BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001O02

Length=661
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009594149.1|  PREDICTED: dolichol kinase isoform X2              101   5e-21   Nicotiana tomentosiformis
ref|XP_011090038.1|  PREDICTED: dolichol kinase                       99.8    2e-20   
ref|XP_006347198.1|  PREDICTED: dolichol kinase-like                  99.4    2e-20   Solanum tuberosum [potatoes]
ref|XP_010322411.1|  PREDICTED: dolichol kinase isoform X2            97.1    9e-20   Solanum lycopersicum
ref|XP_004241288.1|  PREDICTED: dolichol kinase isoform X1            97.4    1e-19   Solanum lycopersicum
ref|XP_009594141.1|  PREDICTED: dolichol kinase isoform X1            96.7    2e-19   Nicotiana tomentosiformis
emb|CDP07056.1|  unnamed protein product                              96.3    3e-19   Coffea canephora [robusta coffee]
ref|XP_009786599.1|  PREDICTED: dolichol kinase                       95.5    5e-19   Nicotiana sylvestris
ref|XP_002273662.1|  PREDICTED: dolichol kinase                       94.7    8e-19   Vitis vinifera
ref|XP_010111811.1|  hypothetical protein L484_020600                 89.7    3e-17   
ref|XP_002523693.1|  Transmembrane protein, putative                  85.9    9e-16   Ricinus communis
gb|KDO60215.1|  hypothetical protein CISIN_1g0083642mg                82.8    2e-15   Citrus sinensis [apfelsine]
gb|KDO60214.1|  hypothetical protein CISIN_1g0083642mg                82.8    2e-15   Citrus sinensis [apfelsine]
ref|XP_008226289.1|  PREDICTED: dolichol kinase                       84.7    2e-15   Prunus mume [ume]
ref|XP_006424498.1|  hypothetical protein CICLE_v10028099mg           82.4    3e-15   
ref|XP_007205002.1|  hypothetical protein PRUPE_ppa003568mg           83.6    5e-15   
gb|EYU36157.1|  hypothetical protein MIMGU_mgv1a005517mg              82.8    8e-15   Erythranthe guttata [common monkey flower]
ref|XP_006424495.1|  hypothetical protein CICLE_v10028099mg           82.4    9e-15   
ref|XP_006488035.1|  PREDICTED: dolichol kinase-like isoform X2       82.4    1e-14   Citrus sinensis [apfelsine]
ref|XP_006424496.1|  hypothetical protein CICLE_v10028099mg           82.4    1e-14   Citrus clementina [clementine]
ref|XP_006488034.1|  PREDICTED: dolichol kinase-like isoform X1       82.4    1e-14   Citrus sinensis [apfelsine]
ref|XP_006424497.1|  hypothetical protein CICLE_v10028099mg           82.4    2e-14   Citrus clementina [clementine]
gb|KHN06871.1|  Dolichol kinase                                       81.6    2e-14   Glycine soja [wild soybean]
gb|KHN21496.1|  Dolichol kinase                                       81.6    3e-14   Glycine soja [wild soybean]
ref|XP_010253970.1|  PREDICTED: dolichol kinase                       81.3    3e-14   Nelumbo nucifera [Indian lotus]
gb|EPS62134.1|  hypothetical protein M569_12659                       80.1    3e-14   Genlisea aurea
ref|XP_003539429.2|  PREDICTED: dolichol kinase-like isoform X1       81.3    3e-14   Glycine max [soybeans]
ref|XP_004288135.1|  PREDICTED: dolichol kinase                       80.5    5e-14   Fragaria vesca subsp. vesca
ref|XP_007016839.1|  Phosphatidate cytidylyltransferase family pr...  80.5    6e-14   
ref|XP_003543453.1|  PREDICTED: dolichol kinase-like                  80.5    6e-14   Glycine max [soybeans]
ref|XP_009356905.1|  PREDICTED: dolichol kinase isoform X1            80.1    7e-14   Pyrus x bretschneideri [bai li]
ref|XP_009356906.1|  PREDICTED: dolichol kinase isoform X2            80.1    7e-14   Pyrus x bretschneideri [bai li]
gb|KHG19069.1|  Dolichol kinase                                       79.7    8e-14   Gossypium arboreum [tree cotton]
gb|KJB83869.1|  hypothetical protein B456_013G268700                  79.7    1e-13   Gossypium raimondii
ref|XP_007150160.1|  hypothetical protein PHAVU_005G1319000g          79.3    1e-13   Phaseolus vulgaris [French bean]
ref|XP_007150159.1|  hypothetical protein PHAVU_005G1319000g          79.3    1e-13   Phaseolus vulgaris [French bean]
gb|KJB83868.1|  hypothetical protein B456_013G268700                  79.7    1e-13   Gossypium raimondii
ref|XP_008385360.1|  PREDICTED: dolichol kinase isoform X2            79.3    1e-13   
ref|XP_008385359.1|  PREDICTED: dolichol kinase isoform X1            79.3    1e-13   
gb|KHG05634.1|  Dolichol kinase                                       79.3    1e-13   Gossypium arboreum [tree cotton]
gb|KDP43992.1|  hypothetical protein JCGZ_05459                       79.3    2e-13   Jatropha curcas
gb|KJB20357.1|  hypothetical protein B456_003G144600                  78.6    2e-13   Gossypium raimondii
gb|KJB20358.1|  hypothetical protein B456_003G144600                  78.6    3e-13   Gossypium raimondii
ref|XP_008789549.1|  PREDICTED: dolichol kinase-like isoform X3       77.4    5e-13   
ref|XP_008789547.1|  PREDICTED: dolichol kinase-like isoform X1       77.4    5e-13   Phoenix dactylifera
ref|XP_008789548.1|  PREDICTED: dolichol kinase-like isoform X2       77.4    5e-13   
ref|XP_008359916.1|  PREDICTED: uncharacterized protein LOC103423600  74.3    6e-13   
ref|XP_010935716.1|  PREDICTED: dolichol kinase-like                  77.4    6e-13   
ref|XP_004147285.1|  PREDICTED: uncharacterized protein LOC101218949  76.6    1e-12   Cucumis sativus [cucumbers]
ref|XP_004161315.1|  PREDICTED: uncharacterized LOC101218949          76.6    1e-12   
ref|XP_004487072.1|  PREDICTED: dolichol kinase-like                  76.3    1e-12   Cicer arietinum [garbanzo]
ref|XP_008463185.1|  PREDICTED: dolichol kinase isoform X2            75.9    1e-12   Cucumis melo [Oriental melon]
ref|XP_008463178.1|  PREDICTED: dolichol kinase isoform X1            75.9    2e-12   Cucumis melo [Oriental melon]
ref|XP_008800540.1|  PREDICTED: dolichol kinase-like isoform X1       75.9    2e-12   Phoenix dactylifera
ref|XP_008800543.1|  PREDICTED: dolichol kinase-like isoform X3       75.5    2e-12   
ref|XP_008800541.1|  PREDICTED: dolichol kinase-like isoform X2       75.5    2e-12   Phoenix dactylifera
ref|XP_009408122.1|  PREDICTED: dolichol kinase isoform X1            75.1    3e-12   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010233805.1|  PREDICTED: uncharacterized protein LOC104583423  72.0    4e-12   
emb|CDY69868.1|  BnaAnng31810D                                        72.0    6e-12   Brassica napus [oilseed rape]
ref|XP_010520384.1|  PREDICTED: dolichol kinase                       74.3    7e-12   Tarenaya hassleriana [spider flower]
gb|KEH39388.1|  phosphatidate cytidylyltransferase family protein     72.8    1e-11   Medicago truncatula
ref|XP_010940630.1|  PREDICTED: dolichol kinase                       72.8    2e-11   Elaeis guineensis
gb|KEH39387.1|  phosphatidate cytidylyltransferase family protein     72.4    2e-11   Medicago truncatula
ref|XP_010689112.1|  PREDICTED: dolichol kinase                       72.4    2e-11   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003638051.1|  Dolichol kinase                                  72.4    3e-11   
ref|XP_010043798.1|  PREDICTED: dolichol kinase                       72.4    3e-11   Eucalyptus grandis [rose gum]
ref|NP_190090.2|  putative dolichol kinase                            71.6    4e-11   Arabidopsis thaliana [mouse-ear cress]
gb|AAL67067.1|  unknown protein                                       71.6    4e-11   Arabidopsis thaliana [mouse-ear cress]
emb|CAB89319.1|  putative protein                                     71.6    5e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009149874.1|  PREDICTED: dolichol kinase                       71.2    6e-11   Brassica rapa
ref|XP_002313531.1|  phosphatidate cytidylyltransferase family pr...  70.9    9e-11   
ref|XP_004951908.1|  PREDICTED: dolichol kinase-like isoform X2       70.1    1e-10   
ref|XP_004951907.1|  PREDICTED: dolichol kinase-like isoform X1       70.1    1e-10   
ref|XP_002877378.1|  phosphatidate cytidylyltransferase family pr...  70.1    2e-10   
ref|XP_011004788.1|  PREDICTED: dolichol kinase isoform X2            69.7    2e-10   Populus euphratica
ref|XP_011004786.1|  PREDICTED: dolichol kinase isoform X1            69.3    3e-10   Populus euphratica
gb|KFK33914.1|  hypothetical protein AALP_AA5G077000                  69.3    3e-10   Arabis alpina [alpine rockcress]
gb|EEE56294.1|  hypothetical protein OsJ_05365                        68.9    3e-10   Oryza sativa Japonica Group [Japonica rice]
gb|EEC72477.1|  hypothetical protein OsI_05838                        68.9    3e-10   Oryza sativa Indica Group [Indian rice]
ref|XP_010425937.1|  PREDICTED: dolichol kinase-like                  68.6    4e-10   Camelina sativa [gold-of-pleasure]
ref|XP_010514840.1|  PREDICTED: dolichol kinase-like                  68.6    5e-10   Camelina sativa [gold-of-pleasure]
ref|XP_010507191.1|  PREDICTED: uncharacterized protein LOC104783777  65.5    5e-10   Camelina sativa [gold-of-pleasure]
ref|XP_008645238.1|  PREDICTED: dolichol kinase                       68.2    6e-10   Zea mays [maize]
emb|CDY23707.1|  BnaC01g24140D                                        68.2    7e-10   Brassica napus [oilseed rape]
ref|XP_006290826.1|  hypothetical protein CARUB_v10016935mg           68.2    7e-10   Capsella rubella
emb|CDY48280.1|  BnaA05g10740D                                        67.8    8e-10   Brassica napus [oilseed rape]
emb|CDY12224.1|  BnaC04g12540D                                        67.8    8e-10   Brassica napus [oilseed rape]
ref|XP_009143958.1|  PREDICTED: dolichol kinase-like                  67.8    8e-10   
ref|XP_006419076.1|  hypothetical protein EUTSA_v10002461mg           67.0    2e-09   
ref|XP_006419077.1|  hypothetical protein EUTSA_v10002461mg           66.6    2e-09   Eutrema salsugineum [saltwater cress]
gb|EMT30058.1|  hypothetical protein F775_31824                       63.9    1e-08   
ref|XP_008355193.1|  PREDICTED: uncharacterized protein LOC103418861  58.9    6e-08   
ref|XP_006833180.1|  hypothetical protein AMTR_s00072p00153940        61.2    1e-07   Amborella trichopoda
gb|EEC72481.1|  hypothetical protein OsI_05844                        61.2    1e-07   Oryza sativa Indica Group [Indian rice]
gb|EEE56295.1|  hypothetical protein OsJ_05366                        60.8    2e-07   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009356907.1|  PREDICTED: dolichol kinase isoform X3            60.5    2e-07   Pyrus x bretschneideri [bai li]



