BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001N23

Length=562
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004245615.1|  PREDICTED: glutathione S-transferase T1-like       251   3e-80   Solanum lycopersicum
ref|XP_006343997.1|  PREDICTED: glutathione S-transferase T1-like       248   4e-79   Solanum tuberosum [potatoes]
ref|XP_009600810.1|  PREDICTED: glutathione S-transferase T1-like       246   1e-78   Nicotiana tomentosiformis
ref|XP_009599399.1|  PREDICTED: glutathione S-transferase T1-like       244   4e-78   Nicotiana tomentosiformis
ref|XP_009796155.1|  PREDICTED: glutathione S-transferase T1-like       243   2e-77   Nicotiana sylvestris
gb|EYU23489.1|  hypothetical protein MIMGU_mgv1a012760mg                239   7e-76   Erythranthe guttata [common monkey flower]
ref|XP_006360687.1|  PREDICTED: glutathione S-transferase T1-like       237   4e-75   Solanum tuberosum [potatoes]
ref|XP_011080977.1|  PREDICTED: glutathione S-transferase T1-like       235   2e-74   Sesamum indicum [beniseed]
ref|XP_004252589.1|  PREDICTED: glutathione S-transferase T1            234   6e-74   Solanum lycopersicum
emb|CDP09756.1|  unnamed protein product                                234   1e-73   Coffea canephora [robusta coffee]
ref|XP_004503735.1|  PREDICTED: tRNA 2'-phosphotransferase 1-like...    234   1e-73   Cicer arietinum [garbanzo]
gb|AAF64449.1|AF239927_1  glutathione S-transferase                     233   2e-73   Euphorbia esula [wolf's milk]
ref|XP_011072506.1|  PREDICTED: glutathione S-transferase T1-like       232   3e-73   Sesamum indicum [beniseed]
gb|KDP25451.1|  hypothetical protein JCGZ_20607                         231   2e-72   Jatropha curcas
ref|XP_007160052.1|  hypothetical protein PHAVU_002G288600g             231   2e-72   Phaseolus vulgaris [French bean]
ref|XP_011072471.1|  PREDICTED: glutathione S-transferase T1            230   3e-72   Sesamum indicum [beniseed]
ref|XP_007040202.1|  Glutathione S-transferase THETA 1                  227   4e-72   
ref|XP_011029250.1|  PREDICTED: glutathione S-transferase T1-like       230   4e-72   Populus euphratica
ref|XP_010053279.1|  PREDICTED: glutathione S-transferase T1            229   1e-71   Eucalyptus grandis [rose gum]
ref|XP_009339919.1|  PREDICTED: glutathione S-transferase T1            229   1e-71   Pyrus x bretschneideri [bai li]
ref|XP_003630525.1|  Glutathione transferase                            226   2e-71   
emb|CDP09752.1|  unnamed protein product                                228   3e-71   Coffea canephora [robusta coffee]
ref|XP_006827675.1|  hypothetical protein AMTR_s00009p00255220          226   5e-71   Amborella trichopoda
ref|XP_003630524.1|  Glutathione transferase                            226   1e-70   Medicago truncatula
gb|AFK47457.1|  unknown                                                 226   1e-70   Medicago truncatula
ref|XP_002509785.1|  glutathione-s-transferase theta, gst, putative     226   1e-70   Ricinus communis
ref|XP_002298040.2|  glutathione S-transferase family protein           225   3e-70   Populus trichocarpa [western balsam poplar]
ref|XP_007209508.1|  hypothetical protein PRUPE_ppa010414mg             224   1e-69   Prunus persica
gb|EYU38357.1|  hypothetical protein MIMGU_mgv1a012529mg                224   1e-69   Erythranthe guttata [common monkey flower]
ref|XP_008238862.1|  PREDICTED: glutathione S-transferase T1            223   2e-69   Prunus mume [ume]
ref|XP_009386058.1|  PREDICTED: glutathione S-transferase T1-like       222   4e-69   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008794197.1|  PREDICTED: glutathione S-transferase T1 isof...    222   4e-69   Phoenix dactylifera
ref|XP_002509786.1|  glutathione-s-transferase theta, gst, putative     222   4e-69   Ricinus communis
ref|XP_011463848.1|  PREDICTED: glutathione S-transferase T1            222   7e-69   Fragaria vesca subsp. vesca
gb|ADB11337.1|  theta class glutathione transferase GSTT1               221   1e-68   Populus trichocarpa [western balsam poplar]
gb|KDP25450.1|  hypothetical protein JCGZ_20606                         220   1e-68   Jatropha curcas
ref|XP_010255416.1|  PREDICTED: glutathione S-transferase T1            220   2e-68   Nelumbo nucifera [Indian lotus]
ref|XP_004146527.1|  PREDICTED: glutathione S-transferase T1-like       220   3e-68   Cucumis sativus [cucumbers]
ref|XP_006476596.1|  PREDICTED: glutathione S-transferase T1-like       220   3e-68   Citrus sinensis [apfelsine]
ref|NP_198937.1|  glutathione S-transferase THETA 1                     219   5e-68   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010909100.1|  PREDICTED: glutathione S-transferase T1 isof...    219   5e-68   Elaeis guineensis
gb|AFK36240.1|  unknown                                                 219   6e-68   Lotus japonicus
ref|XP_009777222.1|  PREDICTED: glutathione S-transferase T1-like       219   6e-68   Nicotiana sylvestris
ref|XP_002868607.1|  hypothetical protein ARALYDRAFT_916086             218   1e-67   Arabidopsis lyrata subsp. lyrata
gb|ACC93946.1|  glutathione S-transferase                               218   2e-67   Panax ginseng [Asiatic ginseng]
ref|XP_008452024.1|  PREDICTED: glutathione S-transferase T1            218   2e-67   Cucumis melo [Oriental melon]
ref|XP_006439583.1|  hypothetical protein CICLE_v10021831mg             218   2e-67   Citrus clementina [clementine]
gb|KJB39646.1|  hypothetical protein B456_007G023300                    218   3e-67   Gossypium raimondii
