BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001N24

Length=345
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|ACU18515.1|  unknown                                                 112   6e-28   Glycine max [soybeans]
ref|XP_003526792.1|  PREDICTED: methylesterase 17                       112   2e-27   Glycine max [soybeans]
ref|XP_002520884.1|  conserved hypothetical protein                     110   5e-27   
ref|XP_007141327.1|  hypothetical protein PHAVU_008G186600g             110   8e-27   Phaseolus vulgaris [French bean]
ref|XP_009363781.1|  PREDICTED: methylesterase 17-like                  110   2e-26   Pyrus x bretschneideri [bai li]
ref|XP_007011384.1|  Methyl esterase 17                                 109   2e-26   Theobroma cacao [chocolate]
gb|KHG20572.1|  Pheophorbidase                                          109   3e-26   Gossypium arboreum [tree cotton]
gb|KDO67571.1|  hypothetical protein CISIN_1g032072mg                   106   3e-26   Citrus sinensis [apfelsine]
gb|KEH35520.1|  methylesterase                                          108   4e-26   Medicago truncatula
ref|XP_007218793.1|  hypothetical protein PRUPE_ppa009785mg             108   4e-26   
ref|XP_008234160.1|  PREDICTED: methylesterase 17                       108   4e-26   Prunus mume [ume]
gb|KEH35519.1|  methylesterase                                          108   8e-26   Medicago truncatula
ref|XP_006435956.1|  hypothetical protein CICLE_v10032372mg             107   8e-26   Citrus clementina [clementine]
gb|KDP21626.1|  hypothetical protein JCGZ_03297                         107   9e-26   Jatropha curcas
gb|AFK40220.1|  unknown                                                 108   9e-26   Medicago truncatula
ref|XP_008376326.1|  PREDICTED: methylesterase 17-like                  107   1e-25   
ref|XP_010102428.1|  hypothetical protein L484_002055                   108   1e-25   
ref|XP_004502811.1|  PREDICTED: methylesterase 17-like                  107   1e-25   Cicer arietinum [garbanzo]
ref|XP_008459483.1|  PREDICTED: methylesterase 17                       107   1e-25   Cucumis melo [Oriental melon]
gb|AFK48205.1|  unknown                                                 107   2e-25   Medicago truncatula
gb|EPS70008.1|  hypothetical protein M569_04755                         106   2e-25   Genlisea aurea
gb|KGN52590.1|  hypothetical protein Csa_5G645150                       104   4e-25   Cucumis sativus [cucumbers]
gb|ACU16989.1|  unknown                                                 104   5e-25   Glycine max [soybeans]
ref|XP_010999645.1|  PREDICTED: methylesterase 17                       105   5e-25   Populus euphratica
gb|KJB60171.1|  hypothetical protein B456_009G292500                    105   7e-25   Gossypium raimondii
ref|XP_004141511.1|  PREDICTED: methylesterase 17-like                  105   8e-25   Cucumis sativus [cucumbers]
ref|XP_003523290.1|  PREDICTED: methylesterase 17 isoformX2             103   8e-25   
ref|XP_004167241.1|  PREDICTED: LOW QUALITY PROTEIN: methylestera...    105   8e-25   
ref|XP_006578847.1|  PREDICTED: methylesterase 17 isoform X3            105   9e-25   Glycine max [soybeans]
ref|XP_003523289.1|  PREDICTED: methylesterase 17 isoformX1             105   9e-25   Glycine max [soybeans]
ref|XP_009362773.1|  PREDICTED: methylesterase 17                       105   1e-24   Pyrus x bretschneideri [bai li]
ref|XP_002325617.2|  hydrolase family protein                           104   2e-24   Populus trichocarpa [western balsam poplar]
ref|XP_008388372.1|  PREDICTED: methylesterase 17-like                  104   2e-24   Malus domestica [apple tree]
ref|XP_011084804.1|  PREDICTED: methylesterase 17 isoform X2            104   2e-24   Sesamum indicum [beniseed]
ref|NP_001237523.1|  uncharacterized protein LOC100527539               104   2e-24   
emb|CAN78031.1|  hypothetical protein VITISV_017532                     103   3e-24   Vitis vinifera
ref|XP_002281126.1|  PREDICTED: methylesterase 17                       103   3e-24   Vitis vinifera
ref|XP_010244542.1|  PREDICTED: methylesterase 17-like                  103   4e-24   Nelumbo nucifera [Indian lotus]
ref|XP_009603473.1|  PREDICTED: methylesterase 17-like                  100   4e-24   
ref|XP_010252030.1|  PREDICTED: methylesterase 17-like isoform X2       101   7e-24   
ref|XP_011084803.1|  PREDICTED: methylesterase 17 isoform X1            102   1e-23   Sesamum indicum [beniseed]
ref|XP_010252032.1|  PREDICTED: methylesterase 17-like isoform X3       100   1e-23   
ref|XP_010067632.1|  PREDICTED: methylesterase 17                       101   3e-23   Eucalyptus grandis [rose gum]
ref|XP_010252029.1|  PREDICTED: methylesterase 17-like isoform X1       101   3e-23   Nelumbo nucifera [Indian lotus]
gb|AFK43530.1|  unknown                                                 100   4e-23   Lotus japonicus
ref|XP_009784670.1|  PREDICTED: methylesterase 17-like                  100   7e-23   Nicotiana sylvestris
ref|XP_004307746.1|  PREDICTED: methylesterase 17                     99.4    2e-22   Fragaria vesca subsp. vesca
ref|XP_007136407.1|  hypothetical protein PHAVU_009G042400g           99.0    2e-22   Phaseolus vulgaris [French bean]
ref|XP_006367441.1|  PREDICTED: methylesterase 17-like                97.4    6e-22   Solanum tuberosum [potatoes]
ref|XP_009146797.1|  PREDICTED: methylesterase 17                     97.1    9e-22   Brassica rapa
emb|CDY65415.1|  BnaCnng46980D                                        97.1    9e-22   Brassica napus [oilseed rape]
emb|CDY08569.1|  BnaA05g28050D                                        97.1    1e-21   Brassica napus [oilseed rape]
ref|XP_004294719.1|  PREDICTED: methylesterase 17-like                96.3    2e-21   Fragaria vesca subsp. vesca
gb|EYU35190.1|  hypothetical protein MIMGU_mgv1a010972mg              95.9    3e-21   Erythranthe guttata [common monkey flower]
ref|XP_009354983.1|  PREDICTED: methylesterase 17-like                95.1    6e-21   Pyrus x bretschneideri [bai li]
ref|XP_004235449.1|  PREDICTED: methylesterase 17-like                94.4    9e-21   Solanum lycopersicum
ref|XP_011041773.1|  PREDICTED: methylesterase 17-like                94.0    9e-21   Populus euphratica
ref|XP_004240843.1|  PREDICTED: methylesterase 17                     94.0    1e-20   Solanum lycopersicum
ref|XP_006376561.1|  hypothetical protein POPTR_0013s15410g           92.4    1e-20   
ref|XP_002326065.1|  Chain A family protein                           93.6    2e-20   Populus trichocarpa [western balsam poplar]
ref|XP_006298200.1|  hypothetical protein CARUB_v10014251mg           94.0    2e-20   
gb|KHF99571.1|  Pheophorbidase                                        93.2    2e-20   Gossypium arboreum [tree cotton]
gb|KJB20515.1|  hypothetical protein B456_003G152800                  90.5    2e-20   Gossypium raimondii
ref|XP_006376560.1|  hypothetical protein POPTR_0013s15410g           92.0    3e-20   
ref|XP_006376559.1|  hypothetical protein POPTR_0013s15410g           92.4    4e-20   
gb|ABK95513.1|  unknown                                               92.4    4e-20   Populus trichocarpa [western balsam poplar]
ref|XP_002884817.1|  hypothetical protein ARALYDRAFT_478421           92.4    4e-20   Arabidopsis lyrata subsp. lyrata
gb|ABK95809.1|  unknown                                               92.4    4e-20   Populus trichocarpa [western balsam poplar]
ref|XP_008245182.1|  PREDICTED: methylesterase 17                     92.0    5e-20   
ref|XP_009626844.1|  PREDICTED: methylesterase 17                     92.4    5e-20   Nicotiana tomentosiformis
ref|XP_007205683.1|  hypothetical protein PRUPE_ppa009635mg           92.0    6e-20   Prunus persica
ref|XP_010486708.1|  PREDICTED: methylesterase 17                     90.9    1e-19   Camelina sativa [gold-of-pleasure]
emb|CDY36279.1|  BnaA01g31390D                                        90.9    2e-19   Brassica napus [oilseed rape]
gb|KDO60409.1|  hypothetical protein CISIN_1g022603mg                 89.7    2e-19   Citrus sinensis [apfelsine]
ref|XP_010491291.1|  PREDICTED: methylesterase 17-like                90.9    2e-19   Camelina sativa [gold-of-pleasure]
ref|NP_187698.1|  methyl esterase 17                                  90.9    2e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009122575.1|  PREDICTED: methylesterase 17                     90.5    2e-19   Brassica rapa
ref|XP_010464778.1|  PREDICTED: methylesterase 17-like                90.1    3e-19   Camelina sativa [gold-of-pleasure]
ref|XP_010670053.1|  PREDICTED: methylesterase 17                     90.1    3e-19   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006357300.1|  PREDICTED: methylesterase 17-like                89.4    5e-19   Solanum tuberosum [potatoes]
gb|KDO60408.1|  hypothetical protein CISIN_1g022603mg                 89.4    5e-19   Citrus sinensis [apfelsine]
ref|XP_009777586.1|  PREDICTED: methylesterase 17-like                89.0    9e-19   Nicotiana sylvestris
ref|XP_006443782.1|  hypothetical protein CICLE_v10021442mg           88.6    1e-18   Citrus clementina [clementine]
gb|ABA95647.1|  hypothetical protein LOC_Os12g02510                   85.9    1e-18   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009406049.1|  PREDICTED: methylesterase 17-like                87.8    2e-18   Musa acuminata subsp. malaccensis [pisang utan]
gb|EEC68737.1|  hypothetical protein OsI_37244                        87.0    3e-18   Oryza sativa Indica Group [Indian rice]
gb|EEE52649.1|  hypothetical protein OsJ_35011                        87.0    3e-18   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001065998.2|  Os12g0117200                                     87.0    3e-18   
ref|XP_006407497.1|  hypothetical protein EUTSA_v10021291mg           87.0    4e-18   Eutrema salsugineum [saltwater cress]
ref|XP_010931511.1|  PREDICTED: methylesterase 17-like                86.7    5e-18   Elaeis guineensis
ref|NP_001065594.1|  Os11g0118000                                     86.3    5e-18   
gb|EEC67553.1|  hypothetical protein OsI_34886                        86.3    5e-18   Oryza sativa Indica Group [Indian rice]
ref|XP_006662681.1|  PREDICTED: methylesterase 17-like                86.3    7e-18   Oryza brachyantha
ref|XP_006574372.1|  PREDICTED: uncharacterized protein LOC100527...  85.9    9e-18   
ref|XP_004978521.1|  PREDICTED: methylesterase 17-like                85.5    1e-17   Setaria italica
ref|XP_010094434.1|  hypothetical protein L484_018804                 87.4    1e-17   
ref|XP_004977392.1|  PREDICTED: methylesterase 17-like                85.1    1e-17   Setaria italica
gb|KHN19243.1|  Pheophorbidase                                        85.5    1e-17   Glycine soja [wild soybean]
gb|KFK38476.1|  hypothetical protein AALP_AA3G117800                  85.5    2e-17   Arabis alpina [alpine rockcress]
ref|XP_002448907.1|  hypothetical protein SORBIDRAFT_05g001250        85.1    2e-17   
ref|XP_008788157.1|  PREDICTED: methylesterase 17                     84.7    2e-17   Phoenix dactylifera
ref|XP_008669935.1|  PREDICTED: methylesterase 17-like isoform X2     83.6    2e-17   
ref|XP_008669934.1|  PREDICTED: methylesterase 17-like isoform X1     84.0    4e-17   Zea mays [maize]
gb|EMS56887.1|  hypothetical protein TRIUR3_06889                     84.0    5e-17   Triticum urartu
ref|NP_001152091.1|  esterase PIR7A                                   82.4    1e-16   Zea mays [maize]
ref|XP_003577845.1|  PREDICTED: methylesterase 17-like                81.3    3e-16   Brachypodium distachyon [annual false brome]
gb|EMT23896.1|  hypothetical protein F775_02537                       81.3    3e-16   
ref|NP_001239778.1|  uncharacterized protein LOC100803613             81.3    4e-16   Glycine max [soybeans]
ref|XP_006842543.1|  hypothetical protein AMTR_s00077p00129970        80.5    8e-16   Amborella trichopoda
ref|XP_006851246.1|  hypothetical protein AMTR_s00180p00034130        79.0    2e-15   Amborella trichopoda
ref|XP_006842541.1|  hypothetical protein AMTR_s00077p00129560        77.4    7e-15   
ref|XP_006842540.1|  hypothetical protein AMTR_s00077p00129020        77.4    9e-15   Amborella trichopoda
emb|CDP19580.1|  unnamed protein product                              76.6    2e-14   Coffea canephora [robusta coffee]
ref|XP_002313085.2|  hypothetical protein POPTR_0009s11070g           76.3    3e-14   Populus trichocarpa [western balsam poplar]
ref|XP_006379213.1|  hypothetical protein POPTR_0009s11050g           76.3    3e-14   
ref|XP_002313084.2|  hypothetical protein POPTR_0009s11040g           75.9    3e-14   Populus trichocarpa [western balsam poplar]
ref|XP_006843726.1|  hypothetical protein AMTR_s00007p00221390        75.5    4e-14   
gb|ABK26618.1|  unknown                                               74.7    9e-14   Picea sitchensis
emb|CDP19577.1|  unnamed protein product                              73.9    2e-13   Coffea canephora [robusta coffee]
ref|XP_006847411.1|  hypothetical protein AMTR_s00153p00056390        73.6    2e-13   
emb|CDP19578.1|  unnamed protein product                              73.6    2e-13   Coffea canephora [robusta coffee]
ref|XP_010938436.1|  PREDICTED: salicylic acid-binding protein 2-...  73.2    3e-13   Elaeis guineensis
ref|XP_002522351.1|  conserved hypothetical protein                   72.8    3e-13   
gb|ABK23030.1|  unknown                                               73.2    3e-13   Picea sitchensis
ref|XP_002866256.1|  hydrolase, alpha/beta fold family protein        72.8    3e-13   
emb|CDY50844.1|  BnaC08g47900D                                        72.8    3e-13   Brassica napus [oilseed rape]
ref|XP_003565022.2|  PREDICTED: esterase PIR7B-like                   72.8    4e-13   Brachypodium distachyon [annual false brome]
gb|ABK21272.1|  unknown                                               72.8    4e-13   Picea sitchensis
ref|XP_008789941.1|  PREDICTED: probable esterase PIR7A               72.8    4e-13   Phoenix dactylifera
ref|NP_200639.1|  methyl esterase 18                                  72.4    5e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008241857.1|  PREDICTED: LOW QUALITY PROTEIN: methylestera...  72.4    5e-13   
ref|XP_008810786.1|  PREDICTED: polyneuridine-aldehyde esterase-l...  72.4    5e-13   Phoenix dactylifera
emb|CDP10786.1|  unnamed protein product                              72.4    5e-13   Coffea canephora [robusta coffee]
ref|XP_011099230.1|  PREDICTED: salicylic acid-binding protein 2-...  72.4    6e-13   Sesamum indicum [beniseed]
ref|XP_006346482.1|  PREDICTED: polyneuridine-aldehyde esterase-like  72.4    6e-13   Solanum tuberosum [potatoes]
ref|XP_007199380.1|  hypothetical protein PRUPE_ppa025654mg           72.0    6e-13   
ref|XP_010543669.1|  PREDICTED: methylesterase 17                     72.4    7e-13   Tarenaya hassleriana [spider flower]
ref|XP_007200132.1|  hypothetical protein PRUPE_ppa017362mg           72.0    8e-13   
ref|XP_010921787.1|  PREDICTED: probable esterase PIR7A               72.0    8e-13   Elaeis guineensis
ref|XP_008810785.1|  PREDICTED: salicylic acid-binding protein 2-...  72.0    8e-13   Phoenix dactylifera
ref|XP_009383535.1|  PREDICTED: probable esterase PIR7A               72.0    9e-13   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002973861.1|  hypothetical protein SELMODRAFT_100200           72.0    9e-13   
ref|XP_002983529.1|  hypothetical protein SELMODRAFT_118270           72.0    9e-13   
pdb|2WFL|B  Chain B, Crystal Structure Of Polyneuridine Aldehyde ...  71.6    9e-13   Rauvolfia serpentina [devilpepper]
ref|XP_010026414.1|  PREDICTED: salicylic acid-binding protein 2-...  71.6    9e-13   Eucalyptus grandis [rose gum]
emb|CDY53646.1|  BnaA08g30360D                                        71.6    1e-12   Brassica napus [oilseed rape]
ref|XP_010263778.1|  PREDICTED: methylesterase 10-like                71.6    1e-12   Nelumbo nucifera [Indian lotus]
pdb|3GZJ|A  Chain A, Crystal Structure Of Polyneuridine Aldehyde ...  71.6    1e-12   Rauvolfia serpentina [devilpepper]
pdb|2WFL|A  Chain A, Crystal Structure Of Polyneuridine Aldehyde ...  71.6    1e-12   Rauvolfia serpentina [devilpepper]
ref|XP_009391582.1|  PREDICTED: probable esterase PIR7A               71.6    1e-12   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010527077.1|  PREDICTED: pheophorbidase isoform X2             71.2    1e-12   Tarenaya hassleriana [spider flower]
ref|XP_006288495.1|  hypothetical protein CARUB_v10001760mg           71.2    1e-12   Capsella rubella
ref|XP_009123030.1|  PREDICTED: pheophorbidase-like                   71.2    1e-12   Brassica rapa
pdb|2WFM|A  Chain A, Crystal Structure Of Polyneuridine Aldehyde ...  71.2    1e-12   Rauvolfia serpentina [devilpepper]
sp|Q9SE93.1|PNAE_RAUSE  RecName: Full=Polyneuridine-aldehyde este...  71.2    1e-12   Rauvolfia serpentina [devilpepper]
ref|XP_007156846.1|  hypothetical protein PHAVU_002G022300g           71.2    1e-12   Phaseolus vulgaris [French bean]
ref|XP_004300554.1|  PREDICTED: probable esterase PIR7A isoform X1    71.6    1e-12   Fragaria vesca subsp. vesca
ref|XP_001772896.1|  predicted protein                                71.2    2e-12   
ref|XP_006346533.1|  PREDICTED: methylesterase 10-like                71.2    2e-12   
ref|NP_001176321.1|  Os11g0117900                                     69.7    2e-12   
ref|XP_010527076.1|  PREDICTED: pheophorbidase isoform X1             71.2    2e-12   Tarenaya hassleriana [spider flower]
emb|CDP02455.1|  unnamed protein product                              70.9    2e-12   Coffea canephora [robusta coffee]
ref|XP_007047137.1|  Methyl esterase 1, putative                      70.9    2e-12   
ref|XP_004301853.2|  PREDICTED: probable esterase PIR7A               71.2    2e-12   Fragaria vesca subsp. vesca
ref|XP_004304220.1|  PREDICTED: putative methylesterase 11, chlor...  72.4    2e-12   Fragaria vesca subsp. vesca
gb|EEE51534.1|  hypothetical protein OsJ_32736                        70.9    2e-12   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010527079.1|  PREDICTED: pheophorbidase isoform X3             70.9    2e-12   Tarenaya hassleriana [spider flower]
ref|XP_008241568.1|  PREDICTED: methylesterase 10-like                70.5    2e-12   Prunus mume [ume]
ref|XP_004230826.1|  PREDICTED: polyneuridine-aldehyde esterase       70.5    2e-12   
gb|KDP31868.1|  hypothetical protein JCGZ_12329                       70.5    2e-12   Jatropha curcas
emb|CDP11927.1|  unnamed protein product                              70.5    2e-12   Coffea canephora [robusta coffee]
ref|XP_003567442.1|  PREDICTED: probable esterase PIR7A               70.5    3e-12   Brachypodium distachyon [annual false brome]
ref|XP_009145604.1|  PREDICTED: pheophorbidase                        70.5    3e-12   Brassica rapa
emb|CDM82835.1|  unnamed protein product                              70.5    3e-12   Triticum aestivum [Canadian hard winter wheat]
ref|XP_004514835.1|  PREDICTED: putative methylesterase 11, chlor...  71.6    3e-12   Cicer arietinum [garbanzo]
gb|AGV54148.1|  polyneuridine-aldehyde esterase                       70.5    3e-12   Rauvolfia yunnanensis
ref|XP_004233422.1|  PREDICTED: salicylic acid-binding protein 2-...  70.5    3e-12   Solanum lycopersicum
gb|ABA91258.1|  hydrolase, alpha/beta fold family protein, expressed  70.1    3e-12   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006401106.1|  hypothetical protein EUTSA_v10014415mg           70.1    3e-12   Eutrema salsugineum [saltwater cress]
ref|XP_009366292.1|  PREDICTED: polyneuridine-aldehyde esterase-like  68.9    3e-12   Pyrus x bretschneideri [bai li]
emb|CAC82615.1|  hypothetical protein                                 70.1    3e-12   Capsella rubella
ref|XP_009376503.1|  PREDICTED: probable esterase PIR7A               70.5    4e-12   Pyrus x bretschneideri [bai li]
ref|XP_006436459.1|  hypothetical protein CICLE_v10032394mg           70.1    4e-12   Citrus clementina [clementine]
ref|XP_009341927.1|  PREDICTED: probable esterase PIR7A               70.1    4e-12   Pyrus x bretschneideri [bai li]
gb|AGV54684.1|  polyneuridine-aldehyde esterase                       69.7    4e-12   Phaseolus vulgaris [French bean]
ref|XP_004512217.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...  72.8    4e-12   
ref|XP_007151829.1|  hypothetical protein PHAVU_004G078700g           69.7    4e-12   Phaseolus vulgaris [French bean]
emb|CDY32712.1|  BnaA02g07740D                                        70.1    4e-12   Brassica napus [oilseed rape]
ref|XP_010683183.1|  PREDICTED: salicylic acid-binding protein 2-...  70.1    4e-12   Beta vulgaris subsp. vulgaris [field beet]
gb|KDP31864.1|  hypothetical protein JCGZ_12325                       69.7    4e-12   Jatropha curcas
emb|CDY40511.1|  BnaC01g20010D                                        69.7    4e-12   Brassica napus [oilseed rape]
ref|XP_010939193.1|  PREDICTED: putative methylesterase 11, chlor...  71.2    4e-12   Elaeis guineensis
ref|XP_006360242.1|  PREDICTED: salicylic acid-binding protein 2-...  69.7    4e-12   Solanum tuberosum [potatoes]
pdb|3STY|A  Chain A, Crystal Structure Of Tomato Methylketone Syn...  69.7    4e-12   Lycopersicon hirsutum f. glabratum
ref|XP_004142015.1|  PREDICTED: salicylic acid-binding protein 2-...  70.1    4e-12   Cucumis sativus [cucumbers]
ref|XP_007200274.1|  hypothetical protein PRUPE_ppa014939mg           69.7    4e-12   
ref|XP_002981647.1|  hypothetical protein SELMODRAFT_114920           69.7    5e-12   Selaginella moellendorffii
ref|XP_008440235.1|  PREDICTED: methylesterase 10                     69.7    5e-12   Cucumis melo [Oriental melon]
ref|XP_007203473.1|  hypothetical protein PRUPE_ppa024619mg           69.7    5e-12   
gb|AFK46482.1|  unknown                                               71.2    5e-12   Medicago truncatula
ref|XP_002459048.1|  hypothetical protein SORBIDRAFT_03g045080        69.7    5e-12   
ref|XP_006436460.1|  hypothetical protein CICLE_v10032396mg           69.7    5e-12   Citrus clementina [clementine]
ref|XP_002967870.1|  hypothetical protein SELMODRAFT_88885            69.7    5e-12   Selaginella moellendorffii
gb|AFW84029.1|  hypothetical protein ZEAMMB73_457200                  67.4    5e-12   
ref|XP_010255102.1|  PREDICTED: methylesterase 10                     69.7    5e-12   Nelumbo nucifera [Indian lotus]
gb|KDP31871.1|  hypothetical protein JCGZ_12332                       69.7    5e-12   Jatropha curcas
ref|XP_008440234.1|  PREDICTED: salicylic acid-binding protein 2-...  69.7    5e-12   Cucumis melo [Oriental melon]
gb|AAV87156.1|  MKS1                                                  69.7    5e-12   Lycopersicon hirsutum f. glabratum
ref|XP_007215535.1|  hypothetical protein PRUPE_ppa007173mg           70.9    6e-12   Prunus persica
ref|XP_008785612.1|  PREDICTED: putative methylesterase 11, chlor...  70.9    6e-12   Phoenix dactylifera
ref|XP_010028525.1|  PREDICTED: putative inactive methylesterase 20   68.6    6e-12   
ref|XP_008230905.1|  PREDICTED: putative methylesterase 11, chlor...  70.9    6e-12   Prunus mume [ume]
ref|XP_006845891.1|  hypothetical protein AMTR_s00154p00089740        70.9    6e-12   Amborella trichopoda
gb|EEC67552.1|  hypothetical protein OsI_34885                        69.3    6e-12   Oryza sativa Indica Group [Indian rice]
ref|XP_010453481.1|  PREDICTED: methylesterase 18                     69.3    6e-12   Camelina sativa [gold-of-pleasure]
ref|NP_001065997.1|  Os12g0117100                                     69.3    6e-12   
ref|XP_010483409.1|  PREDICTED: methylesterase 18-like                69.3    6e-12   Camelina sativa [gold-of-pleasure]
ref|XP_011039237.1|  PREDICTED: salicylic acid-binding protein 2-...  69.3    7e-12   Populus euphratica
gb|ADK38535.1|  methylketone synthase I                               69.3    7e-12   Lycopersicon hirsutum f. glabratum
ref|XP_010491695.1|  PREDICTED: alpha-hydroxynitrile lyase-like       69.3    7e-12   Camelina sativa [gold-of-pleasure]
pdb|3STX|A  Chain A, Crystal Structure Of Tomato Methylketone Syn...  69.3    7e-12   Lycopersicon hirsutum f. glabratum
ref|XP_002522352.1|  Polyneuridine-aldehyde esterase precursor, p...  69.3    7e-12   Ricinus communis
pdb|3STT|A  Chain A, Crystal Structure Of Tomato Methylketone Syn...  69.3    7e-12   Lycopersicon hirsutum f. glabratum
ref|XP_004234677.1|  PREDICTED: methylesterase 3-like isoform X2      68.9    7e-12   Solanum lycopersicum
dbj|BAJ99976.1|  predicted protein                                    69.3    7e-12   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006279686.1|  hypothetical protein CARUB_v10027010mg           68.9    7e-12   
