query  523  KLVNVLK  543
            K+VNV+K
Sbjct  140  KIVNVIK  146


 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/70 (43%), Positives = 47/70 (67%), Gaps = 2/70 (3%)
 Frame = +1

Query  334  RRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQNV  507
            R HT+S+ V +  G++N I G  +RRGYNI+SLAVG  + + L   T V+ GT+  +  +
Sbjct  308  RSHTLSILVANSPGVLNLITGAISRRGYNIQSLAVGPAEKEGLSRITTVIPGTDDHIDKL  367

Query  508  MEQLQKLVNV  537
            + QLQKL+++
Sbjct  368  VRQLQKLIDL  377



>ref|XP_009604733.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic 
[Nicotiana tomentosiformis]
Length=402

 Score =   130 bits (327),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 64/72 (89%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = +1

Query  328  KVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTEAVLQNV  507
            +V+ HTISVFVGDESG+INRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTE VLQ V
Sbjct  81   RVKCHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTEKVLQQV  140

Query  508  MEQLQKLVNVLK  543
            +EQL KLVNVLK
Sbjct  141  VEQLNKLVNVLK  152


 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 48/71 (68%), Gaps = 2/71 (3%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQN  504
            +R HTIS+ V +  G++N I GV +RRGYN++SLAVG  + + L   T VV GT+  +  
Sbjct  314  LRSHTISMLVNNAPGVLNLITGVISRRGYNVQSLAVGPAESEGLSRITTVVPGTDETIGK  373

Query  505  VMEQLQKLVNV  537
            +++Q  KLV++
Sbjct  374  LVKQFYKLVDI  384



>emb|CDP04139.1| unnamed protein product [Coffea canephora]
Length=451

 Score =   130 bits (328),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 64/71 (90%), Positives = 67/71 (94%), Gaps = 0/71 (0%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTEAVLQNVM  510
            V+RHTISVFVGDESG+INRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTE  LQ V+
Sbjct  47   VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTEKTLQQVV  106

Query  511  EQLQKLVNVLK  543
            EQL KLVNVLK
Sbjct  107  EQLNKLVNVLK  117


 Score = 61.6 bits (148),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 47/71 (66%), Gaps = 2/71 (3%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQN  504
            +R HT+S+ V D  G++N + GV +RRGYN++SLAVG  + + +   T VV GT   +  
Sbjct  280  LRSHTLSMLVNDSPGVLNLVTGVISRRGYNVQSLAVGPAEKEGVSRITTVVPGTNETIGK  339

Query  505  VMEQLQKLVNV  537
            +++Q  KLV+V
Sbjct  340  LVQQFYKLVDV  350



>ref|XP_008349232.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic-like 
[Malus domestica]
Length=412

 Score =   130 bits (327),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 63/72 (88%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = +1

Query  328  KVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTEAVLQNV  507
            +V+RHTISVFVGDESG+INRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTE VL+ V
Sbjct  6    RVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTEKVLRQV  65

Query  508  MEQLQKLVNVLK  543
            +EQL KLVNV+K
Sbjct  66   VEQLNKLVNVIK  77


 Score = 64.3 bits (155),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 49/71 (69%), Gaps = 2/71 (3%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQN  504
            VR HT+S+ V D  G++N + GV +RRGYNI+SLAVG  + + L   T VV GT+  +  
Sbjct  240  VRSHTLSMIVNDYPGVLNTVTGVLSRRGYNIQSLAVGPAEMEGLSRITTVVPGTDDSISK  299

Query  505  VMEQLQKLVNV  537
            +++QL KL+++
Sbjct  300  LVQQLHKLIDL  310



>ref|XP_011014725.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic-like 
isoform X4 [Populus euphratica]
Length=392

 Score =   130 bits (326),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 63/85 (74%), Positives = 72/85 (85%), Gaps = 0/85 (0%)
 Frame = +1

Query  289  LSTSDPAPPTPRQKVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFT  468
            +S +D  P   R K++RHTISVFVGDE G+INRIAGVFARRGY+IESLAVGLNKDKALFT
Sbjct  63   VSVADSVPTVTRSKMQRHTISVFVGDEIGIINRIAGVFARRGYSIESLAVGLNKDKALFT  122

Query  469  IVVSGTEAVLQNVMEQLQKLVNVLK  543
            IVV GTE VL+ V+EQL KLV V+K
Sbjct  123  IVVCGTEEVLRQVVEQLNKLVTVIK  147



>ref|XP_002449227.1| hypothetical protein SORBIDRAFT_05g006620 [Sorghum bicolor]
 gb|EES08215.1| hypothetical protein SORBIDRAFT_05g006620 [Sorghum bicolor]
Length=476

 Score =   130 bits (328),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 64/81 (79%), Positives = 70/81 (86%), Gaps = 1/81 (1%)
 Frame = +1

Query  304  PAPPTPRQKV-RRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVS  480
            P PP     V +RHT+SVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVS
Sbjct  61   PVPPRSNHSVIKRHTLSVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVS  120

Query  481  GTEAVLQNVMEQLQKLVNVLK  543
            GT+ +L  V+EQL KLVNV+K
Sbjct  121  GTDKILNQVVEQLNKLVNVIK  141


 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 45/68 (66%), Gaps = 2/68 (3%)
 Frame = +1

Query  340  HTISVFVGDESGMINRIAGVFARRGYNIESLAVG--LNKDKALFTIVVSGTEAVLQNVME  513
            HT+S+ V D  G++N + GVF+RRGYNI+SLAVG    +  +  T VV G +  +  ++ 
Sbjct  307  HTLSILVNDVPGVLNVVTGVFSRRGYNIQSLAVGPAAKEGTSRITTVVPGNDESIAKLVH  366

Query  514  QLQKLVNV  537
            QL KL++V
Sbjct  367  QLYKLIDV  374



>ref|XP_004504201.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like 
[Cicer arietinum]
Length=475

 Score =   130 bits (327),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 71/115 (62%), Positives = 82/115 (71%), Gaps = 8/115 (7%)
 Frame = +1

Query  199  PNIHVGKPKKLSVVFANAADGQHKAPSEITLSTSDPAPPTPRQKVRRHTISVFVGDESGM  378
            P     +  KL++  A +AD         T+S+        R KVRRHTISVFVGDESGM
Sbjct  34   PTTSTPRRNKLTLSAATSAD--------TTVSSHGSVTSPSRSKVRRHTISVFVGDESGM  85

Query  379  INRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTEAVLQNVMEQLQKLVNVLK  543
            INRIAGV A+RGYNIESLAVGLN+DKAL +IVVSGT+  LQ V+EQLQKLVNVLK
Sbjct  86   INRIAGVLAKRGYNIESLAVGLNQDKALLSIVVSGTDRGLQQVVEQLQKLVNVLK  140


 Score = 63.9 bits (154),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 49/70 (70%), Gaps = 2/70 (3%)
 Frame = +1

Query  334  RRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALF--TIVVSGTEAVLQNV  507
            R HT+S+ V D  G+++ + GVFARRGYNI+SL VG ++ + ++  T VV GT+  +  +
Sbjct  304  RSHTLSILVNDVPGVLSCVTGVFARRGYNIQSLVVGHSEVEGIYRLTTVVPGTDESISKL  363

Query  508  MEQLQKLVNV  537
            ++QL KLV +
Sbjct  364  VQQLYKLVEL  373



>ref|XP_009404280.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=460

 Score =   130 bits (326),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 65/71 (92%), Positives = 66/71 (93%), Gaps = 0/71 (0%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTEAVLQNVM  510
            VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLN DKALFTI VSGTE VLQ V+
Sbjct  84   VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNTDKALFTISVSGTEKVLQQVV  143

Query  511  EQLQKLVNVLK  543
            EQL KLVNVLK
Sbjct  144  EQLYKLVNVLK  154


 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 51/71 (72%), Gaps = 2/71 (3%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQN  504
            +R HT+S+ V D  G++N + GVF+RRGYNI+SLAVG  + + +   T VV GT+  ++ 
Sbjct  288  LRSHTLSILVNDIPGVLNIVTGVFSRRGYNIQSLAVGPAEKEGISRITTVVPGTDETIEK  347

Query  505  VMEQLQKLVNV  537
            +++Q+ KL++V
Sbjct  348  LVQQIYKLIDV  358



>ref|XP_006664907.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like 
[Oryza brachyantha]
Length=412

 Score =   129 bits (325),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 63/71 (89%), Positives = 67/71 (94%), Gaps = 0/71 (0%)
 Frame = +1

Query  328  KVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTEAVLQNV  507
            +VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKA+FTIVVSGT+ VL  V
Sbjct  4    RVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAMFTIVVSGTDRVLNQV  63

Query  508  MEQLQKLVNVL  540
            +EQL KLVNVL
Sbjct  64   IEQLNKLVNVL  74


 Score = 67.8 bits (164),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 50/71 (70%), Gaps = 2/71 (3%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQN  504
            +R HT+S+ V D  G++N + GVFARRGYNI+SLAVG  +   L   T V+ GT+  ++ 
Sbjct  240  LRSHTLSILVNDCPGVLNIVTGVFARRGYNIQSLAVGPAEKAGLSRITTVIPGTDESIEK  299

Query  505  VMEQLQKLVNV  537
            +++QL KLV+V
Sbjct  300  LVQQLYKLVDV  310



>gb|EYU39756.1| hypothetical protein MIMGU_mgv1a005187mg [Erythranthe guttata]
Length=494

 Score =   130 bits (326),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 63/72 (88%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = +1

Query  328  KVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTEAVLQNV  507
            + +RHTISVFVGDESG+INRIAGVFARRGYNIESLAVGLN+DKALFTIVVSGTE VLQ V
Sbjct  84   RAKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNQDKALFTIVVSGTEKVLQQV  143

Query  508  MEQLQKLVNVLK  543
            +EQL KLVNVLK
Sbjct  144  VEQLNKLVNVLK  155


 Score = 58.2 bits (139),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 29/71 (41%), Positives = 48/71 (68%), Gaps = 2/71 (3%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQN  504
            ++ HT+S+ V +  G++N I GV +RRGYNI+SLAVG  + + +   T VV GT+  +  
Sbjct  322  LQSHTLSMVVNNSPGVLNLITGVISRRGYNIQSLAVGPAESEGISRITTVVPGTDESIGK  381

Query  505  VMEQLQKLVNV  537
            +++Q  KLV++
Sbjct  382  LVQQFYKLVDI  392



>ref|XP_009404279.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic-like 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=488

 Score =   130 bits (326),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 65/71 (92%), Positives = 66/71 (93%), Gaps = 0/71 (0%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTEAVLQNVM  510
            VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLN DKALFTI VSGTE VLQ V+
Sbjct  84   VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNTDKALFTISVSGTEKVLQQVV  143

Query  511  EQLQKLVNVLK  543
            EQL KLVNVLK
Sbjct  144  EQLYKLVNVLK  154


 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 51/71 (72%), Gaps = 2/71 (3%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQN  504
            +R HT+S+ V D  G++N + GVF+RRGYNI+SLAVG  + + +   T VV GT+  ++ 
Sbjct  316  LRSHTLSILVNDIPGVLNIVTGVFSRRGYNIQSLAVGPAEKEGISRITTVVPGTDETIEK  375

Query  505  VMEQLQKLVNV  537
            +++Q+ KL++V
Sbjct  376  LVQQIYKLIDV  386



>gb|EAZ36982.1| hypothetical protein OsJ_21322 [Oryza sativa Japonica Group]
Length=358

 Score =   129 bits (323),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 60/71 (85%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTEAVLQNVM  510
            ++RHT+SVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTE +L+ V+
Sbjct  17   IKRHTLSVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTEKILKQVV  76

Query  511  EQLQKLVNVLK  543
            EQL KLVNV++
Sbjct  77   EQLNKLVNVIQ  87



>ref|XP_011014719.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic-like 
isoform X3 [Populus euphratica]
Length=446

 Score =   129 bits (325),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 63/85 (74%), Positives = 72/85 (85%), Gaps = 0/85 (0%)
 Frame = +1

Query  289  LSTSDPAPPTPRQKVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFT  468
            +S +D  P   R K++RHTISVFVGDE G+INRIAGVFARRGY+IESLAVGLNKDKALFT
Sbjct  63   VSVADSVPTVTRSKMQRHTISVFVGDEIGIINRIAGVFARRGYSIESLAVGLNKDKALFT  122

Query  469  IVVSGTEAVLQNVMEQLQKLVNVLK  543
            IVV GTE VL+ V+EQL KLV V+K
Sbjct  123  IVVCGTEEVLRQVVEQLNKLVTVIK  147


 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 48/70 (69%), Gaps = 2/70 (3%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQN  504
            +R HT+S+ V +  G++N + GV +RRGYNI+SLAVG  + + L   T V+ GT+  +  
Sbjct  318  LRSHTLSMLVNNCPGVLNILTGVISRRGYNIQSLAVGHAEKEGLSRITTVIPGTDESIGK  377

Query  505  VMEQLQKLVN  534
            +++QL KL++
Sbjct  378  LVQQLHKLID  387



>ref|XP_010420316.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic-like 
[Camelina sativa]
Length=481

 Score =   129 bits (325),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 71/131 (54%), Positives = 91/131 (69%), Gaps = 13/131 (10%)
 Frame = +1

Query  169  SRKLGFCTASPN------IHVGKPKKLSVVFANAADGQHKAPSEITLSTSDPAPPTPRQK  330
            S+  GF   +PN      I  G+  + + V ++A+       ++  ++T+    P    +
Sbjct  25   SKVYGFPAKTPNSVRVTQIIDGRKMRNATVLSSAS-------TDKAITTAQSLAPRACDR  77