>ref|XP_009594149.1| PREDICTED: dolichol kinase isoform X2 [Nicotiana tomentosiformis]
Length=564

 Score =   101 bits (251),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 55/86 (64%), Positives = 67/86 (78%), Gaps = 0/86 (0%)
 Frame = +1

Query  364  DDHSPTPLFQFFKTRPGASSGIFLGAVTLPGLMVSKLIQMSRALALGEVGIEELEYLKVQ  543
            D  S   L  FFKTRPGASSGIFLGAVTLPGLMVSKLIQ+SRA++L +VG EELE L++ 
Sbjct  52   DASSSVSLSHFFKTRPGASSGIFLGAVTLPGLMVSKLIQISRAVSLNQVGTEELENLQLL  111

Query  544  YWITSAICfsvlvflwlvlfRQPRCR  621
            YW+TSA CF+VL +L  + +RQ   +
Sbjct  112  YWVTSASCFTVLAYLCFIFYRQSDSK  137



>ref|XP_011090038.1| PREDICTED: dolichol kinase [Sesamum indicum]
Length=559

 Score = 99.8 bits (247),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 47/67 (70%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = +1

Query  367  DHSPTPLFQFFKTRPGASSGIFLGAVTLPGLMVSKLIQMSRALALGEVGIEELEYLKVQY  546
            D    PL  +F+TRPGASSGI LGAVTLPG+MVS+LIQ  RA AL EVGIEE+EYLK+Q+
Sbjct  53   DDDSNPLANYFRTRPGASSGILLGAVTLPGVMVSRLIQSLRAFALQEVGIEEIEYLKLQF  112

Query  547  WITSAIC  567
            W  SAIC
Sbjct  113  WAASAIC  119



>ref|XP_006347198.1| PREDICTED: dolichol kinase-like [Solanum tuberosum]
Length=561

 Score = 99.4 bits (246),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 83/118 (70%), Positives = 96/118 (81%), Gaps = 0/118 (0%)
 Frame = +1

Query  214  MASSPLFTGEravvvifvarivYLAPlsilyesislsilallalsveisaDDHSPTPLFQ  393
            MASS   TGERAVV +F+ARIV+  P S+L ES+SLS+L+LLALSVEIS D  S  PL  
Sbjct  1    MASSSSLTGERAVVALFIARIVFSVPQSLLSESLSLSLLSLLALSVEISVDASSSVPLSH  60

Query  394  FFKTRPGASSGIFLGAVTLPGLMVSKLIQMSRALALGEVGIEELEYLKVQYWITSAIC  567
            FFKTRPGASSGIFLGAVTLPG+MVSKLIQMSRA++L + G EELE L++ YW TSA C
Sbjct  61   FFKTRPGASSGIFLGAVTLPGVMVSKLIQMSRAVSLNQSGSEELENLQLLYWGTSASC  118



>ref|XP_010322411.1| PREDICTED: dolichol kinase isoform X2 [Solanum lycopersicum]
Length=500

 Score = 97.1 bits (240),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 80/118 (68%), Positives = 97/118 (82%), Gaps = 0/118 (0%)
 Frame = +1

Query  214  MASSPLFTGEravvvifvarivYLAPlsilyesislsilallalsveisaDDHSPTPLFQ  393
            MASS   TGERAVV +F+ARIV+  P S+L+ES+SLS+L+LLALSVEIS D  +  PL  
Sbjct  1    MASSSFLTGERAVVALFIARIVFSLPQSLLFESLSLSLLSLLALSVEISVDASASVPLSH  60

Query  394  FFKTRPGASSGIFLGAVTLPGLMVSKLIQMSRALALGEVGIEELEYLKVQYWITSAIC  567
            FFKTRPGASSGIFLGAVTLPG+MVSKLIQMS A++L + G EEL+ L++ YW+TSA C
Sbjct  61   FFKTRPGASSGIFLGAVTLPGVMVSKLIQMSTAVSLNQSGSEELKNLQLLYWVTSASC  118



>ref|XP_004241288.1| PREDICTED: dolichol kinase isoform X1 [Solanum lycopersicum]
Length=561

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 80/118 (68%), Positives = 97/118 (82%), Gaps = 0/118 (0%)
 Frame = +1

Query  214  MASSPLFTGEravvvifvarivYLAPlsilyesislsilallalsveisaDDHSPTPLFQ  393
            MASS   TGERAVV +F+ARIV+  P S+L+ES+SLS+L+LLALSVEIS D  +  PL  
Sbjct  1    MASSSFLTGERAVVALFIARIVFSLPQSLLFESLSLSLLSLLALSVEISVDASASVPLSH  60

Query  394  FFKTRPGASSGIFLGAVTLPGLMVSKLIQMSRALALGEVGIEELEYLKVQYWITSAIC  567
            FFKTRPGASSGIFLGAVTLPG+MVSKLIQMS A++L + G EEL+ L++ YW+TSA C
Sbjct  61   FFKTRPGASSGIFLGAVTLPGVMVSKLIQMSTAVSLNQSGSEELKNLQLLYWVTSASC  118



>ref|XP_009594141.1| PREDICTED: dolichol kinase isoform X1 [Nicotiana tomentosiformis]
Length=565

 Score = 96.7 bits (239),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 55/87 (63%), Positives = 67/87 (77%), Gaps = 1/87 (1%)
 Frame = +1

Query  364  DDHSPTPLFQFFKTRPGASSGIFLGAVTLPGLMVSKLIQMSRALALGEVGIE-ELEYLKV  540
            D  S   L  FFKTRPGASSGIFLGAVTLPGLMVSKLIQ+SRA++L +VG E ELE L++
Sbjct  52   DASSSVSLSHFFKTRPGASSGIFLGAVTLPGLMVSKLIQISRAVSLNQVGTEAELENLQL  111

Query  541  QYWITSAICfsvlvflwlvlfRQPRCR  621
             YW+TSA CF+VL +L  + +RQ   +
Sbjct  112  LYWVTSASCFTVLAYLCFIFYRQSDSK  138



>emb|CDP07056.1| unnamed protein product [Coffea canephora]
Length=574

 Score = 96.3 bits (238),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 53/83 (64%), Positives = 62/83 (75%), Gaps = 0/83 (0%)
 Frame = +1

Query  367  DHSPTPLFQFFKTRPGASSGIFLGAVTLPGLMVSKLIQMSRALALGEVGIEELEYLKVQY  546
            DH   P  +FFKTRPG SSGI LGAVTLPGLM+S+LIQM R L+L EVG+ ELE L++QY
Sbjct  56   DHDHDPFSRFFKTRPGVSSGILLGAVTLPGLMLSRLIQMLRGLSLNEVGVAELENLQLQY  115

Query  547  WITSAICfsvlvflwlvlfRQPR  615
            W T A CFSVLV   ++L RQ  
Sbjct  116  WATFASCFSVLVCFHVILQRQDN  138



>ref|XP_009786599.1| PREDICTED: dolichol kinase [Nicotiana sylvestris]
Length=564

 Score = 95.5 bits (236),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 89/137 (65%), Positives = 110/137 (80%), Gaps = 1/137 (1%)
 Frame = +1

Query  214  MASSPLF-TGEravvvifvarivYLAPlsilyesislsilallalsveisaDDHSPTPLF  390
            MASSP F TGERAVV +F+ARIV+  P S+L ES+SLS+L+LLALSVEIS D  S   L 
Sbjct  1    MASSPSFLTGERAVVALFIARIVFSIPQSLLSESLSLSLLSLLALSVEISVDASSSLSLS  60

Query  391  QFFKTRPGASSGIFLGAVTLPGLMVSKLIQMSRALALGEVGIEELEYLKVQYWITSAICf  570
             FFKTRPGASSGIFLGAVTLPGL+VSKLIQ++RA++L +VG EELE L++ YW+TSA CF
Sbjct  61   HFFKTRPGASSGIFLGAVTLPGLIVSKLIQITRAVSLNQVGTEELENLQLLYWVTSASCF  120

Query  571  svlvflwlvlfRQPRCR  621
            +VL +L  + +RQ   +
Sbjct  121  TVLAYLCFIFYRQSDSK  137



>ref|XP_002273662.1| PREDICTED: dolichol kinase [Vitis vinifera]
 emb|CBI17166.3| unnamed protein product [Vitis vinifera]
Length=564

 Score = 94.7 bits (234),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 51/57 (89%), Gaps = 0/57 (0%)
 Frame = +1