ref|XP_002519158.1|  hypothetical protein RCOM_0939800                67.4    7e-12   
ref|XP_010921789.1|  PREDICTED: esterase PIR7B-like isoform X2        68.9    7e-12   Elaeis guineensis
ref|XP_011039238.1|  PREDICTED: salicylic acid-binding protein 2-...  68.9    7e-12   Populus euphratica
gb|KDO48825.1|  hypothetical protein CISIN_1g030815mg                 68.6    8e-12   Citrus sinensis [apfelsine]
gb|EEC68736.1|  hypothetical protein OsI_37243                        69.3    8e-12   Oryza sativa Indica Group [Indian rice]
ref|NP_001151405.1|  esterase PIR7B                                   69.3    8e-12   Zea mays [maize]
emb|CDY71711.1|  BnaAnng38540D                                        68.9    8e-12   Brassica napus [oilseed rape]
ref|XP_011039236.1|  PREDICTED: salicylic acid-binding protein 2-...  68.9    8e-12   Populus euphratica
ref|XP_004234676.1|  PREDICTED: salicylic acid-binding protein 2-...  68.9    8e-12   Solanum lycopersicum
ref|XP_002448906.1|  hypothetical protein SORBIDRAFT_05g001240        68.9    8e-12   
ref|XP_011039239.1|  PREDICTED: salicylic acid-binding protein 2-...  68.9    8e-12   Populus euphratica
ref|XP_002310168.2|  Chain A family protein                           68.6    8e-12   
ref|XP_002310757.2|  Chain A family protein                           68.9    8e-12   
ref|XP_006380731.1|  hypothetical protein POPTR_0007s11700g           68.9    8e-12   
ref|XP_006380730.1|  hypothetical protein POPTR_0007s11690g           68.9    8e-12   Populus trichocarpa [western balsam poplar]
ref|XP_010440115.1|  PREDICTED: probable pheophorbidase isoform X2    68.6    9e-12   Camelina sativa [gold-of-pleasure]
ref|XP_007042334.1|  Methyl esterase 10, putative isoform 2           68.6    9e-12   
ref|XP_008800037.1|  PREDICTED: probable esterase PIR7A               68.9    9e-12   
ref|XP_006437909.1|  hypothetical protein CICLE_v10033488mg           70.5    9e-12   Citrus clementina [clementine]
ref|XP_002459049.1|  hypothetical protein SORBIDRAFT_03g045090        68.9    9e-12   Sorghum bicolor [broomcorn]
ref|XP_010449732.1|  PREDICTED: probable pheophorbidase               68.9    9e-12   Camelina sativa [gold-of-pleasure]
ref|XP_010921788.1|  PREDICTED: probable esterase PIR7A isoform X1    68.9    9e-12   Elaeis guineensis
emb|CDY02809.1|  BnaC02g10800D                                        68.9    1e-11   
gb|ABK26277.1|  unknown                                               68.9    1e-11   Picea sitchensis
ref|XP_007204507.1|  hypothetical protein PRUPE_ppa019104mg           68.6    1e-11   
ref|XP_002522346.1|  Polyneuridine-aldehyde esterase precursor, p...  68.9    1e-11   
gb|KDO70337.1|  hypothetical protein CISIN_1g016141mg                 70.5    1e-11   Citrus sinensis [apfelsine]
ref|XP_007047141.1|  Methyl esterase 3, putative                      68.6    1e-11   Theobroma cacao [chocolate]
ref|XP_006485625.1|  PREDICTED: methylesterase 1-like                 68.9    1e-11   Citrus sinensis [apfelsine]
gb|ABR17565.1|  unknown                                               68.9    1e-11   Picea sitchensis
gb|KDP41318.1|  hypothetical protein JCGZ_15725                       70.1    1e-11   Jatropha curcas
ref|XP_010440114.1|  PREDICTED: probable pheophorbidase isoform X1    68.2    1e-11   
ref|XP_010921786.1|  PREDICTED: probable esterase PIR7A               69.3    1e-11   
ref|XP_010030657.1|  PREDICTED: probable esterase PIR7A               68.9    1e-11   Eucalyptus grandis [rose gum]
gb|KHN14024.1|  Putative esterase                                     69.7    1e-11   Glycine soja [wild soybean]
ref|XP_010440116.1|  PREDICTED: probable pheophorbidase isoform X3    67.8    1e-11   
ref|XP_007047142.1|  Methyl esterase 6, putative                      68.6    1e-11   
ref|XP_010089652.1|  hypothetical protein L484_021045                 70.1    1e-11   
ref|XP_006584519.1|  PREDICTED: uncharacterized protein LOC100526...  69.7    1e-11   
ref|XP_009126767.1|  PREDICTED: methylesterase 18                     68.2    1e-11   Brassica rapa
ref|NP_001147011.1|  esterase PIR7B                                   68.2    1e-11   
gb|EYU44209.1|  hypothetical protein MIMGU_mgv1a008225mg              69.7    1e-11   Erythranthe guttata [common monkey flower]
sp|Q2V0W1.1|PPD_RAPSA  RecName: Full=Pheophorbidase; Short=RsPPD      68.2    1e-11   Raphanus sativus
ref|XP_009376486.1|  PREDICTED: salicylic acid-binding protein 2-...  68.2    1e-11   Pyrus x bretschneideri [bai li]
ref|XP_011099841.1|  PREDICTED: salicylic acid-binding protein 2-...  68.2    2e-11   
ref|XP_001774530.1|  predicted protein                                68.2    2e-11   
ref|XP_008389409.1|  PREDICTED: putative methylesterase 11, chlor...  69.7    2e-11   
ref|XP_009356419.1|  PREDICTED: putative methylesterase 11, chlor...  69.7    2e-11   Pyrus x bretschneideri [bai li]
ref|XP_003611833.1|  Polyneuridine-aldehyde esterase                  68.2    2e-11   
gb|KCW55275.1|  hypothetical protein EUGRSUZ_I01202                   68.6    2e-11   Eucalyptus grandis [rose gum]
ref|XP_008341788.1|  PREDICTED: putative methylesterase 11, chlor...  69.7    2e-11   
ref|XP_004231413.1|  PREDICTED: polyneuridine-aldehyde esterase       68.2    2e-11   
ref|XP_008241566.1|  PREDICTED: methylesterase 3-like                 68.6    2e-11   Prunus mume [ume]
ref|NP_001233813.1|  methylesterase                                   68.2    2e-11   
ref|XP_002459047.1|  hypothetical protein SORBIDRAFT_03g045070        68.2    2e-11   
ref|XP_004977391.1|  PREDICTED: methylesterase 17-like                68.2    2e-11   
gb|EEE63482.1|  hypothetical protein OsJ_18296                        67.0    2e-11   
ref|XP_006365368.1|  PREDICTED: salicylic acid-binding protein 2 ...  67.8    2e-11   
ref|XP_007042333.1|  Methyl esterase 10, putative isoform 1           68.6    2e-11   
gb|KDO48824.1|  hypothetical protein CISIN_1g024134mg                 68.2    2e-11   
ref|XP_008810789.1|  PREDICTED: putative inactive methylesterase 20   67.8    2e-11   
gb|AAV31235.1|  hypothetical protein                                  67.4    2e-11   
ref|XP_006346488.1|  PREDICTED: polyneuridine-aldehyde esterase-like  68.2    2e-11   
ref|XP_006431314.1|  hypothetical protein CICLE_v10011905mg           67.8    2e-11   
ref|NP_001275411.1|  methyl jasmonate esterase                        67.8    2e-11   
gb|KCW55271.1|  hypothetical protein EUGRSUZ_I01198                   68.2    2e-11   
ref|XP_008361380.1|  PREDICTED: salicylic acid-binding protein 2-...  67.8    2e-11   
gb|AGV54480.1|  polyneuridine-aldehyde esterase-like protein          67.8    2e-11   
ref|XP_011099228.1|  PREDICTED: salicylic acid-binding protein 2-...  67.8    2e-11   
ref|XP_006431315.1|  hypothetical protein CICLE_v10011905mg           68.6    2e-11   
gb|EAY97783.1|  hypothetical protein OsI_19696                        66.6    2e-11   
ref|XP_009628221.1|  PREDICTED: putative methylesterase 11, chlor...  68.9    2e-11   
ref|XP_009145833.1|  PREDICTED: methylesterase 3-like                 68.2    3e-11   
ref|XP_010936456.1|  PREDICTED: putative methylesterase 11, chlor...  69.3    3e-11   
ref|XP_010443550.1|  PREDICTED: methylesterase 18-like                67.8    3e-11   
ref|XP_006431316.1|  hypothetical protein CICLE_v10011905mg           68.9    3e-11   
ref|XP_010434787.1|  PREDICTED: probable pheophorbidase isoform X2    67.8    3e-11   
ref|XP_002869011.1|  hypothetical protein ARALYDRAFT_490932           67.4    3e-11   
ref|XP_006842542.1|  hypothetical protein AMTR_s00077p00129730        66.2    3e-11   
ref|XP_010434786.1|  PREDICTED: probable pheophorbidase isoform X1    67.4    3e-11   
ref|XP_006431317.1|  hypothetical protein CICLE_v10011905mg           68.9    3e-11   
gb|KCW59297.1|  hypothetical protein EUGRSUZ_H01977                   67.0    3e-11   
ref|XP_008379871.1|  PREDICTED: LOW QUALITY PROTEIN: putative met...  69.7    3e-11   
ref|XP_004297226.1|  PREDICTED: putative methylesterase 13, chlor...  68.9    3e-11   
ref|XP_008236705.1|  PREDICTED: esterase PIR7B-like                   67.8    3e-11   
ref|XP_011099026.1|  PREDICTED: putative methylesterase 11, chlor...  68.9    3e-11   
ref|XP_006365366.1|  PREDICTED: salicylic acid-binding protein 2-...  67.4    3e-11   
ref|XP_006346487.1|  PREDICTED: polyneuridine-aldehyde esterase-like  67.8    3e-11   
ref|XP_006365378.1|  PREDICTED: salicylic acid-binding protein 2-...  66.6    3e-11   
ref|XP_002459046.1|  hypothetical protein SORBIDRAFT_03g045060        67.0    3e-11   
ref|XP_009628220.1|  PREDICTED: putative methylesterase 11, chlor...  68.9    4e-11   
ref|XP_009365968.1|  PREDICTED: putative methylesterase 11, chlor...  68.6    4e-11   
ref|XP_008241854.1|  PREDICTED: salicylic acid-binding protein 2-...  67.4    4e-11   
ref|XP_007047146.1|  Methyl esterase 10, putative                     67.0    4e-11   
ref|XP_002868108.1|  esterase/lipase/thioesterase family protein      67.4    4e-11   
ref|XP_006436461.1|  hypothetical protein CICLE_v10033393mg           67.4    4e-11   
ref|XP_008241567.1|  PREDICTED: salicylic acid-binding protein 2-...  67.4    4e-11   
ref|XP_008243834.1|  PREDICTED: putative methylesterase 11, chlor...  68.6    4e-11   
gb|KDP31866.1|  hypothetical protein JCGZ_12327                       67.0    4e-11   
dbj|BAJ88088.1|  predicted protein                                    68.6    4e-11   
ref|XP_008810745.1|  PREDICTED: putative methylesterase 11, chlor...  68.6    4e-11   
ref|NP_001045314.1|  Os01g0934700                                     67.0    4e-11   
ref|XP_007203427.1|  hypothetical protein PRUPE_ppa021591mg           67.0    5e-11   
ref|XP_009769295.1|  PREDICTED: putative methylesterase 11, chlor...  68.6    5e-11   
ref|XP_004300557.1|  PREDICTED: salicylic acid-binding protein 2-...  67.4    5e-11   
gb|ACH63241.1|  ethylene esterase-like protein                        67.0    5e-11   
ref|XP_007202197.1|  hypothetical protein PRUPE_ppa018866mg           66.6    5e-11   
ref|XP_008459228.1|  PREDICTED: salicylic acid-binding protein 2-...  67.4    5e-11   
ref|XP_007223024.1|  hypothetical protein PRUPE_ppa006887mg           68.2    5e-11   
ref|XP_009589631.1|  PREDICTED: putative methylesterase 11, chlor...  68.2    5e-11   
gb|EMT28094.1|  hypothetical protein F775_16610                       67.8    5e-11   
ref|XP_007047136.1|  Methyl esterase 10, putative                     66.6    5e-11   
ref|XP_008674587.1|  PREDICTED: esterase PIR7B-like                   67.0    5e-11   
ref|XP_008459227.1|  PREDICTED: salicylic acid-binding protein 2-...  67.0    5e-11   
ref|XP_004300558.2|  PREDICTED: salicylic acid-binding protein 2-...  67.0    5e-11   
ref|XP_010070492.1|  PREDICTED: salicylic acid-binding protein 2-...  66.6    5e-11   
ref|XP_004233421.1|  PREDICTED: salicylic acid-binding protein 2      66.6    6e-11   
ref|XP_010422857.1|  PREDICTED: alpha-hydroxynitrile lyase            66.6    6e-11   
ref|NP_001168858.1|  uncharacterized protein LOC100382663             67.0    6e-11   
ref|XP_009588438.1|  PREDICTED: putative methylesterase 11, chlor...  68.6    6e-11   
gb|EPS63353.1|  hypothetical protein M569_11432                       66.6    6e-11   
ref|XP_007047143.1|  Salicylic acid-binding protein 2, putative       66.2    6e-11   
gb|KJB43607.1|  hypothetical protein B456_007G209600                  66.6    7e-11   
gb|EEC72109.1|  hypothetical protein OsI_05084                        66.6    7e-11   
ref|XP_006574732.1|  PREDICTED: salicylic acid-binding protein 2-...  66.6    7e-11   
ref|XP_010091589.1|  hypothetical protein L484_026437                 67.8    7e-11   
ref|XP_004161630.1|  PREDICTED: salicylic acid-binding protein 2-...  66.2    7e-11   
ref|XP_010918139.1|  PREDICTED: esterase PIR7B-like isoform X2        66.2    7e-11   
emb|CAB16781.1|  putative protein (partial)                           65.5    8e-11   
ref|XP_009612686.1|  PREDICTED: putative methylesterase 11, chlor...  67.8    8e-11   
ref|XP_006348679.1|  PREDICTED: putative methylesterase 11, chlor...  66.6    8e-11   
ref|XP_003635144.1|  PREDICTED: methylesterase 10-like                66.2    8e-11   
ref|XP_002533543.1|  Esterase PIR7B, putative                         67.8    8e-11   
ref|XP_010918137.1|  PREDICTED: probable esterase PIR7A isoform X1    66.6    8e-11   
gb|KHG11847.1|  Polyneuridine-aldehyde esterase                       66.2    9e-11   
gb|KCW55029.1|  hypothetical protein EUGRSUZ_I010052                  65.9    9e-11   
gb|KJB40233.1|  hypothetical protein B456_007G052800                  66.2    9e-11   
ref|XP_004167288.1|  PREDICTED: methylesterase 1-like                 66.2    9e-11   
ref|XP_004153672.1|  PREDICTED: salicylic acid-binding protein 2-...  65.9    9e-11   
ref|XP_009406309.1|  PREDICTED: putative methylesterase 11, chlor...  67.8    9e-11   
ref|XP_007139458.1|  hypothetical protein PHAVU_008G031400g           67.4    1e-10   
ref|XP_006338354.1|  PREDICTED: putative methylesterase 11, chlor...  67.4    1e-10   
ref|XP_009365910.1|  PREDICTED: putative methylesterase 11, chlor...  67.8    1e-10   
ref|XP_004232153.1|  PREDICTED: putative methylesterase 11, chlor...  67.4    1e-10   
ref|XP_002459051.1|  hypothetical protein SORBIDRAFT_03g045110        65.9    1e-10   
gb|KDP27262.1|  hypothetical protein JCGZ_19961                       67.4    1e-10   
ref|XP_006361568.1|  PREDICTED: polyneuridine-aldehyde esterase-like  65.9    1e-10   
ref|XP_006366937.1|  PREDICTED: polyneuridine-aldehyde esterase-like  65.9    1e-10   
ref|NP_001055352.1|  Os05g0370700                                     66.6    1e-10   
gb|KHN13537.1|  Putative esterase                                     67.4    1e-10   
ref|XP_009782139.1|  PREDICTED: putative methylesterase 11, chlor...  67.4    1e-10   
ref|XP_007045840.1|  Methyl esterase 15, putative isoform 2           67.8    1e-10   
ref|XP_007045839.1|  Methyl esterase 11, putative isoform 1           67.8    1e-10   
ref|XP_008241565.1|  PREDICTED: salicylic acid-binding protein 2-...  66.2    1e-10   
gb|KCW55258.1|  hypothetical protein EUGRSUZ_I01184                   65.9    1e-10   
ref|XP_003552586.1|  PREDICTED: putative methylesterase 11, chlor...  67.0    1e-10   
ref|XP_009616768.1|  PREDICTED: salicylic acid-binding protein 2-...  66.6    1e-10   
ref|XP_009798021.1|  PREDICTED: putative methylesterase 11, chlor...  67.8    1e-10   
gb|EEC79085.1|  hypothetical protein OsI_19694                        66.2    1e-10   
ref|XP_004141931.1|  PREDICTED: methylesterase 10-like                65.9    1e-10   
ref|XP_009800171.1|  PREDICTED: putative methylesterase 11, chlor...  67.4    1e-10   
ref|XP_004142016.1|  PREDICTED: methylesterase 2-like                 64.7    1e-10   
ref|XP_010255101.1|  PREDICTED: salicylic acid-binding protein 2-...  65.9    1e-10   
ref|XP_004142018.1|  PREDICTED: methylesterase 1-like                 65.5    1e-10   
ref|XP_006466659.1|  PREDICTED: salicylic acid-binding protein 2-...  65.9    1e-10   
ref|XP_006425816.1|  hypothetical protein CICLE_v10026277mg           65.9    1e-10   
ref|XP_002522349.1|  Polyneuridine-aldehyde esterase precursor, p...  65.5    1e-10   
gb|KFK27361.1|  hypothetical protein AALP_AA8G372900                  65.9    1e-10   
gb|ACU23966.1|  unknown                                               65.5    1e-10   
ref|XP_010026413.1|  PREDICTED: salicylic acid-binding protein 2-...  65.9    1e-10   
ref|XP_009376487.1|  PREDICTED: salicylic acid-binding protein 2-...  65.9    1e-10   
ref|XP_006284340.1|  hypothetical protein CARUB_v10005512mg           65.9    1e-10   
ref|XP_004243297.2|  PREDICTED: methylesterase 10-like                65.5    1e-10   
ref|XP_006366936.1|  PREDICTED: polyneuridine-aldehyde esterase-like  65.5    1e-10   
emb|CDM82837.1|  unnamed protein product                              65.5    1e-10   
ref|XP_002305386.1|  hypothetical protein POPTR_0004s11550g           67.0    1e-10   
ref|NP_001240864.1|  uncharacterized protein LOC100796281             65.5    1e-10   
ref|XP_006425815.1|  hypothetical protein CICLE_v10026277mg           65.9    1e-10   
ref|NP_195431.2|  putative inactive methylesterase 20                 64.3    1e-10   
ref|XP_004239042.1|  PREDICTED: putative methylesterase 11, chlor...  67.0    1e-10   
gb|KJB47436.1|  hypothetical protein B456_008G026500                  65.9    1e-10   
emb|CDO97130.1|  unnamed protein product                              65.9    1e-10   
ref|XP_010028516.1|  PREDICTED: salicylic acid-binding protein 2-...  65.9    1e-10   
ref|XP_007202449.1|  hypothetical protein PRUPE_ppa010011mg           65.5    2e-10   
gb|KJB40231.1|  hypothetical protein B456_007G052600                  65.5    2e-10   
gb|KHN13365.1|  Polyneuridine-aldehyde esterase                       65.5    2e-10   
emb|CDY65790.1|  BnaCnng48700D                                        65.9    2e-10   
ref|XP_011009242.1|  PREDICTED: putative methylesterase 11, chlor...  67.0    2e-10   
ref|XP_011009240.1|  PREDICTED: putative methylesterase 11, chlor...  67.0    2e-10   
ref|XP_002279659.2|  PREDICTED: putative methylesterase 11, chlor...  67.0    2e-10   
ref|XP_010070491.1|  PREDICTED: probable esterase PIR7A               65.5    2e-10   
ref|XP_009362000.1|  PREDICTED: methylesterase 7-like                 65.5    2e-10   
ref|XP_010030612.1|  PREDICTED: salicylic acid-binding protein 2-...  64.7    2e-10   
ref|XP_004161629.1|  PREDICTED: salicylic acid-binding protein 2-...  65.9    2e-10   
gb|EMT05820.1|  hypothetical protein F775_20033                       65.5    2e-10   
ref|XP_011099232.1|  PREDICTED: salicylic acid-binding protein 2-...  65.5    2e-10   
emb|CDM82846.1|  unnamed protein product                              65.5    2e-10   
gb|KHN00599.1|  Polyneuridine-aldehyde esterase                       65.5    2e-10   
gb|KDP31865.1|  hypothetical protein JCGZ_12326                       65.5    2e-10   
ref|XP_002869010.1|  hypothetical protein ARALYDRAFT_912657           65.5    2e-10   
ref|XP_008338217.1|  PREDICTED: salicylic acid-binding protein 2-...  65.5    2e-10   
gb|EMS52791.1|  hypothetical protein TRIUR3_30970                     65.5    2e-10   
emb|CAN66934.1|  hypothetical protein VITISV_003889                   67.0    2e-10   
ref|XP_006346532.1|  PREDICTED: LOW QUALITY PROTEIN: probable est...  65.5    2e-10   
gb|EMT21621.1|  hypothetical protein F775_21482                       65.5    2e-10   
gb|KCW59301.1|  hypothetical protein EUGRSUZ_H01982                   64.7    2e-10   
ref|XP_002323905.2|  hypothetical protein POPTR_0017s13080g           66.6    2e-10   
ref|XP_006399524.1|  hypothetical protein EUTSA_v10014451mg           65.1    2e-10   
emb|CDP02329.1|  unnamed protein product                              66.6    2e-10   
ref|XP_010028306.1|  PREDICTED: salicylic acid-binding protein 2-...  65.1    2e-10   
ref|XP_004153671.1|  PREDICTED: salicylic acid-binding protein 2-...  65.9    2e-10   
emb|CDJ26678.1|  unnamed protein product                              65.5    2e-10   
ref|XP_010477863.1|  PREDICTED: putative methylesterase 13, chlor...  67.0    2e-10   
ref|XP_008241571.1|  PREDICTED: LOW QUALITY PROTEIN: salicylic ac...  65.1    2e-10   
ref|XP_003635143.2|  PREDICTED: salicylic acid-binding protein 2-...  65.9    2e-10   
ref|XP_001764587.1|  predicted protein                                65.1    2e-10   
ref|XP_010258012.1|  PREDICTED: putative methylesterase 11, chlor...  66.6    2e-10   
ref|XP_002985678.1|  hypothetical protein SELMODRAFT_424768           65.1    2e-10   
emb|CDM82839.1|  unnamed protein product                              65.1    2e-10   
emb|CDM82848.1|  unnamed protein product                              65.1    2e-10   
ref|XP_010026417.1|  PREDICTED: probable esterase PIR7A               65.1    2e-10   
ref|XP_004300556.1|  PREDICTED: salicylic acid-binding protein 2      64.3    2e-10   
emb|CDX69847.1|  BnaA10g21960D                                        65.1    2e-10   
ref|XP_009122069.1|  PREDICTED: alpha-hydroxynitrile lyase            65.1    2e-10   
gb|KDO79353.1|  hypothetical protein CISIN_1g024065mg                 64.7    2e-10   
ref|XP_010437282.1|  PREDICTED: methylesterase 9-like                 65.1    2e-10   
emb|CBI18568.3|  unnamed protein product                              65.5    2e-10   
ref|XP_002979278.1|  hypothetical protein SELMODRAFT_110618           65.5    2e-10   
ref|XP_010088988.1|  hypothetical protein L484_020271                 65.5    2e-10   
ref|XP_006480147.1|  PREDICTED: methylesterase 10-like                65.5    2e-10   
ref|XP_006360241.1|  PREDICTED: salicylic acid-binding protein 2-...  64.7    3e-10   
ref|XP_008459387.1|  PREDICTED: putative methylesterase 11, chlor...  66.2    3e-10   
ref|XP_010531230.1|  PREDICTED: methylesterase 1-like                 65.1    3e-10   
emb|CDX96991.1|  BnaC09g46340D                                        64.7    3e-10   
ref|XP_007155974.1|  hypothetical protein PHAVU_003G248200g           65.1    3e-10   
ref|XP_003519919.1|  PREDICTED: salicylic acid-binding protein 2-...  64.7    3e-10   
ref|XP_010030653.1|  PREDICTED: salicylic acid-binding protein 2-...  65.1    3e-10   
gb|KFK30331.1|  hypothetical protein AALP_AA7G248000                  64.7    3e-10   
ref|XP_009366235.1|  PREDICTED: salicylic acid-binding protein 2-...  64.7    3e-10   
gb|KHN47092.1|  Putative esterase                                     65.9    3e-10   
ref|XP_007202467.1|  hypothetical protein PRUPE_ppa010154mg           64.7    3e-10   
ref|XP_003562737.1|  PREDICTED: LOW QUALITY PROTEIN: putative met...  66.2    3e-10   
ref|XP_006414315.1|  hypothetical protein EUTSA_v10026004mg           64.7    3e-10   
gb|EMT09102.1|  hypothetical protein F775_06839                       65.1    3e-10   
ref|XP_008440233.1|  PREDICTED: LOW QUALITY PROTEIN: salicylic ac...  64.7    3e-10   
ref|XP_002512066.1|  Esterase PIR7B, putative                         66.2    3e-10   
ref|XP_010026416.1|  PREDICTED: probable esterase PIR7A               64.7    3e-10   
ref|XP_006285859.1|  hypothetical protein CARUB_v10007354mg           64.7    3e-10   
gb|KFK25341.1|  hypothetical protein AALP_AA8G100000                  64.7    3e-10   
ref|NP_001276260.1|  putative methylesterase 12, chloroplastic-like   65.9    3e-10   
tpg|DAA55951.1|  TPA: esterase PIR7A                                  64.7    3e-10   
gb|KCW55026.1|  hypothetical protein EUGRSUZ_I01001                   64.3    3e-10   
ref|XP_007155975.1|  hypothetical protein PHAVU_003G248300g           64.7    3e-10   
ref|XP_003576326.2|  PREDICTED: methylesterase 17-like                65.1    3e-10   
emb|CDY60708.1|  BnaC07g50080D                                        64.7    3e-10   
ref|XP_004141467.1|  PREDICTED: putative methylesterase 11, chlor...  65.9    3e-10   
ref|XP_007047134.1|  Methyl esterase 10, putative isoform 1           64.7    3e-10   
ref|XP_002522344.1|  Polyneuridine-aldehyde esterase precursor, p...  64.7    3e-10   
ref|XP_010323708.1|  PREDICTED: salicylic acid-binding protein 2      64.7    3e-10   
ref|NP_195432.1|  methyl esterase 9                                   64.3    3e-10   
ref|XP_001763956.1|  predicted protein                                64.3    4e-10   
ref|XP_004171121.1|  PREDICTED: salicylic acid-binding protein 2-...  64.3    4e-10   
ref|XP_007047135.1|  Methyl esterase 10, putative isoform 2           64.3    4e-10   
ref|XP_004137134.1|  PREDICTED: putative methylesterase 11, chlor...  65.9    4e-10   
gb|ACG44547.1|  esterase PIR7A                                        64.7    4e-10   
gb|KGN48493.1|  hypothetical protein Csa_6G490080                     64.3    4e-10   
ref|NP_001060214.1|  Os07g0603600                                     64.7    4e-10   
ref|XP_011009369.1|  PREDICTED: putative methylesterase 11, chlor...  65.9    4e-10   
gb|AFS35576.1|  salicylic acid-binding protein 2                      64.3    4e-10   
gb|KDP31869.1|  hypothetical protein JCGZ_12330                       64.3    4e-10   
ref|NP_179940.1|  methyl esterase 8                                   64.3    4e-10   
ref|XP_008444053.1|  PREDICTED: putative methylesterase 11, chlor...  65.5    4e-10   
gb|EMS46077.1|  hypothetical protein TRIUR3_33741                     64.7    4e-10   
ref|XP_010066830.1|  PREDICTED: putative methylesterase 11, chlor...  65.9    4e-10   