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTEAVLQNVM  510
            VRRHTISVFVGDESG+INRIAGVFARRGYNIESLAV LN+DKALFTIVV GT+ VLQ V+
Sbjct  78   VRRHTISVFVGDESGIINRIAGVFARRGYNIESLAVALNEDKALFTIVVLGTDKVLQQVV  137

Query  511  EQLQKLVNVLK  543
            EQL K+VNV+K
Sbjct  138  EQLNKIVNVIK  148


 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/70 (43%), Positives = 47/70 (67%), Gaps = 2/70 (3%)
 Frame = +1

Query  334  RRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQNV  507
            R HT+S+ V +  G++N I G  +RRGYNI+SLAVG  + + L   T V+ GT+  +  +
Sbjct  310  RSHTLSILVANAPGVLNLITGAISRRGYNIQSLAVGPAEKEGLSRITTVIPGTDDHIDKL  369

Query  508  MEQLQKLVNV  537
            + QLQKL+++
Sbjct  370  VRQLQKLIDL  379



>ref|XP_011014695.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic-like 
isoform X1 [Populus euphratica]
 ref|XP_011014703.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic-like 
isoform X1 [Populus euphratica]
Length=490

 Score =   129 bits (325),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 63/85 (74%), Positives = 72/85 (85%), Gaps = 0/85 (0%)
 Frame = +1

Query  289  LSTSDPAPPTPRQKVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFT  468
            +S +D  P   R K++RHTISVFVGDE G+INRIAGVFARRGY+IESLAVGLNKDKALFT
Sbjct  63   VSVADSVPTVTRSKMQRHTISVFVGDEIGIINRIAGVFARRGYSIESLAVGLNKDKALFT  122

Query  469  IVVSGTEAVLQNVMEQLQKLVNVLK  543
            IVV GTE VL+ V+EQL KLV V+K
Sbjct  123  IVVCGTEEVLRQVVEQLNKLVTVIK  147


 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 48/70 (69%), Gaps = 2/70 (3%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQN  504
            +R HT+S+ V +  G++N + GV +RRGYNI+SLAVG  + + L   T V+ GT+  +  
Sbjct  318  LRSHTLSMLVNNCPGVLNILTGVISRRGYNIQSLAVGHAEKEGLSRITTVIPGTDESIGK  377

Query  505  VMEQLQKLVN  534
            +++QL KL++
Sbjct  378  LVQQLHKLID  387



>ref|XP_011014712.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic-like 
isoform X2 [Populus euphratica]
Length=467

 Score =   129 bits (324),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 63/85 (74%), Positives = 72/85 (85%), Gaps = 0/85 (0%)
 Frame = +1

Query  289  LSTSDPAPPTPRQKVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFT  468
            +S +D  P   R K++RHTISVFVGDE G+INRIAGVFARRGY+IESLAVGLNKDKALFT
Sbjct  63   VSVADSVPTVTRSKMQRHTISVFVGDEIGIINRIAGVFARRGYSIESLAVGLNKDKALFT  122

Query  469  IVVSGTEAVLQNVMEQLQKLVNVLK  543
            IVV GTE VL+ V+EQL KLV V+K
Sbjct  123  IVVCGTEEVLRQVVEQLNKLVTVIK  147


 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 48/70 (69%), Gaps = 2/70 (3%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQN  504
            +R HT+S+ V +  G++N + GV +RRGYNI+SLAVG  + + L   T V+ GT+  +  
Sbjct  295  LRSHTLSMLVNNCPGVLNILTGVISRRGYNIQSLAVGHAEKEGLSRITTVIPGTDESIGK  354

Query  505  VMEQLQKLVN  534
            +++QL KL++
Sbjct  355  LVQQLHKLID  364



>ref|XP_010558579.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic-like 
[Tarenaya hassleriana]
Length=421

 Score =   129 bits (323),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 63/75 (84%), Positives = 68/75 (91%), Gaps = 0/75 (0%)
 Frame = +1

Query  319  PRQKVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTEAVL  498
            P  +VRRHTISVFVGDESG+INRIAGVFARRGYNIESLAVGLN DKALFTIVV GT+ VL
Sbjct  12   PISRVRRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNADKALFTIVVIGTDRVL  71

Query  499  QNVMEQLQKLVNVLK  543
            Q V+EQL KLVNV+K
Sbjct  72   QQVVEQLNKLVNVIK  86


 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 47/71 (66%), Gaps = 2/71 (3%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQN  504
            +R HT+S+ V +  G++N IAGV +RRGYNI+SLAVG  + + L   T V+  T+     
Sbjct  249  MRSHTLSILVNNSPGVLNEIAGVISRRGYNIQSLAVGPAEKEGLSRITTVIPATDEKTSQ  308

Query  505  VMEQLQKLVNV  537
            ++ QL KLV++
Sbjct  309  LVGQLHKLVDI  319



>ref|XP_006663345.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like, 
partial [Oryza brachyantha]
Length=425

 Score =   128 bits (322),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 60/71 (85%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTEAVLQNVM  510
            ++RHT+SVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTE +L+ V+
Sbjct  20   IKRHTLSVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTEKILKQVV  79

Query  511  EQLQKLVNVLK  543
            EQL KLVNV++
Sbjct  80   EQLNKLVNVIQ  90


 Score = 61.6 bits (148),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 47/70 (67%), Gaps = 2/70 (3%)
 Frame = +1

Query  340  HTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQNVME  513
            HT+S+ V D  G++N + GVF+RRGYNI+SLAVG  + +     T VV GT+  +  ++ 
Sbjct  256  HTLSILVNDFPGVLNVVTGVFSRRGYNIQSLAVGPAEKEGTSRITTVVPGTDESIAKLVH  315

Query  514  QLQKLVNVLK  543
            QL KL++V +
Sbjct  316  QLYKLIDVYE  325



>ref|XP_011084704.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic-like 
isoform X1 [Sesamum indicum]
 ref|XP_011084706.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic-like 
isoform X1 [Sesamum indicum]
Length=493

 Score =   128 bits (322),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 61/72 (85%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = +1

Query  328  KVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTEAVLQNV  507
            + +RHTISVFVGDESG+INRIAGVFARRGYNIESLAVGLN+DKALFTIVV GTE +LQ V
Sbjct  83   RTKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNQDKALFTIVVCGTEKILQQV  142

Query  508  MEQLQKLVNVLK  543
            +EQL KLVNVLK
Sbjct  143  VEQLNKLVNVLK  154


 Score = 58.5 bits (140),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 29/73 (40%), Positives = 50/73 (68%), Gaps = 2/73 (3%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQN  504
            ++ HT+S+ V +  G++N + GV +RRGYNI+SLAVG  + + +   T VV+GT+  +  
Sbjct  321  LQSHTLSLLVNNSPGVLNLVTGVVSRRGYNIQSLAVGPAETEGISRITTVVAGTDESIGK  380

Query  505  VMEQLQKLVNVLK  543
            +++Q  KLV+V +
Sbjct  381  LVKQFYKLVDVYE  393



>ref|XP_011084705.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic-like 
isoform X2 [Sesamum indicum]
Length=493

 Score =   128 bits (321),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 61/72 (85%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = +1

Query  328  KVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTEAVLQNV  507
            + +RHTISVFVGDESG+INRIAGVFARRGYNIESLAVGLN+DKALFTIVV GTE +LQ V
Sbjct  83   RTKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNQDKALFTIVVCGTEKILQQV  142

Query  508  MEQLQKLVNVLK  543
            +EQL KLVNVLK
Sbjct  143  VEQLNKLVNVLK  154


 Score = 58.5 bits (140),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 29/73 (40%), Positives = 50/73 (68%), Gaps = 2/73 (3%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQN  504
            ++ HT+S+ V +  G++N + GV +RRGYNI+SLAVG  + + +   T VV+GT+  +  
Sbjct  321  LQSHTLSLLVNNSPGVLNLVTGVVSRRGYNIQSLAVGPAETEGISRITTVVAGTDESIGK  380

Query  505  VMEQLQKLVNVLK  543
            +++Q  KLV+V +
Sbjct  381  LVKQFYKLVDVYE  393



>ref|XP_008667813.1| PREDICTED: uncharacterized protein LOC100279727 isoform X1 [Zea 
mays]
Length=407

 Score =   127 bits (318),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 60/71 (85%), Positives = 67/71 (94%), Gaps = 0/71 (0%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTEAVLQNVM  510
            ++RHT+SVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGT+ +L  V+
Sbjct  1    MKRHTLSVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDKILNQVV  60

Query  511  EQLQKLVNVLK  543
            EQL KLVNV+K
Sbjct  61   EQLNKLVNVIK  71


 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 47/70 (67%), Gaps = 2/70 (3%)
 Frame = +1

Query  340  HTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQNVME  513
            HT+S+ V D  G++N + GVF+RRGYNI+SLAVG  + +     T VV GT+  +  ++ 
Sbjct  238  HTLSILVNDVPGVLNLVTGVFSRRGYNIQSLAVGPAEKEGTSRITTVVPGTDESIAKLVH  297

Query  514  QLQKLVNVLK  543
            QL KL++V +
Sbjct  298  QLYKLIDVYE  307



>ref|XP_010911692.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic-like, 
partial [Elaeis guineensis]
Length=256

 Score =   124 bits (311),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 60/68 (88%), Positives = 65/68 (96%), Gaps = 0/68 (0%)
 Frame = +1

Query  340  HTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTEAVLQNVMEQL  519
            HTISVFVGDESGMINRIAGVFARRGYNIESLAVGLN+D+ALFTIVVSGT+ VL+ V+EQL
Sbjct  88   HTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNRDRALFTIVVSGTDRVLRQVVEQL  147

Query  520  QKLVNVLK  543
             KLVNVLK
Sbjct  148  HKLVNVLK  155



>ref|XP_010673855.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=477

 Score =   127 bits (318),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 65/89 (73%), Positives = 75/89 (84%), Gaps = 1/89 (1%)
 Frame = +1

Query  280  EITLSTS-DPAPPTPRQKVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDK  456
            E++ +TS +  P +   KV RHTISVFVGDESG+INRIAGV +RRGYNIESLAVGLNKDK
Sbjct  53   EVSSNTSVNAVPVSAHPKVMRHTISVFVGDESGIINRIAGVISRRGYNIESLAVGLNKDK  112

Query  457  ALFTIVVSGTEAVLQNVMEQLQKLVNVLK  543
            ALFTIVV GT+ VL+ VMEQL KLV+VLK
Sbjct  113  ALFTIVVCGTDKVLRQVMEQLNKLVSVLK  141


 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 49/71 (69%), Gaps = 2/71 (3%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQN  504
            +R HT+S+ V + SG++N + GV +RRGYNI+SLAVG  + + L   T VV G +  +  
Sbjct  303  LRSHTLSMLVNNVSGVLNTVTGVISRRGYNIQSLAVGPAEKEGLSRITTVVPGNDESIGK  362

Query  505  VMEQLQKLVNV  537
            +++QL KLV++
Sbjct  363  LVQQLSKLVDL  373



>ref|XP_008800993.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic 
isoform X2 [Phoenix dactylifera]
Length=488

 Score =   126 bits (316),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 62/68 (91%), Positives = 65/68 (96%), Gaps = 0/68 (0%)
 Frame = +1

Query  340  HTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTEAVLQNVMEQL  519
            HTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGT+ VL+ V+EQL
Sbjct  88   HTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDRVLRQVVEQL  147

Query  520  QKLVNVLK  543
             KLVNVLK
Sbjct  148  HKLVNVLK  155


 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 48/68 (71%), Gaps = 2/68 (3%)
 Frame = +1

Query  340  HTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQNVME  513
            HT+S+ V D  G++N + GVF+RRGYNI+SLAVG  + + +   T VV GT+  +  +++
Sbjct  319  HTLSILVNDSPGVLNIVTGVFSRRGYNIQSLAVGPEEKEGISRITTVVPGTDESIGKLVQ  378

Query  514  QLQKLVNV  537
            QL KLV+V
Sbjct  379  QLYKLVDV  386



>ref|XP_008800984.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic 
isoform X1 [Phoenix dactylifera]
Length=502

 Score =   126 bits (317),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 62/68 (91%), Positives = 65/68 (96%), Gaps = 0/68 (0%)
 Frame = +1

Query  340  HTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTEAVLQNVMEQL  519
            HTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGT+ VL+ V+EQL
Sbjct  88   HTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDRVLRQVVEQL  147

Query  520  QKLVNVLK  543
             KLVNVLK
Sbjct  148  HKLVNVLK  155


 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 48/68 (71%), Gaps = 2/68 (3%)
 Frame = +1

Query  340  HTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQNVME  513
            HT+S+ V D  G++N + GVF+RRGYNI+SLAVG  + + +   T VV GT+  +  +++
Sbjct  333  HTLSILVNDSPGVLNIVTGVFSRRGYNIQSLAVGPEEKEGISRITTVVPGTDESIGKLVQ  392

Query  514  QLQKLVNV  537
            QL KLV+V
Sbjct  393  QLYKLVDV  400



>ref|XP_002979412.1| hypothetical protein SELMODRAFT_111081 [Selaginella moellendorffii]
 gb|EFJ19301.1| hypothetical protein SELMODRAFT_111081 [Selaginella moellendorffii]
Length=414

 Score =   125 bits (315),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 60/72 (83%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = +1

Query  328  KVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTEAVLQNV  507
            +++R+TISVFVGDESGMINRIAGVF+RRGYNIESLAVGLN+DKALFTIVVSGT+ VLQ V
Sbjct  3    RIQRYTISVFVGDESGMINRIAGVFSRRGYNIESLAVGLNRDKALFTIVVSGTDRVLQQV  62