Query  397  FKTRPGASSGIFLGAVTLPGLMVSKLIQMSRALALGEVGIEELEYLKVQYWITSAIC  567
            FKTRPGASSGIFLGAVTLP +M+S+LIQ+SRA +L EVGI+EL YLKVQYW TSA C
Sbjct  59   FKTRPGASSGIFLGAVTLPAVMISRLIQLSRAFSLHEVGIKELGYLKVQYWATSASC  115



>ref|XP_010111811.1| hypothetical protein L484_020600 [Morus notabilis]
 gb|EXC31776.1| hypothetical protein L484_020600 [Morus notabilis]
Length=499

 Score = 89.7 bits (221),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 43/60 (72%), Positives = 48/60 (80%), Gaps = 0/60 (0%)
 Frame = +1

Query  388  FQFFKTRPGASSGIFLGAVTLPGLMVSKLIQMSRALALGEVGIEELEYLKVQYWITSAIC  567
            F FFKTRPGASSGI LGAVTLP LM+ KL QM RA+A+ EV IEE E+L +QYW TSA C
Sbjct  57   FSFFKTRPGASSGILLGAVTLPALMLCKLTQMLRAIAMKEVEIEEFEHLTMQYWATSACC  116



>ref|XP_002523693.1| Transmembrane protein, putative [Ricinus communis]
 gb|EEF38633.1| Transmembrane protein, putative [Ricinus communis]
Length=565

 Score = 85.9 bits (211),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = +1

Query  397  FKTRPGASSGIFLGAVTLPGLMVSKLIQMSRALALGEVGIEELEYLKVQYWITSAIC  567
            FKTRPGASSGIFLGA+TLP +M+SKLIQ+SRA +L ++   EL YL +QYW TSAIC
Sbjct  62   FKTRPGASSGIFLGAITLPAVMLSKLIQLSRAFSLHQIESGELNYLAMQYWATSAIC  118



>gb|KDO60215.1| hypothetical protein CISIN_1g0083642mg, partial [Citrus sinensis]
Length=299

 Score = 82.8 bits (203),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/57 (65%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = +1

Query  397  FKTRPGASSGIFLGAVTLPGLMVSKLIQMSRALALGEVGIEELEYLKVQYWITSAIC  567
            FKTRPGASSGI LGAVTLP +M+SKLIQ++RA +L ++ ++ELE++ +QYW TSA C
Sbjct  60   FKTRPGASSGILLGAVTLPTVMISKLIQLTRAYSLQQIELQELEHMTMQYWATSASC  116



>gb|KDO60214.1| hypothetical protein CISIN_1g0083642mg, partial [Citrus sinensis]
Length=326

 Score = 82.8 bits (203),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/57 (65%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = +1

Query  397  FKTRPGASSGIFLGAVTLPGLMVSKLIQMSRALALGEVGIEELEYLKVQYWITSAIC  567
            FKTRPGASSGI LGAVTLP +M+SKLIQ++RA +L ++ ++ELE++ +QYW TSA C
Sbjct  60   FKTRPGASSGILLGAVTLPTVMISKLIQLTRAYSLQQIELQELEHMTMQYWATSASC  116



>ref|XP_008226289.1| PREDICTED: dolichol kinase [Prunus mume]
Length=570

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 51/81 (63%), Positives = 61/81 (75%), Gaps = 1/81 (1%)
 Frame = +1

Query  373  SPTPLFQFFKTRPGASSGIFLGAVTLPGLMVSKLIQMSRALALGEVGIEELEYLKVQYWI  552
            S T L QF  TRPGASSGI LGAVTLP +++SK+IQ+SRA  L +VGIEELE L +QYW 
Sbjct  57   SSTSLAQF-NTRPGASSGILLGAVTLPAVVISKMIQLSRAFPLDQVGIEELESLTLQYWA  115

Query  553  TSAICfsvlvflwlvlfRQPR  615
             SA C SVL+FL + L+R P 
Sbjct  116  ASASCLSVLIFLCITLWRAPE  136



>ref|XP_006424498.1| hypothetical protein CICLE_v10028099mg [Citrus clementina]
 gb|ESR37738.1| hypothetical protein CICLE_v10028099mg [Citrus clementina]
Length=348

 Score = 82.4 bits (202),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 37/57 (65%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = +1

Query  397  FKTRPGASSGIFLGAVTLPGLMVSKLIQMSRALALGEVGIEELEYLKVQYWITSAIC  567
            FKTRPGASSGI LGAVTLP +M+SKLIQ++RA +L ++ ++ELE++ +QYW TSA C
Sbjct  60   FKTRPGASSGILLGAVTLPTVMISKLIQLTRAYSLQQIELQELEHMTMQYWATSASC  116



>ref|XP_007205002.1| hypothetical protein PRUPE_ppa003568mg [Prunus persica]
 gb|EMJ06201.1| hypothetical protein PRUPE_ppa003568mg [Prunus persica]
Length=565

 Score = 83.6 bits (205),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 51/81 (63%), Positives = 60/81 (74%), Gaps = 1/81 (1%)
 Frame = +1

Query  373  SPTPLFQFFKTRPGASSGIFLGAVTLPGLMVSKLIQMSRALALGEVGIEELEYLKVQYWI  552
            S T L QF  TRPGASSGI LGAVTLP + +SK+IQ+SRA  L +VGIEELE L +QYW 
Sbjct  52   SSTSLSQF-NTRPGASSGILLGAVTLPAVAISKMIQLSRAFPLDQVGIEELESLTLQYWA  110

Query  553  TSAICfsvlvflwlvlfRQPR  615
             SA C SVL+FL + L+R P 
Sbjct  111  ASASCLSVLIFLCITLWRAPE  131



>gb|EYU36157.1| hypothetical protein MIMGU_mgv1a005517mg [Erythranthe guttata]
Length=481

 Score = 82.8 bits (203),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 39/67 (58%), Positives = 48/67 (72%), Gaps = 0/67 (0%)
 Frame = +1

Query  367  DHSPTPLFQFFKTRPGASSGIFLGAVTLPGLMVSKLIQMSRALALGEVGIEELEYLKVQY  546
            D +  PL  FFK RPGASSG+ LGAVT+P L+VS+LIQ  R  ++ EVG E +EYLK+QY
Sbjct  53   DDASNPLGHFFKARPGASSGVLLGAVTVPSLLVSRLIQTLREESINEVGTEGIEYLKLQY  112

Query  547  WITSAIC  567
            W   A C
Sbjct  113  WAAFASC  119



>ref|XP_006424495.1| hypothetical protein CICLE_v10028099mg [Citrus clementina]
 gb|ESR37735.1| hypothetical protein CICLE_v10028099mg [Citrus clementina]
Length=434

 Score = 82.4 bits (202),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 37/57 (65%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = +1

Query  397  FKTRPGASSGIFLGAVTLPGLMVSKLIQMSRALALGEVGIEELEYLKVQYWITSAIC  567
            FKTRPGASSGI LGAVTLP +M+SKLIQ++RA +L ++ ++ELE++ +QYW TSA C
Sbjct  60   FKTRPGASSGILLGAVTLPTVMISKLIQLTRAYSLQQIELQELEHMTMQYWATSASC  116



>ref|XP_006488035.1| PREDICTED: dolichol kinase-like isoform X2 [Citrus sinensis]
Length=541

 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/57 (65%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = +1

Query  397  FKTRPGASSGIFLGAVTLPGLMVSKLIQMSRALALGEVGIEELEYLKVQYWITSAIC  567
            FKTRPGASSGI LGAVTLP +M+SKLIQ++RA +L ++ ++ELE++ +QYW TSA C
Sbjct  60   FKTRPGASSGILLGAVTLPTVMISKLIQLTRAYSLQQIELQELEHMTMQYWATSASC  116



>ref|XP_006424496.1| hypothetical protein CICLE_v10028099mg [Citrus clementina]
 gb|ESR37736.1| hypothetical protein CICLE_v10028099mg [Citrus clementina]
Length=541

 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/57 (65%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = +1

Query  397  FKTRPGASSGIFLGAVTLPGLMVSKLIQMSRALALGEVGIEELEYLKVQYWITSAIC  567
            FKTRPGASSGI LGAVTLP +M+SKLIQ++RA +L ++ ++ELE++ +QYW TSA C
Sbjct  60   FKTRPGASSGILLGAVTLPTVMISKLIQLTRAYSLQQIELQELEHMTMQYWATSASC  116



>ref|XP_006488034.1| PREDICTED: dolichol kinase-like isoform X1 [Citrus sinensis]
Length=568

 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/57 (65%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = +1

Query  397  FKTRPGASSGIFLGAVTLPGLMVSKLIQMSRALALGEVGIEELEYLKVQYWITSAIC  567
            FKTRPGASSGI LGAVTLP +M+SKLIQ++RA +L ++ ++ELE++ +QYW TSA C
Sbjct  60   FKTRPGASSGILLGAVTLPTVMISKLIQLTRAYSLQQIELQELEHMTMQYWATSASC  116



>ref|XP_006424497.1| hypothetical protein CICLE_v10028099mg [Citrus clementina]
 gb|ESR37737.1| hypothetical protein CICLE_v10028099mg [Citrus clementina]
Length=568

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/57 (65%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = +1

Query  397  FKTRPGASSGIFLGAVTLPGLMVSKLIQMSRALALGEVGIEELEYLKVQYWITSAIC  567
            FKTRPGASSGI LGAVTLP +M+SKLIQ++RA +L ++ ++ELE++ +QYW TSA C
Sbjct  60   FKTRPGASSGILLGAVTLPTVMISKLIQLTRAYSLQQIELQELEHMTMQYWATSASC  116



>gb|KHN06871.1| Dolichol kinase [Glycine soja]
Length=531

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/65 (58%), Positives = 51/65 (78%), Gaps = 2/65 (3%)
 Frame = +1

Query  367  DHSPTPLFQFFKTRPGASSGIFLGAVTLPGLMVSKLIQMSRALALGEVGIEELEYLKVQY  546
            D S +P    F+TRPGASSGI LGAVTLP L++SKL+Q+SR  +L ++ +EE++YL +QY
Sbjct  50   DSSNSP--SLFRTRPGASSGILLGAVTLPSLLLSKLVQLSREFSLAQLHLEEIQYLTLQY  107