gb|KDP36315.1|  hypothetical protein JCGZ_09530                         218   3e-67   Jatropha curcas
emb|CDP09754.1|  unnamed protein product                                216   5e-67   Coffea canephora [robusta coffee]
gb|EMS35634.1|  Glutathione S-transferase theta-1                       216   7e-67   Triticum urartu
ref|XP_002272455.1|  PREDICTED: glutathione S-transferase T1            216   8e-67   
emb|CBI34681.3|  unnamed protein product                                217   1e-66   Vitis vinifera
ref|XP_004503770.1|  PREDICTED: glutathione S-transferase T1-like       216   1e-66   Cicer arietinum [garbanzo]
gb|KJB52089.1|  hypothetical protein B456_008G246300                    216   2e-66   Gossypium raimondii
gb|KHG19174.1|  Glutathione S-transferase T1 -like protein              215   3e-66   Gossypium arboreum [tree cotton]
ref|NP_001068175.1|  Os11g0588300                                       214   4e-66   
ref|XP_010447179.1|  PREDICTED: glutathione S-transferase T1-like       214   4e-66   Camelina sativa [gold-of-pleasure]
ref|XP_002304489.1|  glutathione S-transferase family protein           214   5e-66   Populus trichocarpa [western balsam poplar]
gb|ADB11338.1|  theta class glutathione transferase GSTT2               213   6e-66   Populus trichocarpa [western balsam poplar]
gb|KHG14410.1|  Glutathione S-transferase T1 -like protein              221   8e-66   Gossypium arboreum [tree cotton]
ref|XP_011022714.1|  PREDICTED: glutathione S-transferase T1            213   1e-65   Populus euphratica
ref|XP_010553511.1|  PREDICTED: glutathione S-transferase T1            212   3e-65   Tarenaya hassleriana [spider flower]
ref|XP_010441287.1|  PREDICTED: glutathione S-transferase T1-like       212   3e-65   Camelina sativa [gold-of-pleasure]
ref|XP_010436071.1|  PREDICTED: glutathione S-transferase T1            212   3e-65   Camelina sativa [gold-of-pleasure]
gb|KHG21896.1|  Glutathione S-transferase T1 -like protein              212   5e-65   Gossypium arboreum [tree cotton]
gb|AGC13145.1|  theta class glutathione S-transferase                   211   6e-65   Pinus tabuliformis [southern Chinese pine]
ref|XP_006405381.1|  hypothetical protein EUTSA_v10027900mg             211   7e-65   Eutrema salsugineum [saltwater cress]
gb|KJB25823.1|  hypothetical protein B456_004G211100                    212   8e-65   Gossypium raimondii
gb|KJB25822.1|  hypothetical protein B456_004G211100                    211   8e-65   Gossypium raimondii
gb|KFK33026.1|  hypothetical protein AALP_AA6G320800                    211   1e-64   Arabis alpina [alpine rockcress]
ref|XP_006439582.1|  hypothetical protein CICLE_v10021879mg             210   2e-64   Citrus clementina [clementine]
emb|CDY71891.1|  BnaC06g42280D                                          210   2e-64   Brassica napus [oilseed rape]
ref|XP_006579426.1|  PREDICTED: uncharacterized protein LOC100799...    209   3e-64   
gb|AHA46533.1|  theta class glutathione S-transferase                   210   3e-64   Larix kaempferi [karamatsu]
emb|CAA10662.1|  glutathione transferase, GST 10b                       209   4e-64   Arabidopsis thaliana [mouse-ear cress]
gb|KHN23653.1|  Glutathione S-transferase T1                            209   5e-64   Glycine soja [wild soybean]
ref|XP_006579425.1|  PREDICTED: uncharacterized protein LOC100799...    209   5e-64   
ref|XP_009125179.1|  PREDICTED: glutathione S-transferase T1-like       209   5e-64   Brassica rapa
emb|CDX67492.1|  BnaA07g15320D                                          208   8e-64   
gb|EMT22242.1|  hypothetical protein F775_32578                         208   9e-64   
ref|NP_001242886.1|  uncharacterized protein LOC100799229               207   1e-63   
ref|XP_003630527.1|  Glutathione S-transferase theta                    207   2e-63   
gb|AET05003.2|  glutathione S-transferase, amino-terminal domain ...    207   2e-63   Medicago truncatula
gb|AEB77874.1|  glutathione S-transferase protein                       207   3e-63   Bruguiera gymnorhiza [Burma mangrove]
ref|NP_001152125.1|  glutathione S-transferase theta-1                  207   3e-63   Zea mays [maize]
gb|KHN23652.1|  Glutathione S-transferase T1                            207   3e-63   Glycine soja [wild soybean]
ref|NP_001236903.1|  glutathione S-transferase GST 23                   207   4e-63   
ref|XP_006282694.1|  hypothetical protein CARUB_v10005614mg             207   4e-63   Capsella rubella
ref|XP_003563992.1|  PREDICTED: glutathione S-transferase T1            207   9e-63   Brachypodium distachyon [annual false brome]
dbj|BAB11100.1|  glutathione transferase                                205   1e-62   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009140078.1|  PREDICTED: glutathione S-transferase T1-like       205   2e-62   Brassica rapa
ref|XP_003532409.1|  PREDICTED: glutathione S-transferase T2-like...    205   2e-62   
gb|EPS65585.1|  hypothetical protein M569_09192                         204   4e-62   Genlisea aurea
emb|CDY39752.1|  BnaA04g11010D                                          204   5e-62   Brassica napus [oilseed rape]
gb|ADE75690.1|  unknown                                                 204   6e-62   Picea sitchensis
emb|CDY46386.1|  BnaC04g33050D                                          203   9e-62   Brassica napus [oilseed rape]
ref|XP_004980948.1|  PREDICTED: glutathione S-transferase T1-like       203   1e-61   Setaria italica