Query  508  MEQLQKLVNVLK  543
            M+QL KLVNV K
Sbjct  63   MKQLYKLVNVRK  74


 Score = 73.2 bits (178),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 53/70 (76%), Gaps = 2/70 (3%)
 Frame = +1

Query  340  HTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQNVME  513
            HT+S+ V D  G++NR+ GVFARRGYNI+SLAVGL++ + +   T VV GT+  ++ ++ 
Sbjct  242  HTLSMVVNDAPGVLNRVTGVFARRGYNIQSLAVGLSERQGISRITTVVPGTDESIRKLLH  301

Query  514  QLQKLVNVLK  543
            QL KL++V++
Sbjct  302  QLSKLIDVVQ  311



>ref|XP_002977907.1| hypothetical protein SELMODRAFT_107328 [Selaginella moellendorffii]
 gb|EFJ21245.1| hypothetical protein SELMODRAFT_107328 [Selaginella moellendorffii]
Length=412

 Score =   125 bits (314),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 60/72 (83%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = +1

Query  328  KVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTEAVLQNV  507
            +++R+TISVFVGDESGMINRIAGVF+RRGYNIESLAVGLN+DKALFTIVVSGT+ VLQ V
Sbjct  3    RIQRYTISVFVGDESGMINRIAGVFSRRGYNIESLAVGLNRDKALFTIVVSGTDRVLQQV  62

Query  508  MEQLQKLVNVLK  543
            M+QL KLVNV K
Sbjct  63   MKQLYKLVNVRK  74


 Score = 73.2 bits (178),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 53/70 (76%), Gaps = 2/70 (3%)
 Frame = +1

Query  340  HTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQNVME  513
            HT+S+ V D  G++NR+ GVFARRGYNI+SLAVGL++ + +   T VV GT+  ++ ++ 
Sbjct  242  HTLSMVVNDAPGVLNRVTGVFARRGYNIQSLAVGLSERQGISRITTVVPGTDESIRKLLH  301

Query  514  QLQKLVNVLK  543
            QL KL++V++
Sbjct  302  QLSKLIDVVQ  311



>ref|XP_001773408.1| predicted protein [Physcomitrella patens]
 gb|EDQ61781.1| predicted protein, partial [Physcomitrella patens]
Length=417

 Score =   124 bits (312),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 61/70 (87%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = +1

Query  328  KVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTEAVLQNV  507
            +VRR+TISVFVGDESGMINRIAGV ARRGYNIESLAVGLNKDKALFTIVVSGT+ VLQ V
Sbjct  2    RVRRYTISVFVGDESGMINRIAGVIARRGYNIESLAVGLNKDKALFTIVVSGTDRVLQQV  61

Query  508  MEQLQKLVNV  537
            M+QL KLV+V
Sbjct  62   MKQLSKLVSV  71


 Score = 67.0 bits (162),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 33/69 (48%), Positives = 47/69 (68%), Gaps = 2/69 (3%)
 Frame = +1

Query  340  HTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTI--VVSGTEAVLQNVME  513
            HT+ + V D  G++NR+ GVFARRGYNI+SLAVG  +      I  VV GT+  ++ ++ 
Sbjct  244  HTLGILVNDAPGVLNRVTGVFARRGYNIQSLAVGPAETPGTSRILTVVPGTDESIKKLLS  303

Query  514  QLQKLVNVL  540
            QL KL++VL
Sbjct  304  QLSKLIDVL  312



>ref|XP_002316167.1| hypothetical protein POPTR_0010s18560g [Populus trichocarpa]
 gb|EEF02338.1| hypothetical protein POPTR_0010s18560g [Populus trichocarpa]
Length=414

 Score =   121 bits (303),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 59/71 (83%), Positives = 66/71 (93%), Gaps = 0/71 (0%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTEAVLQNVM  510
            ++RHTISVFVGDE G+INRIAGVFARRGY+IESLAVGLNKDKALFTIVV GTE VL+ V+
Sbjct  1    MQRHTISVFVGDEIGIINRIAGVFARRGYSIESLAVGLNKDKALFTIVVCGTEKVLRQVV  60

Query  511  EQLQKLVNVLK  543
            EQL KLVNV+K
Sbjct  61   EQLNKLVNVIK  71


 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 47/70 (67%), Gaps = 2/70 (3%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQN  504
            +R HT+S+ V +  G++N + GV +RRGYNI+SLAVG  + + L   T V+ GT+  +  
Sbjct  242  LRSHTLSMLVNNCPGVLNILTGVISRRGYNIQSLAVGHAEKEGLSRITTVIPGTDESIGK  301

Query  505  VMEQLQKLVN  534
            +++QL K ++
Sbjct  302  LVQQLHKSID  311



>gb|KJB38012.1| hypothetical protein B456_006G233200 [Gossypium raimondii]
Length=250

 Score =   117 bits (294),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 64/80 (80%), Gaps = 1/80 (1%)
 Frame = +1

Query  277  SEITLSTSDPAPPTP-RQKVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKD  453
            S  T   + P P T  R KV+RHTISVFVGDESGMINRIAG FARRGYNIE LAVGLNKD
Sbjct  54   SNNTCFANSPVPSTATRSKVKRHTISVFVGDESGMINRIAGDFARRGYNIEFLAVGLNKD  113

Query  454  KALFTIVVSGTEAVLQNVME  513
            KALFTIVVSGTE VLQ V +
Sbjct  114  KALFTIVVSGTETVLQQVED  133



>ref|XP_010466593.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic-like 
[Camelina sativa]
Length=421

 Score =   119 bits (299),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 58/72 (81%), Positives = 64/72 (89%), Gaps = 0/72 (0%)
 Frame = +1

Query  328  KVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTEAVLQNV  507
            +VRRHTISVFVGDE GMINRIAGVFA RGYN ESLA+GLN+DKALFTIVV GT+ VLQ V
Sbjct  78   RVRRHTISVFVGDERGMINRIAGVFASRGYNTESLAMGLNEDKALFTIVVLGTDKVLQQV  137

Query  508  MEQLQKLVNVLK  543
            +EQL KL NV+K
Sbjct  138  VEQLNKLDNVIK  149


 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 45/70 (64%), Gaps = 2/70 (3%)
 Frame = +1

Query  334  RRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQNV  507
            R HT+S+ V +   ++N I G  +RRGYNI+SLAVG  + + L   T V+ GT+  +  +
Sbjct  312  RSHTLSILVTNVPRVLNLITGAISRRGYNIQSLAVGPAEKEGLCRITTVIPGTDDHIDKL  371

Query  508  MEQLQKLVNV  537
            + QLQ L+++
Sbjct  372  VRQLQMLIDL  381



>gb|AFK41430.1| unknown [Lotus japonicus]
Length=478

 Score =   119 bits (298),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 59/67 (88%), Positives = 63/67 (94%), Gaps = 0/67 (0%)
 Frame = +1

Query  343  TISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTEAVLQNVMEQLQ  522
            TISVFVGDESGMINRIAGVFARRG+NIESLAVGLN+DKALFTIVVSGT  VL+ V+EQLQ
Sbjct  77   TISVFVGDESGMINRIAGVFARRGFNIESLAVGLNEDKALFTIVVSGTGTVLRQVVEQLQ  136

Query  523  KLVNVLK  543
            KL NVLK
Sbjct  137  KLANVLK  143


 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 50/70 (71%), Gaps = 2/70 (3%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQN  504
            +R HT+S+ V D  G++N + GVF+RRGYNI+SLAVG ++ + +   T VV GT+  +  
Sbjct  306  IRSHTLSMLVNDVPGVLNVVTGVFSRRGYNIQSLAVGHSEVEGISRLTTVVPGTDESIGK  365

Query  505  VMEQLQKLVN  534
            +++QL KL++
Sbjct  366  LLQQLYKLID  375



>gb|KJB38011.1| hypothetical protein B456_006G233200 [Gossypium raimondii]
Length=315

 Score =   117 bits (294),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 64/80 (80%), Gaps = 1/80 (1%)
 Frame = +1

Query  277  SEITLSTSDPAPPTP-RQKVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKD  453
            S  T   + P P T  R KV+RHTISVFVGDESGMINRIAG FARRGYNIE LAVGLNKD
Sbjct  54   SNNTCFANSPVPSTATRSKVKRHTISVFVGDESGMINRIAGDFARRGYNIEFLAVGLNKD  113

Query  454  KALFTIVVSGTEAVLQNVME  513
            KALFTIVVSGTE VLQ V +
Sbjct  114  KALFTIVVSGTETVLQQVED  133



>gb|KJB38010.1| hypothetical protein B456_006G233200 [Gossypium raimondii]
Length=312

 Score =   117 bits (293),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 64/80 (80%), Gaps = 1/80 (1%)
 Frame = +1

Query  277  SEITLSTSDPAPPTP-RQKVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKD  453
            S  T   + P P T  R KV+RHTISVFVGDESGMINRIAG FARRGYNIE LAVGLNKD
Sbjct  54   SNNTCFANSPVPSTATRSKVKRHTISVFVGDESGMINRIAGDFARRGYNIEFLAVGLNKD  113

Query  454  KALFTIVVSGTEAVLQNVME  513
            KALFTIVVSGTE VLQ V +
Sbjct  114  KALFTIVVSGTETVLQQVED  133



>ref|XP_006446198.1| hypothetical protein CICLE_v10015044mg [Citrus clementina]
 gb|ESR59438.1| hypothetical protein CICLE_v10015044mg [Citrus clementina]
Length=471

 Score =   115 bits (288),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 63/93 (68%), Positives = 72/93 (77%), Gaps = 8/93 (9%)
 Frame = +1

Query  217  KPKKLSVVFANAADGQHKAPSEITLSTSDPAPPTPRQKVRRHTISVFVGDESGMINRIAG  396
            +PKKL+V    +A   ++  +E T +    +P T R  VRRHTISVFVGDESGMINRIAG
Sbjct  54   EPKKLAV----SARSANENITEGTFT----SPSTNRTNVRRHTISVFVGDESGMINRIAG  105

Query  397  VFARRGYNIESLAVGLNKDKALFTIVVSGTEAV  495
            VFARRGYNIESLAVGLNKDKALFTIVV GT+ V
Sbjct  106  VFARRGYNIESLAVGLNKDKALFTIVVYGTDKV  138


 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 49/71 (69%), Gaps = 2/71 (3%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQN  504
            +R HT+S+ V D  G++N + GVFARRGYNI+SLAVG  + + L   T VV  T+  +  
Sbjct  299  LRSHTLSMLVNDSPGVLNIVTGVFARRGYNIQSLAVGHAETEGLSRITTVVPATDESISK  358

Query  505  VMEQLQKLVNV  537
            +M+QL KL+++
Sbjct  359  LMQQLYKLIDL  369



>ref|XP_002514772.1| acetolactate synthase, putative [Ricinus communis]
 gb|EEF47326.1| acetolactate synthase, putative [Ricinus communis]
Length=531

 Score =   115 bits (287),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 56/72 (78%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = +1

Query  328  KVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTEAVLQNV  507
            +V+ HTISVFVGDESG+INRIAGVFARRG+NIESLAV LN+DKALFTIVV GT+ VL+ V
Sbjct  122  RVQTHTISVFVGDESGIINRIAGVFARRGFNIESLAVCLNEDKALFTIVVRGTDNVLRQV  181

Query  508  MEQLQKLVNVLK  543
            +EQL KLV+V+K
Sbjct  182  VEQLNKLVSVIK  193


 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 45/68 (66%), Gaps = 2/68 (3%)
 Frame = +1

Query  340  HTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQNVME  513
            HT+S+ V D  G++N I GV +RRGYNI+SLAVG  + + L   T V+ GT   +  ++ 
Sbjct  362  HTLSMLVNDSPGVLNMITGVISRRGYNIQSLAVGSAEREGLSRITTVIPGTNESIGKLVL  421

Query  514  QLQKLVNV  537
            QL KL+++
Sbjct  422  QLHKLIDM  429



>gb|AAV65364.1| plastid acetolactate synthase small subunit [Prototheca wickerhamii]
Length=192

 Score =   108 bits (271),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 50/72 (69%), Positives = 62/72 (86%), Gaps = 0/72 (0%)
 Frame = +1

Query  322  RQKVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTEAVLQ  501
             + V +HT++VFVGDE+GMINR+AGVFARRG NIESLAVGL +DKALFTIV +GT+A + 
Sbjct  88   EEGVSKHTLNVFVGDEAGMINRVAGVFARRGANIESLAVGLTQDKALFTIVATGTDATVA  147

Query  502  NVMEQLQKLVNV  537
            N+ +QL KLVNV
Sbjct  148  NLCKQLAKLVNV  159



>ref|XP_011400735.1| Acetolactate synthase small subunit [Auxenochlorella protothecoides]
 gb|KFM27748.1| Acetolactate synthase small subunit [Auxenochlorella protothecoides]
Length=485

 Score =   110 bits (275),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 52/72 (72%), Positives = 62/72 (86%), Gaps = 0/72 (0%)
 Frame = +1

Query  322  RQKVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTEAVLQ  501
             + V +HT+SVFVGDE+GMINR+AGVFARRG NIESLAVGL +DKALFTIV +GTEA + 
Sbjct  84   EEGVAKHTLSVFVGDEAGMINRVAGVFARRGANIESLAVGLTQDKALFTIVATGTEATVA  143

Query  502  NVMEQLQKLVNV  537
            N+ +QL KLVNV
Sbjct  144  NLCKQLAKLVNV  155


 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 47/68 (69%), Gaps = 2/68 (3%)
 Frame = +1