Query  547  WITSA  561
            W TSA
Sbjct  108  WATSA  112



>gb|KHN21496.1| Dolichol kinase [Glycine soja]
Length=560

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 38/65 (58%), Positives = 51/65 (78%), Gaps = 2/65 (3%)
 Frame = +1

Query  367  DHSPTPLFQFFKTRPGASSGIFLGAVTLPGLMVSKLIQMSRALALGEVGIEELEYLKVQY  546
            D S +P    F+TRPGASSGI LGAVTLP L++SKL+Q+SR  +L ++ +EE++YL +QY
Sbjct  50   DSSNSP--SLFRTRPGASSGILLGAVTLPSLLLSKLVQLSRGFSLAQLQLEEIQYLTLQY  107

Query  547  WITSA  561
            W TSA
Sbjct  108  WATSA  112



>ref|XP_010253970.1| PREDICTED: dolichol kinase [Nelumbo nucifera]
Length=574

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = +1

Query  397  FKTRPGASSGIFLGAVTLPGLMVSKLIQMSRALALGEVGIEELEYLKVQYWITSAIC  567
            FKTRPGASSGI LGAVTLP +M S+LIQ+SRA+A  +VG EE+ YL +QYW  SA C
Sbjct  61   FKTRPGASSGILLGAVTLPAVMFSRLIQLSRAVASYDVGTEEVGYLNMQYWAVSASC  117



>gb|EPS62134.1| hypothetical protein M569_12659, partial [Genlisea aurea]
Length=377

 Score = 80.1 bits (196),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 42/68 (62%), Positives = 48/68 (71%), Gaps = 1/68 (1%)
 Frame = +1

Query  367  DHSPTPLFQFFKTRPGASSGIFLGAVTLPGLMVSKLIQMSRALA-LGEVGIEELEYLKVQ  543
            D +  PL   F+TRPGASSGIFL AVTLPGL+VSKLIQ  RA + L E   E L YL++Q
Sbjct  50   DEASNPLSSAFRTRPGASSGIFLSAVTLPGLLVSKLIQTLRAESLLDEAAFEGLHYLRLQ  109

Query  544  YWITSAIC  567
            YW  SA C
Sbjct  110  YWAASASC  117



>ref|XP_003539429.2| PREDICTED: dolichol kinase-like isoform X1 [Glycine max]
Length=579

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 38/65 (58%), Positives = 51/65 (78%), Gaps = 2/65 (3%)
 Frame = +1

Query  367  DHSPTPLFQFFKTRPGASSGIFLGAVTLPGLMVSKLIQMSRALALGEVGIEELEYLKVQY  546
            D S +P    F+TRPGASSGI LGAVTLP L++SKL+Q+SR  +L ++ +EE++YL +QY
Sbjct  68   DSSNSP--SLFRTRPGASSGILLGAVTLPSLLLSKLVQLSREFSLAQLHLEEIQYLTLQY  125

Query  547  WITSA  561
            W TSA
Sbjct  126  WATSA  130



>ref|XP_004288135.1| PREDICTED: dolichol kinase [Fragaria vesca subsp. vesca]
Length=562

 Score = 80.5 bits (197),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 39/63 (62%), Positives = 48/63 (76%), Gaps = 0/63 (0%)
 Frame = +1

Query  373  SPTPLFQFFKTRPGASSGIFLGAVTLPGLMVSKLIQMSRALALGEVGIEELEYLKVQYWI  552
            S   L   F+TRPGASSGI LGAVTLP +M+SK+IQ+SRA +LG+V  +ELE L +QYW 
Sbjct  51   SSAALLSRFRTRPGASSGILLGAVTLPTVMISKMIQLSRAFSLGQVTYQELESLSMQYWA  110

Query  553  TSA  561
             SA
Sbjct  111  ISA  113



>ref|XP_007016839.1| Phosphatidate cytidylyltransferase family protein [Theobroma 
cacao]
 gb|EOY34458.1| Phosphatidate cytidylyltransferase family protein [Theobroma 
cacao]
Length=567

 Score = 80.5 bits (197),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 37/59 (63%), Positives = 48/59 (81%), Gaps = 0/59 (0%)
 Frame = +1

Query  391  QFFKTRPGASSGIFLGAVTLPGLMVSKLIQMSRALALGEVGIEELEYLKVQYWITSAIC  567
              FKTRPGASSGI LGAVTLP +M+SKLIQ+SRA +L ++ + ELE++ +Q+W TSA C
Sbjct  57   SLFKTRPGASSGIMLGAVTLPTVMLSKLIQLSRAFSLQQIELGELEHMTMQFWATSACC  115



>ref|XP_003543453.1| PREDICTED: dolichol kinase-like [Glycine max]
Length=581

 Score = 80.5 bits (197),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 38/65 (58%), Positives = 50/65 (77%), Gaps = 2/65 (3%)
 Frame = +1

Query  367  DHSPTPLFQFFKTRPGASSGIFLGAVTLPGLMVSKLIQMSRALALGEVGIEELEYLKVQY  546
            D S +P    F+TRPGASSGI LGAVTLP L +SKL+Q+SR  +L ++ +EE++YL +QY
Sbjct  71   DSSNSP--SLFRTRPGASSGILLGAVTLPSLFLSKLVQLSRGFSLAQLQLEEIQYLTLQY  128

Query  547  WITSA  561
            W TSA
Sbjct  129  WATSA  133



>ref|XP_009356905.1| PREDICTED: dolichol kinase isoform X1 [Pyrus x bretschneideri]
Length=569

 Score = 80.1 bits (196),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 49/65 (75%), Gaps = 1/65 (2%)
 Frame = +1

Query  373  SPTPLFQFFKTRPGASSGIFLGAVTLPGLMVSKLIQMSRALALGEVGIEELEYLKVQYWI  552
            S T L QF  TRPGASSGI LGAVTLP + +SK+IQ+SRA++L +  IEELE L +QYW 
Sbjct  57   SSTSLSQF-STRPGASSGILLGAVTLPAVFISKMIQLSRAVSLHQAAIEELESLTMQYWA  115

Query  553  TSAIC  567
             SA C
Sbjct  116  ASASC  120



>ref|XP_009356906.1| PREDICTED: dolichol kinase isoform X2 [Pyrus x bretschneideri]
Length=563

 Score = 80.1 bits (196),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 49/65 (75%), Gaps = 1/65 (2%)
 Frame = +1

Query  373  SPTPLFQFFKTRPGASSGIFLGAVTLPGLMVSKLIQMSRALALGEVGIEELEYLKVQYWI  552
            S T L QF  TRPGASSGI LGAVTLP + +SK+IQ+SRA++L +  IEELE L +QYW 
Sbjct  57   SSTSLSQF-STRPGASSGILLGAVTLPAVFISKMIQLSRAVSLHQAAIEELESLTMQYWA  115

Query  553  TSAIC  567
             SA C
Sbjct  116  ASASC  120



>gb|KHG19069.1| Dolichol kinase [Gossypium arboreum]
 gb|KHG22571.1| Dolichol kinase [Gossypium arboreum]
Length=501

 Score = 79.7 bits (195),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 37/57 (65%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +1

Query  397  FKTRPGASSGIFLGAVTLPGLMVSKLIQMSRALALGEVGIEELEYLKVQYWITSAIC  567
            FKTRPGASSGI LGAVTLP +M+SKLIQ+SRA +L ++ I ELE++ +Q+W  SA C
Sbjct  59   FKTRPGASSGIMLGAVTLPTMMLSKLIQLSRAFSLQQIEIGELEHMTMQFWAASACC  115



>gb|KJB83869.1| hypothetical protein B456_013G268700 [Gossypium raimondii]
Length=545

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = +1

Query  388  FQFFKTRPGASSGIFLGAVTLPGLMVSKLIQMSRALALGEVGIEELEYLKVQYWITSAIC  567
               FKTRPGASSGI LGAVTLP +M+SKLIQ+SRA +L ++ I ELE++ +Q+W  SA C
Sbjct  56   LSLFKTRPGASSGIMLGAVTLPTVMLSKLIQLSRAFSLQQIEIGELEHMTMQFWAASACC  115



>ref|XP_007150160.1| hypothetical protein PHAVU_005G1319000g, partial [Phaseolus vulgaris]
 gb|ESW22154.1| hypothetical protein PHAVU_005G1319000g, partial [Phaseolus vulgaris]
Length=507

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/65 (57%), Positives = 51/65 (78%), Gaps = 2/65 (3%)
 Frame = +1

Query  367  DHSPTPLFQFFKTRPGASSGIFLGAVTLPGLMVSKLIQMSRALALGEVGIEELEYLKVQY  546
            D S +P    F+TRPGASSGI LGAVTLP L++SKL+Q+SR  +L ++ ++E++YL +QY
Sbjct  68   DSSNSP--SLFRTRPGASSGILLGAVTLPSLLLSKLVQLSRGFSLDQLQLQEIQYLTLQY  125

Query  547  WITSA  561
            W TSA
Sbjct  126  WATSA  130



>ref|XP_007150159.1| hypothetical protein PHAVU_005G1319000g [Phaseolus vulgaris]
 gb|ESW22153.1| hypothetical protein PHAVU_005G1319000g [Phaseolus vulgaris]
Length=513

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/65 (57%), Positives = 51/65 (78%), Gaps = 2/65 (3%)
 Frame = +1

Query  367  DHSPTPLFQFFKTRPGASSGIFLGAVTLPGLMVSKLIQMSRALALGEVGIEELEYLKVQY  546
            D S +P    F+TRPGASSGI LGAVTLP L++SKL+Q+SR  +L ++ ++E++YL +QY
Sbjct  68   DSSNSP--SLFRTRPGASSGILLGAVTLPSLLLSKLVQLSRGFSLDQLQLQEIQYLTLQY  125

Query  547  WITSA  561
            W TSA
Sbjct  126  WATSA  130



>gb|KJB83868.1| hypothetical protein B456_013G268700 [Gossypium raimondii]
Length=567