ref|XP_010676473.1|  PREDICTED: glutathione S-transferase T1            203   1e-61   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_198940.3|  glutathione S-transferase THETA 2                     211   2e-61   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009386057.1|  PREDICTED: glutathione S-transferase T1-like       202   3e-61   
ref|XP_004245614.1|  PREDICTED: glutathione S-transferase T1            202   4e-61   Solanum lycopersicum
ref|XP_007160051.1|  hypothetical protein PHAVU_002G288500g             197   2e-59   Phaseolus vulgaris [French bean]
ref|XP_002449793.1|  hypothetical protein SORBIDRAFT_05g023450          197   3e-59   Sorghum bicolor [broomcorn]
emb|CDP09755.1|  unnamed protein product                                196   5e-59   Coffea canephora [robusta coffee]
ref|XP_002967178.1|  hypothetical protein SELMODRAFT_144252             196   6e-59   Selaginella moellendorffii
ref|XP_002960542.1|  hypothetical protein SELMODRAFT_74927              196   6e-59   
ref|NP_198938.1|  glutathione S-transferase THETA 3                     203   2e-58   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006343999.1|  PREDICTED: glutathione S-transferase T1-like...    191   5e-58   
ref|XP_006343998.1|  PREDICTED: glutathione S-transferase T1-like...    192   2e-57   Solanum tuberosum [potatoes]
ref|XP_001778018.1|  predicted protein                                  191   8e-57   
gb|AFV96155.1|  glutathion-S-transferase theta                          188   2e-56   Brassica oleracea
ref|XP_008794198.1|  PREDICTED: glutathione S-transferase T1 isof...    189   3e-56   
gb|KJB52088.1|  hypothetical protein B456_008G246300                    186   4e-55   Gossypium raimondii
ref|XP_008651869.1|  PREDICTED: LOW QUALITY PROTEIN: glutathione ...    182   6e-55   
ref|XP_002961176.1|  hypothetical protein SELMODRAFT_270213             185   6e-55   Selaginella moellendorffii
ref|XP_002966830.1|  hypothetical protein SELMODRAFT_144283             185   6e-55   Selaginella moellendorffii
ref|XP_002509787.1|  glutathione-s-transferase theta, gst, putative     185   9e-55   
ref|XP_010676472.1|  PREDICTED: glutathione S-transferase T1-like       184   2e-54   Beta vulgaris subsp. vulgaris [field beet]
tpg|DAA43810.1|  TPA: hypothetical protein ZEAMMB73_384133              179   1e-53   
gb|KJB25825.1|  hypothetical protein B456_004G211100                    180   9e-53   Gossypium raimondii
gb|KJB52086.1|  hypothetical protein B456_008G246300                    175   4e-51   Gossypium raimondii
gb|ACI16511.1|  glutathione S-transferase                               174   5e-51   Cucumis sativus [cucumbers]
emb|CDP09753.1|  unnamed protein product                                172   5e-51   Coffea canephora [robusta coffee]
ref|XP_003630526.1|  Glutathione transferase                            169   8e-50   
ref|XP_006584714.1|  PREDICTED: glutathione S-transferase T2-like...    172   1e-49   Glycine max [soybeans]
gb|KCW77543.1|  hypothetical protein EUGRSUZ_D01861                     168   2e-48   Eucalyptus grandis [rose gum]
gb|KJB52087.1|  hypothetical protein B456_008G246300                    166   2e-47   Gossypium raimondii
ref|XP_002960536.1|  hypothetical protein SELMODRAFT_402877             166   3e-47   
ref|XP_002967183.1|  hypothetical protein SELMODRAFT_407994             166   3e-47   
gb|KJB25824.1|  hypothetical protein B456_004G211100                    162   4e-46   Gossypium raimondii
ref|XP_009774395.1|  PREDICTED: glutathione S-transferase T1-like       159   1e-45   Nicotiana sylvestris
ref|XP_008678005.1|  PREDICTED: glutathione S-transferase T1-like       156   2e-43   Zea mays [maize]
ref|XP_006663010.1|  PREDICTED: glutathione S-transferase T1-like       148   5e-41   
ref|XP_008794199.1|  PREDICTED: glutathione S-transferase T1 isof...    147   2e-40   
gb|AEB91980.1|  glutathione S-transferase theta 1                       144   6e-39   Locusta migratoria
ref|XP_002463456.1|  hypothetical protein SORBIDRAFT_01g000230          141   3e-38   
ref|XP_011072496.1|  PREDICTED: glutathione S-transferase T1-like       140   5e-38   
ref|XP_005848771.1|  hypothetical protein CHLNCDRAFT_57549              142   6e-38   Chlorella variabilis
ref|XP_003485831.1|  PREDICTED: glutathione S-transferase theta-1...    141   9e-38   
ref|XP_010909099.1|  PREDICTED: glutathione S-transferase T1 isof...    139   3e-37   
ref|XP_003397510.1|  PREDICTED: glutathione S-transferase theta-1...    139   5e-37   
ref|XP_009769998.1|  PREDICTED: glutathione S-transferase T1-like       134   8e-37   Nicotiana sylvestris
ref|XP_001767888.1|  predicted protein                                  138   1e-36   
gb|AFZ39143.1|  theta class glutathione S-transferase                   139   1e-36   Physcomitrella patens
emb|CDW81275.1|  glutathione s-transferase theta-1                      138   1e-36   Stylonychia lemnae
ref|XP_003727085.1|  PREDICTED: glutathione S-transferase theta-1...    136   5e-36   Strongylocentrotus purpuratus [purple urchin]
ref|XP_002157119.2|  PREDICTED: glutathione S-transferase T1-like       135   9e-36   Hydra vulgaris
ref|XP_005524538.1|  PREDICTED: glutathione S-transferase theta-1...    136   1e-35   Pseudopodoces humilis [Tibetan ground-jay]
gb|EWS75951.1|  glutathione S-transferase, amine-terminal domain ...    135   1e-35   Tetrahymena thermophila SB210
ref|XP_010573725.1|  PREDICTED: glutathione S-transferase theta-1...    135   3e-35   Haliaeetus leucocephalus