>gb|ACU18515.1| unknown [Glycine max]
Length=219

 Score =   112 bits (280),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 59/89 (66%), Positives = 71/89 (80%), Gaps = 2/89 (2%)
 Frame = +2

Query  77   TAEEKIREEVVAPPPPPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSD  256
            T  E++ E VVA     HFVLVHG+GGG+WCWYK+RCLMENSGYKVSCIDL SAG+D SD
Sbjct  4    TMPERVEEGVVALNQ--HFVLVHGIGGGSWCWYKIRCLMENSGYKVSCIDLKSAGIDQSD  61

Query  257  ANDILTFXDYNxpllxflaslppNXQVIL  343
            A+ +L+F DYN PL+ F++ LP N QVIL
Sbjct  62   ADSVLSFDDYNKPLMDFMSDLPENEQVIL  90



>ref|XP_003526792.1| PREDICTED: methylesterase 17 [Glycine max]
Length=276

 Score =   112 bits (280),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 59/89 (66%), Positives = 71/89 (80%), Gaps = 2/89 (2%)
 Frame = +2

Query  77   TAEEKIREEVVAPPPPPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSD  256
            T  E++ E VVA     HFVLVHG+GGG+WCWYK+RCLMENSGYKVSCIDL SAG+D SD
Sbjct  4    TMPERVEEGVVALNQ--HFVLVHGIGGGSWCWYKIRCLMENSGYKVSCIDLKSAGIDQSD  61

Query  257  ANDILTFXDYNxpllxflaslppNXQVIL  343
            A+ +L+F DYN PL+ F++ LP N QVIL
Sbjct  62   ADSVLSFDDYNKPLMDFMSDLPENEQVIL  90



>ref|XP_002520884.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF41593.1| conserved hypothetical protein [Ricinus communis]
Length=228

 Score =   110 bits (275),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +2

Query  125  PHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYN  289
            PHFVLVHG+GGG+WCWYK+RCLMENSGYKVSCIDL  AG+DP+DAN IL+F DYN
Sbjct  22   PHFVLVHGIGGGSWCWYKIRCLMENSGYKVSCIDLRGAGIDPADANSILSFDDYN  76



>ref|XP_007141327.1| hypothetical protein PHAVU_008G186600g [Phaseolus vulgaris]
 gb|ESW13321.1| hypothetical protein PHAVU_008G186600g [Phaseolus vulgaris]
Length=284

 Score =   110 bits (276),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 60/93 (65%), Positives = 71/93 (76%), Gaps = 3/93 (3%)
 Frame = +2

Query  74   KTAEEK---IREEVVAPPPPPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGV  244
            +  EEK   + EE      P HFVLVHG+GGGAWCWYK+RCLMENSGYKVSCIDL SAG+
Sbjct  2    RVKEEKAMAVSEESGDSRGPIHFVLVHGIGGGAWCWYKIRCLMENSGYKVSCIDLKSAGI  61

Query  245  DPSDANDILTFXDYNxpllxflaslppNXQVIL  343
            D S A+ +L+F DYN PL+ FL++LP N QVIL
Sbjct  62   DQSHADSVLSFDDYNQPLMDFLSALPENEQVIL  94



>ref|XP_009363781.1| PREDICTED: methylesterase 17-like [Pyrus x bretschneideri]
Length=280

 Score =   110 bits (274),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 58/91 (64%), Positives = 68/91 (75%), Gaps = 0/91 (0%)
 Frame = +2

Query  71   KKTAEEKIREEVVAPPPPPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDP  250
            ++T  EK  E    P    HFVLVHG+  GAWCWYK+RCLMENSGYKVSC+DL SAG+D 
Sbjct  8    EETMVEKKMELSEVPLKTTHFVLVHGISHGAWCWYKIRCLMENSGYKVSCVDLKSAGIDQ  67

Query  251  SDANDILTFXDYNxpllxflaslppNXQVIL  343
            SDAN +L+F DYN PLL  L++LP N QVIL
Sbjct  68   SDANSVLSFDDYNKPLLDLLSALPENEQVIL  98



>ref|XP_007011384.1| Methyl esterase 17 [Theobroma cacao]
 gb|EOY20194.1| Methyl esterase 17 [Theobroma cacao]
Length=271

 Score =   109 bits (273),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 55/73 (75%), Positives = 62/73 (85%), Gaps = 0/73 (0%)
 Frame = +2

Query  125  PHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYNxpllx  304
            PHFVLVHG+ GGAWCWYK+RCLMENSGYKVSCIDL  AG+D SDAN IL+F DYN PLL 
Sbjct  17   PHFVLVHGISGGAWCWYKIRCLMENSGYKVSCIDLKGAGIDQSDANSILSFDDYNKPLLD  76

Query  305  flaslppNXQVIL  343
            F+++LP   QVIL
Sbjct  77   FMSALPDTEQVIL  89



>gb|KHG20572.1| Pheophorbidase [Gossypium arboreum]
Length=275

 Score =   109 bits (272),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 67/84 (80%), Gaps = 0/84 (0%)
 Frame = +2

Query  92   IREEVVAPPPPPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDIL  271
            + E+  A    PHFVLVHG+GGGAWCWYK++CLMENSGYKVSCIDL  AG D SDAN I+
Sbjct  9    MTEKETAAMNNPHFVLVHGIGGGAWCWYKIKCLMENSGYKVSCIDLKGAGTDRSDANSIV  68

Query  272  TFXDYNxpllxflaslppNXQVIL  343
            +F DYN PL+ F+++LP + QVIL
Sbjct  69   SFDDYNKPLMDFMSALPHSEQVIL  92



>gb|KDO67571.1| hypothetical protein CISIN_1g032072mg [Citrus sinensis]
Length=148

 Score =   106 bits (264),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 56/90 (62%), Positives = 66/90 (73%), Gaps = 2/90 (2%)
 Frame = +2

Query  80   AEEKIREEVVAPP--PPPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPS  253
             EE    E+  P     PHFVLVHG+ GGAWCWYK+RCLMENSGYKVSCI+L  +G DPS
Sbjct  2    GEEINMREIKKPAEVQKPHFVLVHGISGGAWCWYKVRCLMENSGYKVSCINLKGSGTDPS  61

Query  254  DANDILTFXDYNxpllxflaslppNXQVIL  343
            DAN I +F DYN PL+ F++SL  N +VIL
Sbjct  62   DANSIHSFDDYNKPLMDFMSSLTDNEKVIL  91



>gb|KEH35520.1| methylesterase [Medicago truncatula]
Length=244

 Score =   108 bits (269),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 52/72 (72%), Positives = 63/72 (88%), Gaps = 0/72 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYNxpllxf  307
            HFVLVHG+GGG WCWYK++CLMENSGYKVSCIDL S+G+D SDA+ ILTF DYN P++ F
Sbjct  36   HFVLVHGIGGGGWCWYKIKCLMENSGYKVSCIDLKSSGIDQSDADSILTFDDYNKPVIDF  95

Query  308  laslppNXQVIL  343
            +++LP N QVIL
Sbjct  96   MSALPDNEQVIL  107



>ref|XP_007218793.1| hypothetical protein PRUPE_ppa009785mg [Prunus persica]
 gb|EMJ19992.1| hypothetical protein PRUPE_ppa009785mg [Prunus persica]
Length=277

 Score =   108 bits (271),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 53/72 (74%), Positives = 61/72 (85%), Gaps = 0/72 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYNxpllxf  307
            HFVLVHG+ GGAWCWYK+RCLMENSGYKVSC+DL SAG+D SDAN + +F DYN PLL  
Sbjct  25   HFVLVHGISGGAWCWYKIRCLMENSGYKVSCVDLKSAGIDQSDANSVFSFDDYNKPLLDL  84

Query  308  laslppNXQVIL  343
            L++LP N QVIL
Sbjct  85   LSALPENEQVIL  96



>ref|XP_008234160.1| PREDICTED: methylesterase 17 [Prunus mume]
Length=286

 Score =   108 bits (271),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 53/72 (74%), Positives = 61/72 (85%), Gaps = 0/72 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYNxpllxf  307
            HFVLVHG+ GGAWCWYK+RCLMENSGYKVSC+DL SAG+D SDAN + +F DYN PLL  
Sbjct  32   HFVLVHGISGGAWCWYKIRCLMENSGYKVSCVDLKSAGIDQSDANSVFSFDDYNKPLLDL  91

Query  308  laslppNXQVIL  343
            L++LP N QVIL
Sbjct  92   LSALPENEQVIL  103



>gb|KEH35519.1| methylesterase [Medicago truncatula]
Length=289

 Score =   108 bits (269),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 52/72 (72%), Positives = 63/72 (88%), Gaps = 0/72 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYNxpllxf  307
            HFVLVHG+GGG WCWYK++CLMENSGYKVSCIDL S+G+D SDA+ ILTF DYN P++ F
Sbjct  36   HFVLVHGIGGGGWCWYKIKCLMENSGYKVSCIDLKSSGIDQSDADSILTFDDYNKPVIDF  95

Query  308  laslppNXQVIL  343
            +++LP N QVIL
Sbjct  96   MSALPDNEQVIL  107



>ref|XP_006435956.1| hypothetical protein CICLE_v10032372mg [Citrus clementina]
 ref|XP_006486136.1| PREDICTED: methylesterase 17-like [Citrus sinensis]
 gb|ESR49196.1| hypothetical protein CICLE_v10032372mg [Citrus clementina]
Length=275

 Score =   107 bits (268),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 53/73 (73%), Positives = 61/73 (84%), Gaps = 0/73 (0%)
 Frame = +2

Query  125  PHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYNxpllx  304
            PHFVLVHG+ GGAWCWYK+RCLMENSGYKVSCI+L  AG DPSDAN I +F DYN PL+ 
Sbjct  19   PHFVLVHGISGGAWCWYKVRCLMENSGYKVSCINLKGAGTDPSDANSIHSFDDYNKPLMD  78

Query  305  flaslppNXQVIL  343
            F++SL  N +VIL
Sbjct  79   FMSSLTDNEKVIL  91



>gb|KDP21626.1| hypothetical protein JCGZ_03297 [Jatropha curcas]
Length=274

 Score =   107 bits (268),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 54/72 (75%), Positives = 63/72 (88%), Gaps = 0/72 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYNxpllxf  307
            HFVLVHG+GGG+WCWYK+RCLMENSGYKVSCIDL  AG+D +DAN IL+F DYN PLL F
Sbjct  19   HFVLVHGIGGGSWCWYKIRCLMENSGYKVSCIDLKGAGIDQADANSILSFDDYNKPLLDF  78

Query  308  laslppNXQVIL  343
            ++SLP N QVI+
Sbjct  79   MSSLPDNEQVIM  90



>gb|AFK40220.1| unknown [Medicago truncatula]
Length=289

 Score =   108 bits (269),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 52/72 (72%), Positives = 63/72 (88%), Gaps = 0/72 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYNxpllxf  307
            HFVLVHG+GGG WCWYK++CLMENSGYKVSCIDL S+G+D SDA+ ILTF DYN P++ F
Sbjct  36   HFVLVHGIGGGGWCWYKIKCLMENSGYKVSCIDLKSSGIDQSDADSILTFDDYNKPVIDF  95

Query  308  laslppNXQVIL  343
            +++LP N QVIL
Sbjct  96   MSALPDNEQVIL  107



>ref|XP_008376326.1| PREDICTED: methylesterase 17-like [Malus domestica]
Length=280

 Score =   107 bits (268),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 53/72 (74%), Positives = 61/72 (85%), Gaps = 0/72 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYNxpllxf  307
            HFVLVHG+  GAWCWYK+RCLMENSGYKVSC+DL SAG+D SDAN +L+F DYN PLL  
Sbjct  27   HFVLVHGISHGAWCWYKIRCLMENSGYKVSCVDLKSAGIDQSDANSVLSFDDYNKPLLDL  86

Query  308  laslppNXQVIL  343
            L++LP N QVIL
Sbjct  87   LSALPENEQVIL  98



>ref|XP_010102428.1| hypothetical protein L484_002055 [Morus notabilis]
 gb|EXB93425.1| hypothetical protein L484_002055 [Morus notabilis]
Length=314

 Score =   108 bits (269),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 66/80 (83%), Gaps = 0/80 (0%)
 Frame = +2

Query  104  VVAPPPPPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXD  283
            +V  P  PHFVLVHG+ GG+WCWYK+RCLMENSGY+ SC+DL SAG+D SDA+ +LTF D
Sbjct  8    LVELPLKPHFVLVHGISGGSWCWYKIRCLMENSGYRASCVDLKSAGIDRSDADSVLTFDD  67

Query  284  YNxpllxflaslppNXQVIL  343
            YN PL+ F+++LP N QVIL
Sbjct  68   YNEPLMKFMSALPENEQVIL  87



>ref|XP_004502811.1| PREDICTED: methylesterase 17-like [Cicer arietinum]
Length=293

 Score =   107 bits (268),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 53/76 (70%), Positives = 64/76 (84%), Gaps = 0/76 (0%)
 Frame = +2

Query  116  PPPPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYNxp  295
            P   HFVLVHG+GGG+WCWYK++CLMENSGYKVSCIDL S G+D SDA+ ILTF DYN P
Sbjct  34   PLKQHFVLVHGIGGGSWCWYKIKCLMENSGYKVSCIDLKSGGIDQSDADSILTFDDYNKP  93

Query  296  llxflaslppNXQVIL  343
            L+ F+++LP N +VIL
Sbjct  94   LIDFMSNLPHNEKVIL  109



>ref|XP_008459483.1| PREDICTED: methylesterase 17 [Cucumis melo]
Length=274

 Score =   107 bits (267),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 52/74 (70%), Positives = 62/74 (84%), Gaps = 0/74 (0%)
 Frame = +2

Query  122  PPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYNxpll  301
            PPHFVLVHG+GGG WCWYK+RCLMENSG+KV+CIDL  AG+D SD N ++ F DYN PLL
Sbjct  20   PPHFVLVHGIGGGGWCWYKIRCLMENSGFKVTCIDLKGAGIDLSDPNSVINFDDYNQPLL  79

Query  302  xflaslppNXQVIL  343
             F++SLP N Q+IL
Sbjct  80   DFISSLPENEQIIL  93



>gb|AFK48205.1| unknown [Medicago truncatula]
 gb|KEH28138.1| methylesterase-like protein [Medicago truncatula]
Length=282

 Score =   107 bits (266),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 54/72 (75%), Positives = 63/72 (88%), Gaps = 0/72 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYNxpllxf  307
            HFVLVHG+GGG WCWYK+RCLMENSGYKVSCIDL SAG++ SDA+ +L+F DYN PLL F
Sbjct  30   HFVLVHGIGGGGWCWYKIRCLMENSGYKVSCIDLKSAGINQSDADSVLSFDDYNQPLLDF  89

Query  308  laslppNXQVIL  343
            ++SLP N QVIL
Sbjct  90   MSSLPENEQVIL  101



>gb|EPS70008.1| hypothetical protein M569_04755 [Genlisea aurea]
Length=268

 Score =   106 bits (265),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 42/60 (70%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = +2

Query  110  APPPPPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYN  289
             PP P HFVL+HG+GGGAWCWYK+RCLMENSGY+V+C+DL  +GVDP+DAN I +F  YN
Sbjct  6    TPPAPAHFVLIHGIGGGAWCWYKIRCLMENSGYRVTCLDLRGSGVDPTDANTIRSFDHYN  65



>gb|KGN52590.1| hypothetical protein Csa_5G645150 [Cucumis sativus]
Length=176

 Score =   104 bits (259),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 51/79 (65%), Positives = 62/79 (78%), Gaps = 0/79 (0%)
 Frame = +2

Query  107  VAPPPPPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDY  286
            V+   PPHFVLVHG+ GG WCWYK+RCLMENSG+KV+CIDL  AG+D SD N +  F DY
Sbjct  15   VSVQIPPHFVLVHGISGGGWCWYKIRCLMENSGFKVTCIDLKGAGIDRSDPNSVFNFDDY  74

Query  287  NxpllxflaslppNXQVIL  343
            N PLL F+++LP N Q+IL
Sbjct  75   NQPLLDFISTLPENEQIIL  93



>gb|ACU16989.1| unknown [Glycine max]
Length=204

 Score =   104 bits (260),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 52/72 (72%), Positives = 62/72 (86%), Gaps = 0/72 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYNxpllxf  307
            HFVLVHG+GGG+WCWYK+RCLMENSG KVSCIDL SAG+D SDA+ +L+F DYN PL+ F
Sbjct  14   HFVLVHGIGGGSWCWYKIRCLMENSGCKVSCIDLKSAGIDQSDADSVLSFDDYNKPLMDF  73

Query  308  laslppNXQVIL  343
            ++ LP N QVIL
Sbjct  74   MSDLPENEQVIL  85



>ref|XP_010999645.1| PREDICTED: methylesterase 17 [Populus euphratica]
Length=276

 Score =   105 bits (263),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 52/77 (68%), Positives = 64/77 (83%), Gaps = 0/77 (0%)
 Frame = +2

Query  113  PPPPPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYNx  292
            P  P HFVLVHG+ GG+WCWYK+RCLMENSGY+VSCIDL  AG+DP+DA+ + +F DYN 
Sbjct  18   PQQPTHFVLVHGISGGSWCWYKIRCLMENSGYRVSCIDLKGAGIDPADADSVHSFDDYNK  77

Query  293  pllxflaslppNXQVIL  343
            PLL F++SLP N +VIL
Sbjct  78   PLLDFMSSLPDNEKVIL  94



>gb|KJB60171.1| hypothetical protein B456_009G292500 [Gossypium raimondii]
Length=301

 Score =   105 bits (263),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 52/73 (71%), Positives = 62/73 (85%), Gaps = 0/73 (0%)
 Frame = +2

Query  125  PHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYNxpllx  304
            PHFVLVHGLGGGAWCWY+++CLME SGYKVSCIDL  AG D SDAN I++F DYN PL+ 
Sbjct  46   PHFVLVHGLGGGAWCWYRIKCLMEISGYKVSCIDLKGAGTDRSDANSIVSFDDYNKPLMD  105

Query  305  flaslppNXQVIL  343
            F+++LP + QVIL
Sbjct  106  FMSALPHSEQVIL  118



>ref|XP_004141511.1| PREDICTED: methylesterase 17-like [Cucumis sativus]
Length=285

 Score =   105 bits (262),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 50/74 (68%), Positives = 60/74 (81%), Gaps = 0/74 (0%)
 Frame = +2

Query  122  PPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYNxpll  301
            PPHFVLVHG+ GG WCWYK+RCLMENSG+KV+CIDL  AG+D SD N +  F DYN PLL
Sbjct  20   PPHFVLVHGISGGGWCWYKIRCLMENSGFKVTCIDLKGAGIDRSDPNSVFNFDDYNQPLL  79

Query  302  xflaslppNXQVIL  343
             F+++LP N Q+IL
Sbjct  80   DFISTLPENEQIIL  93



>ref|XP_003523290.1| PREDICTED: methylesterase 17 isoformX2 [Glycine max]
Length=205

 Score =   103 bits (258),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 52/72 (72%), Positives = 62/72 (86%), Gaps = 0/72 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYNxpllxf  307
            HFVLVHG+GGG+WCWYK+RCLMENSG KVSCIDL SAG+D SDA+ +L+F DYN PL+ F
Sbjct  14   HFVLVHGIGGGSWCWYKIRCLMENSGCKVSCIDLKSAGIDQSDADSVLSFDDYNKPLMDF  73

Query  308  laslppNXQVIL  343
            ++ LP N QVIL
Sbjct  74   MSDLPENEQVIL  85



>ref|XP_004167241.1| PREDICTED: LOW QUALITY PROTEIN: methylesterase 17-like [Cucumis 
sativus]
Length=285

 Score =   105 bits (262),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 50/74 (68%), Positives = 60/74 (81%), Gaps = 0/74 (0%)
 Frame = +2

Query  122  PPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYNxpll  301
            PPHFVLVHG+ GG WCWYK+RCLMENSG+KV+CIDL  AG+D SD N +  F DYN PLL
Sbjct  20   PPHFVLVHGISGGGWCWYKIRCLMENSGFKVTCIDLKGAGIDRSDPNSVFNFDDYNQPLL  79

Query  302  xflaslppNXQVIL  343
             F+++LP N Q+IL
Sbjct  80   DFISTLPENEQIIL  93



>ref|XP_006578847.1| PREDICTED: methylesterase 17 isoform X3 [Glycine max]
Length=272

 Score =   105 bits (261),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 52/72 (72%), Positives = 62/72 (86%), Gaps = 0/72 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYNxpllxf  307
            HFVLVHG+GGG+WCWYK+RCLMENSG KVSCIDL SAG+D SDA+ +L+F DYN PL+ F
Sbjct  14   HFVLVHGIGGGSWCWYKIRCLMENSGCKVSCIDLKSAGIDQSDADSVLSFDDYNKPLMDF  73

Query  308  laslppNXQVIL  343
            ++ LP N QVIL
Sbjct  74   MSDLPENEQVIL  85



>ref|XP_003523289.1| PREDICTED: methylesterase 17 isoformX1 [Glycine max]
Length=271

 Score =   105 bits (261),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 52/72 (72%), Positives = 62/72 (86%), Gaps = 0/72 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYNxpllxf  307
            HFVLVHG+GGG+WCWYK+RCLMENSG KVSCIDL SAG+D SDA+ +L+F DYN PL+ F
Sbjct  14   HFVLVHGIGGGSWCWYKIRCLMENSGCKVSCIDLKSAGIDQSDADSVLSFDDYNKPLMDF  73

Query  308  laslppNXQVIL  343
            ++ LP N QVIL
Sbjct  74   MSDLPENEQVIL  85



>ref|XP_009362773.1| PREDICTED: methylesterase 17 [Pyrus x bretschneideri]
Length=281

 Score =   105 bits (261),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 57/93 (61%), Positives = 70/93 (75%), Gaps = 2/93 (2%)
 Frame = +2

Query  65   ETKKTAEEKIREEVVAPPPPPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGV  244
            ET    +++I EE +      HFVLVHG+  GAWCWYK+RCLME+SGYKVSC+DL SAGV
Sbjct  9    ETMVDEDKEISEEPLGATT--HFVLVHGISHGAWCWYKIRCLMESSGYKVSCVDLKSAGV  66

Query  245  DPSDANDILTFXDYNxpllxflaslppNXQVIL  343
            D SDAN +L+F DYN PLL  L++LP N +VIL
Sbjct  67   DQSDANSVLSFDDYNKPLLDLLSALPENEKVIL  99



>ref|XP_002325617.2| hydrolase family protein [Populus trichocarpa]
 gb|EEE99998.2| hydrolase family protein [Populus trichocarpa]
Length=276

 Score =   104 bits (260),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = +2

Query  122  PPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYNxpll  301
            P HFVLVHG+ GG+WCWYK+RCLMENSGY+VSCIDL  AG+DP+DA+ + +F DYN P++
Sbjct  21   PTHFVLVHGISGGSWCWYKIRCLMENSGYRVSCIDLKGAGIDPADADSVHSFDDYNKPIM  80

Query  302  xflaslppNXQVIL  343
             F++SLP N +VIL
Sbjct  81   DFMSSLPDNEKVIL  94



>ref|XP_008388372.1| PREDICTED: methylesterase 17-like [Malus domestica]
Length=281

 Score =   104 bits (259),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 57/97 (59%), Positives = 69/97 (71%), Gaps = 4/97 (4%)
 Frame = +2

Query  65   ETKKTAEEKIREEVVAPPPP----PHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLS  232
            E K T E  + EE      P     HFVLVHG+  GAWCWYK+RCLME+SG+KVSC+DL 
Sbjct  3    EDKATEETMVDEEKEISSEPLKATTHFVLVHGISHGAWCWYKIRCLMESSGFKVSCVDLK  62

Query  233  SAGVDPSDANDILTFXDYNxpllxflaslppNXQVIL  343
            SAG+D SDAN +L+F DYN PLL  L++LP N +VIL
Sbjct  63   SAGLDQSDANSVLSFDDYNKPLLDLLSALPENEKVIL  99



>ref|XP_011084804.1| PREDICTED: methylesterase 17 isoform X2 [Sesamum indicum]
Length=288

 Score =   104 bits (259),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 61/104 (59%), Positives = 76/104 (73%), Gaps = 5/104 (5%)
 Frame = +2

Query  47   MGGESFETKKTAEEK-----IREEVVAPPPPPHFVLVHGLGGGAWCWYKLRCLMENSGYK  211
            MG ES E  +  E++     +       PPPPHFVLVHG+GGGAWCWYK+RCLME+SGY+
Sbjct  1    MGEESTEVVEMKEDQSLNNSVAPPAPPSPPPPHFVLVHGIGGGAWCWYKIRCLMESSGYR  60

Query  212  VSCIDLSSAGVDPSDANDILTFXDYNxpllxflaslppNXQVIL  343
            VSC+DL  AG+DP+D N +L+F DYN PLL FL+SL  + QVIL
Sbjct  61   VSCLDLKGAGMDPTDPNTVLSFNDYNKPLLDFLSSLHDDHQVIL  104



>ref|NP_001237523.1| uncharacterized protein LOC100527539 [Glycine max]
 gb|ACU16635.1| unknown [Glycine max]
Length=283

 Score =   104 bits (259),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 51/76 (67%), Positives = 61/76 (80%), Gaps = 0/76 (0%)
 Frame = +2

Query  116  PPPPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYNxp  295
            P   HFVLVHG+GG  WCWYK+RCLMENSG+KVSCIDL SAG+D SD + +L+F DYN P
Sbjct  24   PLKQHFVLVHGVGGRGWCWYKIRCLMENSGFKVSCIDLKSAGIDQSDVDSVLSFDDYNQP  83

Query  296  llxflaslppNXQVIL  343
            L+  L++LP N QVIL
Sbjct  84   LMDLLSALPENEQVIL  99



>emb|CAN78031.1| hypothetical protein VITISV_017532 [Vitis vinifera]
Length=244

 Score =   103 bits (257),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 49/73 (67%), Positives = 61/73 (84%), Gaps = 0/73 (0%)
 Frame = +2

Query  125  PHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYNxpllx  304
            PHFVL+HG+GGGAWCWYKLRCLMENSGYKVSCI+L+S G+D SDA+ + +F +Y+ PL  
Sbjct  12   PHFVLIHGIGGGAWCWYKLRCLMENSGYKVSCIELTSGGIDRSDASSVQSFDEYSKPLTD  71

Query  305  flaslppNXQVIL  343
            F + LP N +VIL
Sbjct  72   FFSELPENQKVIL  84



>ref|XP_002281126.1| PREDICTED: methylesterase 17 [Vitis vinifera]
Length=263

 Score =   103 bits (257),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 49/73 (67%), Positives = 61/73 (84%), Gaps = 0/73 (0%)
 Frame = +2

Query  125  PHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYNxpllx  304
            PHFVL+HG+GGGAWCWYKLRCLMENSGYKVSCI+L+S G+D SDA+ + +F +Y+ PL  
Sbjct  12   PHFVLIHGIGGGAWCWYKLRCLMENSGYKVSCIELTSGGIDRSDASSVQSFDEYSKPLTD  71

Query  305  flaslppNXQVIL  343
            F + LP N +VIL
Sbjct  72   FFSELPENQKVIL  84



>ref|XP_010244542.1| PREDICTED: methylesterase 17-like [Nelumbo nucifera]
Length=276

 Score =   103 bits (257),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 56/92 (61%), Positives = 69/92 (75%), Gaps = 4/92 (4%)
 Frame = +2

Query  80   AEEKIREEVVAPPP----PPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVD  247
            A E  +  V+  PP      HFVL+HG+GGGAWCWYKLRCLME+SGYKV+CIDL SAG+D
Sbjct  4    ASEDGKGLVMGIPPFSSRAAHFVLLHGIGGGAWCWYKLRCLMESSGYKVTCIDLKSAGID  63

Query  248  PSDANDILTFXDYNxpllxflaslppNXQVIL  343
            PSD + IL+F  YN PL+ FL+ LP + +VIL
Sbjct  64   PSDPDSILSFDQYNQPLVDFLSHLPQDQKVIL  95