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = +1

Query  388  FQFFKTRPGASSGIFLGAVTLPGLMVSKLIQMSRALALGEVGIEELEYLKVQYWITSAIC  567
               FKTRPGASSGI LGAVTLP +M+SKLIQ+SRA +L ++ I ELE++ +Q+W  SA C
Sbjct  56   LSLFKTRPGASSGIMLGAVTLPTVMLSKLIQLSRAFSLQQIEIGELEHMTMQFWAASACC  115



>ref|XP_008385360.1| PREDICTED: dolichol kinase isoform X2 [Malus domestica]
Length=563

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/65 (62%), Positives = 49/65 (75%), Gaps = 1/65 (2%)
 Frame = +1

Query  373  SPTPLFQFFKTRPGASSGIFLGAVTLPGLMVSKLIQMSRALALGEVGIEELEYLKVQYWI  552
            S T L QF  TRPGASSGI LGAVTLP + +SK+IQ++RA++L +  IEELE L +QYW 
Sbjct  57   SSTSLSQF-STRPGASSGILLGAVTLPAVFISKMIQLTRAVSLHQAAIEELESLTMQYWA  115

Query  553  TSAIC  567
             SA C
Sbjct  116  ASASC  120



>ref|XP_008385359.1| PREDICTED: dolichol kinase isoform X1 [Malus domestica]
Length=569

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/65 (62%), Positives = 49/65 (75%), Gaps = 1/65 (2%)
 Frame = +1

Query  373  SPTPLFQFFKTRPGASSGIFLGAVTLPGLMVSKLIQMSRALALGEVGIEELEYLKVQYWI  552
            S T L QF  TRPGASSGI LGAVTLP + +SK+IQ++RA++L +  IEELE L +QYW 
Sbjct  57   SSTSLSQF-STRPGASSGILLGAVTLPAVFISKMIQLTRAVSLHQAAIEELESLTMQYWA  115

Query  553  TSAIC  567
             SA C
Sbjct  116  ASASC  120



>gb|KHG05634.1| Dolichol kinase [Gossypium arboreum]
Length=567

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/65 (60%), Positives = 52/65 (80%), Gaps = 4/65 (6%)
 Frame = +1

Query  367  DHSPTPLFQFFKTRPGASSGIFLGAVTLPGLMVSKLIQMSRALALGEVGIEELEYLKVQY  546
            D+SP+     FKTRPGASSGI LGAVTLP +M+SKLIQ+SRA++L ++ I ELE++ +Q+
Sbjct  53   DNSPS----LFKTRPGASSGIILGAVTLPTVMLSKLIQLSRAVSLQQIEIGELEHMTMQF  108

Query  547  WITSA  561
            W  SA
Sbjct  109  WAASA  113



>gb|KDP43992.1| hypothetical protein JCGZ_05459 [Jatropha curcas]
Length=557

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = +1

Query  397  FKTRPGASSGIFLGAVTLPGLMVSKLIQMSRALALGEVGIEELEYLKVQYWITSAIC  567
            FKTRP ASSGI LGAVTLP +M+SKL+Q+SRA +L ++  EEL+Y+ VQYW   A C
Sbjct  63   FKTRPAASSGILLGAVTLPAVMLSKLVQLSRAFSLHQIEYEELDYMSVQYWAAVASC  119



>gb|KJB20357.1| hypothetical protein B456_003G144600 [Gossypium raimondii]
Length=493

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/65 (60%), Positives = 51/65 (78%), Gaps = 4/65 (6%)
 Frame = +1

Query  367  DHSPTPLFQFFKTRPGASSGIFLGAVTLPGLMVSKLIQMSRALALGEVGIEELEYLKVQY  546
            D SP+     FKTRPGASSGI LGAVTLP +M+SKLIQ+SRA++L ++ I ELE++ +Q+
Sbjct  53   DDSPS----LFKTRPGASSGIILGAVTLPTVMLSKLIQLSRAVSLQQIEIGELEHMTMQF  108

Query  547  WITSA  561
            W  SA
Sbjct  109  WAASA  113



>gb|KJB20358.1| hypothetical protein B456_003G144600 [Gossypium raimondii]
Length=567

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 39/65 (60%), Positives = 51/65 (78%), Gaps = 4/65 (6%)
 Frame = +1

Query  367  DHSPTPLFQFFKTRPGASSGIFLGAVTLPGLMVSKLIQMSRALALGEVGIEELEYLKVQY  546
            D SP+     FKTRPGASSGI LGAVTLP +M+SKLIQ+SRA++L ++ I ELE++ +Q+
Sbjct  53   DDSPS----LFKTRPGASSGIILGAVTLPTVMLSKLIQLSRAVSLQQIEIGELEHMTMQF  108

Query  547  WITSA  561
            W  SA
Sbjct  109  WAASA  113



>ref|XP_008789549.1| PREDICTED: dolichol kinase-like isoform X3 [Phoenix dactylifera]
Length=532

 Score = 77.4 bits (189),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 44/73 (60%), Positives = 54/73 (74%), Gaps = 0/73 (0%)
 Frame = +1

Query  397  FKTRPGASSGIFLGAVTLPGLMVSKLIQMSRALALGEVGIEELEYLKVQYWITSAICfsv  576
            FKTRPGASSGI LGAVTLP +M+S+LIQ+SRAL   + G EEL Y+ +QYW  S  CF V
Sbjct  60   FKTRPGASSGILLGAVTLPTVMLSRLIQLSRALLRQDAGPEELAYMSMQYWTVSVSCFGV  119

Query  577  lvflwlvlfRQPR  615
            L+F + +L R P 
Sbjct  120  LIFFFFILRRSPN  132



>ref|XP_008789547.1| PREDICTED: dolichol kinase-like isoform X1 [Phoenix dactylifera]
Length=568

 Score = 77.4 bits (189),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 44/73 (60%), Positives = 54/73 (74%), Gaps = 0/73 (0%)
 Frame = +1

Query  397  FKTRPGASSGIFLGAVTLPGLMVSKLIQMSRALALGEVGIEELEYLKVQYWITSAICfsv  576
            FKTRPGASSGI LGAVTLP +M+S+LIQ+SRAL   + G EEL Y+ +QYW  S  CF V
Sbjct  60   FKTRPGASSGILLGAVTLPTVMLSRLIQLSRALLRQDAGPEELAYMSMQYWTVSVSCFGV  119

Query  577  lvflwlvlfRQPR  615
            L+F + +L R P 
Sbjct  120  LIFFFFILRRSPN  132



>ref|XP_008789548.1| PREDICTED: dolichol kinase-like isoform X2 [Phoenix dactylifera]
Length=544

 Score = 77.4 bits (189),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 44/73 (60%), Positives = 54/73 (74%), Gaps = 0/73 (0%)
 Frame = +1

Query  397  FKTRPGASSGIFLGAVTLPGLMVSKLIQMSRALALGEVGIEELEYLKVQYWITSAICfsv  576
            FKTRPGASSGI LGAVTLP +M+S+LIQ+SRAL   + G EEL Y+ +QYW  S  CF V
Sbjct  60   FKTRPGASSGILLGAVTLPTVMLSRLIQLSRALLRQDAGPEELAYMSMQYWTVSVSCFGV  119

Query  577  lvflwlvlfRQPR  615
            L+F + +L R P 
Sbjct  120  LIFFFFILRRSPN  132



>ref|XP_008359916.1| PREDICTED: uncharacterized protein LOC103423600 [Malus domestica]
Length=199

 Score = 74.3 bits (181),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 39/65 (60%), Positives = 46/65 (71%), Gaps = 1/65 (2%)
 Frame = +1

Query  373  SPTPLFQFFKTRPGASSGIFLGAVTLPGLMVSKLIQMSRALALGEVGIEELEYLKVQYWI  552
            S T L QF  TRPGASSGI LGAV LP + +SK IQ+S A++L +V IEELE L  +YW 
Sbjct  45   SSTSLSQF-STRPGASSGILLGAVALPTVFISKTIQLSLAVSLHQVSIEELESLTXRYWA  103

Query  553  TSAIC  567
             SA C
Sbjct  104  ASASC  108



>ref|XP_010935716.1| PREDICTED: dolichol kinase-like [Elaeis guineensis]
Length=572

 Score = 77.4 bits (189),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 46/73 (63%), Positives = 56/73 (77%), Gaps = 0/73 (0%)
 Frame = +1

Query  397  FKTRPGASSGIFLGAVTLPGLMVSKLIQMSRALALGEVGIEELEYLKVQYWITSAICfsv  576
            FKTRPGASSGI LGAVTLP +M+S+LIQ+SRAL   +VG EEL Y+ +QYW  S  CF V
Sbjct  60   FKTRPGASSGIQLGAVTLPTVMLSRLIQLSRALLRQDVGPEELAYMSMQYWTVSISCFGV  119

Query  577  lvflwlvlfRQPR  615
            L+F+ L+L R P 
Sbjct  120  LIFICLLLRRSPN  132



>ref|XP_004147285.1| PREDICTED: uncharacterized protein LOC101218949 [Cucumis sativus]
 gb|KGN64794.1| hypothetical protein Csa_1G097720 [Cucumis sativus]
Length=567

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = +1

Query  397  FKTRPGASSGIFLGAVTLPGLMVSKLIQMSRALALGEVGIEELEYLKVQYWITSAIC  567
            FKTRPGASSGI LGA+TLPG+M++K+IQ++RA +  ++ +EE+E   +Q+W TS  C
Sbjct  61   FKTRPGASSGILLGAITLPGVMLAKMIQLTRAFSSNQIALEEIETWTMQFWSTSTCC  117



>ref|XP_004161315.1| PREDICTED: uncharacterized LOC101218949 [Cucumis sativus]
Length=567

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = +1

Query  397  FKTRPGASSGIFLGAVTLPGLMVSKLIQMSRALALGEVGIEELEYLKVQYWITSAIC  567
            FKTRPGASSGI LGA+TLPG+M++K+IQ++RA +  ++ +EE+E   +Q+W TS  C
Sbjct  61   FKTRPGASSGILLGAITLPGVMLAKMIQLTRAFSSNQIALEEIETWTMQFWSTSTCC  117



>ref|XP_004487072.1| PREDICTED: dolichol kinase-like [Cicer arietinum]
Length=554