emb|CDP22238.1|  unnamed protein product                                129   4e-35   Coffea canephora [robusta coffee]
gb|ELK15601.1|  Glutathione S-transferase theta-1                       134   4e-35   Pteropus alecto
ref|XP_006908737.1|  PREDICTED: glutathione S-transferase theta-1...    134   8e-35   Pteropus alecto
ref|XP_004346352.1|  glutathione S-transferase domain-containing ...    133   1e-34   Capsaspora owczarzaki ATCC 30864
ref|XP_010396446.1|  PREDICTED: glutathione S-transferase theta-1...    133   2e-34   Corvus cornix cornix
ref|XP_009006212.1|  PREDICTED: glutathione S-transferase theta-1...    132   2e-34   Callithrix jacchus [common marmoset]
ref|XP_001489453.1|  PREDICTED: glutathione S-transferase theta-1...    132   2e-34   Equus caballus [domestic horse]
ref|XP_007973334.1|  PREDICTED: glutathione S-transferase theta-1       132   2e-34   Chlorocebus sabaeus
ref|XP_010368118.1|  PREDICTED: glutathione S-transferase theta-1...    132   2e-34   Rhinopithecus roxellana
ref|XP_005595439.1|  PREDICTED: glutathione S-transferase theta-1...    132   2e-34   
ref|XP_003919137.1|  PREDICTED: glutathione S-transferase theta-1...    132   3e-34   Papio anubis [baboon]
ref|XP_006822345.1|  PREDICTED: glutathione S-transferase theta-1...    132   3e-34   Saccoglossus kowalevskii
gb|AII00841.1|  glutathione S-transferase theta 1                       132   4e-34   Canis lupus familiaris [dogs]
ref|XP_534751.3|  PREDICTED: glutathione S-transferase theta-1          132   4e-34   Canis lupus familiaris [dogs]
gb|ABQ82132.1|  glutathione S-transferase theta                         131   4e-34   Alitta succinea
ref|XP_008155438.1|  PREDICTED: glutathione S-transferase theta-1       132   4e-34   Eptesicus fuscus
gb|EJY86624.1|  Glutathione S-transferase T1                            132   4e-34   Oxytricha trifallax
gb|EJY80394.1|  Glutathione S-transferase T1                            131   5e-34   Oxytricha trifallax
ref|XP_003994894.3|  PREDICTED: glutathione S-transferase theta-1       131   5e-34   
ref|XP_007092375.1|  PREDICTED: glutathione S-transferase theta-1...    131   5e-34   Panthera tigris altaica
ref|XP_002830963.1|  PREDICTED: glutathione S-transferase theta-1...    131   6e-34   
ref|XP_004680982.1|  PREDICTED: glutathione S-transferase theta-1...    131   6e-34   
gb|AHC08064.1|  theta glutathione S-transferase                         130   7e-34   Locusta migratoria
ref|XP_008500992.1|  PREDICTED: LOW QUALITY PROTEIN: glutathione ...    131   9e-34   Calypte anna
ref|XP_005054826.1|  PREDICTED: glutathione S-transferase theta-1...    130   9e-34   Ficedula albicollis
gb|EHH25431.1|  hypothetical protein EGK_21202                          130   1e-33   Macaca mulatta [rhesus macaque]
ref|XP_006130307.1|  PREDICTED: glutathione S-transferase theta-1...    130   1e-33   
gb|EHH61703.1|  hypothetical protein EGM_19746                          130   1e-33   Macaca fascicularis [crab eating macaque]
ref|XP_004466461.1|  PREDICTED: glutathione S-transferase theta-1...    130   1e-33   Dasypus novemcinctus
ref|XP_001089367.1|  PREDICTED: glutathione S-transferase theta-1...    130   1e-33   
ref|XP_007957332.1|  PREDICTED: glutathione S-transferase theta-1...    130   1e-33   Orycteropus afer afer
ref|XP_008566801.1|  PREDICTED: glutathione S-transferase theta-1...    130   1e-33   Galeopterus variegatus [Malayan flying lemur]
ref|XP_008066997.1|  PREDICTED: glutathione S-transferase theta-1       130   1e-33   Carlito syrichta
ref|XP_005886352.1|  PREDICTED: glutathione S-transferase theta-1...    130   1e-33   Myotis brandtii
ref|NP_000844.2|  glutathione S-transferase theta-1 isoform a           130   2e-33   Homo sapiens [man]
ref|XP_004063215.1|  PREDICTED: glutathione S-transferase theta-1       130   2e-33   Gorilla gorilla gorilla [lowland gorilla]
ref|XP_008961689.1|  PREDICTED: glutathione S-transferase theta-1...    130   2e-33   Pan paniscus [bonobo]
pdb|2C3Q|A  Chain A, Human Glutathione-S-Transferase T1-1 W234r M...    130   2e-33   Homo sapiens [man]
gb|AAV38754.1|  glutathione S-transferase theta 1                       130   2e-33   Homo sapiens [man]
ref|XP_004362055.1|  hypothetical protein DFA_06351                     129   2e-33   Cavenderia fasciculata
ref|XP_003803343.1|  PREDICTED: glutathione S-transferase theta-1...    130   2e-33   Otolemur garnettii
pdb|2C3N|A  Chain A, Human Glutathione-S-Transferase T1-1, Apo Form     130   2e-33   Homo sapiens [man]
ref|XP_003938575.1|  PREDICTED: glutathione S-transferase theta-1...    130   2e-33   Saimiri boliviensis boliviensis
gb|AHH29314.1|  glutathione S-transferase T1                            130   2e-33   Macaca mulatta [rhesus macaque]
gb|AHH29313.1|  glutathione S-transferase T1                            130   2e-33   Macaca fascicularis [crab eating macaque]
emb|CAA55935.1|  glutathione transferase T1                             129   3e-33   Homo sapiens [man]
ref|XP_004607625.1|  PREDICTED: glutathione S-transferase theta-1...    129   3e-33   Sorex araneus [Eurasian shrew]
ref|XP_005023587.1|  PREDICTED: glutathione S-transferase theta-1...    129   4e-33   Anas platyrhynchos [duck]
ref|NP_956815.1|  glutathione S-transferase theta-like                  129   4e-33   
ref|XP_004466459.1|  PREDICTED: glutathione S-transferase theta-1...    129   4e-33   
ref|XP_002200008.1|  PREDICTED: glutathione S-transferase theta-1...    129   5e-33   Taeniopygia guttata