Query  340  HTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQNVME  513
            +T+ + V D  G++N++ GV ARRGYN++SLAVG ++ +     T+VV G    ++ +M+
Sbjct  313  YTLLLEVQDRPGVLNQVTGVVARRGYNVQSLAVGNSEREGYSRITMVVPGNATGIEKLMK  372

Query  514  QLQKLVNV  537
            Q+QKLV V
Sbjct  373  QVQKLVYV  380



>sp|Q9SMC2.1|ILVH_NICPL RecName: Full=Acetolactate synthase small subunit 1, chloroplastic; 
AltName: Full=Acetohydroxy-acid synthase small subunit; 
Short=AHAS; Short=ALS; Flags: Precursor [Nicotiana plumbaginifolia]
 emb|CAB56614.1| acetolactate synthase small subunit [Nicotiana plumbaginifolia]
Length=449

 Score =   108 bits (270),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 53/56 (95%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +1

Query  376  MINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTEAVLQNVMEQLQKLVNVLK  543
            MINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTE VLQ VMEQLQKLVNV+K
Sbjct  37   MINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTERVLQQVMEQLQKLVNVIK  92


 Score = 67.4 bits (163),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 50/71 (70%), Gaps = 2/71 (3%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQN  504
            +R HT+S+ V D  G++N + GVFARRGYNI+SLAVG  + + L   T VV GT+  +  
Sbjct  255  LRSHTLSMLVNDTPGVLNIVTGVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDESVSK  314

Query  505  VMEQLQKLVNV  537
            +++QL KLV++
Sbjct  315  LVQQLYKLVDI  325



>gb|KCW46079.1| hypothetical protein EUGRSUZ_L00052 [Eucalyptus grandis]
Length=373

 Score =   108 bits (269),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 53/56 (95%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +1

Query  376  MINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTEAVLQNVMEQLQKLVNVLK  543
            MINRIAGVFARRGYNIESLAVGLNKD+ALFTIVVSGTE VLQ VMEQLQKLVNVLK
Sbjct  1    MINRIAGVFARRGYNIESLAVGLNKDRALFTIVVSGTERVLQQVMEQLQKLVNVLK  56


 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 51/71 (72%), Gaps = 2/71 (3%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQN  504
            +R HT+S+ V D  G++N I GVF+RRGYNI+SLAVG ++ + L   T VV GT+  +  
Sbjct  219  LRSHTLSMIVKDAPGVLNIITGVFSRRGYNIQSLAVGHSEVEGLSRITTVVPGTDESISK  278

Query  505  VMEQLQKLVNV  537
            +++QL KLV++
Sbjct  279  LVQQLYKLVDL  289



>gb|KCW46078.1| hypothetical protein EUGRSUZ_L00052 [Eucalyptus grandis]
Length=373

 Score =   108 bits (269),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 53/56 (95%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +1

Query  376  MINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTEAVLQNVMEQLQKLVNVLK  543
            MINRIAGVFARRGYNIESLAVGLNKD+ALFTIVVSGTE VLQ VMEQLQKLVNVLK
Sbjct  1    MINRIAGVFARRGYNIESLAVGLNKDRALFTIVVSGTERVLQQVMEQLQKLVNVLK  56


 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 51/71 (72%), Gaps = 2/71 (3%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQN  504
            +R HT+S+ V D  G++N I GVF+RRGYNI+SLAVG ++ + L   T VV GT+  +  
Sbjct  219  LRSHTLSMIVKDAPGVLNIITGVFSRRGYNIQSLAVGHSEVEGLSRITTVVPGTDESISK  278

Query  505  VMEQLQKLVNV  537
            +++QL KLV++
Sbjct  279  LVQQLYKLVDL  289



>gb|KCW46077.1| hypothetical protein EUGRSUZ_L00052 [Eucalyptus grandis]
Length=391

 Score =   107 bits (268),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 53/56 (95%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +1

Query  376  MINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTEAVLQNVMEQLQKLVNVLK  543
            MINRIAGVFARRGYNIESLAVGLNKD+ALFTIVVSGTE VLQ VMEQLQKLVNVLK
Sbjct  1    MINRIAGVFARRGYNIESLAVGLNKDRALFTIVVSGTERVLQQVMEQLQKLVNVLK  56


 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 51/71 (72%), Gaps = 2/71 (3%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQN  504
            +R HT+S+ V D  G++N I GVF+RRGYNI+SLAVG ++ + L   T VV GT+  +  
Sbjct  219  LRSHTLSMIVKDAPGVLNIITGVFSRRGYNIQSLAVGHSEVEGLSRITTVVPGTDESISK  278

Query  505  VMEQLQKLVNV  537
            +++QL KLV++
Sbjct  279  LVQQLYKLVDL  289



>gb|KCW59209.1| hypothetical protein EUGRSUZ_H01869 [Eucalyptus grandis]
Length=391

 Score =   107 bits (268),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 53/56 (95%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +1

Query  376  MINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTEAVLQNVMEQLQKLVNVLK  543
            MINRIAGVFARRGYNIESLAVGLNKD+ALFTIVVSGTE VLQ VMEQLQKLVNVLK
Sbjct  1    MINRIAGVFARRGYNIESLAVGLNKDRALFTIVVSGTERVLQQVMEQLQKLVNVLK  56


 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 51/71 (72%), Gaps = 2/71 (3%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQN  504
            +R HT+S+ V D  G++N I GVF+RRGYNI+SLAVG ++ + L   T VV GT+  +  
Sbjct  219  LRSHTLSMIVNDAPGVLNIITGVFSRRGYNIQSLAVGHSEVEGLSRITTVVPGTDESISK  278

Query  505  VMEQLQKLVNV  537
            +++QL KLV++
Sbjct  279  LVQQLYKLVDL  289



>ref|XP_010101349.1| Acetolactate synthase small subunit [Morus notabilis]
 gb|EXB88296.1| Acetolactate synthase small subunit [Morus notabilis]
Length=401

 Score =   107 bits (266),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 52/68 (76%), Positives = 60/68 (88%), Gaps = 1/68 (1%)
 Frame = +1

Query  277  SEITLSTSDPAPPTP-RQKVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKD  453
            S+  L  ++ +PP+  R KVRRHTISVFVGDESGMINRIAGVFARRGYNI+SLAVGLNKD
Sbjct  63   SDAALPAANGSPPSSTRSKVRRHTISVFVGDESGMINRIAGVFARRGYNIDSLAVGLNKD  122

Query  454  KALFTIVV  477
            KALFTI++
Sbjct  123  KALFTIIM  130


 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 52/82 (63%), Gaps = 4/82 (5%)
 Frame = +1

Query  298  SDPAPPTPRQKVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTI  471
            SD +P T     R HT+S+ V D  G++  + GVFARRGYNI+SLAVG  + + L   T 
Sbjct  225  SDGSPGT--SGFRSHTLSILVNDAPGVLYIVTGVFARRGYNIQSLAVGHAETEGLSRITT  282

Query  472  VVSGTEAVLQNVMEQLQKLVNV  537
            VV  T+  +  +++QL KLV+V
Sbjct  283  VVPATDESITKLVQQLYKLVDV  304



>gb|KDO59634.1| hypothetical protein CISIN_1g0181982mg, partial [Citrus sinensis]
 gb|KDO59635.1| hypothetical protein CISIN_1g0181982mg, partial [Citrus sinensis]
Length=270

 Score =   104 bits (259),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 64/74 (86%), Gaps = 1/74 (1%)
 Frame = +1

Query  325  QKVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAV-GLNKDKALFTIVVSGTEAVLQ  501
            ++V+RHTISVFVGDESG+++RI GVF RR  NIESL V GLNKD+ALFT+VV GT+  LQ
Sbjct  40   ERVQRHTISVFVGDESGILSRIDGVFTRRNCNIESLGVIGLNKDRALFTMVVFGTDRELQ  99

Query  502  NVMEQLQKLVNVLK  543
             V++QLQKLVNVLK
Sbjct  100  QVVKQLQKLVNVLK  113



>gb|KDO39820.1| hypothetical protein CISIN_1g015044mg [Citrus sinensis]
Length=414

 Score =   104 bits (260),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 56/76 (74%), Positives = 63/76 (83%), Gaps = 2/76 (3%)
 Frame = +1

Query  316  TPRQKVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTEAV  495
            T R ++RR  ISVFV DESG+++ I  VFARRGYNIESLAV  NKDK LFTIVVSGT+ V
Sbjct  73   TNRSELRR--ISVFVRDESGVVDLIDEVFARRGYNIESLAVSGNKDKGLFTIVVSGTDRV  130

Query  496  LQNVMEQLQKLVNVLK  543
            LQ V+EQLQKLVNVLK
Sbjct  131  LQQVIEQLQKLVNVLK  146



>ref|XP_006441155.1| hypothetical protein CICLE_v10020491mg [Citrus clementina]
 gb|ESR54395.1| hypothetical protein CICLE_v10020491mg [Citrus clementina]
Length=395

 Score =   104 bits (260),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 65/74 (88%), Gaps = 1/74 (1%)
 Frame = +1

Query  325  QKVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAV-GLNKDKALFTIVVSGTEAVLQ  501
            ++V+RHTISVFV DESG+++RI GVFARR  NIESL V GLNKD+ALFT+VVSGT+  LQ
Sbjct  76   ERVQRHTISVFVVDESGILSRIDGVFARRNCNIESLGVIGLNKDRALFTMVVSGTDRELQ  135

Query  502  NVMEQLQKLVNVLK  543
             V++QLQKLVNVLK
Sbjct  136  QVVKQLQKLVNVLK  149



>ref|XP_009144046.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic 
isoform X2 [Brassica rapa]
Length=379

 Score =   104 bits (260),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 51/56 (91%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +1

Query  376  MINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTEAVLQNVMEQLQKLVNVLK  543
            MINRIAGVFARRGYNI+SLAVGLN+DKALFTIVVSGTE VLQ V+EQLQKLVNVLK
Sbjct  1    MINRIAGVFARRGYNIQSLAVGLNRDKALFTIVVSGTERVLQQVIEQLQKLVNVLK  56


 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 49/71 (69%), Gaps = 2/71 (3%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQN  504
            +R HT+S+ V D  G++N + GVFARRGYNI+SLAVG  + + +   T VV  T+  +  
Sbjct  219  LRSHTLSLLVNDVPGVLNLVTGVFARRGYNIQSLAVGHAETEGISRITTVVPATDESVSK  278

Query  505  VMEQLQKLVNV  537
            +++QL KLV+V
Sbjct  279  LVQQLYKLVDV  289



>ref|XP_006491983.1| PREDICTED: protease Do-like 1, chloroplastic-like [Citrus sinensis]
Length=359

 Score =   104 bits (259),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 64/74 (86%), Gaps = 1/74 (1%)
 Frame = +1

Query  325  QKVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAV-GLNKDKALFTIVVSGTEAVLQ  501
            ++V+RHTISVFVGDESG+++RI GVF RR  NIESL V GLNKD+ALFT+VV GT+  LQ
Sbjct  40   ERVQRHTISVFVGDESGILSRIDGVFTRRNCNIESLGVIGLNKDRALFTMVVFGTDRELQ  99

Query  502  NVMEQLQKLVNVLK  543
             V++QLQKLVNVLK
Sbjct  100  QVVKQLQKLVNVLK  113



>gb|ACN35790.1| unknown [Zea mays]
Length=159

 Score = 99.4 bits (246),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 49/55 (89%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +1

Query  376  MINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTEAVLQNVMEQLQKLVNVL  540
            MINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGT+ VL  V+EQL KLVNVL
Sbjct  1    MINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTDRVLNQVIEQLNKLVNVL  55



>gb|KDD76489.1| hypothetical protein H632_c209p2, partial [Helicosporidium sp. 
ATCC 50920]
Length=479

 Score =   101 bits (251),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 46/69 (67%), Positives = 60/69 (87%), Gaps = 0/69 (0%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTEAVLQNVM  510
            V++H +S+FV DESG+INR+AGVFARRG NIESLAVGL +++ALFTIVV+GT A + N+ 
Sbjct  34   VKKHILSIFVADESGLINRVAGVFARRGANIESLAVGLTRERALFTIVVTGTAATVANLC  93

Query  511  EQLQKLVNV  537
            +QL KLV+V
Sbjct  94   KQLAKLVSV  102


 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 55/91 (60%), Gaps = 2/91 (2%)
 Frame = +1

Query  277  SEITLSTSDPAPPTPRQKVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDK  456
            SE   S++D A  +       +T+ + V D  G++N++ GV ARRGYN++SLAVG ++ +
Sbjct  286  SEAETSSTDGASASAHAAFEPYTLLIEVQDRPGVLNQVTGVIARRGYNVQSLAVGNSERE  345

Query  457  AL--FTIVVSGTEAVLQNVMEQLQKLVNVLK  543
                 T++V GTE  ++ +  Q+ KLV V +
Sbjct  346  GYSRITLMVPGTERGIEALTRQICKLVYVAR  376



>ref|XP_011464846.1| PREDICTED: LOW QUALITY PROTEIN: acetolactate synthase small subunit 
2, chloroplastic-like [Fragaria vesca subsp. vesca]
Length=357

 Score = 99.4 bits (246),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 48/56 (86%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = +1

Query  376  MINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTEAVLQNVMEQLQKLVNVLK  543
            MINRI+GVFARRGYNIESLAVGLNKDKALFTIVVSGT+ VL+  +EQL KLVNVLK
Sbjct  1    MINRISGVFARRGYNIESLAVGLNKDKALFTIVVSGTDTVLRQAIEQLHKLVNVLK  56



>ref|XP_001700185.1| acetolactate synthase, small subunit [Chlamydomonas reinhardtii]
 gb|EDO98300.1| acetolactate synthase, small subunit, partial [Chlamydomonas 
reinhardtii]
Length=489