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = +1

Query  400  KTRPGASSGIFLGAVTLPGLMVSKLIQMSRALALGEVGIEELEYLKVQYWITSA  561
            +TRPGASSGI LGAVTLP L++SKLIQ SR L+LG++  +E+EYL +QYW T+A
Sbjct  59   RTRPGASSGILLGAVTLPSLILSKLIQSSRGLSLGQLQPQEIEYLTLQYWATTA  112



>ref|XP_008463185.1| PREDICTED: dolichol kinase isoform X2 [Cucumis melo]
Length=516

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = +1

Query  397  FKTRPGASSGIFLGAVTLPGLMVSKLIQMSRALALGEVGIEELEYLKVQYWITSAIC  567
            FKTRPGASSGI LGA+TLPG+M++K+IQ++RA +   + +EE+E   +Q+W TS  C
Sbjct  61   FKTRPGASSGILLGAITLPGVMLAKMIQLTRAFSSNHIALEEIETWTMQFWSTSTCC  117



>ref|XP_008463178.1| PREDICTED: dolichol kinase isoform X1 [Cucumis melo]
Length=567

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = +1

Query  397  FKTRPGASSGIFLGAVTLPGLMVSKLIQMSRALALGEVGIEELEYLKVQYWITSAIC  567
            FKTRPGASSGI LGA+TLPG+M++K+IQ++RA +   + +EE+E   +Q+W TS  C
Sbjct  61   FKTRPGASSGILLGAITLPGVMLAKMIQLTRAFSSNHIALEEIETWTMQFWSTSTCC  117



>ref|XP_008800540.1| PREDICTED: dolichol kinase-like isoform X1 [Phoenix dactylifera]
Length=589

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/57 (67%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = +1

Query  397  FKTRPGASSGIFLGAVTLPGLMVSKLIQMSRALALGEVGIEELEYLKVQYWITSAIC  567
            FKTRPGASSGI LGAVTLP +M+S+LIQ+SRAL   +V  EEL Y+ +QYW  SA C
Sbjct  60   FKTRPGASSGIQLGAVTLPTVMLSRLIQLSRALLREDVEPEELAYMSMQYWTVSASC  116



>ref|XP_008800543.1| PREDICTED: dolichol kinase-like isoform X3 [Phoenix dactylifera]
Length=550

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/57 (67%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = +1

Query  397  FKTRPGASSGIFLGAVTLPGLMVSKLIQMSRALALGEVGIEELEYLKVQYWITSAIC  567
            FKTRPGASSGI LGAVTLP +M+S+LIQ+SRAL   +V  EEL Y+ +QYW  SA C
Sbjct  60   FKTRPGASSGIQLGAVTLPTVMLSRLIQLSRALLREDVEPEELAYMSMQYWTVSASC  116



>ref|XP_008800541.1| PREDICTED: dolichol kinase-like isoform X2 [Phoenix dactylifera]
Length=572

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/57 (67%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = +1

Query  397  FKTRPGASSGIFLGAVTLPGLMVSKLIQMSRALALGEVGIEELEYLKVQYWITSAIC  567
            FKTRPGASSGI LGAVTLP +M+S+LIQ+SRAL   +V  EEL Y+ +QYW  SA C
Sbjct  60   FKTRPGASSGIQLGAVTLPTVMLSRLIQLSRALLREDVEPEELAYMSMQYWTVSASC  116



>ref|XP_009408122.1| PREDICTED: dolichol kinase isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=573

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 37/57 (65%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +1

Query  397  FKTRPGASSGIFLGAVTLPGLMVSKLIQMSRALALGEVGIEELEYLKVQYWITSAIC  567
            FKTRPGASSGI LG VTLP  M+S+LIQ+SR L   +V  EE+E L +QYWI SA C
Sbjct  61   FKTRPGASSGILLGTVTLPAAMLSRLIQLSRVLPENDVTSEEVEGLNMQYWIASASC  117



>ref|XP_010233805.1| PREDICTED: uncharacterized protein LOC104583423 [Brachypodium 
distachyon]
Length=227

 Score = 72.0 bits (175),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 35/64 (55%), Positives = 45/64 (70%), Gaps = 0/64 (0%)
 Frame = +1

Query  376  PTPLFQFFKTRPGASSGIFLGAVTLPGLMVSKLIQMSRALALGEVGIEELEYLKVQYWIT  555
            P  L + F+TRPGASSGI LGA TLP +M+S+LIQ+SR L+    G E+  YL++QYW  
Sbjct  60   PFSLLRRFRTRPGASSGILLGATTLPCVMLSRLIQLSRVLSADPNGQEDFAYLEMQYWAV  119

Query  556  SAIC  567
            S  C
Sbjct  120  SISC  123



>emb|CDY69868.1| BnaAnng31810D, partial [Brassica napus]
Length=254

 Score = 72.0 bits (175),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 34/61 (56%), Positives = 45/61 (74%), Gaps = 0/61 (0%)
 Frame = +1

Query  385  LFQFFKTRPGASSGIFLGAVTLPGLMVSKLIQMSRALALGEVGIEELEYLKVQYWITSAI  564
            L   F  R GASSGI LGAVTLP +M+SKL+Q++RA++L E G +EL ++ +QYW  SA 
Sbjct  58   LLSRFSPRRGASSGILLGAVTLPSVMLSKLVQLTRAISLHEAGQDELSHVTMQYWAASAS  117

Query  565  C  567
            C
Sbjct  118  C  118



>ref|XP_010520384.1| PREDICTED: dolichol kinase [Tarenaya hassleriana]
Length=584

 Score = 74.3 bits (181),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 35/61 (57%), Positives = 46/61 (75%), Gaps = 0/61 (0%)
 Frame = +1

Query  385  LFQFFKTRPGASSGIFLGAVTLPGLMVSKLIQMSRALALGEVGIEELEYLKVQYWITSAI  564
            L   F +R GA+SGI LGAVTLP +M+SKLIQ++RAL++ E   EE E++ +QYW TSA 
Sbjct  70   LLSRFASRRGATSGILLGAVTLPAVMISKLIQLTRALSMHEAEQEEFEHVTMQYWATSAS  129

Query  565  C  567
            C
Sbjct  130  C  130



>gb|KEH39388.1| phosphatidate cytidylyltransferase family protein [Medicago truncatula]
Length=403

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/65 (57%), Positives = 48/65 (74%), Gaps = 2/65 (3%)
 Frame = +1

Query  367  DHSPTPLFQFFKTRPGASSGIFLGAVTLPGLMVSKLIQMSRALALGEVGIEELEYLKVQY  546
            D S +P     +TRPGASSGI LGA+TLP L++SKLIQ SR  +L ++  +E+EYL +QY
Sbjct  50   DSSVSPFS--LRTRPGASSGILLGAITLPSLILSKLIQSSRGFSLQQLQPQEIEYLTLQY  107

Query  547  WITSA  561
            W TSA
Sbjct  108  WATSA  112



>ref|XP_010940630.1| PREDICTED: dolichol kinase [Elaeis guineensis]
Length=572

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/57 (61%), Positives = 42/57 (74%), Gaps = 0/57 (0%)
 Frame = +1

Query  397  FKTRPGASSGIFLGAVTLPGLMVSKLIQMSRALALGEVGIEELEYLKVQYWITSAIC  567
            FKTRPGASSGI LG VTLP +M+S+LIQ+SRAL   + G E+L Y  +QYW  S  C
Sbjct  60   FKTRPGASSGILLGTVTLPTVMLSRLIQLSRALLTQDAGPEKLAYKNMQYWTVSVSC  116



>gb|KEH39387.1| phosphatidate cytidylyltransferase family protein [Medicago truncatula]
Length=503

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = +1

Query  400  KTRPGASSGIFLGAVTLPGLMVSKLIQMSRALALGEVGIEELEYLKVQYWITSA  561
            +TRPGASSGI LGA+TLP L++SKLIQ SR  +L ++  +E+EYL +QYW TSA
Sbjct  59   RTRPGASSGILLGAITLPSLILSKLIQSSRGFSLQQLQPQEIEYLTLQYWATSA  112



>ref|XP_010689112.1| PREDICTED: dolichol kinase [Beta vulgaris subsp. vulgaris]
Length=560

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/57 (61%), Positives = 39/57 (68%), Gaps = 0/57 (0%)
 Frame = +1

Query  397  FKTRPGASSGIFLGAVTLPGLMVSKLIQMSRALALGEVGIEELEYLKVQYWITSAIC  567
            F  RPGASSGI LGAVTLP L+ SKLIQ+SR   L EV +EE +Y K  YW T   C
Sbjct  63   FTARPGASSGILLGAVTLPALVFSKLIQLSRGFLLAEVALEEFQYQKFLYWTTYISC  119



>ref|XP_003638051.1| Dolichol kinase [Medicago truncatula]
 gb|KEH39386.1| phosphatidate cytidylyltransferase family protein [Medicago truncatula]
Length=554

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = +1

Query  400  KTRPGASSGIFLGAVTLPGLMVSKLIQMSRALALGEVGIEELEYLKVQYWITSA  561
            +TRPGASSGI LGA+TLP L++SKLIQ SR  +L ++  +E+EYL +QYW TSA
Sbjct  59   RTRPGASSGILLGAITLPSLILSKLIQSSRGFSLQQLQPQEIEYLTLQYWATSA  112



>ref|XP_010043798.1| PREDICTED: dolichol kinase [Eucalyptus grandis]
Length=571

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = +1

Query  397  FKTRPGASSGIFLGAVTLPGLMVSKLIQMSRALALGEVGIEELEYLKVQYWITSA  561
            FKTRPGASSGI L AVTLP +++SKLIQ+SRA++  +V  E+ EYLK+ YW  S 
Sbjct  64   FKTRPGASSGILLAAVTLPTVLISKLIQLSRAVSPHQVSYEDFEYLKMLYWAASV  118



>ref|NP_190090.2| putative dolichol kinase [Arabidopsis thaliana]
 gb|AEE77982.1| putative dolichol kinase [Arabidopsis thaliana]
Length=569

 Score = 71.6 bits (174),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 45/61 (74%), Gaps = 0/61 (0%)
 Frame = +1