ref|XP_011400420.1|  Glutathione S-transferase theta-2B                 134   6e-33   Auxenochlorella protothecoides
ref|XP_790223.2|  PREDICTED: glutathione S-transferase theta-1-like     128   6e-33   Strongylocentrotus purpuratus [purple urchin]
ref|XP_007063803.1|  PREDICTED: glutathione S-transferase theta-1...    129   6e-33   Chelonia mydas [green seaturtle]
ref|XP_006106312.1|  PREDICTED: glutathione S-transferase theta-1...    129   7e-33   Myotis lucifugus
ref|XP_006213356.1|  PREDICTED: glutathione S-transferase theta-1...    128   7e-33   Vicugna pacos
ref|XP_005334521.1|  PREDICTED: glutathione S-transferase theta-1...    128   7e-33   Ictidomys tridecemlineatus
ref|XP_001929409.1|  PREDICTED: glutathione S-transferase theta-1...    128   8e-33   
ref|XP_005987168.1|  PREDICTED: glutathione S-transferase theta-1...    128   9e-33   
gb|AAX29474.1|  glutathione S-transferase theta 1                       128   1e-32   synthetic construct
gb|AAH07065.1|  Glutathione S-transferase theta 1                       127   1e-32   Homo sapiens [man]
ref|XP_005288627.1|  PREDICTED: glutathione S-transferase theta-1...    127   1e-32   Chrysemys picta bellii
ref|XP_011332867.1|  PREDICTED: glutathione S-transferase theta-1...    127   1e-32   
ref|XP_005147828.1|  PREDICTED: glutathione S-transferase theta-1...    127   2e-32   Melopsittacus undulatus
ref|XP_005987166.1|  PREDICTED: glutathione S-transferase theta-1...    127   2e-32   Latimeria chalumnae
gb|KFO57915.1|  Glutathione S-transferase theta-1                       127   2e-32   Corvus brachyrhynchos
ref|XP_005288626.1|  PREDICTED: glutathione S-transferase theta-1...    127   2e-32   Chrysemys picta bellii
ref|XP_004742534.1|  PREDICTED: glutathione S-transferase theta-1...    127   2e-32   Mustela putorius furo [black ferret]
ref|XP_008630325.1|  PREDICTED: glutathione S-transferase theta-1...    127   2e-32   Corvus brachyrhynchos
ref|XP_003639976.1|  PREDICTED: glutathione S-transferase theta-1...    127   3e-32   Canis lupus familiaris [dogs]
ref|XP_005334522.1|  PREDICTED: glutathione S-transferase theta-1...    127   3e-32   Ictidomys tridecemlineatus
ref|XP_009090481.1|  PREDICTED: glutathione S-transferase theta-1...    127   3e-32   Serinus canaria [canary]
ref|XP_003281783.1|  PREDICTED: glutathione S-transferase theta-1...    127   3e-32   Nomascus leucogenys [White-cheeked Gibbon]
ref|XP_006513055.1|  PREDICTED: glutathione S-transferase, theta ...    125   3e-32   
ref|XP_010985616.1|  PREDICTED: glutathione S-transferase theta-1       126   4e-32   Camelus dromedarius [camel]
gb|AEA86294.1|  putative glutathione S-transferase theta-2              124   4e-32   Solanum nigrum
dbj|BAB22023.1|  unnamed protein product                                126   5e-32   Mus musculus [mouse]
ref|XP_003508143.1|  PREDICTED: glutathione S-transferase theta-1       126   5e-32   Cricetulus griseus [Chinese hamsters]
ref|XP_797684.3|  PREDICTED: glutathione S-transferase theta-1-like     125   5e-32   Strongylocentrotus purpuratus [purple urchin]
ref|NP_598755.1|  glutathione S-transferase, theta 3                    126   6e-32   Mus musculus [mouse]
emb|CAA66665.1|  glutathione S-transferase theta                        126   6e-32   Mus musculus [mouse]
ref|NP_032211.3|  glutathione S-transferase theta-1                     126   6e-32   Mus musculus [mouse]
ref|XP_006048174.1|  PREDICTED: glutathione S-transferase theta-1...    125   7e-32   Bubalus bubalis [domestic water buffalo]
ref|XP_005396465.1|  PREDICTED: glutathione S-transferase theta-1...    125   7e-32   Chinchilla lanigera
ref|XP_004636372.1|  PREDICTED: glutathione S-transferase theta-1...    125   8e-32   Octodon degus
ref|XP_008248399.1|  PREDICTED: glutathione S-transferase theta-1...    124   8e-32   
gb|EMP32140.1|  Glutathione S-transferase theta-1                       129   8e-32   Chelonia mydas [green seaturtle]
ref|XP_004742535.1|  PREDICTED: glutathione S-transferase theta-1...    125   8e-32   Mustela putorius furo [black ferret]
ref|XP_007906035.1|  PREDICTED: LOW QUALITY PROTEIN: glutathione ...    125   8e-32   Callorhinchus milii [Australian ghost shark]
gb|KDR15740.1|  Glutathione S-transferase theta-1                       125   9e-32   Zootermopsis nevadensis
ref|NP_001039697.1|  glutathione S-transferase theta-1                  125   9e-32   Bos taurus [bovine]
ref|XP_001195869.2|  PREDICTED: glutathione S-transferase theta-1...    125   9e-32   Strongylocentrotus purpuratus [purple urchin]
ref|XP_010858349.1|  PREDICTED: glutathione S-transferase theta-1...    125   1e-31   Bison bison bison
ref|XP_008248398.1|  PREDICTED: glutathione S-transferase theta-1...    124   1e-31   
ref|XP_010953752.1|  PREDICTED: glutathione S-transferase theta-2...    124   1e-31   Camelus bactrianus [camel]
ref|XP_006640254.1|  PREDICTED: glutathione S-transferase theta-1...    125   1e-31   Lepisosteus oculatus
ref|XP_003994893.1|  PREDICTED: glutathione S-transferase theta-1...    125   1e-31   Felis catus [cat]
ref|XP_006874993.1|  PREDICTED: glutathione S-transferase theta-1...    125   1e-31   Chrysochloris asiatica
ref|XP_007092374.1|  PREDICTED: glutathione S-transferase theta-1...    125   1e-31   Panthera tigris altaica
ref|XP_006746108.1|  PREDICTED: glutathione S-transferase theta-1...    125   2e-31   Leptonychotes weddellii
ref|XP_004400592.1|  PREDICTED: glutathione S-transferase theta-1...    125   2e-31   Odobenus rosmarus divergens