 Score = 99.8 bits (247),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 52/113 (46%), Positives = 70/113 (62%), Gaps = 12/113 (11%)
 Frame = +1

Query  235  VVFANAADGQHKAPSEITLSTSDPAPPTP------------RQKVRRHTISVFVGDESGM  378
            V F   A  Q +  + + +  ++ +P  P             + V +H IS+FV DE G+
Sbjct  32   VAFGRTATQQQQRAAHVAVRVAEASPAKPAGDVYRVETRPLEEGVEKHIISIFVADEPGL  91

Query  379  INRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTEAVLQNVMEQLQKLVNV  537
            INR+AGVFARRG NIESLAVGL  DKALFT+VV+G   V+ N+++QL KLV V
Sbjct  92   INRVAGVFARRGANIESLAVGLTVDKALFTVVVAGKANVVANLVKQLGKLVKV  144



>ref|XP_005648800.1| acetolactate synthase [Coccomyxa subellipsoidea C-169]
 gb|EIE24256.1| acetolactate synthase [Coccomyxa subellipsoidea C-169]
Length=824

 Score =   100 bits (250),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 48/68 (71%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = +1

Query  334  RRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTEAVLQNVME  513
             +H IS FV DESG+INR+AGVFARRG NIESLAVGLN DKALFTIVV+GT++ + N+++
Sbjct  39   EKHLISAFVADESGIINRVAGVFARRGANIESLAVGLNIDKALFTIVVTGTQSTVANLVK  98

Query  514  QLQKLVNV  537
            QL KLV V
Sbjct  99   QLAKLVKV  106


 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 48/68 (71%), Gaps = 2/68 (3%)
 Frame = +1

Query  340  HTISVFVGDESGMINRIAGVFARRGYNIESLAVGLN--KDKALFTIVVSGTEAVLQNVME  513
            HT+S+ V D  G++N++ GVFARRGYN++SLAVG +  + ++   +V+ G+      +++
Sbjct  273  HTLSIEVEDVPGVLNQVTGVFARRGYNVQSLAVGNSEVEGQSRIIMVIPGSAEGTSKIIK  332

Query  514  QLQKLVNV  537
            QL KLV+V
Sbjct  333  QLNKLVHV  340



>gb|EEE57346.1| hypothetical protein OsJ_07472 [Oryza sativa Japonica Group]
Length=422

 Score = 98.6 bits (244),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 48/56 (86%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = +1

Query  376  MINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTEAVLQNVMEQLQKLVNVLK  543
            MINRIAGVFARRGYNIESLAVGLNKDKA+FTIVVSGT+ VL  V+EQL KLVNVL 
Sbjct  1    MINRIAGVFARRGYNIESLAVGLNKDKAMFTIVVSGTDRVLNQVIEQLNKLVNVLN  56


 Score = 52.0 bits (123),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 34/100 (34%), Positives = 49/100 (49%), Gaps = 31/100 (31%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNI-----------------------------  423
            +R HT+S+ V D  G++N + GVFARRGYNI                             
Sbjct  221  LRSHTLSILVNDCPGVLNIVTGVFARRGYNIQGDVYPVEPYEGSSMNQVLDAHWGVLDDE  280

Query  424  ESLAVGLNKDKAL--FTIVVSGTEAVLQNVMEQLQKLVNV  537
            +SLAVG  +   L   T V  GT+  ++ +++QL KLV+V
Sbjct  281  DSLAVGPAEKSGLSRITTVAPGTDESIEKLVQQLNKLVDV  320



>ref|XP_002948458.1| hypothetical protein VOLCADRAFT_73781 [Volvox carteri f. nagariensis]
 gb|EFJ50333.1| hypothetical protein VOLCADRAFT_73781 [Volvox carteri f. nagariensis]
Length=486

 Score = 98.6 bits (244),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 48/76 (63%), Positives = 60/76 (79%), Gaps = 1/76 (1%)
 Frame = +1

Query  313  PTPRQK-VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTE  489
            P P ++ V +H IS+FV DE G+INR+AGVFARRG NIESLAVGL  DKALFT+VV+G  
Sbjct  69   PKPLEEGVEKHIISIFVADEPGLINRVAGVFARRGANIESLAVGLTVDKALFTVVVAGKA  128

Query  490  AVLQNVMEQLQKLVNV  537
            A + N+++QL KLV V
Sbjct  129  ATVANLIKQLSKLVKV  144



>ref|XP_005851575.1| hypothetical protein CHLNCDRAFT_29593 [Chlorella variabilis]
 gb|EFN59473.1| hypothetical protein CHLNCDRAFT_29593 [Chlorella variabilis]
Length=399

 Score = 97.1 bits (240),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 55/64 (86%), Gaps = 0/64 (0%)
 Frame = +1

Query  346  ISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTEAVLQNVMEQLQK  525
            +SVFV DESG+INR+AGVFARRG NIESLAVGL  DKALFTIV +GT+A + N+ +Q+ K
Sbjct  2    LSVFVADESGLINRVAGVFARRGANIESLAVGLTVDKALFTIVATGTDATVANLAKQIAK  61

Query  526  LVNV  537
            LVNV
Sbjct  62   LVNV  65


 Score = 58.5 bits (140),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 29/66 (44%), Positives = 48/66 (73%), Gaps = 2/66 (3%)
 Frame = +1

Query  346  ISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQNVMEQL  519
            +++ V D  G++N++ GVFARRGYN++SLAVG ++ + +   TIVV  + + + N+++QL
Sbjct  229  LAIEVQDVPGVLNQVTGVFARRGYNVQSLAVGNSEREGMSRITIVVPASTSSIANLIKQL  288

Query  520  QKLVNV  537
             KLV V
Sbjct  289  NKLVYV  294



>gb|EEC73569.1| hypothetical protein OsI_08011 [Oryza sativa Indica Group]
Length=554

 Score = 98.6 bits (244),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 48/55 (87%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +1

Query  376  MINRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTEAVLQNVMEQLQKLVNVL  540
            MINRIAGVFARRGYNIESLAVGLNKDKA+FTIVVSGT+ VL  V+EQL KLVNVL
Sbjct  1    MINRIAGVFARRGYNIESLAVGLNKDKAMFTIVVSGTDRVLNQVIEQLNKLVNVL  55


 Score = 67.0 bits (162),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 49/71 (69%), Gaps = 2/71 (3%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQN  504
            +R HT+S+ V D  G++N + GVFARRGYNI+SLAVG  +   L   T V  GT+  ++ 
Sbjct  382  LRSHTLSILVNDCPGVLNIVTGVFARRGYNIQSLAVGPAEKSGLSRITTVAPGTDESIEK  441

Query  505  VMEQLQKLVNV  537
            +++QL KLV+V
Sbjct  442  LVQQLYKLVDV  452



>emb|CEF99544.1| Acetolactate synthase, small subunit, C-terminal [Ostreococcus 
tauri]
Length=538

 Score = 97.4 bits (241),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 52/88 (59%), Positives = 62/88 (70%), Gaps = 2/88 (2%)
 Frame = +1

Query  286  TLSTSD--PAPPTPRQKVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKA  459
            T ST D    P      +RRHTI V+V DE+GMINR+AGVFARRGYNIESLAVGLN DKA
Sbjct  82   TGSTGDVYAGPARLSGDLRRHTILVYVADETGMINRVAGVFARRGYNIESLAVGLNIDKA  141

Query  460  LFTIVVSGTEAVLQNVMEQLQKLVNVLK  543
            +FTI V  +E  +  +M+Q+ KL  V K
Sbjct  142  IFTISVICSEEDVVKLMKQVNKLAKVRK  169


 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 45/78 (58%), Gaps = 2/78 (3%)
 Frame = +1

Query  301  DPAPPTPRQKVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNK--DKALFTIV  474
            D   P    K    T+S+ V +  G+++ + GVFARRGYN++SL VG  K  D +  + V
Sbjct  350  DIDKPDENAKFTPRTLSILVDNRPGVLDSVTGVFARRGYNVQSLGVGPEKSFDISRISTV  409

Query  475  VSGTEAVLQNVMEQLQKL  528
            V GT   +  +M+Q+ K+
Sbjct  410  VPGTSQDIAMLMKQILKV  427



>ref|XP_003081855.1| Acetolactate synthase, small subunit (ISS) [Ostreococcus tauri]
Length=515

 Score = 97.4 bits (241),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 52/88 (59%), Positives = 62/88 (70%), Gaps = 2/88 (2%)
 Frame = +1

Query  286  TLSTSD--PAPPTPRQKVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKA  459
            T ST D    P      +RRHTI V+V DE+GMINR+AGVFARRGYNIESLAVGLN DKA
Sbjct  59   TGSTGDVYAGPARLSGDLRRHTILVYVADETGMINRVAGVFARRGYNIESLAVGLNIDKA  118

Query  460  LFTIVVSGTEAVLQNVMEQLQKLVNVLK  543
            +FTI V  +E  +  +M+Q+ KL  V K
Sbjct  119  IFTISVICSEEDVVKLMKQVNKLAKVRK  146


 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 45/78 (58%), Gaps = 2/78 (3%)
 Frame = +1

Query  301  DPAPPTPRQKVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNK--DKALFTIV  474
            D   P    K    T+S+ V +  G+++ + GVFARRGYN++SL VG  K  D +  + V
Sbjct  327  DIDKPDENAKFTPRTLSILVDNRPGVLDSVTGVFARRGYNVQSLGVGPEKSFDISRISTV  386

Query  475  VSGTEAVLQNVMEQLQKL  528
            V GT   +  +M+Q+ K+
Sbjct  387  VPGTSQDIAMLMKQILKV  404



>ref|XP_001420250.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO98543.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=463

 Score = 95.5 bits (236),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 54/114 (47%), Positives = 69/114 (61%), Gaps = 4/114 (4%)
 Frame = +1

Query  214  GKPKKLSVVFANAADGQHKAPSEITL--STSD--PAPPTPRQKVRRHTISVFVGDESGMI  381
            G    L    A A  G    P+      ST D    P    + +RRHT+ V+V DE+GMI
Sbjct  11   GDDYDLDAGIAGATPGDGWTPTSYDGRGSTGDVYQGPARLAEGLRRHTVLVYVADETGMI  70

Query  382  NRIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTEAVLQNVMEQLQKLVNVLK  543
            NR+AGVFARRGYNIESLAVGLN DKA+FTI V  ++  +  +++Q+ KL  V K
Sbjct  71   NRVAGVFARRGYNIESLAVGLNIDKAIFTISVICSDGDVGKLIKQVNKLAKVRK  124


 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/79 (38%), Positives = 47/79 (59%), Gaps = 2/79 (3%)
 Frame = +1

Query  310  PPTPRQKVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNK--DKALFTIVVSG  483
            P     K   HTIS+ V +  G+++ I GVFARRGYNI+SL VG  +  D +  + VV G
Sbjct  279  PMDENAKYTPHTISILVDNRPGVLDSITGVFARRGYNIQSLGVGPERTFDISRISTVVPG  338

Query  484  TEAVLQNVMEQLQKLVNVL  540
            +   +  +++Q+ K+  V+
Sbjct  339  STEDIAMLLKQILKVPYVI  357



>ref|XP_003061628.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH54258.1| predicted protein [Micromonas pusilla CCMP1545]
Length=557

 Score = 92.8 bits (229),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 47/97 (48%), Positives = 62/97 (64%), Gaps = 13/97 (13%)
 Frame = +1

Query  292  STSDPAPPTPRQKV-------------RRHTISVFVGDESGMINRIAGVFARRGYNIESL  432
            S   P PP P+++V             RR T+ ++V D +GMINR+AGVFARRGYNIESL
Sbjct  92   SVPSPTPPAPKEEVGVYGGPARLKEGLRRQTMLIYVADVTGMINRVAGVFARRGYNIESL  151

Query  433  AVGLNKDKALFTIVVSGTEAVLQNVMEQLQKLVNVLK  543
            AVGLN DKA+FT+VV  +      +++Q+ KL  V K
Sbjct  152  AVGLNIDKAIFTVVVIASNDDATKLIKQINKLAKVRK  188


 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 39/107 (36%), Positives = 58/107 (54%), Gaps = 5/107 (5%)
 Frame = +1

Query  229  LSVVFANAADGQHKAPSEITLSTSDPAPPT-PRQKVRRHTISVFVGDESGMINRIAGVFA  405
            LS  FA  A  Q    + I     D  P   P  K   HTIS+ V ++ G+++ + GVFA
Sbjct  347  LSSDFAGGAGSQQD--NNIDKEYPDDIPKMDPNAKYTPHTISIVVMNKPGVLDVVTGVFA  404

Query  406  RRGYNIESLAVGLNK--DKALFTIVVSGTEAVLQNVMEQLQKLVNVL  540
            RRGYN++SL VG  K  D +  + VV GT   +  +++Q+ K+  V+
Sbjct  405  RRGYNVQSLGVGPEKTFDVSRISTVVPGTYDDVTKLLKQILKVPYVI  451



>ref|NP_850173.2| ACT domain-containing small subunit of acetolactate synthase 
protein [Arabidopsis thaliana]
 gb|AEC08587.1| ACT domain-containing small subunit of acetolactate synthase 
protein [Arabidopsis thaliana]
Length=421

 Score = 90.5 bits (223),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 44/49 (90%), Positives = 46/49 (94%), Gaps = 0/49 (0%)
 Frame = +1

Query  397  VFARRGYNIESLAVGLNKDKALFTIVVSGTEAVLQNVMEQLQKLVNVLK  543
            VFARRGYNIESLAVGLN+DKALFTIVV GTE VLQ V+EQLQKLVNVLK
Sbjct  35   VFARRGYNIESLAVGLNRDKALFTIVVCGTERVLQQVIEQLQKLVNVLK  83