Query  385  LFQFFKTRPGASSGIFLGAVTLPGLMVSKLIQMSRALALGEVGIEELEYLKVQYWITSAI  564
            L   F +R GASSGI LGAVTLP +M+SKL+Q+SRA+++ E   +EL ++ +QYW  SA 
Sbjct  58   LLSHFSSRRGASSGILLGAVTLPSVMISKLVQLSRAISIHEAEQDELAHVTMQYWAASAS  117

Query  565  C  567
            C
Sbjct  118  C  118



>gb|AAL67067.1| unknown protein [Arabidopsis thaliana]
Length=569

 Score = 71.6 bits (174),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 45/61 (74%), Gaps = 0/61 (0%)
 Frame = +1

Query  385  LFQFFKTRPGASSGIFLGAVTLPGLMVSKLIQMSRALALGEVGIEELEYLKVQYWITSAI  564
            L   F +R GASSGI LGAVTLP +M+SKL+Q+SRA+++ E   +EL ++ +QYW  SA 
Sbjct  58   LLSHFSSRRGASSGILLGAVTLPSVMISKLVQLSRAISIHEAEQDELAHVTMQYWAASAS  117

Query  565  C  567
            C
Sbjct  118  C  118



>emb|CAB89319.1| putative protein [Arabidopsis thaliana]
Length=598

 Score = 71.6 bits (174),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 45/61 (74%), Gaps = 0/61 (0%)
 Frame = +1

Query  385  LFQFFKTRPGASSGIFLGAVTLPGLMVSKLIQMSRALALGEVGIEELEYLKVQYWITSAI  564
            L   F +R GASSGI LGAVTLP +M+SKL+Q+SRA+++ E   +EL ++ +QYW  SA 
Sbjct  58   LLSHFSSRRGASSGILLGAVTLPSVMISKLVQLSRAISIHEAEQDELAHVTMQYWAASAS  117

Query  565  C  567
            C
Sbjct  118  C  118



>ref|XP_009149874.1| PREDICTED: dolichol kinase [Brassica rapa]
Length=567

 Score = 71.2 bits (173),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 34/61 (56%), Positives = 45/61 (74%), Gaps = 0/61 (0%)
 Frame = +1

Query  385  LFQFFKTRPGASSGIFLGAVTLPGLMVSKLIQMSRALALGEVGIEELEYLKVQYWITSAI  564
            L   F  R GASSGI LGAVTLP +M+SKL+Q++RA++L E G +EL ++ +QYW  SA 
Sbjct  57   LLSRFSPRRGASSGILLGAVTLPSVMLSKLVQLTRAISLHEAGQDELSHVTMQYWAASAS  116

Query  565  C  567
            C
Sbjct  117  C  117



>ref|XP_002313531.1| phosphatidate cytidylyltransferase family protein [Populus trichocarpa]
 gb|EEE87486.1| phosphatidate cytidylyltransferase family protein [Populus trichocarpa]
Length=573

 Score = 70.9 bits (172),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 42/79 (53%), Positives = 52/79 (66%), Gaps = 0/79 (0%)
 Frame = +1

Query  397  FKTRPGASSGIFLGAVTLPGLMVSKLIQMSRALALGEVGIEELEYLKVQYWITSAICfsv  576
            FKTR GASSG+ LGAVTLP  M+SKLIQ SRA +L +V   EL YL +QYW     CF+V
Sbjct  62   FKTRAGASSGLLLGAVTLPTFMLSKLIQQSRAFSLNQVHPGELNYLALQYWAAFGSCFTV  121

Query  577  lvflwlvlfRQPRCRYYIN  633
            L+ L L+     R R + +
Sbjct  122  LMVLCLLTLDNTRSRSFCH  140



>ref|XP_004951908.1| PREDICTED: dolichol kinase-like isoform X2 [Setaria italica]
Length=569

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/67 (57%), Positives = 46/67 (69%), Gaps = 1/67 (1%)
 Frame = +1

Query  367  DHSPTPLFQFFKTRPGASSGIFLGAVTLPGLMVSKLIQMSRALALGEVGIEELEYLKVQY  546
            D S +PL +F +TRPGASSGI LGA TLP +M+S+LIQ SR L     G EE  YL++QY
Sbjct  58   DGSASPLRRF-RTRPGASSGILLGATTLPSVMLSQLIQRSRLLPADPNGPEEFAYLEMQY  116

Query  547  WITSAIC  567
            W  S  C
Sbjct  117  WAASISC  123



>ref|XP_004951907.1| PREDICTED: dolichol kinase-like isoform X1 [Setaria italica]
Length=605

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/67 (57%), Positives = 46/67 (69%), Gaps = 1/67 (1%)
 Frame = +1

Query  367  DHSPTPLFQFFKTRPGASSGIFLGAVTLPGLMVSKLIQMSRALALGEVGIEELEYLKVQY  546
            D S +PL +F +TRPGASSGI LGA TLP +M+S+LIQ SR L     G EE  YL++QY
Sbjct  58   DGSASPLRRF-RTRPGASSGILLGATTLPSVMLSQLIQRSRLLPADPNGPEEFAYLEMQY  116

Query  547  WITSAIC  567
            W  S  C
Sbjct  117  WAASISC  123



>ref|XP_002877378.1| phosphatidate cytidylyltransferase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH53637.1| phosphatidate cytidylyltransferase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=569

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +1

Query  397  FKTRPGASSGIFLGAVTLPGLMVSKLIQMSRALALGEVGIEELEYLKVQYWITSAIC  567
            F +R GASSGI LGAVTLP +M+SKL+Q+SRA++  E   +EL ++ +QYW  SA C
Sbjct  62   FSSRRGASSGILLGAVTLPSVMISKLVQLSRAISFHEAEQDELAHVTMQYWAASASC  118



>ref|XP_011004788.1| PREDICTED: dolichol kinase isoform X2 [Populus euphratica]
Length=540

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/57 (61%), Positives = 40/57 (70%), Gaps = 0/57 (0%)
 Frame = +1

Query  397  FKTRPGASSGIFLGAVTLPGLMVSKLIQMSRALALGEVGIEELEYLKVQYWITSAIC  567
            FKTR GASSG+ LGAVTLP  M+SKLIQ SRA +L +V   EL YL +QYW     C
Sbjct  62   FKTRAGASSGLLLGAVTLPTFMLSKLIQQSRAFSLHQVHPGELNYLAMQYWAAFGSC  118



>ref|XP_011004786.1| PREDICTED: dolichol kinase isoform X1 [Populus euphratica]
Length=562

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 35/57 (61%), Positives = 40/57 (70%), Gaps = 0/57 (0%)
 Frame = +1

Query  397  FKTRPGASSGIFLGAVTLPGLMVSKLIQMSRALALGEVGIEELEYLKVQYWITSAIC  567
            FKTR GASSG+ LGAVTLP  M+SKLIQ SRA +L +V   EL YL +QYW     C
Sbjct  62   FKTRAGASSGLLLGAVTLPTFMLSKLIQQSRAFSLHQVHPGELNYLAMQYWAAFGSC  118



>gb|KFK33914.1| hypothetical protein AALP_AA5G077000 [Arabis alpina]
Length=576

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 36/67 (54%), Positives = 49/67 (73%), Gaps = 1/67 (1%)
 Frame = +1

Query  367  DHSPTPLFQFFKTRPGASSGIFLGAVTLPGLMVSKLIQMSRALALGEVGIEELEYLKVQY  546
            + SP+ L   F +R GASSGI LGAVTLP +M+SKLIQ+SRA++L E   +EL ++ +QY
Sbjct  59   ETSPS-LLSRFSSRKGASSGILLGAVTLPAVMISKLIQLSRAISLHEAEQDELAHVTMQY  117

Query  547  WITSAIC  567
            +  SA C
Sbjct  118  YAASASC  124



>gb|EEE56294.1| hypothetical protein OsJ_05365 [Oryza sativa Japonica Group]
Length=506

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 40/57 (70%), Gaps = 0/57 (0%)
 Frame = +1

Query  397  FKTRPGASSGIFLGAVTLPGLMVSKLIQMSRALALGEVGIEELEYLKVQYWITSAIC  567
            F+TRPGASSGI LGA TLP +M+S+LIQ+ R L     G EE  YL++QYW  S  C
Sbjct  66   FRTRPGASSGILLGATTLPSVMLSRLIQLYRVLLADPNGREEYAYLEMQYWAVSVSC  122



>gb|EEC72477.1| hypothetical protein OsI_05838 [Oryza sativa Indica Group]
Length=568

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 45/65 (69%), Gaps = 1/65 (2%)
 Frame = +1

Query  373  SPTPLFQFFKTRPGASSGIFLGAVTLPGLMVSKLIQMSRALALGEVGIEELEYLKVQYWI  552
            S +PL +F +TRPGASSGI LGA TLP +M+S+LIQ+ R L     G EE  YL++QYW 
Sbjct  57   SSSPLRRF-RTRPGASSGILLGATTLPSVMLSRLIQLYRVLLADPNGREEYAYLEMQYWA  115

Query  553  TSAIC  567
             S  C
Sbjct  116  VSVSC  120



>ref|XP_010425937.1| PREDICTED: dolichol kinase-like [Camelina sativa]
Length=573

 Score = 68.6 bits (166),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 34/67 (51%), Positives = 48/67 (72%), Gaps = 1/67 (1%)
 Frame = +1

Query  367  DHSPTPLFQFFKTRPGASSGIFLGAVTLPGLMVSKLIQMSRALALGEVGIEELEYLKVQY  546
            ++SP  L   F  R GASSGI LGAVTLP +M+SKL+Q++RA+++ E   +EL ++ +QY
Sbjct  57   ENSPF-LLSCFSARRGASSGILLGAVTLPAVMMSKLVQLTRAISIHEAEQDELAHVTMQY  115

Query  547  WITSAIC  567
            W  SA C
Sbjct  116  WAASASC  122



>ref|XP_010514840.1| PREDICTED: dolichol kinase-like [Camelina sativa]
Length=572

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +1

Query  397  FKTRPGASSGIFLGAVTLPGLMVSKLIQMSRALALGEVGIEELEYLKVQYWITSAIC  567
            F  R GASSGI LGAVTLP +M+SKL+Q++RA+++ E   +EL ++ +QYW  SA C
Sbjct  65   FSARRGASSGILLGAVTLPAVMMSKLVQLTRAISIHEAEQDELAHVTMQYWAASASC  121