ref|XP_003803344.1|  PREDICTED: glutathione S-transferase theta-1...    125   2e-31   Otolemur garnettii
ref|XP_004318777.1|  PREDICTED: glutathione S-transferase theta-1...    125   2e-31   
gb|AAH62201.1|  Glutathione S-transferase, theta 3                      125   2e-31   Mus musculus [mouse]
ref|XP_005360257.1|  PREDICTED: glutathione S-transferase theta-1...    126   2e-31   Microtus ochrogaster [prairie voles]
ref|XP_007646923.1|  PREDICTED: glutathione S-transferase theta-1       124   2e-31   Cricetulus griseus [Chinese hamsters]
ref|NP_445745.1|  glutathione S-transferase theta-1                     124   2e-31   Rattus norvegicus [brown rat]
ref|XP_010953754.1|  PREDICTED: glutathione S-transferase theta-2...    124   2e-31   Camelus bactrianus [camel]
ref|XP_008695753.1|  PREDICTED: glutathione S-transferase theta-1...    124   2e-31   Ursus maritimus [white bear]
ref|XP_008122745.1|  PREDICTED: LOW QUALITY PROTEIN: glutathione ...    125   2e-31   
ref|XP_004337203.1|  glutathione Stransferase, C-terminal domain ...    125   3e-31   Acanthamoeba castellanii str. Neff
ref|XP_004742533.1|  PREDICTED: glutathione S-transferase theta-1...    126   3e-31   
ref|XP_010985617.1|  PREDICTED: glutathione S-transferase theta-1...    124   3e-31   Camelus dromedarius [camel]
ref|XP_006874994.1|  PREDICTED: glutathione S-transferase theta-1...    124   3e-31   Chrysochloris asiatica
ref|XP_001929405.1|  PREDICTED: glutathione S-transferase theta-1       124   3e-31   
ref|XP_007127246.1|  PREDICTED: glutathione S-transferase theta-1...    124   4e-31   Physeter catodon
emb|CDW72288.1|  glutathione s-transferase domain-containing protein    124   4e-31   Stylonychia lemnae
ref|XP_780216.3|  PREDICTED: glutathione S-transferase theta-1-like     123   5e-31   
ref|XP_007451118.1|  PREDICTED: glutathione S-transferase theta-1...    123   6e-31   Lipotes vexillifer [baiji]
ref|XP_006121722.1|  PREDICTED: glutathione S-transferase theta-1...    123   6e-31   Pelodiscus sinensis [Chinese softshell turtle]
ref|XP_010718625.1|  PREDICTED: glutathione S-transferase theta-1...    123   6e-31   Meleagris gallopavo [common turkey]
ref|XP_005396466.1|  PREDICTED: glutathione S-transferase theta-1...    123   7e-31   Chinchilla lanigera
ref|XP_003419175.1|  PREDICTED: glutathione S-transferase theta-1...    123   7e-31   Loxodonta africana [African bush elephant]
ref|XP_006019954.1|  PREDICTED: glutathione S-transferase theta-1...    123   7e-31   Alligator sinensis
ref|XP_006979147.1|  PREDICTED: glutathione S-transferase theta-1...    123   8e-31   Peromyscus maniculatus bairdii
ref|XP_008248397.1|  PREDICTED: LOW QUALITY PROTEIN: glutathione ...    123   9e-31   Oryctolagus cuniculus [domestic rabbit]
ref|XP_006997739.1|  PREDICTED: glutathione S-transferase theta-2...    123   9e-31   Peromyscus maniculatus bairdii
ref|XP_005360258.1|  PREDICTED: glutathione S-transferase theta-1...    123   9e-31   Microtus ochrogaster [prairie voles]
ref|XP_005070806.1|  PREDICTED: glutathione S-transferase theta-1...    123   1e-30   
ref|XP_007063835.1|  PREDICTED: glutathione S-transferase theta-1...    122   1e-30   
ref|XP_006620387.1|  PREDICTED: glutathione S-transferase theta-1...    122   1e-30   
ref|XP_006277068.1|  PREDICTED: glutathione S-transferase theta-1...    122   1e-30   
ref|XP_004681155.1|  PREDICTED: glutathione S-transferase theta-1...    122   1e-30   
ref|XP_004276138.1|  PREDICTED: glutathione S-transferase theta-1...    122   1e-30   
ref|XP_004670992.1|  PREDICTED: glutathione S-transferase theta-1...    122   2e-30   
ref|XP_797671.3|  PREDICTED: glutathione S-transferase theta-1-like     122   2e-30   
ref|XP_002925099.1|  PREDICTED: glutathione S-transferase theta-1       122   2e-30   
ref|XP_004466458.1|  PREDICTED: glutathione S-transferase theta-1...    122   2e-30   
ref|XP_004887553.1|  PREDICTED: glutathione S-transferase theta-1...    122   2e-30   
ref|XP_006213357.1|  PREDICTED: glutathione S-transferase theta-1...    122   2e-30   
ref|XP_004843627.1|  PREDICTED: glutathione S-transferase theta-1...    122   2e-30   
gb|ACI34093.1|  Glutathione S-transferase theta-1                       122   2e-30   
ref|XP_010953749.1|  PREDICTED: glutathione S-transferase theta-1...    123   2e-30   
ref|XP_007196373.1|  PREDICTED: glutathione S-transferase theta-1...    122   2e-30   
ref|NP_036928.1|  glutathione S-transferase theta-2                     122   2e-30   
ref|XP_006157221.1|  PREDICTED: glutathione S-transferase theta-1...    122   3e-30   
ref|XP_005070805.1|  PREDICTED: glutathione S-transferase theta-1...    122   3e-30   
gb|KGL79187.1|  Glutathione S-transferase theta-1                       121   3e-30   
ref|XP_003478005.2|  PREDICTED: glutathione S-transferase theta-1...    122   3e-30   
gb|AAB03534.1|  glutathione transferase theta class type 2              122   3e-30   
ref|XP_008825395.1|  PREDICTED: glutathione S-transferase theta-1...    119   3e-30   
ref|XP_007973333.1|  PREDICTED: LOW QUALITY PROTEIN: glutathione ...    122   3e-30   
ref|NP_001279515.1|  glutathione S-transferase theta-1-like             121   3e-30   
ref|XP_003730181.1|  PREDICTED: glutathione S-transferase theta-1...    121   3e-30   
ref|NP_034491.2|  glutathione S-transferase theta-2                     121   4e-30   
gb|EJY66553.1|  hypothetical protein OXYTRI_13160                       121   4e-30   