>ref|XP_009603473.1| PREDICTED: methylesterase 17-like, partial [Nicotiana tomentosiformis]
Length=140

 Score =   100 bits (249),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 56/99 (57%), Positives = 70/99 (71%), Gaps = 6/99 (6%)
 Frame = +2

Query  53   GESFETKKTAEEKIREEVVAPPPP--PHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCID  226
            GE F   K   EK +     PP P   HFVL+HG+GGG WCWYK+R LMENSGYKV+C+D
Sbjct  2    GEEFVDMKLEIEKTK----VPPQPQRAHFVLIHGIGGGGWCWYKIRSLMENSGYKVTCLD  57

Query  227  LSSAGVDPSDANDILTFXDYNxpllxflaslppNXQVIL  343
            L  AG+D +D N I++F +YN PL+ FL+SLP + QVIL
Sbjct  58   LKGAGIDQADPNTIVSFDEYNKPLIDFLSSLPDSEQVIL  96



>ref|XP_010252030.1| PREDICTED: methylesterase 17-like isoform X2 [Nelumbo nucifera]
Length=207

 Score =   101 bits (252),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 50/85 (59%), Positives = 66/85 (78%), Gaps = 0/85 (0%)
 Frame = +2

Query  89   KIREEVVAPPPPPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDI  268
            K+   V     P HFVLVHG+GGGAWCWYK+RCL+E+SGYKV+C+DL SAG+D S+ + I
Sbjct  16   KVTSSVFISSSPAHFVLVHGIGGGAWCWYKVRCLLESSGYKVTCLDLKSAGIDQSNPDSI  75

Query  269  LTFXDYNxpllxflaslppNXQVIL  343
            L+F +YN PL+ FL+ LP + +VIL
Sbjct  76   LSFEEYNKPLIDFLSDLPQDQKVIL  100



>ref|XP_011084803.1| PREDICTED: methylesterase 17 isoform X1 [Sesamum indicum]
Length=304

 Score =   102 bits (254),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 59/104 (57%), Positives = 76/104 (73%), Gaps = 5/104 (5%)
 Frame = +2

Query  47   MGGESFETKKTAEEK-----IREEVVAPPPPPHFVLVHGLGGGAWCWYKLRCLMENSGYK  211
            MG ES E  +  E++     +       PPPPHFVLVHG+GGGAWCWYK+RCLME+SGY+
Sbjct  1    MGEESTEVVEMKEDQSLNNSVAPPAPPSPPPPHFVLVHGIGGGAWCWYKIRCLMESSGYR  60

Query  212  VSCIDLSSAGVDPSDANDILTFXDYNxpllxflaslppNXQVIL  343
            VSC+DL  AG+DP+D N +L+F DYN PLL FL+SL  + Q++L
Sbjct  61   VSCLDLKGAGMDPTDPNTVLSFNDYNKPLLDFLSSLHDDHQLVL  104



>ref|XP_010252032.1| PREDICTED: methylesterase 17-like isoform X3 [Nelumbo nucifera]
Length=200

 Score =   100 bits (249),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 50/85 (59%), Positives = 66/85 (78%), Gaps = 0/85 (0%)
 Frame = +2

Query  89   KIREEVVAPPPPPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDI  268
            K+   V     P HFVLVHG+GGGAWCWYK+RCL+E+SGYKV+C+DL SAG+D S+ + I
Sbjct  16   KVTSSVFISSSPAHFVLVHGIGGGAWCWYKVRCLLESSGYKVTCLDLKSAGIDQSNPDSI  75

Query  269  LTFXDYNxpllxflaslppNXQVIL  343
            L+F +YN PL+ FL+ LP + +VIL
Sbjct  76   LSFEEYNKPLIDFLSDLPQDQKVIL  100



>ref|XP_010067632.1| PREDICTED: methylesterase 17 [Eucalyptus grandis]
 gb|KCW65799.1| hypothetical protein EUGRSUZ_G03151 [Eucalyptus grandis]
Length=276

 Score =   101 bits (251),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 50/73 (68%), Positives = 62/73 (85%), Gaps = 0/73 (0%)
 Frame = +2

Query  125  PHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYNxpllx  304
            PHFVLVHG+GGGAWCWYK+R LME+SGY VSC+DL+ AG++P+D N +LT  DYN PLL 
Sbjct  24   PHFVLVHGIGGGAWCWYKIRTLMESSGYTVSCLDLTGAGINPTDPNTVLTMDDYNKPLLD  83

Query  305  flaslppNXQVIL  343
            FL++LP + QVIL
Sbjct  84   FLSTLPDDKQVIL  96



>ref|XP_010252029.1| PREDICTED: methylesterase 17-like isoform X1 [Nelumbo nucifera]
Length=283

 Score =   101 bits (251),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 50/85 (59%), Positives = 66/85 (78%), Gaps = 0/85 (0%)
 Frame = +2

Query  89   KIREEVVAPPPPPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDI  268
            K+   V     P HFVLVHG+GGGAWCWYK+RCL+E+SGYKV+C+DL SAG+D S+ + I
Sbjct  16   KVTSSVFISSSPAHFVLVHGIGGGAWCWYKVRCLLESSGYKVTCLDLKSAGIDQSNPDSI  75

Query  269  LTFXDYNxpllxflaslppNXQVIL  343
            L+F +YN PL+ FL+ LP + +VIL
Sbjct  76   LSFEEYNKPLIDFLSDLPQDQKVIL  100



>gb|AFK43530.1| unknown [Lotus japonicus]
Length=285

 Score =   100 bits (250),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 50/80 (63%), Positives = 63/80 (79%), Gaps = 0/80 (0%)
 Frame = +2

Query  104  VVAPPPPPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXD  283
            +  P    HFVLVHG+ GG+WCWYK+RCLMEN GYKVSCIDL SAG+D S A+ +L+F D
Sbjct  21   ITIPLKQQHFVLVHGISGGSWCWYKIRCLMENPGYKVSCIDLKSAGIDQSVADSVLSFDD  80

Query  284  YNxpllxflaslppNXQVIL  343
            YN PL+ F+++LP N +VIL
Sbjct  81   YNQPLMDFMSALPDNEKVIL  100



>ref|XP_009784670.1| PREDICTED: methylesterase 17-like [Nicotiana sylvestris]
Length=281

 Score =   100 bits (248),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 46/83 (55%), Positives = 59/83 (71%), Gaps = 5/83 (6%)
 Frame = +2

Query  47   MGGESFETKKTAEEKIREEVVAPPPP--PHFVLVHGLGGGAWCWYKLRCLMENSGYKVSC  220
            MG ES + +   E   + +V  PP P   HFVLVHG+GGG WCWYK+R LMENSGYKV+C
Sbjct  1    MGEESVDIRLEIE---KAKVPLPPQPQRTHFVLVHGIGGGGWCWYKIRSLMENSGYKVTC  57

Query  221  IDLSSAGVDPSDANDILTFXDYN  289
            +DL  AG+D +D N I++F +YN
Sbjct  58   LDLKGAGIDQADPNTIISFDEYN  80



>ref|XP_004307746.1| PREDICTED: methylesterase 17 [Fragaria vesca subsp. vesca]
Length=282

 Score = 99.4 bits (246),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 50/72 (69%), Positives = 60/72 (83%), Gaps = 0/72 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYNxpllxf  307
            HFVLVHG+GGG WCWYK+RCLME SGYKVS +DL SAG+DPS+ + +L+F DYN PLL F
Sbjct  20   HFVLVHGIGGGGWCWYKIRCLMEKSGYKVSTVDLKSAGIDPSNVDSVLSFDDYNKPLLDF  79

Query  308  laslppNXQVIL  343
            L+SLP   QV+L
Sbjct  80   LSSLPEYEQVVL  91



>ref|XP_007136407.1| hypothetical protein PHAVU_009G042400g [Phaseolus vulgaris]
 gb|ESW08401.1| hypothetical protein PHAVU_009G042400g [Phaseolus vulgaris]
Length=282

 Score = 99.0 bits (245),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 59/93 (63%), Positives = 72/93 (77%), Gaps = 1/93 (1%)
 Frame = +2

Query  65   ETKKTAEEKIREEVVAPPPPPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGV  244
            + +K+  E +REE V      HFVLVHGLGGG WCWYK+RCLMENSGYKVSCIDL S G+
Sbjct  4    KAEKSMPEGVREEGVGLKQQ-HFVLVHGLGGGGWCWYKIRCLMENSGYKVSCIDLKSGGI  62

Query  245  DPSDANDILTFXDYNxpllxflaslppNXQVIL  343
            D SDA+ +L+F DYN PL+ F+++LP N QVIL
Sbjct  63   DQSDADSLLSFDDYNKPLMDFMSALPENEQVIL  95



>ref|XP_006367441.1| PREDICTED: methylesterase 17-like [Solanum tuberosum]
Length=274

 Score = 97.4 bits (241),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 50/72 (69%), Positives = 59/72 (82%), Gaps = 0/72 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYNxpllxf  307
            HFVL+HG+GGG WCWYK+R L+EN GYKV+ +DL  AG+DPSD N IL+F DYN PLL F
Sbjct  24   HFVLIHGIGGGGWCWYKIRSLIENCGYKVTSLDLKGAGIDPSDPNTILSFHDYNKPLLDF  83

Query  308  laslppNXQVIL  343
            L+SLP N QVIL
Sbjct  84   LSSLPHNEQVIL  95



>ref|XP_009146797.1| PREDICTED: methylesterase 17 [Brassica rapa]
Length=275

 Score = 97.1 bits (240),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 51/90 (57%), Positives = 65/90 (72%), Gaps = 2/90 (2%)
 Frame = +2

Query  80   AEEKIREEVVAPP--PPPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPS  253
            AEE   E +V  P   PPHFVL+HG+  G+WCWYK++CLME SG+ V+CIDL S+G+DPS
Sbjct  2    AEENQEETLVLKPRSKPPHFVLIHGISLGSWCWYKIKCLMEVSGFTVTCIDLKSSGIDPS  61

Query  254  DANDILTFXDYNxpllxflaslppNXQVIL  343
             A+ + +F  YN PL  FL+SLP   QVIL
Sbjct  62   SADSLTSFDQYNQPLTDFLSSLPEQEQVIL  91



>emb|CDY65415.1| BnaCnng46980D [Brassica napus]
Length=275

 Score = 97.1 bits (240),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 51/90 (57%), Positives = 65/90 (72%), Gaps = 2/90 (2%)
 Frame = +2

Query  80   AEEKIREEVVAPP--PPPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPS  253
            AEE   E +V  P   PPHFVL+HG+  G+WCWYK++CLME SG+ V+CIDL S+G+DPS
Sbjct  2    AEENQEETLVLKPRSKPPHFVLIHGISLGSWCWYKIKCLMEVSGFTVTCIDLKSSGIDPS  61

Query  254  DANDILTFXDYNxpllxflaslppNXQVIL  343
             A+ + +F  YN PL  FL+SLP   QVIL
Sbjct  62   SADSLTSFDQYNQPLTDFLSSLPEQEQVIL  91



>emb|CDY08569.1| BnaA05g28050D [Brassica napus]
Length=275

 Score = 97.1 bits (240),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 51/90 (57%), Positives = 65/90 (72%), Gaps = 2/90 (2%)
 Frame = +2

Query  80   AEEKIREEVVAPP--PPPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPS  253
            AEE   E +V  P   PPHFVL+HG+  G+WCWYK++CLME SG+ V+CIDL S+G+DPS
Sbjct  2    AEENQEETLVLKPRSKPPHFVLIHGISLGSWCWYKIKCLMEVSGFTVTCIDLKSSGIDPS  61

Query  254  DANDILTFXDYNxpllxflaslppNXQVIL  343
             A+ + +F  YN PL  FL+SLP   QVIL
Sbjct  62   SADSLTSFDQYNQPLTDFLSSLPEQEQVIL  91



>ref|XP_004294719.1| PREDICTED: methylesterase 17-like [Fragaria vesca subsp. vesca]
Length=269

 Score = 96.3 bits (238),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 51/82 (62%), Positives = 63/82 (77%), Gaps = 0/82 (0%)
 Frame = +2

Query  98   EEVVAPPPPPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTF  277
            E  VA P   H VL+HG+G GAWCWYKLRCL+E SG+KV+C+DL  AG+D SD N ILTF
Sbjct  4    ETEVANPHHHHLVLIHGVGHGAWCWYKLRCLLEASGHKVTCMDLKGAGIDQSDPNTILTF  63

Query  278  XDYNxpllxflaslppNXQVIL  343
             DYN PL+ FL++LP + +VIL
Sbjct  64   EDYNKPLINFLSTLPHDEKVIL  85



>gb|EYU35190.1| hypothetical protein MIMGU_mgv1a010972mg [Erythranthe guttata]
Length=295

 Score = 95.9 bits (237),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 58/71 (82%), Gaps = 0/71 (0%)
 Frame = +2

Query  131  FVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYNxpllxfl  310
            FVL+HG+ GGAWCWYK+R LMENSGYKV+C+DL  AGVD +D N +L+F DYN PL+ FL
Sbjct  41   FVLIHGISGGAWCWYKMRSLMENSGYKVTCLDLKGAGVDQTDPNSVLSFHDYNTPLIHFL  100

Query  311  aslppNXQVIL  343
            +SL  + QVIL
Sbjct  101  SSLNHDHQVIL  111



>ref|XP_009354983.1| PREDICTED: methylesterase 17-like [Pyrus x bretschneideri]
Length=281

 Score = 95.1 bits (235),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 49/71 (69%), Positives = 57/71 (80%), Gaps = 0/71 (0%)
 Frame = +2

Query  131  FVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYNxpllxfl  310
             VL+HG+G GAWCWYK+RCLME SGYKV+C+DL  AGVD SD N +LTF DYN PL  FL
Sbjct  29   LVLIHGIGHGAWCWYKIRCLMEASGYKVTCLDLKGAGVDQSDPNTVLTFQDYNQPLTDFL  88

Query  311  aslppNXQVIL  343
            +SLP N +VIL
Sbjct  89   SSLPGNEKVIL  99



>ref|XP_004235449.1| PREDICTED: methylesterase 17-like [Solanum lycopersicum]
Length=273

 Score = 94.4 bits (233),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 53/99 (54%), Positives = 65/99 (66%), Gaps = 5/99 (5%)
 Frame = +2

Query  47   MGGESFETKKTAEEKIREEVVAPPPPPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCID  226
            MG E  + K    EK +          H VL+HG+GGG WCWYK+R L+EN GYKV+ +D
Sbjct  1    MGEECVDMKMEGLEKCKRSERG-----HLVLIHGIGGGGWCWYKIRSLIENCGYKVTSLD  55

Query  227  LSSAGVDPSDANDILTFXDYNxpllxflaslppNXQVIL  343
            L  AG+DPSD N IL+F +YN PLL  L+SLP N QVIL
Sbjct  56   LKGAGIDPSDPNTILSFHEYNKPLLDLLSSLPHNEQVIL  94



>ref|XP_011041773.1| PREDICTED: methylesterase 17-like [Populus euphratica]
Length=263

 Score = 94.0 bits (232),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 48/73 (66%), Positives = 61/73 (84%), Gaps = 0/73 (0%)
 Frame = +2

Query  125  PHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYNxpllx  304
            P+FVLVHG+  GAWCWYK+RCLME SGYKV+C+DL SAG+D S+ N ILTF +YN PL+ 
Sbjct  10   PYFVLVHGVCHGAWCWYKIRCLMETSGYKVTCLDLKSAGIDQSNPNTILTFDEYNAPLID  69

Query  305  flaslppNXQVIL  343
            FL++LP + +VIL
Sbjct  70   FLSNLPHDEKVIL  82



>ref|XP_004240843.1| PREDICTED: methylesterase 17 [Solanum lycopersicum]
Length=280

 Score = 94.0 bits (232),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 54/99 (55%), Positives = 68/99 (69%), Gaps = 5/99 (5%)
 Frame = +2

Query  47   MGGESFETKKTAEEKIREEVVAPPPPPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCID  226
            MG E F  K+  EE + E+V       HFVL+HG+ GG WCWYK++ LME SGYKV+C+D
Sbjct  1    MGEEYFVEKEKMEENL-EQVSKI----HFVLIHGISGGGWCWYKIKSLMEISGYKVTCLD  55

Query  227  LSSAGVDPSDANDILTFXDYNxpllxflaslppNXQVIL  343
            L  AG+ P D   I++F DYN PL+ FL+SLP N QVIL
Sbjct  56   LKGAGIHPHDPTTIISFDDYNQPLINFLSSLPLNEQVIL  94



>ref|XP_006376561.1| hypothetical protein POPTR_0013s15410g [Populus trichocarpa]
 gb|ERP54358.1| hypothetical protein POPTR_0013s15410g [Populus trichocarpa]
Length=193

 Score = 92.4 bits (228),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +2

Query  119  PPPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYN  289
            P  HFVLVHG+  GAWCWYK+RCLME SG+KV+C+DL SAG+D S+ N ILTF +YN
Sbjct  8    PNLHFVLVHGVCHGAWCWYKIRCLMEKSGHKVTCLDLKSAGIDQSNPNTILTFDEYN  64



>ref|XP_002326065.1| Chain A family protein [Populus trichocarpa]
 gb|EEF00447.1| Chain A family protein [Populus trichocarpa]
Length=263

 Score = 93.6 bits (231),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 48/73 (66%), Positives = 59/73 (81%), Gaps = 0/73 (0%)
 Frame = +2

Query  125  PHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYNxpllx  304
            PHFVLVHG   GAWCWYK+RCLME SGYKV+C+DL SAG+D S+ N ILT  +YN PL+ 
Sbjct  10   PHFVLVHGACHGAWCWYKIRCLMETSGYKVTCLDLKSAGIDQSNPNTILTLDEYNAPLID  69

Query  305  flaslppNXQVIL  343
            FL++LP + +VIL
Sbjct  70   FLSNLPHDEKVIL  82



>ref|XP_006298200.1| hypothetical protein CARUB_v10014251mg [Capsella rubella]
 gb|EOA31098.1| hypothetical protein CARUB_v10014251mg [Capsella rubella]
Length=305

 Score = 94.0 bits (232),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 47/93 (51%), Positives = 66/93 (71%), Gaps = 3/93 (3%)
 Frame = +2

Query  74   KTAEEKIREEVVAPPP---PPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGV  244
            + A+E  +EE +   P   PPHFVL+HG+  G+WCWYK++CLME SG+ V+CIDL S+G+
Sbjct  28   QMADENHQEETLELKPRSKPPHFVLIHGMSLGSWCWYKIKCLMEVSGFDVTCIDLKSSGI  87

Query  245  DPSDANDILTFXDYNxpllxflaslppNXQVIL  343
            D S A+ + +F  YN PL+ FL+S   + QVIL
Sbjct  88   DSSSADSLTSFDQYNQPLIDFLSSSSEHEQVIL  120



>gb|KHF99571.1| Pheophorbidase [Gossypium arboreum]
Length=262

 Score = 93.2 bits (230),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/72 (64%), Positives = 56/72 (78%), Gaps = 0/72 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYNxpllxf  307
            HFV+VHG G GAWCWYK+R L+E S YKVSCIDL  +G+DPSD N I +F DYN PL+  
Sbjct  9    HFVMVHGFGHGAWCWYKIRSLLEASDYKVSCIDLKGSGMDPSDPNTIFSFQDYNKPLIDL  68

Query  308  laslppNXQVIL  343
            L++LP N +VIL
Sbjct  69   LSNLPHNEKVIL  80



>gb|KJB20515.1| hypothetical protein B456_003G152800 [Gossypium raimondii]
Length=126

 Score = 90.5 bits (223),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/72 (64%), Positives = 56/72 (78%), Gaps = 0/72 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYNxpllxf  307
            HFV+VH  G GAWCWYK+R L+E SGYKVSCIDL  +G+DPSD N I +F DYN PL+  
Sbjct  9    HFVVVHVFGHGAWCWYKIRSLLEASGYKVSCIDLKGSGMDPSDPNTIFSFQDYNKPLIDL  68

Query  308  laslppNXQVIL  343
            L++LP N +VIL
Sbjct  69   LSNLPHNEKVIL  80



>ref|XP_006376560.1| hypothetical protein POPTR_0013s15410g [Populus trichocarpa]
 gb|ERP54357.1| hypothetical protein POPTR_0013s15410g [Populus trichocarpa]
Length=229

 Score = 92.0 bits (227),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +2

Query  119  PPPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYN  289
            P  HFVLVHG+  GAWCWYK+RCLME SG+KV+C+DL SAG+D S+ N ILTF +YN
Sbjct  8    PNLHFVLVHGVCHGAWCWYKIRCLMEKSGHKVTCLDLKSAGIDQSNPNTILTFDEYN  64



>ref|XP_006376559.1| hypothetical protein POPTR_0013s15410g [Populus trichocarpa]
 gb|ERP54356.1| hypothetical protein POPTR_0013s15410g [Populus trichocarpa]
Length=246

 Score = 92.4 bits (228),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +2

Query  119  PPPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYN  289
            P  HFVLVHG+  GAWCWYK+RCLME SG+KV+C+DL SAG+D S+ N ILTF +YN
Sbjct  8    PNLHFVLVHGVCHGAWCWYKIRCLMEKSGHKVTCLDLKSAGIDQSNPNTILTFDEYN  64



>gb|ABK95513.1| unknown [Populus trichocarpa]
Length=260

 Score = 92.4 bits (228),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +2

Query  119  PPPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYN  289
            P  HFVLVHG+  GAWCWYK+RCLME SG+KV+C+DL SAG+D S+ N ILTF +YN
Sbjct  8    PNLHFVLVHGVCHGAWCWYKIRCLMEKSGHKVTCLDLKSAGIDQSNPNTILTFDEYN  64



>ref|XP_002884817.1| hypothetical protein ARALYDRAFT_478421 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61076.1| hypothetical protein ARALYDRAFT_478421 [Arabidopsis lyrata subsp. 
lyrata]
Length=275

 Score = 92.4 bits (228),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 50/90 (56%), Positives = 63/90 (70%), Gaps = 2/90 (2%)
 Frame = +2

Query  80   AEEKIREEVVAPP--PPPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPS  253
            AEE   E V   P   PPHFVL+HG+  G+WCWYK++CLME SG+ V+CIDL S+G+D S
Sbjct  2    AEENQEETVDLKPGRKPPHFVLIHGMSLGSWCWYKIKCLMEVSGFTVTCIDLKSSGIDFS  61

Query  254  DANDILTFXDYNxpllxflaslppNXQVIL  343
             A+ + TF  YN PL+ FL+S P   QVIL
Sbjct  62   SADSLTTFDQYNQPLIDFLSSFPEQEQVIL  91



>gb|ABK95809.1| unknown [Populus trichocarpa]
Length=277

 Score = 92.4 bits (228),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +2

Query  119  PPPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYN  289
            P  HFVLVHG+  GAWCWYK+RCLME SG+KV+C+DL SAG+D S+ N ILTF +YN
Sbjct  8    PNLHFVLVHGVCHGAWCWYKIRCLMEKSGHKVTCLDLKSAGIDQSNPNTILTFDEYN  64



>ref|XP_008245182.1| PREDICTED: methylesterase 17 [Prunus mume]
Length=240

 Score = 92.0 bits (227),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = +2

Query  131  FVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYN  289
             VL+HG+G GAWCWYK+RCL+E SGYKV+C+DL  AG+D SD N ILTF DYN
Sbjct  33   LVLIHGIGHGAWCWYKIRCLLEASGYKVTCLDLKGAGIDQSDPNTILTFQDYN  85



>ref|XP_009626844.1| PREDICTED: methylesterase 17 [Nicotiana tomentosiformis]
Length=280

 Score = 92.4 bits (228),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 67/99 (68%), Gaps = 4/99 (4%)
 Frame = +2

Query  47   MGGESFETKKTAEEKIREEVVAPPPPPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCID  226
            MG E F   +  +   +EE+       HFVLVHG+ GG WCWYK++ LME SGYKV+C+D
Sbjct  1    MGEEYFVETEKMKLVEKEELSQT----HFVLVHGISGGGWCWYKIKSLMEISGYKVTCLD  56

Query  227  LSSAGVDPSDANDILTFXDYNxpllxflaslppNXQVIL  343
            L  AG+ P+D   +L+F DYN PL+ FL+SLP N QVIL
Sbjct  57   LKGAGIHPTDPTTLLSFDDYNEPLIDFLSSLPENEQVIL  95



>ref|XP_007205683.1| hypothetical protein PRUPE_ppa009635mg [Prunus persica]
 gb|EMJ06882.1| hypothetical protein PRUPE_ppa009635mg [Prunus persica]
Length=284

 Score = 92.0 bits (227),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = +2

Query  131  FVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYN  289
             VL+HG+G GAWCWYK+RCL+E SGYKV+C+DL  AG+D SD N ILTF DYN
Sbjct  32   LVLIHGIGHGAWCWYKIRCLLEASGYKVTCLDLKGAGIDQSDPNTILTFQDYN  84



>ref|XP_010486708.1| PREDICTED: methylesterase 17 [Camelina sativa]
Length=278

 Score = 90.9 bits (224),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 48/90 (53%), Positives = 63/90 (70%), Gaps = 2/90 (2%)
 Frame = +2

Query  80   AEEKIREEVVAPP--PPPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPS  253
            AEE   E +   P   PPHFVL+HG+  G+WCWYK++CLME SG+ V+CIDL S+G+D S
Sbjct  2    AEENQEETLELKPIRKPPHFVLIHGMSLGSWCWYKIKCLMEVSGFDVTCIDLKSSGIDSS  61

Query  254  DANDILTFXDYNxpllxflaslppNXQVIL  343
             A+ + +F  YN PL+ FL+S P   QVIL
Sbjct  62   SADSLTSFDQYNQPLIDFLSSSPEEEQVIL  91



>emb|CDY36279.1| BnaA01g31390D [Brassica napus]
Length=276

 Score = 90.9 bits (224),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/73 (60%), Positives = 57/73 (78%), Gaps = 0/73 (0%)
 Frame = +2

Query  125  PHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYNxpllx  304
            PHFVL+HG+  G+WCWYK++CL+E SGY V+CIDL S+G+DPS A+ + +F  YN PL  
Sbjct  19   PHFVLIHGMSLGSWCWYKIKCLLEVSGYTVTCIDLKSSGIDPSSADTLTSFDQYNQPLTD  78

Query  305  flaslppNXQVIL  343
            FL+SLP   QVIL
Sbjct  79   FLSSLPEQEQVIL  91



>gb|KDO60409.1| hypothetical protein CISIN_1g022603mg [Citrus sinensis]
Length=206

 Score = 89.7 bits (221),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/85 (52%), Positives = 61/85 (72%), Gaps = 0/85 (0%)
 Frame = +2

Query  89   KIREEVVAPPPPPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDI  268
            KI+E+ +      HFV+VHG   GAWCW+K+R L+E SGYKV+C+DL+SAG+D +D N +
Sbjct  24   KIKEDKIHSSMMSHFVMVHGASHGAWCWFKVRALLETSGYKVTCLDLTSAGIDRTDPNTV  83

Query  269  LTFXDYNxpllxflaslppNXQVIL  343
             T  +YN PL+  L +LP N +VIL
Sbjct  84   FTLEEYNKPLINLLHNLPHNEKVIL  108



>ref|XP_010491291.1| PREDICTED: methylesterase 17-like [Camelina sativa]
Length=279

 Score = 90.9 bits (224),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 48/91 (53%), Positives = 64/91 (70%), Gaps = 3/91 (3%)
 Frame = +2

Query  80   AEEKIREEVVAPPP---PPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDP  250
            AEE  +EE +   P   PP FVL+HG+  G+WCWYK++CLME SG+ V+CIDL S+G+D 
Sbjct  2    AEENHQEETLELKPIRKPPQFVLIHGMSLGSWCWYKIKCLMEVSGFDVTCIDLKSSGIDS  61