 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 49/72 (68%), Gaps = 3/72 (4%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIES-LAVGLNKDKAL--FTIVVSGTEAVLQ  501
            +R HT+S+ V D  G++N + GVFARRGYNI++ LAVG  + K +   T V+  T+  + 
Sbjct  246  LRSHTLSLLVNDIPGVLNIVTGVFARRGYNIQAYLAVGHAETKGISRITTVIPATDESVS  305

Query  502  NVMEQLQKLVNV  537
             +++QL KLV+V
Sbjct  306  KLVQQLYKLVDV  317



>ref|XP_010414083.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like 
isoform X2 [Camelina sativa]
Length=415

 Score = 90.5 bits (223),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 45/53 (85%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +1

Query  385  RIAGVFARRGYNIESLAVGLNKDKALFTIVVSGTEAVLQNVMEQLQKLVNVLK  543
            +I  VFARRGYNIESLAVGLN+DKALFTIVV GTE VLQ V+EQLQKLVNVLK
Sbjct  25   QIRRVFARRGYNIESLAVGLNRDKALFTIVVCGTERVLQQVIEQLQKLVNVLK  77


 Score = 60.8 bits (146),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 49/72 (68%), Gaps = 3/72 (4%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIES-LAVGLNKDKAL--FTIVVSGTEAVLQ  501
            +R HT+S+ V D  G++N + GVFARRGYNI++ LAVG  + K +   T VV  T+  + 
Sbjct  240  LRSHTLSLLVNDVPGVLNIVTGVFARRGYNIQAYLAVGHAETKGISRITTVVPATDESVS  299

Query  502  NVMEQLQKLVNV  537
             +++QL KLV+V
Sbjct  300  KLVQQLNKLVDV  311



>ref|XP_010557052.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like 
isoform X2 [Tarenaya hassleriana]
Length=417

 Score = 90.1 bits (222),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 43/49 (88%), Positives = 46/49 (94%), Gaps = 0/49 (0%)
 Frame = +1

Query  397  VFARRGYNIESLAVGLNKDKALFTIVVSGTEAVLQNVMEQLQKLVNVLK  543
            +FARRGYNIESLAVGLN+DKALFTIVV GTE VLQ V+EQLQKLVNVLK
Sbjct  34   IFARRGYNIESLAVGLNRDKALFTIVVCGTERVLQQVIEQLQKLVNVLK  82


 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 49/71 (69%), Gaps = 2/71 (3%)
 Frame = +1

Query  331  VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVG--LNKDKALFTIVVSGTEAVLQN  504
            +R HT+S+ V D  G++N + GVFARRGYNI+SLAVG    + ++  T V+  T+  +  
Sbjct  245  LRSHTLSLLVNDAPGVLNLVTGVFARRGYNIQSLAVGHAETEGRSRITTVIPATDESISK  304

Query  505  VMEQLQKLVNV  537
            +++QL KLV+V
Sbjct  305  LVQQLYKLVDV  315



>gb|KDO59632.1| hypothetical protein CISIN_1g0414212mg, partial [Citrus sinensis]
Length=140

 Score = 84.0 bits (206),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 43/56 (77%), Positives = 50/56 (89%), Gaps = 1/56 (2%)
 Frame = +1

Query  379  INRIAGVFARRGYNIESLA-VGLNKDKALFTIVVSGTEAVLQNVMEQLQKLVNVLK  543
            +N+IAGVFARR YNIESLA +GL+KD+ALFTIVVSGT+  LQ V+EQLQKLVNVL 
Sbjct  1    MNQIAGVFARRKYNIESLAAIGLDKDRALFTIVVSGTDRELQQVVEQLQKLVNVLN  56



>ref|WP_013255317.1| acetolactate synthase [Spirochaeta smaragdinae]
 gb|ADK81856.1| acetolactate synthase, small subunit [Spirochaeta smaragdinae 
DSM 11293]
Length=166

 Score = 82.4 bits (202),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 56/71 (79%), Gaps = 2/71 (3%)
 Frame = +1

Query  337  RHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLN--KDKALFTIVVSGTEAVLQNVM  510
            +HTIS+   D  G++ RI+G+F+RRG+NIESLAVG    K K+ FTIVVSG +AVL+ V 
Sbjct  2    KHTISILCDDTPGVMTRISGLFSRRGFNIESLAVGNTEIKGKSRFTIVVSGDDAVLEQVR  61

Query  511  EQLQKLVNVLK  543
            +QLQKLV+V+K
Sbjct  62   KQLQKLVHVIK  72



>ref|WP_038653708.1| acetolactate synthase [Prochlorococcus sp. MIT 0801]
 gb|AIQ97755.1| Acetolactate synthase small subunit [Prochlorococcus sp. MIT 
0801]
Length=167

 Score = 81.3 bits (199),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 40/71 (56%), Positives = 55/71 (77%), Gaps = 2/71 (3%)
 Frame = +1

Query  337  RHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQNVM  510
            +HT+SV V DESG ++RIAG+FARRG+NI+SLAVG  + K +   T+VV G E+ LQ + 
Sbjct  2    KHTLSVLVEDESGALSRIAGLFARRGFNIDSLAVGPAEAKGISRLTMVVQGDESTLQQMT  61

Query  511  EQLQKLVNVLK  543
            +QL KL+NVL+
Sbjct  62   KQLNKLINVLE  72



>ref|WP_011294852.1| acetolactate synthase [Prochlorococcus marinus]
 gb|AAZ58255.1| acetolactate synthase, small subunit [Prochlorococcus marinus 
str. NATL2A]
 gb|ABM76161.1| Acetolactate synthase small subunit [Prochlorococcus marinus 
str. NATL1A]
 gb|KGG21278.1| Acetolactate synthase small subunit [Prochlorococcus marinus 
str. PAC1]
Length=167

 Score = 81.3 bits (199),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 40/71 (56%), Positives = 55/71 (77%), Gaps = 2/71 (3%)
 Frame = +1

Query  337  RHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQNVM  510
            +HT+SV V DESG ++RIAG+FARRG+NI+SLAVG  + K +   T+VV G E+ LQ + 
Sbjct  2    KHTLSVLVEDESGALSRIAGLFARRGFNIDSLAVGPAEAKGISRLTMVVQGDESTLQQMT  61

Query  511  EQLQKLVNVLK  543
            +QL KL+NVL+
Sbjct  62   KQLNKLINVLE  72



>ref|WP_020613267.1| acetolactate synthase [Spirochaeta bajacaliforniensis]
Length=166

 Score = 80.9 bits (198),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 41/71 (58%), Positives = 56/71 (79%), Gaps = 2/71 (3%)
 Frame = +1

Query  337  RHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLN--KDKALFTIVVSGTEAVLQNVM  510
            +HTIS+   D  G++ RI+G+F+RRG+NIESLAVG    + K+ FTIVVSG +AVL+ V 
Sbjct  2    KHTISILCDDTPGVMTRISGLFSRRGFNIESLAVGNTEIQGKSRFTIVVSGDDAVLEQVR  61

Query  511  EQLQKLVNVLK  543
            +QLQKLV+V+K
Sbjct  62   KQLQKLVHVIK  72



>ref|WP_028952581.1| acetolactate synthase [Synechococcus sp. CC9616]
Length=176

 Score = 80.9 bits (198),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/71 (56%), Positives = 54/71 (76%), Gaps = 2/71 (3%)
 Frame = +1

Query  337  RHTISVFVGDESGMINRIAGVFARRGYNIESLAVG--LNKDKALFTIVVSGTEAVLQNVM  510
            +HT+SV V DESG ++RIAG+FARRG+NI+SLAVG   N  ++  T+VV G +  LQ + 
Sbjct  2    KHTLSVLVEDESGALSRIAGLFARRGFNIDSLAVGPAENDGQSRLTMVVEGDDQTLQQMT  61

Query  511  EQLQKLVNVLK  543
            +QL KLVNVL+
Sbjct  62   KQLDKLVNVLQ  72



>ref|WP_009631788.1| acetolactate synthase, small subunit [Synechocystis sp. PCC 7509]
Length=172

 Score = 80.1 bits (196),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/71 (55%), Positives = 55/71 (77%), Gaps = 2/71 (3%)
 Frame = +1

Query  337  RHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQNVM  510
            +HT+SV V DESG+++RIAG+FARRG+NIESLAVG  +   +   T+VV G E +++ + 
Sbjct  2    KHTLSVLVEDESGVLSRIAGLFARRGFNIESLAVGAAEQGGMSRITMVVPGDEQIIEQLT  61

Query  511  EQLQKLVNVLK  543
            +QL KLVNV+K
Sbjct  62   KQLYKLVNVIK  72



>ref|WP_012598844.1| acetolactate synthase [Cyanothece sp. PCC 7424]
 gb|ACK69899.1| acetolactate synthase, small subunit [Cyanothece sp. PCC 7424]
Length=175

 Score = 80.1 bits (196),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 38/71 (54%), Positives = 55/71 (77%), Gaps = 2/71 (3%)
 Frame = +1

Query  337  RHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQNVM  510
            +HT+SV V DE+G++ RIAG+FARRG+NIESLAVG  +   +   T+VVSG + +++ + 
Sbjct  2    KHTLSVLVQDEAGVLTRIAGLFARRGFNIESLAVGPAEQLGISRITMVVSGDDGIIEQIT  61

Query  511  EQLQKLVNVLK  543
            +QL KL+NVLK
Sbjct  62   KQLYKLINVLK  72



>ref|WP_012195782.1| acetolactate synthase [Prochlorococcus marinus]
 gb|ABX09161.1| Acetolactate synthase small subunit [Prochlorococcus marinus 
str. MIT 9211]
Length=176

 Score = 80.1 bits (196),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 40/70 (57%), Positives = 53/70 (76%), Gaps = 2/70 (3%)
 Frame = +1

Query  337  RHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQNVM  510
            +HT+SV V D+SG ++RI+G+FARRG+NIESLAVG  + K +   T+VV G E  LQ + 
Sbjct  2    KHTLSVLVEDQSGALSRISGLFARRGFNIESLAVGPAEAKGISRLTMVVEGDEETLQQMT  61

Query  511  EQLQKLVNVL  540
            +QL KLVNVL
Sbjct  62   KQLDKLVNVL  71



>dbj|BAI88928.1| acetolactate synthase III small subunit [Arthrospira platensis 
NIES-39]
Length=184

 Score = 80.1 bits (196),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 39/75 (52%), Positives = 57/75 (76%), Gaps = 2/75 (3%)
 Frame = +1

Query  325  QKVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVL  498
            +K+ +HT+SV V DE+G++ RIAG+FARRG+NIESLAVG  +   +   T+VV G + V+
Sbjct  7    EKIMKHTLSVLVEDEAGVLTRIAGLFARRGFNIESLAVGPAEKSGVSRITMVVPGDDRVI  66

Query  499  QNVMEQLQKLVNVLK  543
            + + +QL KL+NVLK
Sbjct  67   EQLTKQLYKLINVLK  81



>gb|ABB17340.1| acetolactate synthase [Coleofasciculus chthonoplastes IPPAS B-270]
Length=172

 Score = 79.3 bits (194),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 38/71 (54%), Positives = 56/71 (79%), Gaps = 2/71 (3%)
 Frame = +1

Query  337  RHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNK--DKALFTIVVSGTEAVLQNVM  510
            +HT+SV V DE+G++ RIA +FARRG+NIESLAVG  +  D +  T+VV+G + V++ ++
Sbjct  2    KHTLSVLVEDEAGVLTRIAALFARRGFNIESLAVGTGEQGDVSRVTMVVNGNDQVIEQIV  61

Query  511  EQLQKLVNVLK  543
            +QL KL+NVLK
Sbjct  62   KQLYKLINVLK  72



>ref|WP_026073042.1| acetolactate synthase [Nodosilinea nodulosa]
Length=173

 Score = 79.3 bits (194),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 39/71 (55%), Positives = 56/71 (79%), Gaps = 2/71 (3%)
 Frame = +1

Query  337  RHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQNVM  510
            +HT+SV V DE+G+++RIAG+FARRG+NIESLAVG  +   +   T+VV G +AV++ + 
Sbjct  2    KHTLSVLVEDEAGVLSRIAGLFARRGFNIESLAVGPAETAGISRITMVVPGDDAVIEQLT  61

Query  511  EQLQKLVNVLK  543
            +QL KL+NVLK
Sbjct  62   KQLYKLINVLK  72



>ref|WP_006453777.1| acetolactate synthase [Synechococcus sp. PCC 7335]
 gb|EDX84032.1| acetolactate synthase, small subunit [Synechococcus sp. PCC 7335]
Length=172

 Score = 79.3 bits (194),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 39/71 (55%), Positives = 55/71 (77%), Gaps = 2/71 (3%)
 Frame = +1

Query  337  RHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQNVM  510
            +HT+SV V DESG++ RIAG+FARRG+NIESLAVG  ++  +   T+VV G + V++ + 
Sbjct  2    KHTLSVLVEDESGVLTRIAGLFARRGFNIESLAVGPAEEAGISRITMVVPGDDLVIEQLA  61

Query  511  EQLQKLVNVLK  543
            +QL KL+NVLK
Sbjct  62   KQLYKLINVLK  72



>ref|WP_023066701.1| acetolactate synthase, small subunit [Lyngbya aestuarii]
 gb|ERT07064.1| acetolactate synthase, small subunit [Lyngbya aestuarii BL J]
Length=176

 Score = 79.0 bits (193),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 37/71 (52%), Positives = 55/71 (77%), Gaps = 2/71 (3%)
 Frame = +1