emb|CDQ65962.1|  unnamed protein product                                121   4e-30   
gb|KDD76756.1|  hypothetical protein H632_c117p3                        124   5e-30   
ref|NP_001156289.1|  glutathione S-transferase, theta class-like        120   6e-30   
ref|NP_001131115.1|  glutathione S-transferase, theta 3                 120   6e-30   
ref|XP_780137.3|  PREDICTED: glutathione S-transferase theta-1-like     120   7e-30   
ref|XP_001659668.2|  AAEL009016-PA                                      120   7e-30   
ref|XP_008566800.1|  PREDICTED: glutathione S-transferase theta-1...    122   7e-30   
ref|XP_008534717.1|  PREDICTED: glutathione S-transferase theta-1...    120   9e-30   
ref|XP_003919135.1|  PREDICTED: glutathione S-transferase theta-2B      120   9e-30   
ref|XP_004592181.1|  PREDICTED: glutathione S-transferase theta-1...    120   1e-29   
ref|XP_011136696.1|  PREDICTED: glutathione S-transferase theta-1...    120   1e-29   
ref|XP_010602226.1|  PREDICTED: glutathione S-transferase theta-1...    120   1e-29   
gb|AAV68400.1|  glutathione S-transferase theta 2                       119   1e-29   
ref|XP_004400591.1|  PREDICTED: glutathione S-transferase theta-1...    120   1e-29   
ref|XP_006768810.1|  PREDICTED: glutathione S-transferase theta-1...    119   2e-29   
ref|XP_010875032.1|  PREDICTED: glutathione S-transferase theta-1...    119   2e-29   
ref|XP_004443156.1|  PREDICTED: glutathione S-transferase theta-1...    119   2e-29   
ref|XP_003387291.1|  PREDICTED: glutathione S-transferase T1-like       119   2e-29   
ref|XP_004887554.1|  PREDICTED: glutathione S-transferase theta-1...    119   2e-29   
ref|XP_007520872.1|  PREDICTED: glutathione S-transferase theta-1...    119   2e-29   
ref|NP_001165927.1|  glutathione S-transferase T3                       119   2e-29   
ref|XP_006901484.1|  PREDICTED: glutathione S-transferase theta-2...    119   2e-29   
ref|XP_008400753.1|  PREDICTED: glutathione S-transferase theta-1...    119   2e-29   
ref|XP_008838833.1|  PREDICTED: glutathione S-transferase theta-1...    119   2e-29   
gb|EHJ70012.1|  glutathione S-transferase theta 1                       119   2e-29   
ref|XP_007578350.1|  PREDICTED: glutathione S-transferase theta-1...    119   2e-29   
ref|XP_010215724.1|  PREDICTED: glutathione S-transferase theta-1...    120   3e-29   
gb|AGO58894.1|  glutathione S-transferase theta 1a                      119   3e-29   
ref|XP_003693859.1|  PREDICTED: glutathione S-transferase theta-1...    119   3e-29   
gb|AFJ75807.1|  glutathione s-transferase T1                            119   3e-29   
ref|XP_006901483.1|  PREDICTED: glutathione S-transferase theta-2...    119   3e-29   
ref|XP_005167246.1|  PREDICTED: glutathione S-transferase theta-1...    117   3e-29   
ref|XP_006048173.1|  PREDICTED: glutathione S-transferase theta-1...    119   3e-29   
ref|XP_005334523.1|  PREDICTED: glutathione S-transferase theta-2...    119   3e-29   
ref|XP_001426880.1|  hypothetical protein                               118   3e-29   
ref|NP_001069206.1|  glutathione S-transferase theta-2                  119   3e-29   
ref|XP_008179163.1|  PREDICTED: glutathione S-transferase theta-1...    119   3e-29   
ref|XP_005901654.1|  PREDICTED: glutathione S-transferase theta-1...    119   4e-29   
gb|ELR52176.1|  Glutathione S-transferase theta-1                       118   4e-29   
ref|XP_005901647.1|  PREDICTED: glutathione S-transferase theta-1...    119   4e-29   
ref|XP_002605845.1|  hypothetical protein BRAFLDRAFT_123804             118   4e-29   
gb|EHH62577.1|  hypothetical protein EGM_20970                          119   4e-29   
ref|NP_001244563.1|  glutathione S-transferase theta 2                  119   4e-29   
gb|ELR52175.1|  Glutathione S-transferase theta-1                       118   4e-29   
ref|XP_001106693.1|  PREDICTED: glutathione S-transferase theta-2...    119   4e-29   
ref|XP_001106578.1|  PREDICTED: glutathione S-transferase theta-2...    118   5e-29   
gb|EHH16568.1|  hypothetical protein EGK_11862                          118   5e-29   
ref|XP_004085257.1|  PREDICTED: glutathione S-transferase theta-1...    118   5e-29   
ref|XP_004670993.1|  PREDICTED: glutathione S-transferase theta-2...    118   6e-29   
ref|XP_011159137.1|  PREDICTED: glutathione S-transferase theta-1...    118   6e-29   
ref|XP_007657957.1|  PREDICTED: glutathione S-transferase theta-1...    118   6e-29   
ref|XP_010602224.1|  PREDICTED: glutathione S-transferase theta-1...    118   6e-29   
ref|XP_006140270.1|  PREDICTED: glutathione S-transferase theta-1...    114   7e-29   
ref|XP_005503935.1|  PREDICTED: glutathione S-transferase theta-1...    118   7e-29   
ref|XP_002429863.1|  GSTD1-5 protein, putative                          117   7e-29   
ref|XP_009909247.1|  PREDICTED: glutathione S-transferase theta-2       118   8e-29   
ref|XP_011293522.1|  PREDICTED: LOW QUALITY PROTEIN: glutathione ...    118   8e-29   
ref|XP_002925113.1|  PREDICTED: glutathione S-transferase theta-1...    117   8e-29   
ref|XP_005691800.1|  PREDICTED: glutathione S-transferase theta-1...    117   9e-29   
ref|XP_004017553.1|  PREDICTED: glutathione S-transferase theta-1...    117   9e-29   
ref|XP_692427.1|  PREDICTED: glutathione S-transferase theta-1 is...    117   9e-29   
ref|XP_002115231.1|  hypothetical protein TRIADDRAFT_59204              117   9e-29   
ref|XP_011354287.1|  PREDICTED: glutathione S-transferase theta-1...    117   9e-29   