Query  251  SDANDILTFXDYNxpllxflaslppNXQVIL  343
            S A+ + +F  YN PL+ FL+S P   QVIL
Sbjct  62   SSADTLTSFDQYNQPLIDFLSSSPEEEQVIL  92



>ref|NP_187698.1| methyl esterase 17 [Arabidopsis thaliana]
 sp|Q9SG92.1|MES17_ARATH RecName: Full=Methylesterase 17; Short=AtMES17; AltName: Full=Methyl 
indole-3-acetic acid esterase [Arabidopsis thaliana]
 gb|AAF19562.1|AC011708_5 putative alpha-hydroxynitrile lyase [Arabidopsis thaliana]
 gb|AAL36348.1| putative alpha-hydroxynitrile lyase [Arabidopsis thaliana]
 gb|AAM20326.1| putative alpha-hydroxynitrile lyase [Arabidopsis thaliana]
 gb|AEE74965.1| methyl esterase 17 [Arabidopsis thaliana]
Length=276

 Score = 90.9 bits (224),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 48/90 (53%), Positives = 62/90 (69%), Gaps = 2/90 (2%)
 Frame = +2

Query  80   AEEKIREEVVAPPP--PPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPS  253
            AEE   E +   P   PPHFVL+HG+  G+WCWYK++CLME SG+ V+CIDL S+G+D S
Sbjct  2    AEENQEETLELKPSRKPPHFVLIHGMSLGSWCWYKIKCLMEVSGFTVTCIDLKSSGIDSS  61

Query  254  DANDILTFXDYNxpllxflaslppNXQVIL  343
              + + TF  YN PL+ FL+S P   QVIL
Sbjct  62   SVDSLTTFDQYNQPLIDFLSSFPEQEQVIL  91



>ref|XP_009122575.1| PREDICTED: methylesterase 17 [Brassica rapa]
Length=276

 Score = 90.5 bits (223),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/73 (60%), Positives = 58/73 (79%), Gaps = 0/73 (0%)
 Frame = +2

Query  125  PHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYNxpllx  304
            PHFVL+HG+  G+WCWYK++CL+E SGY V+CIDL S+G+DPS A+ + +F  YN PL+ 
Sbjct  19   PHFVLIHGMSLGSWCWYKIKCLLEVSGYTVTCIDLKSSGIDPSSADTLTSFDQYNQPLVD  78

Query  305  flaslppNXQVIL  343
            FL+SLP   QVIL
Sbjct  79   FLSSLPEQEQVIL  91



>ref|XP_010464778.1| PREDICTED: methylesterase 17-like [Camelina sativa]
Length=279

 Score = 90.1 bits (222),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 47/89 (53%), Positives = 64/89 (72%), Gaps = 3/89 (3%)
 Frame = +2

Query  86   EKIREEVVAPPP---PPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSD  256
            E  +EE +   P   PPHFVL+HG+  G+WCWYK++CLME SG+ V+CIDL S+G+D S 
Sbjct  3    EDNQEETLELKPGRKPPHFVLIHGMSLGSWCWYKIKCLMEVSGFDVTCIDLKSSGIDSSS  62

Query  257  ANDILTFXDYNxpllxflaslppNXQVIL  343
            A+ + +F  YN PL+ FL+S+P   QVIL
Sbjct  63   ADSLTSFDQYNQPLIDFLSSIPEQEQVIL  91



>ref|XP_010670053.1| PREDICTED: methylesterase 17 [Beta vulgaris subsp. vulgaris]
Length=274

 Score = 90.1 bits (222),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 57/72 (79%), Gaps = 0/72 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYNxpllxf  307
            HF+LVHG   G WCWYK+R L+E+SGY V+C+DL S+G++PSDAN I TF DYN PL+  
Sbjct  20   HFILVHGASHGGWCWYKVRTLLESSGYLVTCLDLKSSGIEPSDANSIATFQDYNQPLIDL  79

Query  308  laslppNXQVIL  343
            LASLP + +VIL
Sbjct  80   LASLPIHTKVIL  91



>ref|XP_006357300.1| PREDICTED: methylesterase 17-like [Solanum tuberosum]
Length=275

 Score = 89.4 bits (220),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 43/72 (60%), Positives = 55/72 (76%), Gaps = 0/72 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYNxpllxf  307
            HFVL+HG+ GG WCWYK++ LME SGYKV+C+DL  +G+ P D   I++F DYN PL+ F
Sbjct  23   HFVLIHGISGGGWCWYKIKSLMEISGYKVTCLDLKGSGIHPHDPTTIISFDDYNQPLINF  82

Query  308  laslppNXQVIL  343
             +SLP N QVIL
Sbjct  83   FSSLPQNEQVIL  94



>gb|KDO60408.1| hypothetical protein CISIN_1g022603mg [Citrus sinensis]
Length=294

 Score = 89.4 bits (220),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 44/85 (52%), Positives = 61/85 (72%), Gaps = 0/85 (0%)
 Frame = +2

Query  89   KIREEVVAPPPPPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDI  268
            KI+E+ +      HFV+VHG   GAWCW+K+R L+E SGYKV+C+DL+SAG+D +D N +
Sbjct  24   KIKEDKIHSSMMSHFVMVHGASHGAWCWFKVRALLETSGYKVTCLDLTSAGIDRTDPNTV  83

Query  269  LTFXDYNxpllxflaslppNXQVIL  343
             T  +YN PL+  L +LP N +VIL
Sbjct  84   FTLEEYNKPLINLLHNLPHNEKVIL  108



>ref|XP_009777586.1| PREDICTED: methylesterase 17-like [Nicotiana sylvestris]
Length=280

 Score = 89.0 bits (219),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 56/72 (78%), Gaps = 0/72 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYNxpllxf  307
            HFVLVHG+ GG WCWYK++ LME S YKV+C+DL  AG+ P+D   +L+F DYN PL+ F
Sbjct  24   HFVLVHGISGGGWCWYKIKSLMEISCYKVTCLDLKGAGIHPADPTTVLSFDDYNEPLIEF  83

Query  308  laslppNXQVIL  343
            L+SLP N QVIL
Sbjct  84   LSSLPENEQVIL  95



>ref|XP_006443782.1| hypothetical protein CICLE_v10021442mg [Citrus clementina]
 ref|XP_006479484.1| PREDICTED: methylesterase 17-like [Citrus sinensis]
 gb|ESR57022.1| hypothetical protein CICLE_v10021442mg [Citrus clementina]
Length=294

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/85 (52%), Positives = 60/85 (71%), Gaps = 0/85 (0%)
 Frame = +2

Query  89   KIREEVVAPPPPPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDI  268
            KI+E+ +      HFV+VHG   GAWCW+K+R L+E SGYKV+C+DL SAG+D +D N +
Sbjct  24   KIKEDKIHSSMMSHFVMVHGASHGAWCWFKVRALLETSGYKVTCLDLKSAGIDRTDPNTV  83

Query  269  LTFXDYNxpllxflaslppNXQVIL  343
             T  +YN PL+  L +LP N +VIL
Sbjct  84   FTLEEYNKPLINLLHNLPHNEKVIL  108



>gb|ABA95647.1| hypothetical protein LOC_Os12g02510 [Oryza sativa Japonica Group]
Length=126

 Score = 85.9 bits (211),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYN  289
            HFVLVHG G G+WCW+KLR L+E+SGY+V+CIDL+ AGVDP+D N + +F  Y+
Sbjct  5    HFVLVHGEGHGSWCWFKLRWLLESSGYQVTCIDLAGAGVDPTDPNTVRSFEQYD  58



>ref|XP_009406049.1| PREDICTED: methylesterase 17-like [Musa acuminata subsp. malaccensis]
Length=258

 Score = 87.8 bits (216),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 57/72 (79%), Gaps = 0/72 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYNxpllxf  307
            HFVLVHG G GAWCW+KLRCL+E SG++VSC DL+SAG+ P+D N IL+  +Y+ PL   
Sbjct  9    HFVLVHGAGHGAWCWFKLRCLLEASGHRVSCPDLASAGIHPADPNSILSIDEYDAPLFSI  68

Query  308  laslppNXQVIL  343
            +++LP + +VIL
Sbjct  69   MSALPEHEKVIL  80



>gb|EEC68737.1| hypothetical protein OsI_37244 [Oryza sativa Indica Group]
Length=250

 Score = 87.0 bits (214),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 41/72 (57%), Positives = 58/72 (81%), Gaps = 0/72 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYNxpllxf  307
            HFVLVHG G G+WCW+KLR L+E+SGY+V+CIDL+ AGVDP+D N + +F  Y+ PLL  
Sbjct  5    HFVLVHGEGHGSWCWFKLRWLLESSGYQVTCIDLAGAGVDPTDPNTVRSFEQYDKPLLDL  64

Query  308  laslppNXQVIL  343
            ++++P + +VIL
Sbjct  65   ISAIPEDEKVIL  76



>gb|EEE52649.1| hypothetical protein OsJ_35011 [Oryza sativa Japonica Group]
Length=250

 Score = 87.0 bits (214),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 41/72 (57%), Positives = 58/72 (81%), Gaps = 0/72 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYNxpllxf  307
            HFVLVHG G G+WCW+KLR L+E+SGY+V+CIDL+ AGVDP+D N + +F  Y+ PLL  
Sbjct  5    HFVLVHGEGHGSWCWFKLRWLLESSGYQVTCIDLAGAGVDPTDPNTVRSFEQYDKPLLDL  64

Query  308  laslppNXQVIL  343
            ++++P + +VIL
Sbjct  65   ISAIPEDEKVIL  76



>ref|NP_001065998.2| Os12g0117200 [Oryza sativa Japonica Group]
 dbj|BAF29017.2| Os12g0117200 [Oryza sativa Japonica Group]
Length=252

 Score = 87.0 bits (214),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 41/72 (57%), Positives = 58/72 (81%), Gaps = 0/72 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYNxpllxf  307
            HFVLVHG G G+WCW+KLR L+E+SGY+V+CIDL+ AGVDP+D N + +F  Y+ PLL  
Sbjct  7    HFVLVHGEGHGSWCWFKLRWLLESSGYQVTCIDLAGAGVDPTDPNTVRSFEQYDKPLLDL  66

Query  308  laslppNXQVIL  343
            ++++P + +VIL
Sbjct  67   ISAIPEDEKVIL  78



>ref|XP_006407497.1| hypothetical protein EUTSA_v10021291mg [Eutrema salsugineum]
 gb|ESQ48950.1| hypothetical protein EUTSA_v10021291mg [Eutrema salsugineum]
Length=279

 Score = 87.0 bits (214),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 47/89 (53%), Positives = 64/89 (72%), Gaps = 3/89 (3%)
 Frame = +2

Query  86   EKIREEVVAPPP---PPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSD  256
            E+ +EE +   P    PHFVL+HG+  G+WCWYK++CLME SG+ V+CI+L S+G+D S 
Sbjct  3    EENQEEALGLKPRRKQPHFVLIHGMSLGSWCWYKIKCLMEVSGFAVTCINLKSSGIDSSS  62

Query  257  ANDILTFXDYNxpllxflaslppNXQVIL  343
            A+ I +F  YN PL+ FL+SLP   QVIL
Sbjct  63   ADSITSFDQYNQPLIDFLSSLPEQEQVIL  91



>ref|XP_010931511.1| PREDICTED: methylesterase 17-like [Elaeis guineensis]
Length=266

 Score = 86.7 bits (213),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 51/65 (78%), Gaps = 1/65 (2%)
 Frame = +2

Query  98   EEVVAPP-PPPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILT  274
            EEVV     P HFV VHG+G GAWCW+K+R L+E SG++V+C+DL+SAG+D +D N +L+
Sbjct  3    EEVVTDAFQPQHFVFVHGVGHGAWCWFKVRHLLEGSGHRVTCLDLTSAGIDRTDPNSVLS  62

Query  275  FXDYN  289
            F +Y+
Sbjct  63   FEEYD  67



>ref|NP_001065594.1| Os11g0118000 [Oryza sativa Japonica Group]
 gb|ABA91260.1| hydrolase, alpha/beta fold family protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF27439.1| Os11g0118000 [Oryza sativa Japonica Group]
Length=252

 Score = 86.3 bits (212),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 40/72 (56%), Positives = 58/72 (81%), Gaps = 0/72 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYNxpllxf  307
            HFVL+HG G G+WCW+KLR L+E+SGY+V+CIDL+ AGVDP+D N + +F  Y+ PLL  
Sbjct  7    HFVLIHGEGHGSWCWFKLRWLLESSGYQVTCIDLAGAGVDPTDPNTVQSFEQYDKPLLDL  66

Query  308  laslppNXQVIL  343
            ++++P + +VIL
Sbjct  67   ISAIPEDEKVIL  78



>gb|EEC67553.1| hypothetical protein OsI_34886 [Oryza sativa Indica Group]
 gb|EEE51535.1| hypothetical protein OsJ_32737 [Oryza sativa Japonica Group]
Length=250

 Score = 86.3 bits (212),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 40/72 (56%), Positives = 58/72 (81%), Gaps = 0/72 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYNxpllxf  307
            HFVL+HG G G+WCW+KLR L+E+SGY+V+CIDL+ AGVDP+D N + +F  Y+ PLL  
Sbjct  5    HFVLIHGEGHGSWCWFKLRWLLESSGYQVTCIDLAGAGVDPTDPNTVQSFEQYDKPLLDL  64

Query  308  laslppNXQVIL  343
            ++++P + +VIL
Sbjct  65   ISAIPEDEKVIL  76



>ref|XP_006662681.1| PREDICTED: methylesterase 17-like [Oryza brachyantha]
Length=252

 Score = 86.3 bits (212),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 41/72 (57%), Positives = 56/72 (78%), Gaps = 0/72 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYNxpllxf  307
            HFVLVHG G GAWCW+KLR L+E+SGY+V+CIDL+  GVDP+D N + +F  Y+ PLL  
Sbjct  7    HFVLVHGEGHGAWCWFKLRWLLESSGYRVTCIDLAGGGVDPTDPNSVRSFEHYDKPLLDL  66

Query  308  laslppNXQVIL  343
            ++++P   +VIL
Sbjct  67   ISTMPEGEKVIL  78



>ref|XP_006574372.1| PREDICTED: uncharacterized protein LOC100527539 isoform X1 [Glycine 
max]
Length=288

 Score = 85.9 bits (211),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 52/76 (68%), Positives = 62/76 (82%), Gaps = 0/76 (0%)
 Frame = +2

Query  116  PPPPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYNxp  295
            P   HFVLVHG+GGG WCWYK+RCLMENSG+KVSCIDL SAG+D SD + +L+F DYN P
Sbjct  24   PLKQHFVLVHGVGGGGWCWYKIRCLMENSGFKVSCIDLKSAGIDQSDVDSVLSFDDYNQP  83

Query  296  llxflaslppNXQVIL  343
            L+  L++LP N QVIL
Sbjct  84   LMDLLSALPENEQVIL  99



>ref|XP_004978521.1| PREDICTED: methylesterase 17-like [Setaria italica]
Length=252

 Score = 85.5 bits (210),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYN  289
            HFVLVHG G GAWCW+KLR L+E SGY+V+CIDL+  GVDP+D N + +F  Y+
Sbjct  7    HFVLVHGEGHGAWCWFKLRWLLEGSGYRVTCIDLAGGGVDPTDPNTVRSFKQYD  60



>ref|XP_010094434.1| hypothetical protein L484_018804 [Morus notabilis]
 gb|EXB56015.1| hypothetical protein L484_018804 [Morus notabilis]
Length=451

 Score = 87.4 bits (215),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 49/69 (71%), Gaps = 7/69 (10%)
 Frame = +2

Query  83   EEKIREEVVAPPPPPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDAN  262
            EEK ++++       HFVLVHG G G WCWYK+R L+E SG+KV+C+DL  +G+DP+D N
Sbjct  161  EEKAKQQL-------HFVLVHGAGHGGWCWYKIRTLLEASGHKVTCLDLKCSGIDPTDFN  213

Query  263  DILTFXDYN  289
             + TF  YN
Sbjct  214  SVFTFAQYN  222


 Score = 84.7 bits (208),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYN  289
            HFVLVHG G GAWCWY+LR L+E SG+KVS IDL S+G+DP++ + + TF +YN
Sbjct  11   HFVLVHGAGHGAWCWYRLRTLLEASGHKVSAIDLKSSGIDPTNFDAVFTFQEYN  64



>ref|XP_004977392.1| PREDICTED: methylesterase 17-like [Setaria italica]
Length=252

 Score = 85.1 bits (209),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYN  289
            HFVLVHG G GAWCW+KLR L+E SGY+V+CIDL+  GVDP+D N + +F  Y+
Sbjct  7    HFVLVHGEGHGAWCWFKLRWLLEGSGYRVTCIDLAGGGVDPTDPNTVWSFKQYD  60



>gb|KHN19243.1| Pheophorbidase [Glycine soja]
Length=288

 Score = 85.5 bits (210),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 51/72 (71%), Positives = 61/72 (85%), Gaps = 0/72 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYNxpllxf  307
            HFVLVHG+GGG WCWYK+RCLMENSG+KVSCIDL SAG+D SD + +L+F DYN PL+  
Sbjct  28   HFVLVHGVGGGGWCWYKIRCLMENSGFKVSCIDLKSAGIDQSDVDSVLSFDDYNQPLMDL  87

Query  308  laslppNXQVIL  343
            L++LP N QVIL
Sbjct  88   LSALPENEQVIL  99



>gb|KFK38476.1| hypothetical protein AALP_AA3G117800 [Arabis alpina]
Length=276

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/74 (58%), Positives = 56/74 (76%), Gaps = 0/74 (0%)
 Frame = +2

Query  122  PPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYNxpll  301
            PPHFVL+HG+  G+W WYK++CLME SG+ V+CIDL S G+D S A+ + +F  YN PL+
Sbjct  4    PPHFVLIHGMSLGSWSWYKIKCLMEASGFTVTCIDLKSCGIDSSSADSLTSFDQYNQPLI  63

Query  302  xflaslppNXQVIL  343
             FL+SLP   QVIL
Sbjct  64   DFLSSLPEQEQVIL  77



>ref|XP_002448907.1| hypothetical protein SORBIDRAFT_05g001250 [Sorghum bicolor]
 gb|EES07895.1| hypothetical protein SORBIDRAFT_05g001250 [Sorghum bicolor]
Length=251

 Score = 85.1 bits (209),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYN  289
            HFVLVHG G GAWCW+KLR L+E +GY+V+CIDL+  GVDP+D N I +F  Y+
Sbjct  6    HFVLVHGEGHGAWCWFKLRWLLEGAGYRVTCIDLAGGGVDPTDPNTIRSFKQYD  59



>ref|XP_008788157.1| PREDICTED: methylesterase 17 [Phoenix dactylifera]
Length=265

 Score = 84.7 bits (208),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 51/65 (78%), Gaps = 1/65 (2%)
 Frame = +2

Query  98   EEVVAPP-PPPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILT  274
            EEV+A    P HFV VHG+G GAWCW+KLR L+E SG++VSC+DL+SAG+D + A+ + +
Sbjct  3    EEVIAEAFQPQHFVFVHGVGHGAWCWFKLRHLLEASGHRVSCLDLTSAGIDRTGADSVRS  62

Query  275  FXDYN  289
            F +Y+
Sbjct  63   FEEYD  67



>ref|XP_008669935.1| PREDICTED: methylesterase 17-like isoform X2 [Zea mays]
 tpg|DAA39314.1| TPA: hypothetical protein ZEAMMB73_815569 [Zea mays]
Length=179

 Score = 83.6 bits (205),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYN  289
            HFVLVHG G GAWCW+KLR L+E +GY V+CIDL+  GVDP+D N I +F  Y+
Sbjct  8    HFVLVHGEGHGAWCWFKLRWLLEGAGYHVTCIDLAGGGVDPTDPNTIRSFQQYD  61



>ref|XP_008669934.1| PREDICTED: methylesterase 17-like isoform X1 [Zea mays]
Length=253

 Score = 84.0 bits (206),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYN  289
            HFVLVHG G GAWCW+KLR L+E +GY V+CIDL+  GVDP+D N I +F  Y+
Sbjct  8    HFVLVHGEGHGAWCWFKLRWLLEGAGYHVTCIDLAGGGVDPTDPNTIRSFQQYD  61



>gb|EMS56887.1| hypothetical protein TRIUR3_06889 [Triticum urartu]
Length=250

 Score = 84.0 bits (206),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 41/72 (57%), Positives = 55/72 (76%), Gaps = 0/72 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYNxpllxf  307
            HFVLVHG G G WCW+KLR L+E SGY+V+CIDL+ +GVDP+D N + +F  Y+ PLL  
Sbjct  5    HFVLVHGEGHGGWCWFKLRWLLEGSGYQVTCIDLAGSGVDPTDPNTVRSFDQYDKPLLRL  64

Query  308  laslppNXQVIL  343
            +++LP   +VIL
Sbjct  65   ISALPEGEKVIL  76



>ref|NP_001152091.1| esterase PIR7A [Zea mays]
 gb|ACG45749.1| esterase PIR7A [Zea mays]
 gb|AFW64635.1| esterase PIR7A [Zea mays]
Length=253

 Score = 82.4 bits (202),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYN  289
            HFVLVHG G GAWCW+KLR L+E +G++V+C+DL+  GVDP+D N I +F  Y+
Sbjct  8    HFVLVHGEGHGAWCWFKLRWLLEGAGHRVTCVDLAGGGVDPTDPNTIRSFKQYD  61



>ref|XP_003577845.1| PREDICTED: methylesterase 17-like [Brachypodium distachyon]
Length=250

 Score = 81.3 bits (199),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYN  289
            H VLVHG G G WCW+KLR L+E SGY+V+CIDL+  GVDP+D N + +F  Y+
Sbjct  5    HLVLVHGEGHGGWCWFKLRWLLEGSGYRVTCIDLAGGGVDPTDPNTVRSFEQYD  58



>gb|EMT23896.1| hypothetical protein F775_02537 [Aegilops tauschii]
Length=250

 Score = 81.3 bits (199),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 40/72 (56%), Positives = 53/72 (74%), Gaps = 0/72 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYNxpllxf  307
            H VLVHG G G WCW+KLR L+E SGY+V+CIDL+  GVDP+D N + +F  Y+ PLL  
Sbjct  5    HLVLVHGEGHGGWCWFKLRWLLEGSGYQVTCIDLAGGGVDPTDPNTVRSFEQYDKPLLRL  64

Query  308  laslppNXQVIL  343
            +++LP   +VIL
Sbjct  65   ISALPEGEKVIL  76



>ref|NP_001239778.1| uncharacterized protein LOC100803613 [Glycine max]
 gb|ACU19012.1| unknown [Glycine max]
 gb|KHN42051.1| Polyneuridine-aldehyde esterase [Glycine soja]
Length=261

 Score = 81.3 bits (199),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 58/72 (81%), Gaps = 0/72 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYNxpllxf  307
            HFVLVHG+G GAWCWYKL+ L+E++G+KV+ +DL+++G+D  D  DI TF +Y+ PLL  
Sbjct  10   HFVLVHGIGHGAWCWYKLKPLLESAGHKVTVLDLAASGIDTHDIEDIHTFSEYSKPLLDL  69

Query  308  laslppNXQVIL  343
            LASL PN +V+L
Sbjct  70   LASLAPNEKVVL  81



>ref|XP_006842543.1| hypothetical protein AMTR_s00077p00129970 [Amborella trichopoda]
 gb|ERN04218.1| hypothetical protein AMTR_s00077p00129970 [Amborella trichopoda]
Length=258

 Score = 80.5 bits (197),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = +2

Query  116  PPPPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYNxp  295
            P   HFVLVHG   GAWCWYK   L++NSG+KV+ +DL  AG+DP ++N IL F +YN P
Sbjct  5    PATRHFVLVHGFCHGAWCWYKTASLLKNSGFKVTAVDLGGAGIDPGNSNSILQFDEYNKP  64

Query  296  llxflaslppNXQVIL  343
            L+  L+++P + +VIL
Sbjct  65   LIDLLSAIPEDEKVIL  80



>ref|XP_006851246.1| hypothetical protein AMTR_s00180p00034130 [Amborella trichopoda]
 gb|ERN12827.1| hypothetical protein AMTR_s00180p00034130 [Amborella trichopoda]
Length=257

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = +2

Query  116  PPPPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYNxp  295
            P   HFVLVHG   GAWCWYK+  L+ N G+KVS +DL+ AG+DP DA+ I +F +YN P
Sbjct  5    PGIQHFVLVHGACHGAWCWYKIVSLLRNKGHKVSAVDLAGAGIDPRDADSIFSFEEYNKP  64

Query  296  llxflaslppNXQVIL  343
            L+  ++++P + +VIL
Sbjct  65   LIDLISTIPDDEKVIL  80



>ref|XP_006842541.1| hypothetical protein AMTR_s00077p00129560 [Amborella trichopoda]
 gb|ERN04216.1| hypothetical protein AMTR_s00077p00129560 [Amborella trichopoda]
Length=257

 Score = 77.4 bits (189),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 44/58 (76%), Gaps = 0/58 (0%)
 Frame = +2

Query  116  PPPPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYN  289
            P   HFVLVHG+  GAWCWYK+  L++NSG KV+ +DL  AG++P +A+ IL+F +YN
Sbjct  5    PATRHFVLVHGICHGAWCWYKIASLLKNSGVKVTAVDLGGAGINPGNADSILSFEEYN  62



>ref|XP_006842540.1| hypothetical protein AMTR_s00077p00129020 [Amborella trichopoda]
 gb|ERN04215.1| hypothetical protein AMTR_s00077p00129020 [Amborella trichopoda]
Length=255

 Score = 77.4 bits (189),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 55/80 (69%), Gaps = 0/80 (0%)
 Frame = +2

Query  104  VVAPPPPPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXD  283
            +V  P   HFVL+HG   GAWCWYK+  L++++GYKVS +DL  AG++  +A+ I TF +
Sbjct  1    MVETPATKHFVLIHGACHGAWCWYKMASLLKSAGYKVSAVDLGGAGINMGNADSISTFEE  60

Query  284  YNxpllxflaslppNXQVIL  343
            YN P +  ++ +P N +VIL
Sbjct  61   YNRPAIDIISGIPENEKVIL  80



>emb|CDP19580.1| unnamed protein product [Coffea canephora]
Length=264

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYN  289
            HFVLVHG G GAWCWYKL+ L+E++G +V+ IDLS+AG++P   +++ T  DY+
Sbjct  12   HFVLVHGAGHGAWCWYKLKPLLESAGQRVTAIDLSAAGINPKRLDELYTLEDYS  65



>ref|XP_002313085.2| hypothetical protein POPTR_0009s11070g [Populus trichocarpa]
 gb|EEE87040.2| hypothetical protein POPTR_0009s11070g [Populus trichocarpa]
Length=289

 Score = 76.3 bits (186),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 42/75 (56%), Positives = 54/75 (72%), Gaps = 0/75 (0%)
 Frame = +2

Query  119  PPPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYNxpl  298
            P  HFVLVHG G GAWCWYKL  L+ +SG+ V+ IDL+++G+DP   +D+ +  DY  PL
Sbjct  33   PSKHFVLVHGAGHGAWCWYKLVPLLRSSGHNVTTIDLAASGIDPRQISDLQSISDYIRPL  92

Query  299  lxflaslppNXQVIL  343
               LASLPPN +VIL
Sbjct  93   RDLLASLPPNEKVIL  107



>ref|XP_006379213.1| hypothetical protein POPTR_0009s11050g [Populus trichocarpa]
 gb|ERP57010.1| hypothetical protein POPTR_0009s11050g [Populus trichocarpa]
Length=289

 Score = 76.3 bits (186),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 42/75 (56%), Positives = 54/75 (72%), Gaps = 0/75 (0%)
 Frame = +2