Query  337  RHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQNVM  510
            +HT+SV V DE+G++ RIAG+FARRG+NIESLAVG  +   +   T++VSG + +++ + 
Sbjct  2    KHTLSVLVEDEAGVLTRIAGLFARRGFNIESLAVGPAEQSGISRITMIVSGDDRIIEQIT  61

Query  511  EQLQKLVNVLK  543
            +QL KL+NVLK
Sbjct  62   KQLYKLINVLK  72



>gb|AHF64430.1| acetolactate synthase, small subunit [Synechococcus sp. WH 8109]
Length=176

 Score = 79.0 bits (193),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 40/71 (56%), Positives = 54/71 (76%), Gaps = 2/71 (3%)
 Frame = +1

Query  337  RHTISVFVGDESGMINRIAGVFARRGYNIESLAVG--LNKDKALFTIVVSGTEAVLQNVM  510
            +HT+SV V DESG ++RIAG+FARRG+NI+SLAVG    + ++  T+VV G E  LQ + 
Sbjct  2    KHTLSVVVEDESGALSRIAGLFARRGFNIDSLAVGPAEAEGQSRLTMVVEGDEQTLQQMT  61

Query  511  EQLQKLVNVLK  543
            +QL KLVNVL+
Sbjct  62   KQLDKLVNVLQ  72



>ref|WP_019508465.1| acetolactate synthase [Pleurocapsa sp. PCC 7319]
Length=174

 Score = 79.0 bits (193),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 39/71 (55%), Positives = 55/71 (77%), Gaps = 2/71 (3%)
 Frame = +1

Query  337  RHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQNVM  510
            +HTISV V DE+G++ RIAG+FARRG+NIESLAVG  +   +   T+VV G E V++ ++
Sbjct  2    KHTISVLVEDEAGVLTRIAGLFARRGFNIESLAVGSAEQMGISRITMVVPGDEQVIEQLI  61

Query  511  EQLQKLVNVLK  543
            +QL KL++VLK
Sbjct  62   KQLYKLISVLK  72



>ref|WP_027843130.1| acetolactate synthase [Mastigocoleus testarum]
Length=172

 Score = 79.0 bits (193),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 38/71 (54%), Positives = 56/71 (79%), Gaps = 2/71 (3%)
 Frame = +1

Query  337  RHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQNVM  510
            +HTISV V DE+G+++RIAG+FARRG+NIESLAVG  +   +   T+VV G +++++ + 
Sbjct  2    KHTISVLVQDEAGVLSRIAGLFARRGFNIESLAVGPAEQMGISRITMVVHGDDSIIEQLT  61

Query  511  EQLQKLVNVLK  543
            +QL KL+NVLK
Sbjct  62   KQLYKLINVLK  72



>ref|WP_035993822.1| acetolactate synthase [Leptolyngbya sp. KIOST-1]
Length=173

 Score = 78.6 bits (192),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 39/71 (55%), Positives = 56/71 (79%), Gaps = 2/71 (3%)
 Frame = +1

Query  337  RHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQNVM  510
            +HT+SV V DE+G+++RIAG+FARRG+NIESLAVG  +   +   T+VV G +AV++ + 
Sbjct  2    KHTLSVLVEDEAGVLSRIAGLFARRGFNIESLAVGPAETGGISRITMVVPGDDAVIEQLT  61

Query  511  EQLQKLVNVLK  543
            +QL KL+NVLK
Sbjct  62   KQLYKLINVLK  72



>ref|WP_011056724.1| MULTISPECIES: acetolactate synthase [Thermosynechococcus]
 ref|NP_681670.1| acetolactate synthase 3 regulatory subunit [Thermosynechococcus 
elongatus BP-1]
 dbj|BAC08432.1| acetolactate synthase small subunit [Thermosynechococcus elongatus 
BP-1]
 gb|AHB89434.1| acetolactate synthase regulatory subunit IlvH [Thermosynechococcus 
sp. NK55a]
Length=172

 Score = 78.6 bits (192),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 39/71 (55%), Positives = 55/71 (77%), Gaps = 2/71 (3%)
 Frame = +1

Query  337  RHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQNVM  510
            +HT+SV V DE+G++ RIAG+FARRG+NIESLAVG  +   +   T+VV G +AV++ + 
Sbjct  2    KHTLSVLVEDEAGVLTRIAGLFARRGFNIESLAVGPAEQIGISRITMVVPGDDAVIEQLT  61

Query  511  EQLQKLVNVLK  543
            +QL KL+NVLK
Sbjct  62   KQLYKLINVLK  72



>emb|CBN54307.1| acetolactate synthase 3 regulatory subunit [ [[Oscillatoria] 
sp. PCC 6506]
Length=194

 Score = 79.0 bits (193),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 63/87 (72%), Gaps = 3/87 (3%)
 Frame = +1

Query  289  LSTSDPAPPTPRQKVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--  462
            L++++P   +  +K++ HTISV V DE+G++ RIAG+FARRG+NIESLAVG  +      
Sbjct  9    LASTEPHAASLDRKMK-HTISVLVEDEAGVLTRIAGLFARRGFNIESLAVGPAEQGGFSR  67

Query  463  FTIVVSGTEAVLQNVMEQLQKLVNVLK  543
             T+VV G + +++ + +QL KL+NVLK
Sbjct  68   ITMVVPGDDRIIEQLTKQLYKLINVLK  94



>ref|WP_038545989.1| acetolactate synthase [Synechococcus sp. KORDI-100]
 gb|AII44144.1| acetolactate synthase [Synechococcus sp. KORDI-100]
Length=176

 Score = 78.6 bits (192),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 39/71 (55%), Positives = 54/71 (76%), Gaps = 2/71 (3%)
 Frame = +1

Query  337  RHTISVFVGDESGMINRIAGVFARRGYNIESLAVG--LNKDKALFTIVVSGTEAVLQNVM  510
            +HT+SV V DESG ++RIAG+FARRG+NI+SLAVG   +  ++  T+VV G +  LQ + 
Sbjct  2    KHTLSVLVEDESGALSRIAGLFARRGFNIDSLAVGPAESDGQSRLTMVVEGDDQTLQQMT  61

Query  511  EQLQKLVNVLK  543
            +QL KLVNVL+
Sbjct  62   KQLDKLVNVLQ  72



>ref|WP_035154634.1| acetolactate synthase [Calothrix sp. 336/3]
 gb|KFB84426.1| acetolactate synthase [Calothrix sp. 336/3]
Length=172

 Score = 78.6 bits (192),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 39/71 (55%), Positives = 55/71 (77%), Gaps = 2/71 (3%)
 Frame = +1

Query  337  RHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQNVM  510
            +HT+SV V DESG+++RIAG+FARRG+NIESLAVG  +   +   T+VV G + V++ + 
Sbjct  2    KHTLSVLVEDESGVLSRIAGLFARRGFNIESLAVGPAEQSGISRITMVVPGDDRVIEQLT  61

Query  511  EQLQKLVNVLK  543
            +QL KL+NVLK
Sbjct  62   KQLYKLINVLK  72



>emb|CCI18700.1| Acetolactate synthase small subunit [Microcystis aeruginosa PCC 
9807]
Length=185

 Score = 78.6 bits (192),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 55/76 (72%), Gaps = 2/76 (3%)
 Frame = +1

Query  322  RQKVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAV  495
            RQ   +HT+SV V DE+G++ RIAG+FARRG+NIESLAVG  +   +   T+VV G E  
Sbjct  8    RQSAMKHTLSVLVEDEAGVLTRIAGLFARRGFNIESLAVGPAEQMGVSRITMVVPGDEDS  67

Query  496  LQNVMEQLQKLVNVLK  543
            ++ + +QL KL+NVLK
Sbjct  68   IEQLTKQLYKLINVLK  83



>ref|WP_007098346.1| acetolactate synthase [Synechococcus sp. RS9916]
 gb|EAU74243.1| acetolactate synthase III small subunit [Synechococcus sp. RS9916]
Length=176

 Score = 78.6 bits (192),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 40/71 (56%), Positives = 54/71 (76%), Gaps = 2/71 (3%)
 Frame = +1

Query  337  RHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNK--DKALFTIVVSGTEAVLQNVM  510
            +HT+SV V DESG ++RIAG+FARRG+NI+SLAVG  +   ++  T+VV G E  LQ + 
Sbjct  2    KHTLSVLVEDESGALSRIAGLFARRGFNIDSLAVGPAEADGRSRLTMVVEGDEHTLQQMT  61

Query  511  EQLQKLVNVLK  543
            +QL KLVNVL+
Sbjct  62   KQLDKLVNVLQ  72



>ref|WP_011618839.1| acetolactate synthase [Synechococcus sp. CC9311]
 gb|ABI47420.1| acetolactate synthase, small subunit [Synechococcus sp. CC9311]
Length=176

 Score = 78.6 bits (192),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 40/71 (56%), Positives = 53/71 (75%), Gaps = 2/71 (3%)
 Frame = +1

Query  337  RHTISVFVGDESGMINRIAGVFARRGYNIESLAVG--LNKDKALFTIVVSGTEAVLQNVM  510
            +HT+SV V DESG ++RIAG+FARRG+NI+SLAVG      ++  T+VV G E  LQ + 
Sbjct  2    KHTLSVLVEDESGALSRIAGLFARRGFNIDSLAVGPAETNGQSRLTMVVEGDEHTLQQMS  61

Query  511  EQLQKLVNVLK  543
            +QL KLVNVL+
Sbjct  62   KQLDKLVNVLQ  72



>gb|AFY41657.1| acetolactate synthase, small subunit [Nostoc sp. PCC 7107]
Length=181

 Score = 78.6 bits (192),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 39/79 (49%), Positives = 57/79 (72%), Gaps = 2/79 (3%)
 Frame = +1

Query  313  PTPRQKVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGT  486
            P P     +HT+SV V DE+G+++RI+ +FARRGYNIESLAVG  +   +   T+VV+G 
Sbjct  3    PEPVLAKMKHTLSVLVEDEAGVLSRISSLFARRGYNIESLAVGQAEQGGVSRITMVVAGD  62

Query  487  EAVLQNVMEQLQKLVNVLK  543
            + +++ + +QL KLVNVLK
Sbjct  63   DRIIEQITKQLYKLVNVLK  81



>gb|EKV00810.1| acetolactate synthase, small subunit [Leptolyngbya sp. PCC 7375]
Length=199

 Score = 78.6 bits (192),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 42/86 (49%), Positives = 59/86 (69%), Gaps = 8/86 (9%)
 Frame = +1

Query  292  STSDPAPPTPRQKVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--F  465
            S S   PP       +HT+SV V DE+G+++RIAG+FARRG+NIESLAVG  +   +   
Sbjct  16   SISITVPPM------KHTLSVLVEDEAGVLSRIAGLFARRGFNIESLAVGPAEQAGISRI  69

Query  466  TIVVSGTEAVLQNVMEQLQKLVNVLK  543
            T+VV G + V++ + +QL KL+NVLK
Sbjct  70   TMVVPGDDGVIEQLTKQLYKLINVLK  95



>emb|CCI14937.1| Acetolactate synthase small subunit [Microcystis aeruginosa PCC 
9806]
Length=185

 Score = 78.6 bits (192),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 55/76 (72%), Gaps = 2/76 (3%)
 Frame = +1

Query  322  RQKVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAV  495
            RQ   +HT+SV V DE+G++ RIAG+FARRG+NIESLAVG  +   +   T+VV G E  
Sbjct  8    RQSAMKHTLSVLVEDEAGVLTRIAGLFARRGFNIESLAVGPAEQMGVSRITMVVPGDENS  67

Query  496  LQNVMEQLQKLVNVLK  543
            ++ + +QL KL+NVLK
Sbjct  68   IEQLTKQLYKLINVLK  83



>ref|WP_007100311.1| acetolactate synthase [Synechococcus sp. RS9917]
 gb|EAQ69008.1| Acetolactate synthase small subunit [Synechococcus sp. RS9917]
Length=176

 Score = 78.2 bits (191),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 39/71 (55%), Positives = 54/71 (76%), Gaps = 2/71 (3%)
 Frame = +1

Query  337  RHTISVFVGDESGMINRIAGVFARRGYNIESLAVG--LNKDKALFTIVVSGTEAVLQNVM  510
            +HT+SV V DESG ++RIAG+FARRG+NI+SLAVG   +  ++  T+VV G +  LQ + 
Sbjct  2    KHTLSVLVEDESGALSRIAGLFARRGFNIDSLAVGPAESDGRSRLTMVVDGDDHTLQQMT  61

Query  511  EQLQKLVNVLK  543
            +QL KLVNVL+
Sbjct  62   QQLDKLVNVLQ  72



>ref|WP_017660939.1| acetolactate synthase [Geitlerinema sp. PCC 7105]
Length=172

 Score = 78.2 bits (191),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/71 (52%), Positives = 55/71 (77%), Gaps = 2/71 (3%)
 Frame = +1

Query  337  RHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQNVM  510
            +HT+SV V DE+G++ RIAG+FARRG+NIESLAVG  +   +   T+VV+G + V++ + 
Sbjct  2    KHTLSVLVEDEAGVLTRIAGLFARRGFNIESLAVGSAEQGGISRITMVVNGNDQVIEQIT  61

Query  511  EQLQKLVNVLK  543
            +QL KL+NV+K
Sbjct  62   KQLYKLINVIK  72



>ref|WP_011933543.1| acetolactate synthase [Synechococcus sp. WH 7803]
 emb|CAK24070.1| Acetolactate synthase small subunit [Synechococcus sp. WH 7803]
Length=176

 Score = 78.2 bits (191),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 39/71 (55%), Positives = 54/71 (76%), Gaps = 2/71 (3%)
 Frame = +1