>ref|XP_010507191.1| PREDICTED: uncharacterized protein LOC104783777 [Camelina sativa]
Length=171

 Score = 65.5 bits (158),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = +1

Query  385  LFQFFKTRPGASSGIFLGAVTLPGLMVSKLIQMSRALALGEVGIEELEYLKVQYW  549
            L   F  R GASSGI LGAVTLP +M+SKL+Q++RA+++ E   +EL ++ +QYW
Sbjct  62   LLSRFSARRGASSGILLGAVTLPAVMMSKLVQLTRAISIHEAEQDELAHVTMQYW  116



>ref|XP_008645238.1| PREDICTED: dolichol kinase [Zea mays]
 gb|AFW70133.1| hypothetical protein ZEAMMB73_937323 [Zea mays]
Length=575

 Score = 68.2 bits (165),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 36/68 (53%), Positives = 45/68 (66%), Gaps = 1/68 (1%)
 Frame = +1

Query  364  DDHSPTPLFQFFKTRPGASSGIFLGAVTLPGLMVSKLIQMSRALALGEVGIEELEYLKVQ  543
            D     PL +F +TRPGASSGI LGA TLP +M+S+LIQ+SR L     G +E  YL++Q
Sbjct  61   DGSGSAPLRRF-RTRPGASSGILLGATTLPSVMLSRLIQLSRLLPADPNGPKEFAYLEMQ  119

Query  544  YWITSAIC  567
            YW  S  C
Sbjct  120  YWAASISC  127



>emb|CDY23707.1| BnaC01g24140D [Brassica napus]
Length=568

 Score = 68.2 bits (165),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +1

Query  397  FKTRPGASSGIFLGAVTLPGLMVSKLIQMSRALALGEVGIEELEYLKVQYWITSAIC  567
            F  R GASSGI LGAVTLP +M+SKL+Q++RA++L E   +EL ++ +QYW  SA C
Sbjct  62   FSPRRGASSGILLGAVTLPSVMLSKLVQLTRAISLHEAEQDELSHVTMQYWAASASC  118



>ref|XP_006290826.1| hypothetical protein CARUB_v10016935mg [Capsella rubella]
 gb|EOA23724.1| hypothetical protein CARUB_v10016935mg [Capsella rubella]
Length=569

 Score = 68.2 bits (165),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +1

Query  397  FKTRPGASSGIFLGAVTLPGLMVSKLIQMSRALALGEVGIEELEYLKVQYWITSAIC  567
            F  R GASSGI LGAVTLP +M+SKL+Q++RA+++ E   +EL ++ +QYW  SA C
Sbjct  62   FSARRGASSGILLGAVTLPSVMMSKLVQLTRAISIHEAEQDELAHVTMQYWAASASC  118



>emb|CDY48280.1| BnaA05g10740D [Brassica napus]
Length=564

 Score = 67.8 bits (164),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +1

Query  397  FKTRPGASSGIFLGAVTLPGLMVSKLIQMSRALALGEVGIEELEYLKVQYWITSAIC  567
            F  R GASSGI LGAVTLP +M+SKL+Q++RA++L +   +EL ++ +QYW  SA C
Sbjct  58   FSARRGASSGILLGAVTLPAVMMSKLVQLTRAISLHQAEQDELAHVTMQYWAASASC  114



>emb|CDY12224.1| BnaC04g12540D [Brassica napus]
Length=574

 Score = 67.8 bits (164),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 32/61 (52%), Positives = 44/61 (72%), Gaps = 0/61 (0%)
 Frame = +1

Query  385  LFQFFKTRPGASSGIFLGAVTLPGLMVSKLIQMSRALALGEVGIEELEYLKVQYWITSAI  564
            L   F  R GASSGI LGAVTLP +M+SKL+Q++RA++L +   +EL ++ +QYW  SA 
Sbjct  64   LLSRFSARRGASSGILLGAVTLPAVMMSKLVQLTRAISLHQAEQDELAHVTMQYWAASAS  123

Query  565  C  567
            C
Sbjct  124  C  124



>ref|XP_009143958.1| PREDICTED: dolichol kinase-like [Brassica rapa]
Length=589

 Score = 67.8 bits (164),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +1

Query  397  FKTRPGASSGIFLGAVTLPGLMVSKLIQMSRALALGEVGIEELEYLKVQYWITSAIC  567
            F  R GASSGI LGAVTLP +M+SKL+Q++RA++L +   +EL ++ +QYW  SA C
Sbjct  83   FSARRGASSGILLGAVTLPAVMMSKLVQLTRAISLHQAEQDELAHVTMQYWAASASC  139



>ref|XP_006419076.1| hypothetical protein EUTSA_v10002461mg [Eutrema salsugineum]
 gb|ESQ37512.1| hypothetical protein EUTSA_v10002461mg [Eutrema salsugineum]
Length=531

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/61 (52%), Positives = 44/61 (72%), Gaps = 0/61 (0%)
 Frame = +1

Query  385  LFQFFKTRPGASSGIFLGAVTLPGLMVSKLIQMSRALALGEVGIEELEYLKVQYWITSAI  564
            L   F  R GASSGI LGAVTLP +M+SKL+Q++RA+++ E   +EL ++ +QYW  SA 
Sbjct  67   LLSRFSPRLGASSGILLGAVTLPAVMMSKLVQLTRAISVHEAEQDELAHVTMQYWAASAS  126

Query  565  C  567
            C
Sbjct  127  C  127



>ref|XP_006419077.1| hypothetical protein EUTSA_v10002461mg [Eutrema salsugineum]
 gb|ESQ37513.1| hypothetical protein EUTSA_v10002461mg [Eutrema salsugineum]
Length=578

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +1

Query  397  FKTRPGASSGIFLGAVTLPGLMVSKLIQMSRALALGEVGIEELEYLKVQYWITSAIC  567
            F  R GASSGI LGAVTLP +M+SKL+Q++RA+++ E   +EL ++ +QYW  SA C
Sbjct  71   FSPRLGASSGILLGAVTLPAVMMSKLVQLTRAISVHEAEQDELAHVTMQYWAASASC  127



>gb|EMT30058.1| hypothetical protein F775_31824 [Aegilops tauschii]
Length=482

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 44/67 (66%), Gaps = 4/67 (6%)
 Frame = +1

Query  379  TPLFQF----FKTRPGASSGIFLGAVTLPGLMVSKLIQMSRALALGEVGIEELEYLKVQY  546
            +PL +F      +RPGASSGI LGA TLP +M+++LIQ+SR L     G +E  YL++QY
Sbjct  57   SPLRRFRTSHISSRPGASSGILLGATTLPCVMLARLIQLSRILPTDPNGAQEFAYLEMQY  116

Query  547  WITSAIC  567
            W  S  C
Sbjct  117  WAVSISC  123



>ref|XP_008355193.1| PREDICTED: uncharacterized protein LOC103418861 [Malus domestica]
Length=131

 Score = 58.9 bits (141),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 40/62 (65%), Gaps = 1/62 (2%)
 Frame = +1

Query  373  SPTPLFQFFKTRPGASSGIFLGAVTLPGLMVSKLIQMSRALALGEVGIEELEYLKVQYWI  552
            S T L QF  TRPGASSGI LGAVTLP + +SK IQ+S A++L +V IE  E      W 
Sbjct  45   SSTSLSQF-STRPGASSGILLGAVTLPTVFISKTIQLSLAVSLHQVSIEGFETALKLLWX  103

Query  553  TS  558
             S
Sbjct  104  LS  105



>ref|XP_006833180.1| hypothetical protein AMTR_s00072p00153940 [Amborella trichopoda]
 gb|ERM98458.1| hypothetical protein AMTR_s00072p00153940 [Amborella trichopoda]
Length=581

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 37/55 (67%), Gaps = 0/55 (0%)
 Frame = +1

Query  397  FKTRPGASSGIFLGAVTLPGLMVSKLIQMSRALALGEVGIEELEYLKVQYWITSA  561
            FKTRPGASSGI LGA TLP + +S++IQ+ RAL     G  E   LK+QYW  S 
Sbjct  61   FKTRPGASSGILLGATTLPTVFLSRMIQLCRALPEHHTGEHEHGILKLQYWAASV  115



>gb|EEC72481.1| hypothetical protein OsI_05844 [Oryza sativa Indica Group]
Length=588

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 36/53 (68%), Gaps = 0/53 (0%)
 Frame = +1

Query  409  PGASSGIFLGAVTLPGLMVSKLIQMSRALALGEVGIEELEYLKVQYWITSAIC  567
            PGASSGI LGA TLP +M+S+LIQ+ R L     G EE  YL++QYW  S  C
Sbjct  99   PGASSGILLGATTLPSVMLSRLIQLYRVLLADPNGREEYAYLEMQYWAVSVSC  151



>gb|EEE56295.1| hypothetical protein OsJ_05366 [Oryza sativa Japonica Group]
Length=509

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 36/53 (68%), Gaps = 0/53 (0%)
 Frame = +1

Query  409  PGASSGIFLGAVTLPGLMVSKLIQMSRALALGEVGIEELEYLKVQYWITSAIC  567
            PGASSGI LGA TLP +M+S+LIQ+ R L     G EE  YL++QYW  S  C
Sbjct  9    PGASSGILLGATTLPSVMLSRLIQLYRVLLADPNGREEYAYLEMQYWAVSVSC  61



>ref|XP_009356907.1| PREDICTED: dolichol kinase isoform X3 [Pyrus x bretschneideri]
Length=501

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/52 (60%), Positives = 39/52 (75%), Gaps = 1/52 (2%)
 Frame = +1

Query  373  SPTPLFQFFKTRPGASSGIFLGAVTLPGLMVSKLIQMSRALALGEVGIEELE  528
            S T L QF  TRPGASSGI LGAVTLP + +SK+IQ+SRA++L +  IE  +
Sbjct  57   SSTSLSQF-STRPGASSGILLGAVTLPAVFISKMIQLSRAVSLHQAAIEGFD  107



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1023687230320