Query  119  PPPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYNxpl  298
            P  HFVLVHG G GAWCWYKL  L+ +SG+ V+ IDL+++G+DP   +D+ +  DY  PL
Sbjct  33   PSKHFVLVHGAGHGAWCWYKLVPLLRSSGHNVTTIDLAASGIDPRQISDLQSISDYIRPL  92

Query  299  lxflaslppNXQVIL  343
               LASLPPN +VIL
Sbjct  93   RDLLASLPPNEKVIL  107



>ref|XP_002313084.2| hypothetical protein POPTR_0009s11040g [Populus trichocarpa]
 gb|EEE87039.2| hypothetical protein POPTR_0009s11040g [Populus trichocarpa]
Length=289

 Score = 75.9 bits (185),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 42/75 (56%), Positives = 54/75 (72%), Gaps = 0/75 (0%)
 Frame = +2

Query  119  PPPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYNxpl  298
            P  HFVLVHG G GAWCWYKL  L+ +SG+ V+ IDL+++G+DP   +D+ +  DY  PL
Sbjct  33   PSKHFVLVHGAGHGAWCWYKLVPLLRSSGHNVTTIDLAASGIDPRQISDLQSISDYIRPL  92

Query  299  lxflaslppNXQVIL  343
               LASLPPN +VIL
Sbjct  93   RDLLASLPPNDKVIL  107



>ref|XP_006843726.1| hypothetical protein AMTR_s00007p00221390 [Amborella trichopoda]
 gb|ERN05401.1| hypothetical protein AMTR_s00007p00221390 [Amborella trichopoda]
Length=259

 Score = 75.5 bits (184),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 44/58 (76%), Gaps = 0/58 (0%)
 Frame = +2

Query  116  PPPPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYN  289
            P   H VLVHG+  GAWCWYK+  L++NSG+KV+ +DL  AG++P +A+ I++F +YN
Sbjct  5    PGTRHVVLVHGVCHGAWCWYKIASLLKNSGFKVTAVDLGGAGINPKNADSIVSFEEYN  62



>gb|ABK26618.1| unknown [Picea sitchensis]
Length=276

 Score = 74.7 bits (182),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYN  289
            HFVLVHG   GAWCWYK+  L+E  G+KVS IDL SAG +P  A+ I++F +YN
Sbjct  24   HFVLVHGAMHGAWCWYKIVELLEKDGHKVSAIDLMSAGTNPVAADSIMSFEEYN  77



>emb|CDP19577.1| unnamed protein product [Coffea canephora]
Length=267

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYN  289
            HFVLVHG   GAWCWYKL+ L+E++G +V+ IDLS+AG++P   +++ T  DY+
Sbjct  12   HFVLVHGACHGAWCWYKLKPLLESAGQRVTAIDLSAAGINPKRLDEVYTLEDYS  65



>ref|XP_006847411.1| hypothetical protein AMTR_s00153p00056390 [Amborella trichopoda]
 gb|ERN08992.1| hypothetical protein AMTR_s00153p00056390 [Amborella trichopoda]
Length=260

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/76 (49%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = +2

Query  116  PPPPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYNxp  295
            P   HFVLVHG   GAWCWYK   L+++SG+KV+ +DL  +G+ P +A+ IL+F +YN P
Sbjct  5    PATQHFVLVHGTCHGAWCWYKTASLLKDSGFKVTAVDLCGSGLHPGNADSILSFEEYNKP  64

Query  296  llxflaslppNXQVIL  343
            L+  L+++P + +VIL
Sbjct  65   LMDLLSTIPEDEKVIL  80



>emb|CDP19578.1| unnamed protein product [Coffea canephora]
Length=266

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYN  289
            HFVLVHG   GAWCWYKL+ L+E++G +V+ IDLS+AG++P    ++ T  DY+
Sbjct  12   HFVLVHGACHGAWCWYKLKPLLESAGQRVTAIDLSAAGINPKRLEEVYTLEDYS  65



>ref|XP_010938436.1| PREDICTED: salicylic acid-binding protein 2-like [Elaeis guineensis]
Length=270

 Score = 73.2 bits (178),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDY  286
            HF+LVHG+G GAWCWYKL  L+ ++G++V+  DL+++GV P + +++ +F DY
Sbjct  16   HFILVHGIGHGAWCWYKLATLLTSAGHRVTAFDLAASGVHPKNLHELRSFTDY  68



>ref|XP_002522351.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF40035.1| conserved hypothetical protein [Ricinus communis]
Length=214

 Score = 72.8 bits (177),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 27/53 (51%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDY  286
            HFVLVHG G GAWCWYK+  L++++G+KV+ +D++++G +P  A D+ +F DY
Sbjct  7    HFVLVHGAGHGAWCWYKVAALLKSAGHKVTALDMAASGENPRQAKDLHSFSDY  59



>gb|ABK23030.1| unknown [Picea sitchensis]
Length=278

 Score = 73.2 bits (178),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYN  289
            HFVLVHG   GAWCWYK+  L+E  G++VS IDL SAG +P  A+ I++F +YN
Sbjct  24   HFVLVHGGMHGAWCWYKIMELLEKDGHRVSAIDLMSAGTNPVTADSIMSFEEYN  77



>ref|XP_002866256.1| hydrolase, alpha/beta fold family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH42515.1| hydrolase, alpha/beta fold family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=263

 Score = 72.8 bits (177),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 36/72 (50%), Positives = 50/72 (69%), Gaps = 0/72 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYNxpllxf  307
            HFV VHG G G WCWYKL   +  +G+K +CIDL +AG++P+D N + +  DY+ PL  F
Sbjct  5    HFVFVHGAGHGGWCWYKLANSLRENGHKATCIDLKAAGINPTDPNTVSSLDDYDEPLYAF  64

Query  308  laslppNXQVIL  343
            L+ LP + +VIL
Sbjct  65   LSQLPIDQKVIL  76



>emb|CDY50844.1| BnaC08g47900D [Brassica napus]
Length=263

 Score = 72.8 bits (177),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 51/75 (68%), Gaps = 0/75 (0%)
 Frame = +2

Query  119  PPPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYNxpl  298
            P  HFVLVHG   GAWCWYKL  L+ + G+K + +DL+SAG++ +DAN +  F  YN PL
Sbjct  9    PIIHFVLVHGASHGAWCWYKLTTLLVSDGFKATTVDLTSAGINLTDANTVFEFDHYNRPL  68

Query  299  lxflaslppNXQVIL  343
               L+ +P + ++IL
Sbjct  69   FSLLSDIPHHYKIIL  83



>ref|XP_003565022.2| PREDICTED: esterase PIR7B-like [Brachypodium distachyon]
Length=271

 Score = 72.8 bits (177),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYN  289
            HFVLVHGLG GAWCWYK+  ++E +G++V+ +DL+++GV P    D+ +F DY+
Sbjct  15   HFVLVHGLGHGAWCWYKVVPVLEAAGHRVTALDLAASGVHPGRVEDVHSFEDYS  68



>gb|ABK21272.1| unknown [Picea sitchensis]
 gb|ABK21298.1| unknown [Picea sitchensis]
Length=263

 Score = 72.8 bits (177),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYN  289
            HFVL+HG G GAWCWYKL  L+ NSG+KV+ +DL+ +G++  D + + +F DY+
Sbjct  14   HFVLIHGAGHGAWCWYKLIHLLRNSGHKVTAMDLTGSGLNSVDPDSVTSFEDYD  67



>ref|XP_008789941.1| PREDICTED: probable esterase PIR7A [Phoenix dactylifera]
Length=270

 Score = 72.8 bits (177),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 41/53 (77%), Gaps = 0/53 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDY  286
            HF+LVHG+G GAWCWYKL  L+ ++G++V+ +DL ++GV P   +++ +F DY
Sbjct  16   HFILVHGIGHGAWCWYKLATLLTSAGHRVTALDLGASGVHPKQLDELRSFTDY  68



>ref|NP_200639.1| methyl esterase 18 [Arabidopsis thaliana]
 sp|Q9LVL9.1|MES18_ARATH RecName: Full=Methylesterase 18; Short=AtMES18 [Arabidopsis thaliana]
 dbj|BAA96922.1| polyneuridine aldehyde esterase-like protein [Arabidopsis thaliana]
 gb|AAM61536.1| polyneuridine aldehyde esterase-like [Arabidopsis thaliana]
 gb|AAO42166.1| putative polyneuridine aldehyde esterase [Arabidopsis thaliana]
 gb|AAO64092.1| putative polyneuridine aldehyde esterase [Arabidopsis thaliana]
 gb|AED97032.1| methyl esterase 18 [Arabidopsis thaliana]
Length=263

 Score = 72.4 bits (176),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 36/72 (50%), Positives = 50/72 (69%), Gaps = 0/72 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYNxpllxf  307
            HFV VHG G G WCWYKL   + ++G+K +CIDL  AG++P+D N + +  DY+ PL  F
Sbjct  5    HFVFVHGAGHGGWCWYKLANSLRDNGHKATCIDLKGAGINPTDPNTVSSLDDYDEPLYAF  64

Query  308  laslppNXQVIL  343
            L+ LP + +VIL
Sbjct  65   LSQLPNDQKVIL  76



>ref|XP_008241857.1| PREDICTED: LOW QUALITY PROTEIN: methylesterase 10 [Prunus mume]
Length=261

 Score = 72.4 bits (176),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 42/83 (51%), Positives = 56/83 (67%), Gaps = 5/83 (6%)
 Frame = +2

Query  110  APPPPP-----HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILT  274
            +P P P     HFVLVHG G GAWCWYKL  L+ ++GY V+ +DL+++G +P   N +  
Sbjct  3    SPSPNPEAQKKHFVLVHGAGHGAWCWYKLSALLTSAGYNVTALDLAASGDNPKQINQVHC  62

Query  275  FXDYNxpllxflaslppNXQVIL  343
            F DY  PL+ F+ SLPPN +VIL
Sbjct  63   FADYVEPLIEFIESLPPNERVIL  85



>ref|XP_008810786.1| PREDICTED: polyneuridine-aldehyde esterase-like isoform X2 [Phoenix 
dactylifera]
Length=236

 Score = 72.4 bits (176),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 43/63 (68%), Gaps = 0/63 (0%)
 Frame = +2

Query  98   EEVVAPPPPPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTF  277
            EE        HF+LVHGL  GAWCWYKL  L+ ++G+KV+ +DL ++GV P + +D+ +F
Sbjct  18   EEEREDESKKHFILVHGLCHGAWCWYKLATLLTSAGHKVTWLDLGASGVHPKNLDDLRSF  77

Query  278  XDY  286
             DY
Sbjct  78   TDY  80



>emb|CDP10786.1| unnamed protein product [Coffea canephora]
Length=268

 Score = 72.4 bits (176),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 29/53 (55%), Positives = 41/53 (77%), Gaps = 0/53 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDY  286
            HFVLVHG G GAWCWYKL+ L+E++G +V+ IDLS++G++    ++I T  DY
Sbjct  12   HFVLVHGAGHGAWCWYKLKPLLESTGQRVTAIDLSASGINTKSLDEIHTLHDY  64



>ref|XP_011099230.1| PREDICTED: salicylic acid-binding protein 2-like [Sesamum indicum]
Length=264

 Score = 72.4 bits (176),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYN  289
            H VLVHGL  GAWCWYKL+ L+E +G++V+ +DL+++G+D  +  D+ TF DY+
Sbjct  9    HIVLVHGLCHGAWCWYKLQPLLEAAGHRVTVLDLAASGIDRRNVEDLRTFIDYS  62



>ref|XP_006346482.1| PREDICTED: polyneuridine-aldehyde esterase-like [Solanum tuberosum]
Length=273

 Score = 72.4 bits (176),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 41/61 (67%), Gaps = 0/61 (0%)
 Frame = +2

Query  104  VVAPPPPPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXD  283
            V+ P    HFVLVH LG GAW WYK+  LM +SG+ V+ IDL ++G++P  A +I  F D
Sbjct  12   VLGPKAKKHFVLVHTLGHGAWSWYKIVALMTSSGHNVTAIDLGASGINPKQALEIPHFSD  71

Query  284  Y  286
            Y
Sbjct  72   Y  72



>ref|XP_007199380.1| hypothetical protein PRUPE_ppa025654mg [Prunus persica]
 gb|EMJ00579.1| hypothetical protein PRUPE_ppa025654mg [Prunus persica]
Length=268

 Score = 72.0 bits (175),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 40/57 (70%), Gaps = 0/57 (0%)
 Frame = +2

Query  116  PPPPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDY  286
            P   HFVLVHG   GAW WYKL  LM++SG+ V+ IDL+++GVDP  A D+ +  DY
Sbjct  10   PSKKHFVLVHGSCFGAWSWYKLVTLMKSSGHNVTAIDLAASGVDPQQAKDLQSISDY  66



>ref|XP_010543669.1| PREDICTED: methylesterase 17 [Tarenaya hassleriana]
Length=279

 Score = 72.4 bits (176),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 43/72 (60%), Positives = 56/72 (78%), Gaps = 0/72 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYNxpllxf  307
            HFVL+HG+  G WCWYK++CLME SG+ V+CIDL S+GVD S A+ + +F DYN PL+ F
Sbjct  18   HFVLIHGMSLGGWCWYKIKCLMEVSGFSVTCIDLKSSGVDLSSADSLSSFDDYNQPLVRF  77

Query  308  laslppNXQVIL  343
            L+SL  + QVIL
Sbjct  78   LSSLSEDEQVIL  89



>ref|XP_007200132.1| hypothetical protein PRUPE_ppa017362mg [Prunus persica]
 gb|EMJ01331.1| hypothetical protein PRUPE_ppa017362mg [Prunus persica]
Length=259

 Score = 72.0 bits (175),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 40/57 (70%), Gaps = 0/57 (0%)
 Frame = +2

Query  116  PPPPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDY  286
            P   HFVLVHG   GAW WYKL  LM++SG+ V+ IDL+++GVDP  A D+ +  DY
Sbjct  22   PSKKHFVLVHGSCFGAWSWYKLVTLMKSSGHNVTAIDLAASGVDPQQAKDLQSISDY  78



>ref|XP_010921787.1| PREDICTED: probable esterase PIR7A [Elaeis guineensis]
Length=284

 Score = 72.0 bits (175),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYN  289
            HF+LVHG+G GAWCWYKL  L+ ++G +V+ +DL+++G +P   N++ +F DY+
Sbjct  32   HFILVHGMGHGAWCWYKLAPLLRSAGQRVTALDLAASGRNPEPLNELRSFSDYS  85



>ref|XP_008810785.1| PREDICTED: salicylic acid-binding protein 2-like isoform X1 [Phoenix 
dactylifera]
Length=282

 Score = 72.0 bits (175),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 41/53 (77%), Gaps = 0/53 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDY  286
            HF+LVHGL  GAWCWYKL  L+ ++G+KV+ +DL ++GV P + +D+ +F DY
Sbjct  28   HFILVHGLCHGAWCWYKLATLLTSAGHKVTWLDLGASGVHPKNLDDLRSFTDY  80



>ref|XP_009383535.1| PREDICTED: probable esterase PIR7A [Musa acuminata subsp. malaccensis]
Length=300

 Score = 72.0 bits (175),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 27/53 (51%), Positives = 40/53 (75%), Gaps = 0/53 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDY  286
            HFVLVHG+G GAWCWYKL  L+ ++G+ V+ +DL+ +GV P   +++ +F DY
Sbjct  29   HFVLVHGIGHGAWCWYKLTALLRSAGHTVTALDLAGSGVHPQRLDEVRSFGDY  81



>ref|XP_002973861.1| hypothetical protein SELMODRAFT_100200 [Selaginella moellendorffii]
 gb|EFJ24816.1| hypothetical protein SELMODRAFT_100200 [Selaginella moellendorffii]
Length=301

 Score = 72.0 bits (175),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 39/72 (54%), Positives = 47/72 (65%), Gaps = 0/72 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYNxpllxf  307
            HFVLVHG G GAWCWYK   L+E SG+  S +DL+ +G+D +D N I T   Y  PLL  
Sbjct  25   HFVLVHGAGNGAWCWYKSIALLEESGFTASTVDLTGSGIDHTDPNTISTLSQYVKPLLSL  84

Query  308  laslppNXQVIL  343
            L  LP N +VIL
Sbjct  85   LEKLPDNEKVIL  96



>ref|XP_002983529.1| hypothetical protein SELMODRAFT_118270 [Selaginella moellendorffii]
 gb|EFJ15430.1| hypothetical protein SELMODRAFT_118270 [Selaginella moellendorffii]
Length=303

 Score = 72.0 bits (175),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 39/72 (54%), Positives = 47/72 (65%), Gaps = 0/72 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYNxpllxf  307
            HFVLVHG G GAWCWYK   L+E SG+  S +DL+ +G+D +D N I T   Y  PLL  
Sbjct  25   HFVLVHGAGNGAWCWYKSIALLEESGFTASTVDLTGSGIDHTDPNTISTLSQYVKPLLSL  84

Query  308  laslppNXQVIL  343
            L  LP N +VIL
Sbjct  85   LEKLPDNEKVIL  96



>pdb|2WFL|B Chain B, Crystal Structure Of Polyneuridine Aldehyde Esterase
Length=264

 Score = 71.6 bits (174),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 38/72 (53%), Positives = 57/72 (79%), Gaps = 0/72 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYNxpllxf  307
            HFVLVHG   GAW WYKL+ L+E++G+KV+ +DLS+AG++P   ++I TF DY+ PL+  
Sbjct  12   HFVLVHGGCLGAWIWYKLKPLLESAGHKVTAVDLSAAGINPRRLDEIHTFRDYSEPLMEV  71

Query  308  laslppNXQVIL  343
            +AS+PP+ +V+L
Sbjct  72   MASIPPDEKVVL  83



>ref|XP_010026414.1| PREDICTED: salicylic acid-binding protein 2-like [Eucalyptus 
grandis]
 gb|KCW59300.1| hypothetical protein EUGRSUZ_H01981 [Eucalyptus grandis]
Length=270

 Score = 71.6 bits (174),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 48/75 (64%), Gaps = 10/75 (13%)
 Frame = +2

Query  62   FETKKTAEEKIREEVVAPPPPPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAG  241
             E KKT  E+ R          HFVLVHG   GAWCWY++  L+E+SG+KV+ +D++++G
Sbjct  1    MEDKKTQRERER----------HFVLVHGACHGAWCWYRVATLLESSGHKVTALDMAASG  50

Query  242  VDPSDANDILTFXDY  286
            V+P  A D+ +  +Y
Sbjct  51   VNPKQARDLNSIVEY  65



>emb|CDY53646.1| BnaA08g30360D [Brassica napus]
Length=262

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 51/72 (71%), Gaps = 0/72 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYNxpllxf  307
            HFVLVHG   GAWCWY+L  L+ ++G+K + +DL+SAG++ +DAN +  F  YN PL   
Sbjct  12   HFVLVHGACHGAWCWYRLTTLLLSAGFKATTVDLTSAGINLTDANTVFEFDHYNRPLFSL  71

Query  308  laslppNXQVIL  343
            L+ +P + ++IL
Sbjct  72   LSDIPHHHKIIL  83



>ref|XP_010263778.1| PREDICTED: methylesterase 10-like [Nelumbo nucifera]
Length=266

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 27/53 (51%), Positives = 40/53 (75%), Gaps = 0/53 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDY  286
            HFVLVHG G GAWCWYKL  L+++ G++V+ +DL+++GVDP   N + +  +Y
Sbjct  11   HFVLVHGAGQGAWCWYKLAMLLKSGGHRVTALDLAASGVDPKQLNQVSSVFEY  63



>pdb|3GZJ|A Chain A, Crystal Structure Of Polyneuridine Aldehyde Esterase 
Complexed With 16-Epi-Vellosimine
 pdb|3GZJ|B Chain B, Crystal Structure Of Polyneuridine Aldehyde Esterase 
Complexed With 16-Epi-Vellosimine
 pdb|3GZJ|C Chain C, Crystal Structure Of Polyneuridine Aldehyde Esterase 
Complexed With 16-Epi-Vellosimine
 pdb|3GZJ|D Chain D, Crystal Structure Of Polyneuridine Aldehyde Esterase 
Complexed With 16-Epi-Vellosimine
 pdb|3GZJ|E Chain E, Crystal Structure Of Polyneuridine Aldehyde Esterase 
Complexed With 16-Epi-Vellosimine
Length=258

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 38/72 (53%), Positives = 57/72 (79%), Gaps = 0/72 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYNxpllxf  307
            HFVLVHG   GAW WYKL+ L+E++G+KV+ +DLS+AG++P   ++I TF DY+ PL+  
Sbjct  6    HFVLVHGGCLGAWIWYKLKPLLESAGHKVTAVDLSAAGINPRRLDEIHTFRDYSEPLMEV  65

Query  308  laslppNXQVIL  343
            +AS+PP+ +V+L
Sbjct  66   MASIPPDEKVVL  77



>pdb|2WFL|A Chain A, Crystal Structure Of Polyneuridine Aldehyde Esterase
Length=264

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 38/72 (53%), Positives = 57/72 (79%), Gaps = 0/72 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYNxpllxf  307
            HFVLVHG   GAW WYKL+ L+E++G+KV+ +DLS+AG++P   ++I TF DY+ PL+  
Sbjct  12   HFVLVHGGCLGAWIWYKLKPLLESAGHKVTAVDLSAAGINPRRLDEIHTFRDYSEPLMEV  71

Query  308  laslppNXQVIL  343
            +AS+PP+ +V+L
Sbjct  72   MASIPPDEKVVL  83



>ref|XP_009391582.1| PREDICTED: probable esterase PIR7A [Musa acuminata subsp. malaccensis]
Length=261

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYN  289
            HFVLVHG+G GAWCWYKL  L+  +G++V+ +DL+++GV P   +++ +F DY+
Sbjct  9    HFVLVHGIGHGAWCWYKLVVLLRLAGHRVTTLDLAASGVHPQRLDELESFADYS  62



>ref|XP_010527077.1| PREDICTED: pheophorbidase isoform X2 [Tarenaya hassleriana]
Length=244

 Score = 71.2 bits (173),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 37/54 (69%), Gaps = 0/54 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYN  289
            HFVLVHG   G WCWYKL  L+E SG KV+ +DLS AG+  +D+N +    DYN
Sbjct  31   HFVLVHGASHGGWCWYKLITLLEKSGRKVTAVDLSGAGISLTDSNTVFESDDYN  84



>ref|XP_006288495.1| hypothetical protein CARUB_v10001760mg [Capsella rubella]
 gb|EOA21393.1| hypothetical protein CARUB_v10001760mg [Capsella rubella]
Length=258

 Score = 71.2 bits (173),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/72 (50%), Positives = 53/72 (74%), Gaps = 0/72 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYNxpllxf  307
            HFVLVH    GAW WYKL+ L+E++G++V+ ++L+++G+DP    DI TF +Y+ PL+  
Sbjct  6    HFVLVHNAFHGAWIWYKLKPLLESAGHRVTAVELAASGIDPRPIQDIETFEEYSKPLIET  65

Query  308  laslppNXQVIL  343
            L +LP N QVIL
Sbjct  66   LKALPENEQVIL  77



>ref|XP_009123030.1| PREDICTED: pheophorbidase-like [Brassica rapa]
Length=244

 Score = 71.2 bits (173),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 51/72 (71%), Gaps = 0/72 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYNxpllxf  307
            HFVLVHG   GAWCWY+L  L+ ++G+K + +DL+SAG++ +DAN +  F  YN PL   
Sbjct  12   HFVLVHGACHGAWCWYRLTTLLLSAGFKATTVDLTSAGINLTDANTVFEFDHYNRPLFSL  71

Query  308  laslppNXQVIL  343
            L+ +P + ++IL
Sbjct  72   LSDIPHHHKIIL  83



>pdb|2WFM|A Chain A, Crystal Structure Of Polyneuridine Aldehyde Esterase 
Mutant (H244a)
 pdb|2WFM|B Chain B, Crystal Structure Of Polyneuridine Aldehyde Esterase 
Mutant (H244a)
 pdb|2WFM|C Chain C, Crystal Structure Of Polyneuridine Aldehyde Esterase 
Mutant (H244a)
 pdb|2WFM|D Chain D, Crystal Structure Of Polyneuridine Aldehyde Esterase 
Mutant (H244a)
 pdb|2WFM|E Chain E, Crystal Structure Of Polyneuridine Aldehyde Esterase 
Mutant (H244a)
Length=264

 Score = 71.2 bits (173),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 38/72 (53%), Positives = 57/72 (79%), Gaps = 0/72 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYNxpllxf  307
            HFVLVHG   GAW WYKL+ L+E++G+KV+ +DLS+AG++P   ++I TF DY+ PL+  
Sbjct  12   HFVLVHGGCLGAWIWYKLKPLLESAGHKVTAVDLSAAGINPRRLDEIHTFRDYSEPLMEV  71

Query  308  laslppNXQVIL  343
            +AS+PP+ +V+L
Sbjct  72   MASIPPDEKVVL  83



>sp|Q9SE93.1|PNAE_RAUSE RecName: Full=Polyneuridine-aldehyde esterase; AltName: Full=Polyneuridine 
aldehyde esterase; Flags: Precursor [Rauvolfia 
serpentina]
 gb|AAF22288.1|AF178576_1 polyneuridine aldehyde esterase [Rauvolfia serpentina]
Length=264

 Score = 71.2 bits (173),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 38/72 (53%), Positives = 57/72 (79%), Gaps = 0/72 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYNxpllxf  307
            HFVLVHG   GAW WYKL+ L+E++G+KV+ +DLS+AG++P   ++I TF DY+ PL+  
Sbjct  12   HFVLVHGGCLGAWIWYKLKPLLESAGHKVTAVDLSAAGINPRRLDEIHTFRDYSEPLMEV  71

Query  308  laslppNXQVIL  343
            +AS+PP+ +V+L
Sbjct  72   MASIPPDEKVVL  83



>ref|XP_007156846.1| hypothetical protein PHAVU_002G022300g [Phaseolus vulgaris]
 gb|ESW28840.1| hypothetical protein PHAVU_002G022300g [Phaseolus vulgaris]
Length=262

 Score = 71.2 bits (173),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 41/53 (77%), Gaps = 0/53 (0%)
 Frame = +2

Query  131  FVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYN  289
            FVLVHGLG G WCWYKL+ ++E++G+KV+ +DL+++G+ P    DI TF  Y+
Sbjct  15   FVLVHGLGHGGWCWYKLKPVLESAGHKVTVLDLAASGIKPEKIEDIHTFSHYS  67



>ref|XP_004300554.1| PREDICTED: probable esterase PIR7A isoform X1 [Fragaria vesca 
subsp. vesca]
 ref|XP_004300555.2| PREDICTED: probable esterase PIR7A isoform X2 [Fragaria vesca 
subsp. vesca]
Length=296

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 41/53 (77%), Gaps = 0/53 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDY  286
            HFVLVHG G GAWCWYK+  L++++G+ V+ +D++++G++P+    + +F DY
Sbjct  49   HFVLVHGAGHGAWCWYKVATLLKSAGHNVTALDMAASGINPTQVQQVHSFSDY  101



>ref|XP_001772896.1| predicted protein [Physcomitrella patens]
 gb|EDQ62298.1| predicted protein [Physcomitrella patens]
Length=266

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYN  289
            HFVLVHG G GAWCWYK   L+ENSG+K + +DL  +G++P+D N + +   Y+
Sbjct  9    HFVLVHGGGLGAWCWYKSIALLENSGFKATAVDLMGSGIEPTDPNRVTSLVHYS  62



>ref|XP_006346533.1| PREDICTED: methylesterase 10-like [Solanum tuberosum]
Length=285

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 29/53 (55%), Positives = 38/53 (72%), Gaps = 0/53 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDY  286
            HFVLVH +G GAW WYK+  LM +SGY V+ IDL ++G++P  A +I  F DY
Sbjct  32   HFVLVHTVGHGAWSWYKIVALMRSSGYNVTAIDLGASGINPKQALEIPHFSDY  84