Query  337  RHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNK--DKALFTIVVSGTEAVLQNVM  510
            +HT+SV V DESG ++RIAG+FARRG+NI+SLAVG  +   ++  T+VV G +  LQ + 
Sbjct  2    KHTLSVLVEDESGALSRIAGLFARRGFNIDSLAVGPAEADGRSRLTMVVEGDQQTLQQMT  61

Query  511  EQLQKLVNVLK  543
            +QL KLVNVL+
Sbjct  62   KQLDKLVNVLQ  72



>ref|WP_011376800.1| acetolactate synthase [Prochlorococcus marinus]
 gb|ABB50312.1| acetolactate synthase, small subunit [Prochlorococcus marinus 
str. MIT 9312]
 gb|KGF99900.1| Acetolactate synthase small subunit [Prochlorococcus marinus 
str. MIT 9311]
Length=174

 Score = 78.2 bits (191),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 39/70 (56%), Positives = 53/70 (76%), Gaps = 2/70 (3%)
 Frame = +1

Query  337  RHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQNVM  510
            +HT+SV V DESG ++RI+G+FARRG+NI+SLAVG  + K +   T+VV G +A LQ + 
Sbjct  2    KHTLSVLVEDESGALSRISGLFARRGFNIDSLAVGPAESKGISRLTMVVEGDDATLQQMT  61

Query  511  EQLQKLVNVL  540
            +QL KL NVL
Sbjct  62   KQLNKLFNVL  71



>ref|WP_036020223.1| acetolactate synthase [Leptolyngbya sp. PCC 7375]
Length=176

 Score = 78.2 bits (191),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 38/71 (54%), Positives = 55/71 (77%), Gaps = 2/71 (3%)
 Frame = +1

Query  337  RHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQNVM  510
            +HT+SV V DE+G+++RIAG+FARRG+NIESLAVG  +   +   T+VV G + V++ + 
Sbjct  2    KHTLSVLVEDEAGVLSRIAGLFARRGFNIESLAVGPAEQAGISRITMVVPGDDGVIEQLT  61

Query  511  EQLQKLVNVLK  543
            +QL KL+NVLK
Sbjct  62   KQLYKLINVLK  72



>ref|WP_006041820.1| acetolactate synthase [Synechococcus sp. WH 7805]
 gb|EAR18129.1| acetolactate synthase III small subunit [Synechococcus sp. WH 
7805]
Length=176

 Score = 77.8 bits (190),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 39/71 (55%), Positives = 54/71 (76%), Gaps = 2/71 (3%)
 Frame = +1

Query  337  RHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNK--DKALFTIVVSGTEAVLQNVM  510
            +HT+SV V DESG ++RIAG+FARRG+NI+SLAVG  +   ++  T+VV G +  LQ + 
Sbjct  2    KHTLSVLVEDESGALSRIAGLFARRGFNIDSLAVGPAEADGRSRLTMVVEGDQQTLQQMT  61

Query  511  EQLQKLVNVLK  543
            +QL KLVNVL+
Sbjct  62   KQLDKLVNVLQ  72



>ref|WP_015125829.1| acetolactate synthase small subunit [Synechococcus sp. PCC 6312]
 gb|AFY62289.1| acetolactate synthase, small subunit [Synechococcus sp. PCC 6312]
Length=172

 Score = 77.8 bits (190),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 38/71 (54%), Positives = 54/71 (76%), Gaps = 2/71 (3%)
 Frame = +1

Query  337  RHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQNVM  510
            +HT+SV V DE+G++ RIAG+FARRG+NIESLAVG  +   +   T+VV G + V++ + 
Sbjct  2    KHTLSVLVEDEAGVLTRIAGLFARRGFNIESLAVGPAEQLGISRITMVVPGDDTVIEQIT  61

Query  511  EQLQKLVNVLK  543
            +QL KL+NVLK
Sbjct  62   KQLYKLINVLK  72



>ref|WP_015227737.1| acetolactate synthase small subunit [Halothece sp. PCC 7418]
 gb|AFZ45866.1| acetolactate synthase, small subunit [Halothece sp. PCC 7418]
Length=176

 Score = 77.8 bits (190),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/71 (54%), Positives = 54/71 (76%), Gaps = 2/71 (3%)
 Frame = +1

Query  337  RHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQNVM  510
            +HT+SV V DE+G++ RIAG+FARRGYNIESLAVG  + + +   T+VV G +  ++ + 
Sbjct  3    KHTLSVLVQDEAGVLTRIAGLFARRGYNIESLAVGPAEKEGISRITMVVPGDDRTIEQLT  62

Query  511  EQLQKLVNVLK  543
            +QL KL+NVLK
Sbjct  63   KQLYKLINVLK  73



>ref|WP_017313402.1| MULTISPECIES: acetolactate synthase [Stigonematales]
 gb|KIY11765.1| acetolactate synthase [Mastigocladus laminosus UU774]
Length=173

 Score = 77.8 bits (190),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/71 (54%), Positives = 55/71 (77%), Gaps = 2/71 (3%)
 Frame = +1

Query  337  RHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQNVM  510
            +HT+SV V DE+G+++RIAG+FARRG+NIESLAVG  +   +   T+VV G + V++ + 
Sbjct  2    KHTLSVLVEDEAGVLSRIAGLFARRGFNIESLAVGPAEQSGVSRITMVVPGDDWVIEQLT  61

Query  511  EQLQKLVNVLK  543
            +QL KL+NVLK
Sbjct  62   KQLYKLINVLK  72



>ref|WP_016859689.1| acetolactate synthase [Fischerella muscicola]
Length=173

 Score = 77.8 bits (190),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/71 (54%), Positives = 55/71 (77%), Gaps = 2/71 (3%)
 Frame = +1

Query  337  RHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQNVM  510
            +HT+SV V DE+G+++RIAG+FARRG+NIESLAVG  +   +   T+VV G + V++ + 
Sbjct  2    KHTLSVLVEDEAGVLSRIAGLFARRGFNIESLAVGPAEQSGVSRITMVVPGDDWVIEQLT  61

Query  511  EQLQKLVNVLK  543
            +QL KL+NVLK
Sbjct  62   KQLYKLINVLK  72



>ref|WP_015195236.1| acetolactate synthase, small subunit [Stanieria cyanosphaera]
 gb|AFZ37582.1| acetolactate synthase, small subunit [Stanieria cyanosphaera 
PCC 7437]
Length=173

 Score = 77.8 bits (190),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/71 (54%), Positives = 55/71 (77%), Gaps = 2/71 (3%)
 Frame = +1

Query  337  RHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQNVM  510
            +HTISV V DE+G++ RIAG+FARRG+NIESLAVG  +   +   T+VV G + +++ ++
Sbjct  2    KHTISVLVEDEAGVLTRIAGLFARRGFNIESLAVGPAEQVGISRITMVVPGDDRIIEQLI  61

Query  511  EQLQKLVNVLK  543
            +QL KL+NVLK
Sbjct  62   KQLYKLINVLK  72



>ref|WP_015189621.1| acetolactate synthase, small subunit [Gloeocapsa sp. PCC 7428]
 gb|AFZ31752.1| acetolactate synthase, small subunit [Gloeocapsa sp. PCC 7428]
Length=173

 Score = 77.8 bits (190),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/71 (55%), Positives = 54/71 (76%), Gaps = 2/71 (3%)
 Frame = +1

Query  337  RHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQNVM  510
            +HT+SV V DE+G++ RIAG+FARRG+NIESLAVG  +   +   T+VV G + V++ + 
Sbjct  2    KHTLSVLVEDEAGVLTRIAGLFARRGFNIESLAVGPAEQNGISRITMVVPGDDRVIEQLT  61

Query  511  EQLQKLVNVLK  543
            +QL KLVNVLK
Sbjct  62   KQLYKLVNVLK  72



>ref|WP_011127547.1| acetolactate synthase [Synechococcus sp. WH 8102]
 emb|CAE07195.1| Acetolactate synthase small subunit [Synechococcus sp. WH 8102]
Length=176

 Score = 77.8 bits (190),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 40/71 (56%), Positives = 54/71 (76%), Gaps = 2/71 (3%)
 Frame = +1

Query  337  RHTISVFVGDESGMINRIAGVFARRGYNIESLAVG-LNKDK-ALFTIVVSGTEAVLQNVM  510
            +HT+SV V DESG ++RIAG+FARRG+NI+SLAVG    D+ +  T+VV G +  LQ + 
Sbjct  2    KHTLSVLVEDESGALSRIAGLFARRGFNIDSLAVGPAEADRQSRLTMVVEGDDQTLQQMT  61

Query  511  EQLQKLVNVLK  543
            +QL KLVNVL+
Sbjct  62   KQLDKLVNVLQ  72



>ref|WP_011498832.1| acetolactate synthase [Methanococcoides burtonii]
 ref|YP_565424.1| acetolactate synthase 3 regulatory subunit [Methanococcoides 
burtonii DSM 6242]
 gb|ABE51674.1| acetolactate synthase, small subunit [Methanococcoides burtonii 
DSM 6242]
Length=161

 Score = 77.4 bits (189),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/71 (51%), Positives = 56/71 (79%), Gaps = 2/71 (3%)
 Frame = +1

Query  337  RHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQNVM  510
            RHT++V V ++ G++ R+AG+F+RRG+NI+SLAVG  +D  L   TI+VSG + VL+ VM
Sbjct  2    RHTLAVLVENKYGVLARVAGLFSRRGFNIDSLAVGTTEDPTLSRMTIIVSGDDHVLEQVM  61

Query  511  EQLQKLVNVLK  543
            +QL KL++V++
Sbjct  62   KQLNKLIDVIR  72



>ref|WP_013322899.1| acetolactate synthase [Cyanothece sp. PCC 7822]
 gb|ADN14794.1| acetolactate synthase, small subunit [Cyanothece sp. PCC 7822]
Length=175

 Score = 77.8 bits (190),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/71 (52%), Positives = 54/71 (76%), Gaps = 2/71 (3%)
 Frame = +1

Query  337  RHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQNVM  510
            +HT+SV V DE+G++ RIAG+FARRG+NIESLAVG  +   +   T+VV G + +++ + 
Sbjct  2    KHTLSVLVEDEAGVLTRIAGLFARRGFNIESLAVGPAEQPGISRITMVVPGDDGIIEQIT  61

Query  511  EQLQKLVNVLK  543
            +QL KL+NVLK
Sbjct  62   KQLYKLINVLK  72



>ref|WP_011364939.1| acetolactate synthase [Synechococcus sp. CC9605]
 gb|ABB35730.1| acetolactate synthase, small subunit [Synechococcus sp. CC9605]
Length=176

 Score = 77.8 bits (190),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/71 (55%), Positives = 54/71 (76%), Gaps = 2/71 (3%)
 Frame = +1

Query  337  RHTISVFVGDESGMINRIAGVFARRGYNIESLAVG--LNKDKALFTIVVSGTEAVLQNVM  510
            +HT+SV V DESG ++RIAG+FARRG+NI+SLAVG    + ++  T+VV G +  LQ + 
Sbjct  2    KHTLSVVVEDESGALSRIAGLFARRGFNIDSLAVGPAEAEGQSRLTMVVEGDDQTLQQMT  61

Query  511  EQLQKLVNVLK  543
            +QL KLVNVL+
Sbjct  62   KQLDKLVNVLQ  72



>ref|WP_038553682.1| acetolactate synthase [Synechococcus sp. KORDI-52]
Length=176

 Score = 77.8 bits (190),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/71 (55%), Positives = 54/71 (76%), Gaps = 2/71 (3%)
 Frame = +1

Query  337  RHTISVFVGDESGMINRIAGVFARRGYNIESLAVG--LNKDKALFTIVVSGTEAVLQNVM  510
            +HT+SV V DESG ++RIAG+FARRG+NI+SLAVG    + ++  T+VV G +  LQ + 
Sbjct  2    KHTLSVVVEDESGALSRIAGLFARRGFNIDSLAVGPAEAEGQSRLTMVVEGDDQTLQQMT  61

Query  511  EQLQKLVNVLK  543
            +QL KLVNVL+
Sbjct  62   KQLDKLVNVLQ  72



>ref|WP_023076484.1| acetolactate small subunit [Leptolyngbya sp. Heron Island J]
 gb|ESA32600.1| acetolactate small subunit [Leptolyngbya sp. Heron Island J]
Length=178

 Score = 77.8 bits (190),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/71 (54%), Positives = 56/71 (79%), Gaps = 2/71 (3%)
 Frame = +1

Query  337  RHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQNVM  510
            +HT+SV V DE+G+++RIAG+FARRG+NIESLAVG  +   +   T+VV G ++V++ + 
Sbjct  2    KHTLSVLVEDEAGVLSRIAGLFARRGFNIESLAVGPAEQTGVSRITMVVPGDDSVIEQLT  61

Query  511  EQLQKLVNVLK  543
            +QL KL+NVLK
Sbjct  62   KQLYKLINVLK  72



>ref|WP_018130638.1| acetolactate synthase [Effusibacillus pohliae]
Length=164

 Score = 77.4 bits (189),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/71 (52%), Positives = 52/71 (73%), Gaps = 2/71 (3%)
 Frame = +1

Query  337  RHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEAVLQNVM  510
            RHT+SV V D+ G++ R+AG+F+RRGYNI+SL VG  ++  L   TI   G EA L+ VM
Sbjct  2    RHTLSVLVNDQPGVLARVAGLFSRRGYNIDSLTVGPAEEPGLSRMTITTIGDEATLEQVM  61

Query  511  EQLQKLVNVLK  543
            +QL KL++V+K
Sbjct  62   KQLHKLIDVIK  72



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 579015689490