>ref|NP_001176321.1| Os11g0117900 [Oryza sativa Japonica Group]
 dbj|BAH95049.1| Os11g0117900 [Oryza sativa Japonica Group]
Length=139

 Score = 69.7 bits (169),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYN  289
            HFVLVHG G GAWCW++L  L+++SG++VS +DL+ A     D N + TF DYN
Sbjct  16   HFVLVHGAGHGAWCWFRLLRLLQDSGHRVSAVDLAGAAGSLVDPNHVRTFDDYN  69



>ref|XP_010527076.1| PREDICTED: pheophorbidase isoform X1 [Tarenaya hassleriana]
Length=292

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 37/54 (69%), Gaps = 0/54 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYN  289
            HFVLVHG   G WCWYKL  L+E SG KV+ +DLS AG+  +D+N +    DYN
Sbjct  31   HFVLVHGASHGGWCWYKLITLLEKSGRKVTAVDLSGAGISLTDSNTVFESDDYN  84



>emb|CDP02455.1| unnamed protein product [Coffea canephora]
Length=268

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/72 (51%), Positives = 54/72 (75%), Gaps = 0/72 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYNxpllxf  307
            HFVLVHG   GAW WYKL+ L+E++G++V+ +DLS++G++  +  D+ TF DY  PLL  
Sbjct  12   HFVLVHGACHGAWSWYKLKPLLESAGHRVTALDLSASGINTKNLQDLRTFHDYTLPLLEL  71

Query  308  laslppNXQVIL  343
            +ASLP + +VIL
Sbjct  72   MASLPQHQRVIL  83



>ref|XP_007047137.1| Methyl esterase 1, putative [Theobroma cacao]
 gb|EOX91294.1| Methyl esterase 1, putative [Theobroma cacao]
Length=263

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/72 (50%), Positives = 55/72 (76%), Gaps = 0/72 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYNxpllxf  307
            HFVLVHG+  GAWCWYKL+  +E++G++V+ +DL+++G++     D+ TF +Y+ PLL  
Sbjct  9    HFVLVHGMCKGAWCWYKLKTRLESAGHRVTALDLAASGINTKSIQDVRTFHEYSEPLLEM  68

Query  308  laslppNXQVIL  343
            LASLP + +VIL
Sbjct  69   LASLPSDKKVIL  80



>ref|XP_004301853.2| PREDICTED: probable esterase PIR7A [Fragaria vesca subsp. vesca]
Length=298

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 41/53 (77%), Gaps = 0/53 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDY  286
            HFVLVHG G GAWCW+K+  L+E++G+ V+ +D++++G++P+    + +F DY
Sbjct  49   HFVLVHGAGHGAWCWFKVATLLESAGHNVTALDMAASGINPTQVQKVHSFSDY  101



>ref|XP_004304220.1| PREDICTED: putative methylesterase 11, chloroplastic [Fragaria 
vesca subsp. vesca]
Length=387

 Score = 72.4 bits (176),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 30/53 (57%), Positives = 37/53 (70%), Gaps = 0/53 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDY  286
            HFVLVHG G GAWCWYK   L+E  GYKV+ IDL+ +G+  SD N I +  +Y
Sbjct  135  HFVLVHGGGFGAWCWYKTIALLEEGGYKVNAIDLTGSGIHSSDTNTIASLSEY  187



>gb|EEE51534.1| hypothetical protein OsJ_32736 [Oryza sativa Japonica Group]
Length=266

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/72 (54%), Positives = 51/72 (71%), Gaps = 0/72 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYNxpllxf  307
            HFVLVHG G GAWCW++L  L+++SG++VS +DL+ A     D N + TF DYN PLL  
Sbjct  16   HFVLVHGAGHGAWCWFRLLRLLQDSGHRVSAVDLAGAAGSLVDPNHVRTFDDYNAPLLDL  75

Query  308  laslppNXQVIL  343
            +ASLP   +VIL
Sbjct  76   MASLPAGDKVIL  87



>ref|XP_010527079.1| PREDICTED: pheophorbidase isoform X3 [Tarenaya hassleriana]
Length=283

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 37/54 (69%), Gaps = 0/54 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYN  289
            HFVLVHG   G WCWYKL  L+E SG KV+ +DLS AG+  +D+N +    DYN
Sbjct  31   HFVLVHGASHGGWCWYKLITLLEKSGRKVTAVDLSGAGISLTDSNTVFESDDYN  84



>ref|XP_008241568.1| PREDICTED: methylesterase 10-like [Prunus mume]
Length=261

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 27/53 (51%), Positives = 39/53 (74%), Gaps = 0/53 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDY  286
            HFVLVHG G GAWCWYKL  L+ ++G++V+ +DL+++G +P   N +  F DY
Sbjct  14   HFVLVHGAGHGAWCWYKLSALLTSAGHQVTALDLAASGDNPKQINQVHCFADY  66



>ref|XP_004230826.1| PREDICTED: polyneuridine-aldehyde esterase [Solanum lycopersicum]
 gb|ADK38537.1| methylketone synthase Ia [Solanum lycopersicum]
Length=265

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 56/82 (68%), Gaps = 0/82 (0%)
 Frame = +2

Query  98   EEVVAPPPPPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTF  277
            E+  +P    HFVLVH    GAWCWYK+  LM +SG+ V+ +DL ++G++P  A +I  F
Sbjct  2    EKSTSPFVKKHFVLVHTAFHGAWCWYKIVALMRSSGHNVTALDLGASGINPKQALEIPNF  61

Query  278  XDYNxpllxflaslppNXQVIL  343
             DY+ PL+ F+ASLP N ++IL
Sbjct  62   SDYSSPLMEFMASLPANEKLIL  83



>gb|KDP31868.1| hypothetical protein JCGZ_12329 [Jatropha curcas]
Length=263

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/72 (53%), Positives = 54/72 (75%), Gaps = 0/72 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYNxpllxf  307
            HFVLVHG   GAWCWYKL+  +E++GY+V+ +DL+++G++     +I TF DY+ PLL F
Sbjct  9    HFVLVHGACHGAWCWYKLKPRLESAGYRVTALDLAASGINMKAIQEIQTFGDYSKPLLEF  68

Query  308  laslppNXQVIL  343
            LASL  + +VIL
Sbjct  69   LASLQSDERVIL  80



>emb|CDP11927.1| unnamed protein product [Coffea canephora]
Length=266

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/72 (49%), Positives = 53/72 (74%), Gaps = 0/72 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYNxpllxf  307
            HFVLVHG   GAWCWYKL  L++++G+KV+ +DL+++G+D    +D+ T  DY+ PL  +
Sbjct  30   HFVLVHGACHGAWCWYKLVSLLQDAGHKVTALDLAASGIDTKQVSDLHTIDDYHEPLYSY  89

Query  308  laslppNXQVIL  343
            L +L P+ +VIL
Sbjct  90   LKALSPDDKVIL  101



>ref|XP_003567442.1| PREDICTED: probable esterase PIR7A [Brachypodium distachyon]
Length=270

 Score = 70.5 bits (171),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYN  289
            HFVLVHGL  GAWCWYKL  L+E +G++V+ +DL+++GV P+ A+++ +F  Y+
Sbjct  12   HFVLVHGLCHGAWCWYKLAPLLEAAGHRVTAVDLAASGVHPARAHEVPSFEAYS  65



>ref|XP_009145604.1| PREDICTED: pheophorbidase [Brassica rapa]
Length=263

 Score = 70.5 bits (171),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYN  289
            HFVLVHG   GAWCWYKL  L+  +G+K + +DL+ AG++ +D+N ++ F  YN
Sbjct  13   HFVLVHGASHGAWCWYKLTTLLAAAGFKATSVDLTGAGINLTDSNTVVDFDQYN  66



>emb|CDM82835.1| unnamed protein product [Triticum aestivum]
Length=264

 Score = 70.5 bits (171),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYN  289
            HF+LVHGLG GAWCWYKL  ++  +G++V+ +D++++GV P+  +++ +F DY+
Sbjct  8    HFILVHGLGHGAWCWYKLVPMLRAAGHRVTALDMAASGVHPARMDEVPSFEDYS  61



>ref|XP_004514835.1| PREDICTED: putative methylesterase 11, chloroplastic-like [Cicer 
arietinum]
Length=370

 Score = 71.6 bits (174),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 31/53 (58%), Positives = 37/53 (70%), Gaps = 0/53 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDY  286
            H+VLVHG G GAWCWYK   L+E SGYKVS IDL+ +GV   D N+I +   Y
Sbjct  120  HYVLVHGGGFGAWCWYKTIALLEESGYKVSAIDLTGSGVHSFDTNNITSLSQY  172



>gb|AGV54148.1| polyneuridine-aldehyde esterase [Rauvolfia yunnanensis]
Length=264

 Score = 70.5 bits (171),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 56/77 (73%), Gaps = 0/77 (0%)
 Frame = +2

Query  113  PPPPPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYNx  292
            P    HFVLVHG   GAW WYKL+ L+E++G+KV+ +DLS+AG++P   ++I T  DY+ 
Sbjct  7    PKQQKHFVLVHGGCLGAWIWYKLKPLLESAGHKVTAVDLSAAGINPQRLDEIHTLRDYSE  66

Query  293  pllxflaslppNXQVIL  343
            PL+  +AS+P + +V+L
Sbjct  67   PLMEVMASIPSDEKVVL  83



>ref|XP_004233422.1| PREDICTED: salicylic acid-binding protein 2-like [Solanum lycopersicum]
Length=264

 Score = 70.5 bits (171),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYN  289
            HFVLVHG G GAWCWYKL+ L+E +G+KV+ +DL+++G+D      + T  DY 
Sbjct  10   HFVLVHGAGHGAWCWYKLKPLLEAAGHKVTALDLAASGIDLRKIEQLHTLHDYT  63



>gb|ABA91258.1| hydrolase, alpha/beta fold family protein, expressed [Oryza sativa 
Japonica Group]
Length=263

 Score = 70.1 bits (170),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYN  289
            HFVLVHG G GAWCW++L  L+++SG++VS +DL+ A     D N + TF DYN
Sbjct  18   HFVLVHGAGHGAWCWFRLLRLLQDSGHRVSAVDLAGAAGSLVDPNHVRTFDDYN  71



>ref|XP_006401106.1| hypothetical protein EUTSA_v10014415mg [Eutrema salsugineum]
 gb|ESQ42559.1| hypothetical protein EUTSA_v10014415mg [Eutrema salsugineum]
Length=263

 Score = 70.1 bits (170),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/72 (50%), Positives = 48/72 (67%), Gaps = 0/72 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYNxpllxf  307
            HFV VHG G G WCWYKL   +  +G+K +CIDL  AG+D +D N + +  DY+ PL  F
Sbjct  5    HFVFVHGAGHGGWCWYKLANSLRENGHKATCIDLKGAGIDQTDPNTVSSLDDYDQPLYDF  64

Query  308  laslppNXQVIL  343
            L+ LP + +VIL
Sbjct  65   LSQLPFDQKVIL  76



>ref|XP_009366292.1| PREDICTED: polyneuridine-aldehyde esterase-like [Pyrus x bretschneideri]
Length=133

 Score = 68.9 bits (167),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 37/53 (70%), Gaps = 0/53 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDY  286
            HFVL+HG   GAWCWYKL  L+ ++GY V+ +DL++ G+ P +   + TF DY
Sbjct  14   HFVLIHGACHGAWCWYKLSALLTSAGYNVTALDLAACGIHPKEVKYVQTFSDY  66



>emb|CAC82615.1| hypothetical protein [Capsella rubella]
Length=265

 Score = 70.1 bits (170),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 38/78 (49%), Positives = 51/78 (65%), Gaps = 0/78 (0%)
 Frame = +2

Query  110  APPPPPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYN  289
            A  P  HFV VHG   GAWCWYKL  L+E +G+K + +DL+ AG+  +D+N +L    YN
Sbjct  7    AEQPVIHFVFVHGASHGAWCWYKLTSLLETAGFKTTSVDLTGAGISVTDSNTVLESDQYN  66

Query  290  xpllxflaslppNXQVIL  343
             PL   L+ LPP+ +VIL
Sbjct  67   RPLFSLLSDLPPSHKVIL  84



>ref|XP_009376503.1| PREDICTED: probable esterase PIR7A [Pyrus x bretschneideri]
Length=288

 Score = 70.5 bits (171),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 39/53 (74%), Gaps = 0/53 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDY  286
            HFVLVHG G GAWCWYKL  L+ ++G+ V+ +D++++G++P     + +F DY
Sbjct  43   HFVLVHGAGVGAWCWYKLATLLNSTGHNVTTLDMAASGINPKQVQQVNSFSDY  95



>ref|XP_006436459.1| hypothetical protein CICLE_v10032394mg [Citrus clementina]
 ref|XP_006485627.1| PREDICTED: methylesterase 1-like [Citrus sinensis]
 gb|ESR49699.1| hypothetical protein CICLE_v10032394mg [Citrus clementina]
Length=272

 Score = 70.1 bits (170),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 47/75 (63%), Gaps = 9/75 (12%)
 Frame = +2

Query  65   ETKKTAEEKIREEVVAPPPPPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGV  244
            + KK AE K R+         HFVLVHG   GAWCWYK++  +E +GY+V+ +DL++ G+
Sbjct  6    KIKKMAEAKKRK---------HFVLVHGSNHGAWCWYKVKPQLEAAGYRVTALDLAATGI  56

Query  245  DPSDANDILTFXDYN  289
            +     D+ +F +YN
Sbjct  57   NMKKIQDVHSFYEYN  71



>ref|XP_009341927.1| PREDICTED: probable esterase PIR7A [Pyrus x bretschneideri]
 ref|XP_009341930.1| PREDICTED: probable esterase PIR7A [Pyrus x bretschneideri]
Length=288

 Score = 70.1 bits (170),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 39/53 (74%), Gaps = 0/53 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDY  286
            HFVLVHG G GAWCWYKL  L+ ++G+ V+ +D++++G++P     + +F DY
Sbjct  43   HFVLVHGAGVGAWCWYKLATLLNSTGHNVTTLDMAASGINPKQVQQVNSFSDY  95



>gb|AGV54684.1| polyneuridine-aldehyde esterase [Phaseolus vulgaris]
Length=257

 Score = 69.7 bits (169),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 36/72 (50%), Positives = 53/72 (74%), Gaps = 0/72 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYNxpllxf  307
            HFVLVHG   GAWCWYKL+  +E++G+KV+ +DL+++G++     D+ TF  Y+  LL  
Sbjct  7    HFVLVHGACHGAWCWYKLKPRLESAGHKVTALDLAASGINLQKMEDVHTFSQYSEALLQL  66

Query  308  laslppNXQVIL  343
            LA++PPN +VIL
Sbjct  67   LATIPPNEKVIL  78



>ref|XP_004512217.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing 
protein At3g50420-like [Cicer arietinum]
Length=966

 Score = 72.8 bits (177),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 54/72 (75%), Gaps = 0/72 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYNxpllxf  307
            HFVLVHG   GAWCWYKL+ L+E+ GYKV+ +DL++ G+D     D+ TF DY+ PLL F
Sbjct  14   HFVLVHGACVGAWCWYKLKPLLESVGYKVTTLDLAACGIDTKKIEDVNTFFDYSKPLLEF  73

Query  308  laslppNXQVIL  343
            LASL PN +V+L
Sbjct  74   LASLAPNEKVVL  85



>ref|XP_007151829.1| hypothetical protein PHAVU_004G078700g [Phaseolus vulgaris]
 gb|ESW23823.1| hypothetical protein PHAVU_004G078700g [Phaseolus vulgaris]
Length=257

 Score = 69.7 bits (169),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 36/72 (50%), Positives = 53/72 (74%), Gaps = 0/72 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYNxpllxf  307
            HFVLVHG   GAWCWYKL+  +E++G+KV+ +DL+++G++     D+ TF  Y+  LL  
Sbjct  7    HFVLVHGACHGAWCWYKLKPRLESAGHKVTALDLAASGINLQKMEDVHTFSQYSEALLQL  66

Query  308  laslppNXQVIL  343
            LA++PPN +VIL
Sbjct  67   LATIPPNEKVIL  78



>emb|CDY32712.1| BnaA02g07740D [Brassica napus]
Length=263

 Score = 70.1 bits (170),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 36/72 (50%), Positives = 48/72 (67%), Gaps = 0/72 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYNxpllxf  307
            HFV VHG G G WCWYKL   +  +G+K +CIDL  AG++ +D N + +  DYN PL  F
Sbjct  5    HFVFVHGAGHGGWCWYKLANSLRENGHKATCIDLKGAGINLTDPNTVSSLDDYNQPLYDF  64

Query  308  laslppNXQVIL  343
            L+ LP + +VIL
Sbjct  65   LSQLPLDQKVIL  76



>ref|XP_010683183.1| PREDICTED: salicylic acid-binding protein 2-like [Beta vulgaris 
subsp. vulgaris]
Length=273

 Score = 70.1 bits (170),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 56/72 (78%), Gaps = 0/72 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYNxpllxf  307
            HFVLVHG   GAWCWYKL+ ++E +G++V+ +D++++G++P + +++ T  DY+ PL+ F
Sbjct  20   HFVLVHGSCHGAWCWYKLKPMIETAGHRVTVLDMAASGINPKNIDELQTLRDYSEPLIEF  79

Query  308  laslppNXQVIL  343
            + S+P + +VIL
Sbjct  80   MTSVPDDQKVIL  91



>gb|KDP31864.1| hypothetical protein JCGZ_12325 [Jatropha curcas]
Length=259

 Score = 69.7 bits (169),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 27/53 (51%), Positives = 41/53 (77%), Gaps = 0/53 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDY  286
            HFVL+HG   GAWCWYK+  L++++G+KV+ +DL+++GV    ANDI +F +Y
Sbjct  7    HFVLIHGACHGAWCWYKVAALLKSAGHKVTALDLAASGVHTKQANDIYSFLEY  59



>emb|CDY40511.1| BnaC01g20010D [Brassica napus]
Length=263

 Score = 69.7 bits (169),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYN  289
            HFV VHG   GAWCWYKL  L++ +G+K + +DL+ AG++ +D+N ++ F  YN
Sbjct  13   HFVFVHGASHGAWCWYKLTTLLDAAGFKATSVDLTGAGINLTDSNTVVDFEHYN  66



>ref|XP_010939193.1| PREDICTED: putative methylesterase 11, chloroplastic [Elaeis 
guineensis]
Length=391

 Score = 71.2 bits (173),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 38/53 (72%), Gaps = 0/53 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDY  286
            HFVLVHG G GAWCWYK   L+E+SG+KV+ IDL+ +G+   D N I T  +Y
Sbjct  136  HFVLVHGGGFGAWCWYKTIALLEDSGFKVNAIDLTGSGIHSFDTNKITTLPEY  188



>ref|XP_006360242.1| PREDICTED: salicylic acid-binding protein 2-like [Solanum tuberosum]
Length=264

 Score = 69.7 bits (169),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 36/72 (50%), Positives = 50/72 (69%), Gaps = 0/72 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYNxpllxf  307
            HFVLVHG G G WCWYKL+ L+E++G+KV+ +DL+++G+D      + T  DY  PLL  
Sbjct  10   HFVLVHGAGHGGWCWYKLKPLLEDAGHKVTALDLAASGIDLRKLEQLHTLHDYTLPLLEL  69

Query  308  laslppNXQVIL  343
            + SLP   +VIL
Sbjct  70   MESLPQEEKVIL  81



>pdb|3STY|A Chain A, Crystal Structure Of Tomato Methylketone Synthase I 
T18a Mutant
 pdb|3STY|B Chain B, Crystal Structure Of Tomato Methylketone Synthase I 
T18a Mutant
Length=267

 Score = 69.7 bits (169),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 55/82 (67%), Gaps = 0/82 (0%)
 Frame = +2

Query  98   EEVVAPPPPPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTF  277
            E+ ++P    HFVLVH    GAWCWYK+  LM +SG+ V+ +DL ++G++P  A  I  F
Sbjct  4    EKSMSPFVKKHFVLVHAAFHGAWCWYKIVALMRSSGHNVTALDLGASGINPKQALQIPNF  63

Query  278  XDYNxpllxflaslppNXQVIL  343
             DY  PL+ F+ASLP N ++IL
Sbjct  64   SDYLSPLMEFMASLPANEKIIL  85



>ref|XP_004142015.1| PREDICTED: salicylic acid-binding protein 2-like [Cucumis sativus]
 gb|KGN48495.1| hypothetical protein Csa_6G490100 [Cucumis sativus]
Length=271

 Score = 70.1 bits (170),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYN  289
            HF+LVHG   GAWCWYKL+ L+E++G++V+ +D++++G+D  D  ++ T  +Y+
Sbjct  11   HFILVHGACHGAWCWYKLKPLLESAGHRVTALDMAASGIDRRDVEEVRTLSEYS  64



>ref|XP_007200274.1| hypothetical protein PRUPE_ppa014939mg [Prunus persica]
 gb|EMJ01473.1| hypothetical protein PRUPE_ppa014939mg [Prunus persica]
Length=269

 Score = 69.7 bits (169),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 29/53 (55%), Positives = 39/53 (74%), Gaps = 0/53 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDY  286
            HFVLVHG   GAW WYKL  LM++SG+ V+ +DL+++GVDP  A D+ +  DY
Sbjct  15   HFVLVHGSCFGAWSWYKLVTLMKSSGHNVTALDLAASGVDPQQAKDLQSISDY  67



>ref|XP_002981647.1| hypothetical protein SELMODRAFT_114920 [Selaginella moellendorffii]
 gb|EFJ17129.1| hypothetical protein SELMODRAFT_114920 [Selaginella moellendorffii]
Length=256

 Score = 69.7 bits (169),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 29/56 (52%), Positives = 38/56 (68%), Gaps = 0/56 (0%)
 Frame = +2

Query  122  PPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYN  289
            P HFVLVHG   GAWCWYK+  L++ SG+KV+ +DLSS G    DA  + +F +Y 
Sbjct  4    PCHFVLVHGGSHGAWCWYKIVNLLQASGHKVTALDLSSCGTHTRDAETVTSFAEYT  59



>ref|XP_008440235.1| PREDICTED: methylesterase 10 [Cucumis melo]
Length=277

 Score = 69.7 bits (169),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 27/53 (51%), Positives = 39/53 (74%), Gaps = 0/53 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDY  286
            HFVLVHG G GAWCW+KL  L+ ++G+  + IDL+SAG DP+  +D+ +  +Y
Sbjct  8    HFVLVHGAGHGAWCWFKLLSLLRSAGHHATAIDLASAGTDPTKLDDVASIEEY  60



>ref|XP_007203473.1| hypothetical protein PRUPE_ppa024619mg, partial [Prunus persica]
 gb|EMJ04672.1| hypothetical protein PRUPE_ppa024619mg, partial [Prunus persica]
Length=252

 Score = 69.7 bits (169),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 27/53 (51%), Positives = 38/53 (72%), Gaps = 0/53 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDY  286
            HFVLVHG G GAWCWYKL  L+ ++G+ V+ +DL+++G +P   N +  F DY
Sbjct  5    HFVLVHGAGHGAWCWYKLSALLTSAGHNVTALDLAASGDNPKQINQVHCFADY  57



>gb|AFK46482.1| unknown [Medicago truncatula]
 gb|KEH21703.1| methylesterase [Medicago truncatula]
Length=374

 Score = 71.2 bits (173),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 30/53 (57%), Positives = 37/53 (70%), Gaps = 0/53 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDY  286
            HFVLVHG G GAWCWYK   L+E SG+KV+ IDL+ +GV   D N+I +   Y
Sbjct  124  HFVLVHGGGFGAWCWYKTIALLEESGFKVAAIDLTGSGVHSFDTNNITSLSQY  176



>ref|XP_002459048.1| hypothetical protein SORBIDRAFT_03g045080 [Sorghum bicolor]
 gb|EES04168.1| hypothetical protein SORBIDRAFT_03g045080 [Sorghum bicolor]
Length=280

 Score = 69.7 bits (169),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 41/59 (69%), Gaps = 0/59 (0%)
 Frame = +2

Query  113  PPPPPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYN  289
            P  P HFVLVHG+  GAWCWYK+  L+ ++G++V+ +D++  G  P+   D+ +F DY+
Sbjct  10   PQHPHHFVLVHGVCHGAWCWYKVATLLTSAGHRVTALDMAGCGASPARGEDVASFEDYS  68



>ref|XP_006436460.1| hypothetical protein CICLE_v10032396mg [Citrus clementina]
 ref|XP_006485626.1| PREDICTED: methylesterase 1-like [Citrus sinensis]
 gb|ESR49700.1| hypothetical protein CICLE_v10032396mg [Citrus clementina]
Length=272

 Score = 69.7 bits (169),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 48/75 (64%), Gaps = 9/75 (12%)
 Frame = +2

Query  65   ETKKTAEEKIREEVVAPPPPPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGV  244
            + KK AE K ++         HFVLVHG   GAWCWYK++  +E +G++V+ +DL+++G+
Sbjct  6    KIKKMAEAKKQK---------HFVLVHGSNHGAWCWYKVKAQLEAAGHRVTALDLTASGI  56

Query  245  DPSDANDILTFXDYN  289
            D     D+ +F +YN
Sbjct  57   DMKKIQDVHSFYEYN  71



>ref|XP_002967870.1| hypothetical protein SELMODRAFT_88885 [Selaginella moellendorffii]
 gb|EFJ31217.1| hypothetical protein SELMODRAFT_88885 [Selaginella moellendorffii]
Length=256

 Score = 69.7 bits (169),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 29/56 (52%), Positives = 38/56 (68%), Gaps = 0/56 (0%)
 Frame = +2

Query  122  PPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYN  289
            P HFVLVHG   GAWCWYK+  L++ SG+KV+ +DLSS G    DA  + +F +Y 
Sbjct  4    PCHFVLVHGGSHGAWCWYKIVNLLQASGHKVTALDLSSCGTHTRDAETVTSFAEYT  59



>gb|AFW84029.1| hypothetical protein ZEAMMB73_457200, partial [Zea mays]
Length=85

 Score = 67.4 bits (163),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 42/68 (62%), Gaps = 4/68 (6%)
 Frame = +2

Query  98   EEVVAPPPPP----HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDAND  265
            EE     PPP    HFVLVHG   GAWCWYK+  L+ ++G++V+ +D++  G  P    D
Sbjct  9    EEESGKGPPPQHQHHFVLVHGACHGAWCWYKVATLLASAGHRVTALDMAGCGASPVRGED  68

Query  266  ILTFXDYN  289
            + +F DY+
Sbjct  69   VASFEDYS  76



>ref|XP_010255102.1| PREDICTED: methylesterase 10 [Nelumbo nucifera]
Length=262

 Score = 69.7 bits (169),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 27/53 (51%), Positives = 40/53 (75%), Gaps = 0/53 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDY  286
            HFVLVHG G GAWCWYKL  L++++GY+V+ +DL ++GV+P   + I +  +Y
Sbjct  6    HFVLVHGAGHGAWCWYKLLALLKSAGYRVTALDLGASGVNPKKLDQIASVFEY  58



>gb|KDP31871.1| hypothetical protein JCGZ_12332 [Jatropha curcas]
Length=260

 Score = 69.7 bits (169),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 41/53 (77%), Gaps = 0/53 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDY  286
            HFVLVHG G GAWCWYK+  L++++G+KV+ +D++++GV P   ++I +  DY
Sbjct  8    HFVLVHGAGLGAWCWYKVATLLKSAGHKVTALDMAASGVHPKQVSEIQSISDY  60



>ref|XP_008440234.1| PREDICTED: salicylic acid-binding protein 2-like [Cucumis melo]
Length=267

 Score = 69.7 bits (169),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYN  289
            HF+LVHG   GAWCWYKL+ L+E++G++V+ +D++++G+D  D  ++ T  +Y+
Sbjct  10   HFILVHGACHGAWCWYKLKPLLESAGHRVTALDMAASGIDRRDVEEVRTLSEYS  63



>gb|AAV87156.1| MKS1 [Lycopersicon hirsutum f. glabratum]
Length=265

 Score = 69.7 bits (169),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 55/82 (67%), Gaps = 0/82 (0%)
 Frame = +2

Query  98   EEVVAPPPPPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTF  277
            E+ ++P    HFVLVH    GAWCWYK+  LM +SG+ V+ +DL ++G++P  A  I  F
Sbjct  2    EKSMSPFVKKHFVLVHTAFHGAWCWYKIVALMRSSGHNVTALDLXASGINPKQALQIPNF  61

Query  278  XDYNxpllxflaslppNXQVIL  343
             DY  PL+ F+ASLP N ++IL
Sbjct  62   SDYLSPLMEFMASLPANEKIIL  83



>ref|XP_007215535.1| hypothetical protein PRUPE_ppa007173mg [Prunus persica]
 gb|EMJ16734.1| hypothetical protein PRUPE_ppa007173mg [Prunus persica]
Length=379

 Score = 70.9 bits (172),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 29/53 (55%), Positives = 37/53 (70%), Gaps = 0/53 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDY  286
            HFVLVHG G GAWCWYK   L+E  G+KV+ IDL+ +G+  SDAN + +   Y
Sbjct  127  HFVLVHGGGFGAWCWYKTIALLEEVGFKVTAIDLTGSGIHSSDANSVTSLSQY  179



>ref|XP_008785612.1| PREDICTED: putative methylesterase 11, chloroplastic [Phoenix 
dactylifera]
Length=388

 Score = 70.9 bits (172),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 38/53 (72%), Gaps = 0/53 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDY  286
            HFVLVHG G GAWCWYK   L+E+SG+KV+ IDL+ +G+   D N I T  +Y
Sbjct  133  HFVLVHGGGFGAWCWYKTIALLEDSGFKVNAIDLTGSGIHSFDTNKITTLPEY  185



>ref|XP_010028525.1| PREDICTED: putative inactive methylesterase 20 [Eucalyptus grandis]
Length=159

 Score = 68.6 bits (166),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 39/53 (74%), Gaps = 0/53 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDY  286
            HFVLVHG   GAWCWYK+  L+ +SG+ V+ IDL+++G++P  A+ + +  DY
Sbjct  34   HFVLVHGASHGAWCWYKVVTLLRSSGHNVTTIDLTASGINPIQASSLQSISDY  86



>ref|XP_008230905.1| PREDICTED: putative methylesterase 11, chloroplastic [Prunus 
mume]
Length=379

 Score = 70.9 bits (172),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 29/53 (55%), Positives = 37/53 (70%), Gaps = 0/53 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDY  286
            HFVLVHG G GAWCWYK   L+E  G+KV+ IDL+ +G+  SDAN + +   Y
Sbjct  127  HFVLVHGGGFGAWCWYKTIALLEEVGFKVTAIDLTGSGIHSSDANSVTSLSQY  179



>ref|XP_006845891.1| hypothetical protein AMTR_s00154p00089740 [Amborella trichopoda]
 gb|ERN07566.1| hypothetical protein AMTR_s00154p00089740 [Amborella trichopoda]
Length=367

 Score = 70.9 bits (172),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 29/53 (55%), Positives = 37/53 (70%), Gaps = 0/53 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDY  286
            HF+LVHG G GAWCWYK   L+E  G+K + IDL+ +G+D SDAN I +   Y
Sbjct  117  HFLLVHGGGFGAWCWYKTITLLEEGGFKATAIDLTGSGIDSSDANSISSLSQY  169



>gb|EEC67552.1| hypothetical protein OsI_34885 [Oryza sativa Indica Group]
Length=266

 Score = 69.3 bits (168),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 38/72 (53%), Positives = 51/72 (71%), Gaps = 0/72 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYNxpllxf  307
            HFVLVHG G GAWCW++L  L+++SG++VS +DL+ A     D N + +F DYN PLL  
Sbjct  16   HFVLVHGAGHGAWCWFRLLRLLQDSGHRVSAVDLAGAAGSLVDPNHVRSFDDYNAPLLDL  75

Query  308  laslppNXQVIL  343
            +ASLP   +VIL
Sbjct  76   MASLPAGDKVIL  87



>ref|XP_010453481.1| PREDICTED: methylesterase 18 [Camelina sativa]
Length=269

 Score = 69.3 bits (168),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 35/72 (49%), Positives = 48/72 (67%), Gaps = 0/72 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYNxpllxf  307
            HFV VHG G G WCWYKL   +  +G+K +CIDL  AG++ +D N + +  DY+ PL  F
Sbjct  11   HFVFVHGAGHGGWCWYKLANSLRENGHKATCIDLKGAGINQTDPNTVTSLDDYDEPLYAF  70

Query  308  laslppNXQVIL  343
            L+ LP + +VIL
Sbjct  71   LSQLPIDQKVIL  82



>ref|NP_001065997.1| Os12g0117100 [Oryza sativa Japonica Group]
 gb|ABA95646.1| hydrolase, alpha/beta fold family protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF29016.1| Os12g0117100 [Oryza sativa Japonica Group]
 dbj|BAG87221.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE52648.1| hypothetical protein OsJ_35010 [Oryza sativa Japonica Group]
Length=268

 Score = 69.3 bits (168),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 38/72 (53%), Positives = 51/72 (71%), Gaps = 0/72 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYNxpllxf  307
            HFVLVHG G GAWCW++L  L+++SG++VS +DL+ A     D N + +F DYN PLL  
Sbjct  18   HFVLVHGAGHGAWCWFRLLRLLQDSGHRVSAVDLAGAAGSLVDPNHVRSFDDYNAPLLDL  77

Query  308  laslppNXQVIL  343
            +ASLP   +VIL
Sbjct  78   MASLPAGDKVIL  89



>ref|XP_010483409.1| PREDICTED: methylesterase 18-like [Camelina sativa]
Length=271

 Score = 69.3 bits (168),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 35/72 (49%), Positives = 48/72 (67%), Gaps = 0/72 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYNxpllxf  307
            HFV VHG G G WCWYKL   +  +G+K +CIDL  AG++ +D N + +  DY+ PL  F
Sbjct  13   HFVFVHGAGHGGWCWYKLANSLRENGHKATCIDLKGAGINQTDPNTVTSLDDYDEPLYAF  72

Query  308  laslppNXQVIL  343
            L+ LP + +VIL
Sbjct  73   LSQLPIDQKVIL  84



>ref|XP_011039237.1| PREDICTED: salicylic acid-binding protein 2-like [Populus euphratica]
Length=254

 Score = 69.3 bits (168),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 52/72 (72%), Gaps = 0/72 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYNxpllxf  307
            HFVL+HG   GAW WYK++ ++E +G+ V+ +D+S++GV+     +++TF  YN PL+ F
Sbjct  10   HFVLIHGSASGAWAWYKVKTILEAAGHSVTALDMSASGVNTKTLEEVVTFDQYNEPLIEF  69

Query  308  laslppNXQVIL  343
            +A+L  N +V+L
Sbjct  70   MANLAENEKVVL  81



>gb|ADK38535.1| methylketone synthase I [Lycopersicon hirsutum f. glabratum]
Length=265

 Score = 69.3 bits (168),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 55/82 (67%), Gaps = 0/82 (0%)
 Frame = +2

Query  98   EEVVAPPPPPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTF  277
            E+ ++P    HFVLVH    GAWCWYK+  LM +SG+ V+ +DL ++G++P  A  I  F
Sbjct  2    EKSMSPFVKKHFVLVHTAFHGAWCWYKIVALMRSSGHNVTALDLGASGINPKQALQIPNF  61

Query  278  XDYNxpllxflaslppNXQVIL  343
             DY  PL+ F+ASLP N ++IL
Sbjct  62   SDYLSPLMEFMASLPANEKIIL  83



>ref|XP_010491695.1| PREDICTED: alpha-hydroxynitrile lyase-like [Camelina sativa]
Length=256

 Score = 69.3 bits (168),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 37/72 (51%), Positives = 52/72 (72%), Gaps = 0/72 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYNxpllxf  307
            HFVLVH    GAW WYKL+ L+E++G++V+ I+LS++G+DP     + TF +Y+ PL+  
Sbjct  6    HFVLVHNAFHGAWIWYKLKPLLESAGHRVTAIELSASGIDPRPIQAVDTFEEYSKPLIET  65

Query  308  laslppNXQVIL  343
            L SLP N QVIL
Sbjct  66   LKSLPENEQVIL  77



>pdb|3STX|A Chain A, Crystal Structure Of Tomato Methylketone Synthase I 
H243a Variant Complexed With Beta-ketoheptanoate
 pdb|3STX|B Chain B, Crystal Structure Of Tomato Methylketone Synthase I 
H243a Variant Complexed With Beta-ketoheptanoate
Length=267

 Score = 69.3 bits (168),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 55/82 (67%), Gaps = 0/82 (0%)
 Frame = +2

Query  98   EEVVAPPPPPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTF  277
            E+ ++P    HFVLVH    GAWCWYK+  LM +SG+ V+ +DL ++G++P  A  I  F
Sbjct  4    EKSMSPFVKKHFVLVHTAFHGAWCWYKIVALMRSSGHNVTALDLGASGINPKQALQIPNF  63

Query  278  XDYNxpllxflaslppNXQVIL  343
             DY  PL+ F+ASLP N ++IL
Sbjct  64   SDYLSPLMEFMASLPANEKIIL  85



>ref|XP_002522352.1| Polyneuridine-aldehyde esterase precursor, putative [Ricinus 
communis]
 gb|EEF40036.1| Polyneuridine-aldehyde esterase precursor, putative [Ricinus 
communis]
Length=260

 Score = 69.3 bits (168),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 40/53 (75%), Gaps = 0/53 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDY  286
            HFVL+HG   GAWCWYK+  L++ +G+KV+ ++L+++GV P   ND+ +F DY
Sbjct  7    HFVLIHGACHGAWCWYKVATLLKCAGHKVTALELAASGVHPKQVNDLYSFSDY  59



>pdb|3STT|A Chain A, Crystal Structure Of Tomato Methylketone Synthase I 
Apo Form
 pdb|3STT|B Chain B, Crystal Structure Of Tomato Methylketone Synthase I 
Apo Form
 pdb|3STU|A Chain A, Crystal Structure Of Tomato Methylketone Synthase I 
Complexed With Methyl-3-hydroxydodecanoate
 pdb|3STU|B Chain B, Crystal Structure Of Tomato Methylketone Synthase I 
Complexed With Methyl-3-hydroxydodecanoate
 pdb|3STV|A Chain A, Crystal Structure Of Tomato Methylketone Synthase I 
Complexed With 3- Hydroxyoctanoate
 pdb|3STV|B Chain B, Crystal Structure Of Tomato Methylketone Synthase I 
Complexed With 3- Hydroxyoctanoate
 pdb|3STW|A Chain A, Crystal Structure Of Tomato Methylketone Synthase I 
Complexed With 2- Tridecanone
 pdb|3STW|B Chain B, Crystal Structure Of Tomato Methylketone Synthase I 
Complexed With 2- Tridecanone
Length=267

 Score = 69.3 bits (168),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 55/82 (67%), Gaps = 0/82 (0%)
 Frame = +2

Query  98   EEVVAPPPPPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTF  277
            E+ ++P    HFVLVH    GAWCWYK+  LM +SG+ V+ +DL ++G++P  A  I  F
Sbjct  4    EKSMSPFVKKHFVLVHTAFHGAWCWYKIVALMRSSGHNVTALDLGASGINPKQALQIPNF  63

Query  278  XDYNxpllxflaslppNXQVIL  343
             DY  PL+ F+ASLP N ++IL
Sbjct  64   SDYLSPLMEFMASLPANEKIIL  85



>ref|XP_004234677.1| PREDICTED: methylesterase 3-like isoform X2 [Solanum lycopersicum]
Length=218

 Score = 68.9 bits (167),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYN  289
            HF+LVHG   GAWCWYK+  ++ + G+KVS +D++++G++P   ND+ +  DYN
Sbjct  8    HFLLVHGACHGAWCWYKVVTILRSEGHKVSVLDMAASGINPKHVNDLNSMADYN  61



>dbj|BAJ99976.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ93660.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=266

 Score = 69.3 bits (168),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYN  289
            HFVLVHGLG GAWCWYKL  ++  +G++V+ +D++++G  P+  +++ +F DY+
Sbjct  10   HFVLVHGLGHGAWCWYKLVPMLRAAGHEVTALDMAASGAHPARMDEVASFEDYS  63



>ref|XP_006279686.1| hypothetical protein CARUB_v10027010mg [Capsella rubella]
 gb|EOA12584.1| hypothetical protein CARUB_v10027010mg [Capsella rubella]
Length=245

 Score = 68.9 bits (167),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 36/72 (50%), Positives = 48/72 (67%), Gaps = 0/72 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYNxpllxf  307
            HFV VHG G G WCWYKL   +  +G+K +CIDL  AGV+ +D N + +  DY+ PL  F
Sbjct  13   HFVFVHGAGHGGWCWYKLANSLRENGHKATCIDLKGAGVNSTDPNTVSSLDDYDEPLYAF  72

Query  308  laslppNXQVIL  343
            L+ LP + +VIL
Sbjct  73   LSQLPNDQKVIL  84



>ref|XP_002519158.1| hypothetical protein RCOM_0939800 [Ricinus communis]
 gb|EEF43369.1| hypothetical protein RCOM_0939800 [Ricinus communis]
Length=106

 Score = 67.4 bits (163),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 38/56 (68%), Gaps = 0/56 (0%)
 Frame = +2

Query  101  EVVAPPPPPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDI  268
            E V+ P   HFVL+HG G GAWCWYKL  ++ + GY V+ +DL+++ ++P    DI
Sbjct  32   EFVSAPATKHFVLLHGAGSGAWCWYKLIPMLRSYGYNVTAVDLAASEINPLQIRDI  87



>ref|XP_010921789.1| PREDICTED: esterase PIR7B-like isoform X2 [Elaeis guineensis]
Length=236

 Score = 68.9 bits (167),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 40/53 (75%), Gaps = 0/53 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDY  286
            HF+LVHG+  GAWCWYKL  L+ ++G +V+ +DL+++GV P   N++ +F DY
Sbjct  8    HFILVHGMCHGAWCWYKLATLLRSAGQRVTALDLAASGVHPKCLNELRSFSDY  60



>ref|XP_011039238.1| PREDICTED: salicylic acid-binding protein 2-like isoform X1 [Populus 
euphratica]
Length=254

 Score = 68.9 bits (167),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 52/72 (72%), Gaps = 0/72 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYNxpllxf  307
            HFVL+HG   GAW WYK++ ++E +G+ V+ +D+S++GV+     +++TF  YN PL+ F
Sbjct  10   HFVLIHGSASGAWAWYKVKTILEAAGHSVTALDMSASGVNTKTLEEVVTFDQYNEPLIEF  69

Query  308  laslppNXQVIL  343
            +A+L  N +V+L
Sbjct  70   MANLAENEKVVL  81



>gb|KDO48825.1| hypothetical protein CISIN_1g030815mg [Citrus sinensis]
Length=171

 Score = 68.6 bits (166),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYN  289
            HFVLVHG   GAWCWYK++  +E +G++V+ +DL+++G+D     D+ +F +YN
Sbjct  9    HFVLVHGSNHGAWCWYKVKPQLEAAGHRVTALDLTASGIDMKKIQDVHSFYEYN  62



>gb|EEC68736.1| hypothetical protein OsI_37243 [Oryza sativa Indica Group]
Length=268

 Score = 69.3 bits (168),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 38/72 (53%), Positives = 51/72 (71%), Gaps = 0/72 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYNxpllxf  307
            HFVLVHG G GAWCW++L  L+++SG++VS +DL+ A     D N + +F DYN PLL  
Sbjct  18   HFVLVHGAGHGAWCWFRLVRLLQDSGHRVSAVDLAGAAGSLVDPNHVRSFDDYNAPLLDL  77

Query  308  laslppNXQVIL  343
            +ASLP   +VIL
Sbjct  78   MASLPAGDKVIL  89



>ref|NP_001151405.1| esterase PIR7B [Zea mays]
 gb|ACG42731.1| esterase PIR7B [Zea mays]
 gb|AFW64634.1| esterase PIR7B [Zea mays]
Length=272

 Score = 69.3 bits (168),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 40/55 (73%), Gaps = 1/55 (2%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSG-YKVSCIDLSSAGVDPSDANDILTFXDYN  289
            HFVLVHG G GAWCW+KL CL+  SG ++VSC+DL+ A     D +D+ +F +Y+
Sbjct  20   HFVLVHGAGHGAWCWFKLACLLRGSGRHRVSCVDLAGAAGSLVDPDDVRSFDEYD  74



>emb|CDY71711.1| BnaAnng38540D [Brassica napus]
Length=263

 Score = 68.9 bits (167),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYN  289
            HFV VHG   GAWCWYKL  L+  +G+K + +DL+ AG++ +D+N ++ F  YN
Sbjct  13   HFVFVHGASHGAWCWYKLTTLLAAAGFKATSVDLTGAGINLTDSNTVVDFDQYN  66



>ref|XP_011039236.1| PREDICTED: salicylic acid-binding protein 2-like [Populus euphratica]
Length=254

 Score = 68.9 bits (167),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 52/72 (72%), Gaps = 0/72 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYNxpllxf  307
            HFVL+HG   GAW WYK++ ++E +G+ V+ +D+S++GV+     +++TF  YN PL+ F
Sbjct  10   HFVLIHGSASGAWAWYKVKTILEAAGHSVTALDMSASGVNTKTLEEVVTFDQYNEPLIEF  69

Query  308  laslppNXQVIL  343
            +A+L  N +V+L
Sbjct  70   MANLAENEKVVL  81



>ref|XP_004234676.1| PREDICTED: salicylic acid-binding protein 2-like isoform X1 [Solanum 
lycopersicum]
Length=262

 Score = 68.9 bits (167),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYN  289
            HF+LVHG   GAWCWYK+  ++ + G+KVS +D++++G++P   ND+ +  DYN
Sbjct  8    HFLLVHGACHGAWCWYKVVTILRSEGHKVSVLDMAASGINPKHVNDLNSMADYN  61



>ref|XP_002448906.1| hypothetical protein SORBIDRAFT_05g001240 [Sorghum bicolor]
 gb|EES07894.1| hypothetical protein SORBIDRAFT_05g001240 [Sorghum bicolor]
Length=240

 Score = 68.9 bits (167),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 37/54 (69%), Gaps = 0/54 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYN  289
            HFVLVHG G GAWCW+KL CL+  SG++VSCID +       D +D+ +F  Y+
Sbjct  14   HFVLVHGAGHGAWCWFKLACLLRGSGHRVSCIDHAGTAGSLVDPDDVRSFDKYD  67



>ref|XP_011039239.1| PREDICTED: salicylic acid-binding protein 2-like isoform X2 [Populus 
euphratica]
Length=254

 Score = 68.9 bits (167),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 52/72 (72%), Gaps = 0/72 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYNxpllxf  307
            HFVL+HG   GAW WYK++ ++E +G+ V+ +D+S++GV+     +++TF  YN PL+ F
Sbjct  10   HFVLIHGSASGAWAWYKVKTILEAAGHSVTALDMSASGVNTKTLEEVVTFDQYNEPLIEF  69

Query  308  laslppNXQVIL  343
            +A+L  N +V+L
Sbjct  70   MANLAENEKVVL  81



>ref|XP_002310168.2| Chain A family protein, partial [Populus trichocarpa]
 gb|EEE90618.2| Chain A family protein, partial [Populus trichocarpa]
Length=221

 Score = 68.6 bits (166),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 52/72 (72%), Gaps = 0/72 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYNxpllxf  307
            HFVL+HG   GAW WYK++ ++E +G+ V+ +D+S++GV+     +++TF  YN PL+ F
Sbjct  10   HFVLIHGSASGAWAWYKVKTMLEAAGHSVTALDMSASGVNTKTLEEVVTFDQYNEPLIEF  69

Query  308  laslppNXQVIL  343
            +A+L  N +V+L
Sbjct  70   VANLAENEKVVL  81



>ref|XP_002310757.2| Chain A family protein [Populus trichocarpa]
 ref|XP_002310167.2| Chain A family protein [Populus trichocarpa]
 gb|EEE91207.2| Chain A family protein [Populus trichocarpa]
 gb|EEE90617.2| Chain A family protein [Populus trichocarpa]
Length=254

 Score = 68.9 bits (167),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 52/72 (72%), Gaps = 0/72 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYNxpllxf  307
            HFVL+HG   GAW WYK++ ++E +G+ V+ +D+S++GV+     +++TF  YN PL+ F
Sbjct  10   HFVLIHGSASGAWAWYKVKTMLEAAGHSVTALDMSASGVNTKTLEEVVTFDQYNEPLIEF  69

Query  308  laslppNXQVIL  343
            +A+L  N +V+L
Sbjct  70   MANLAENEKVVL  81



>ref|XP_006380731.1| hypothetical protein POPTR_0007s11700g [Populus trichocarpa]
 gb|ERP58528.1| hypothetical protein POPTR_0007s11700g [Populus trichocarpa]
Length=246

 Score = 68.9 bits (167),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 52/72 (72%), Gaps = 0/72 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYNxpllxf  307
            HFVL+HG   GAW WYK++ ++E +G+ V+ +D+S++GV+     +++TF  YN PL+ F
Sbjct  10   HFVLIHGSASGAWAWYKVKTMLEAAGHSVTALDMSASGVNTKTLEEVVTFDQYNEPLIEF  69

Query  308  laslppNXQVIL  343
            +A+L  N +V+L
Sbjct  70   MANLAENEKVVL  81



>ref|XP_006380730.1| hypothetical protein POPTR_0007s11690g [Populus trichocarpa]
 gb|ERP58527.1| hypothetical protein POPTR_0007s11690g [Populus trichocarpa]
Length=254

 Score = 68.9 bits (167),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 52/72 (72%), Gaps = 0/72 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYNxpllxf  307
            HFVL+HG   GAW WYK++ ++E +G+ V+ +D+S++GV+     +++TF  YN PL+ F
Sbjct  10   HFVLIHGSASGAWAWYKVKTMLEAAGHSVTALDMSASGVNTKTLEEVVTFDQYNEPLIEF  69

Query  308  laslppNXQVIL  343
            +A+L  N +V+L
Sbjct  70   MANLAENEKVVL  81



>ref|XP_010440115.1| PREDICTED: probable pheophorbidase isoform X2 [Camelina sativa]
Length=189

 Score = 68.6 bits (166),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 37/57 (65%), Gaps = 0/57 (0%)
 Frame = +2

Query  119  PPPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYN  289
            P  HFV VHG   GAWCWYKL  L+E +G+K + +DL+ AG+  +D+N +     YN
Sbjct  9    PVIHFVFVHGASHGAWCWYKLTTLLETAGFKATSVDLTGAGISLTDSNTVFDSDQYN  65



>ref|XP_007042334.1| Methyl esterase 10, putative isoform 2 [Theobroma cacao]
 gb|EOX98165.1| Methyl esterase 10, putative isoform 2 [Theobroma cacao]
Length=215

 Score = 68.6 bits (166),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 29/56 (52%), Positives = 38/56 (68%), Gaps = 0/56 (0%)
 Frame = +2

Query  119  PPPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDY  286
            PP HFVLVHG   GAW WYKL  L+++ G+ V+ IDL+ +GVDP   N + +  DY
Sbjct  44   PPKHFVLVHGSCHGAWSWYKLVPLLKSEGHNVTGIDLAGSGVDPQQVNTLRSISDY  99



>ref|XP_008800037.1| PREDICTED: probable esterase PIR7A [Phoenix dactylifera]
Length=255

 Score = 68.9 bits (167),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 23/54 (43%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYN  289
            HF+LVHG+  GAWCWY+L  L+ ++G++V+ +DL+++G++P   +++  F DY 
Sbjct  3    HFILVHGMCHGAWCWYQLATLLRSAGHRVTALDLAASGINPKRLDELRRFADYT  56



>ref|XP_006437909.1| hypothetical protein CICLE_v10033488mg [Citrus clementina]
 ref|XP_006484224.1| PREDICTED: putative methylesterase 13, chloroplastic-like [Citrus 
sinensis]
 gb|ESR51149.1| hypothetical protein CICLE_v10033488mg [Citrus clementina]
Length=395

 Score = 70.5 bits (171),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 39/64 (61%), Gaps = 0/64 (0%)
 Frame = +2

Query  95   REEVVAPPPPPHFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILT  274
            +E  +  P   HFVLVHG G GAWCWYK   L++ SG+KV  +DL+ +GV   D N I +
Sbjct  132  QEPKIESPETSHFVLVHGGGFGAWCWYKTMTLLKESGFKVDAVDLTGSGVSSCDTNSITS  191

Query  275  FXDY  286
               Y
Sbjct  192  LEQY  195



>ref|XP_002459049.1| hypothetical protein SORBIDRAFT_03g045090 [Sorghum bicolor]
 gb|EES04169.1| hypothetical protein SORBIDRAFT_03g045090 [Sorghum bicolor]
Length=277

 Score = 68.9 bits (167),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYN  289
            HFVLVHGL  GAWCWYK+  ++E++G++V+ +DL+++G  P+  +++ +F DY+
Sbjct  9    HFVLVHGLCHGAWCWYKVATVLESAGHRVTALDLAASGAHPARLHEVRSFEDYS  62



>ref|XP_010449732.1| PREDICTED: probable pheophorbidase [Camelina sativa]
Length=265

 Score = 68.9 bits (167),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 35/72 (49%), Positives = 49/72 (68%), Gaps = 0/72 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYNxpllxf  307
            HFV VHG   GAWCWYKL  L+E +G+K + +DL+ AG+  +D+N +     YN PL   
Sbjct  12   HFVFVHGASHGAWCWYKLTTLLETAGFKATSVDLTGAGISLTDSNTVFDSDQYNRPLYSL  71

Query  308  laslppNXQVIL  343
            L++LPP+ +VIL
Sbjct  72   LSALPPSHKVIL  83



>ref|XP_010921788.1| PREDICTED: probable esterase PIR7A isoform X1 [Elaeis guineensis]
Length=262

 Score = 68.9 bits (167),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 40/53 (75%), Gaps = 0/53 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDY  286
            HF+LVHG+  GAWCWYKL  L+ ++G +V+ +DL+++GV P   N++ +F DY
Sbjct  8    HFILVHGMCHGAWCWYKLATLLRSAGQRVTALDLAASGVHPKCLNELRSFSDY  60



>emb|CDY02809.1| BnaC02g10800D [Brassica napus]
Length=259

 Score = 68.9 bits (167),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/72 (49%), Positives = 48/72 (67%), Gaps = 0/72 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYNxpllxf  307
            HFV VHG G G WCWYK+   +  +G+K +CIDL  AG++ +D N + +  DYN PL  F
Sbjct  5    HFVFVHGAGHGGWCWYKIANSLRENGHKATCIDLKGAGINLTDPNTVSSLDDYNQPLNDF  64

Query  308  laslppNXQVIL  343
            L+ LP + +VIL
Sbjct  65   LSQLPLDQKVIL  76



>gb|ABK26277.1| unknown [Picea sitchensis]
Length=279

 Score = 68.9 bits (167),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +2

Query  128  HFVLVHGLGGGAWCWYKLRCLMENSGYKVSCIDLSSAGVDPSDANDILTFXDYN  289
            HFVLVHG   GAWCWYKL  L++N+G+ V+ +DL  AG++P D + I +  +YN
Sbjct  15   HFVLVHGACHGAWCWYKLSDLLKNAGHVVTAVDLGGAGLNPKDGDGIRSLAEYN  68



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 554595229600