ref|XP_005959724.1|  PREDICTED: glutathione S-transferase theta-1...    117   1e-28   
ref|XP_008196475.1|  PREDICTED: glutathione S-transferase theta-1       117   1e-28   
ref|XP_003387275.1|  PREDICTED: glutathione S-transferase theta-2...    117   1e-28   
ref|XP_008695752.1|  PREDICTED: glutathione S-transferase theta-1...    117   1e-28   
ref|XP_005360260.1|  PREDICTED: glutathione S-transferase theta-2...    117   1e-28   
ref|XP_001231971.3|  PREDICTED: glutathione S-transferase theta-1...    119   1e-28   
ref|XP_797660.1|  PREDICTED: glutathione S-transferase theta-1-like     117   1e-28   
ref|XP_006908738.1|  PREDICTED: glutathione S-transferase theta-1...    117   1e-28   
ref|XP_009090484.1|  PREDICTED: glutathione S-transferase theta-1...    117   1e-28   
gb|ADO27893.1|  glutathione S-transferase theta-1                       117   2e-28   
ref|XP_007520826.1|  PREDICTED: glutathione S-transferase theta-1...    117   2e-28   
emb|CDW75647.1|  glutathione s-transferase domain-containing protein    117   2e-28   
ref|XP_011255352.1|  PREDICTED: glutathione S-transferase theta-1...    116   2e-28   
ref|XP_003478006.2|  PREDICTED: glutathione S-transferase theta-1...    117   2e-28   
ref|XP_003508145.1|  PREDICTED: glutathione S-transferase theta-2       116   2e-28   
ref|XP_004607626.1|  PREDICTED: glutathione S-transferase theta-1...    116   3e-28   
ref|XP_004887550.1|  PREDICTED: glutathione S-transferase theta-1...    116   3e-28   
ref|XP_004636371.1|  PREDICTED: glutathione S-transferase theta-1...    116   3e-28   
emb|CDW86738.1|  glutathione transferase 10                             116   3e-28   
gb|EHB04748.1|  Glutathione S-transferase theta-1                       116   4e-28   
ref|XP_004716394.1|  PREDICTED: glutathione S-transferase theta-1...    116   4e-28   
ref|XP_002505077.1|  predicted protein                                  116   4e-28   
emb|CDW75323.1|  glutathione s-transferase domain-containing protein    115   4e-28   
ref|XP_011159136.1|  PREDICTED: glutathione S-transferase theta-1...    117   4e-28   
ref|XP_004517788.1|  PREDICTED: glutathione S-transferase theta-1...    115   4e-28   
gb|EFB19466.1|  hypothetical protein PANDA_014538                       112   4e-28   
gb|EHB04747.1|  Glutathione S-transferase theta-1                       116   4e-28   
ref|XP_004742536.1|  PREDICTED: glutathione S-transferase theta-1...    114   4e-28   
ref|XP_004887549.1|  PREDICTED: glutathione S-transferase theta-1...    116   4e-28   
ref|XP_002049289.1|  GJ21509                                            115   4e-28   
ref|XP_002115230.1|  hypothetical protein TRIADDRAFT_59202              115   5e-28   
gb|KDD76755.1|  hypothetical protein H632_c117p2                        115   5e-28   
gb|AFO69981.1|  GST_theta-like protein                                  115   5e-28   
ref|XP_004354059.1|  glutathione transferase family protein             115   6e-28   
ref|NP_001187546.1|  glutathione S-transferase theta-1                  115   7e-28   
ref|XP_008566796.1|  PREDICTED: glutathione S-transferase theta-2...    115   7e-28   
gb|KJB52085.1|  hypothetical protein B456_008G246200                    111   7e-28   
gb|AEY80033.1|  glutathione S-transferase T1                            115   1e-27   
emb|CCQ19302.1|  GST-theta                                              114   1e-27   
ref|XP_011430263.1|  PREDICTED: glutathione S-transferase theta-1...    114   1e-27   
ref|NP_001006811.1|  glutathione S-transferase theta 1                  115   1e-27   
ref|XP_624692.1|  PREDICTED: glutathione S-transferase theta-4          114   2e-27   
ref|XP_011241675.1|  PREDICTED: glutathione S-transferase theta-2...    114   2e-27   
gb|ABW96271.1|  glutathione S-transferase theta                         113   2e-27   
ref|XP_009090483.1|  PREDICTED: glutathione S-transferase theta-1...    114   2e-27   
ref|XP_780057.1|  PREDICTED: glutathione S-transferase theta-1-like     114   2e-27   
gb|ABD67512.1|  glutathione S-transferase theta                         112   3e-27   
ref|XP_002114013.1|  expressed hypothetical protein                     113   3e-27   
ref|XP_006277069.1|  PREDICTED: glutathione S-transferase theta-1...    114   3e-27   
ref|XP_006019953.1|  PREDICTED: glutathione S-transferase theta-1...    114   3e-27   
gb|ACQ58539.1|  Glutathione S-transferase theta-1                       114   3e-27   
ref|XP_002722606.1|  PREDICTED: glutathione S-transferase theta-2...    114   3e-27   
gb|EJY80586.1|  Glutathione S-transferase                               113   3e-27   
ref|XP_011206473.1|  PREDICTED: glutathione S-transferase theta-1       113   4e-27   
ref|XP_003230207.2|  PREDICTED: glutathione S-transferase theta-1...    114   4e-27   
gb|EJY70920.1|  Glutathione S-transferase domain-containing protein     113   5e-27   
ref|XP_004742538.1|  PREDICTED: glutathione S-transferase theta-1...    113   5e-27   
ref|XP_003478004.2|  PREDICTED: glutathione S-transferase theta-2       113   5e-27   
ref|XP_006768844.1|  PREDICTED: glutathione S-transferase theta-1...    113   5e-27   
ref|XP_010003090.1|  PREDICTED: glutathione S-transferase theta-1...    113   6e-27   
ref|XP_006121720.1|  PREDICTED: glutathione S-transferase theta-1...    113   6e-27   
ref|XP_002115221.1|  expressed hypothetical protein                     112   7e-27   
ref|XP_007520874.1|  PREDICTED: glutathione S-transferase theta-1...    112   7e-27   
gb|AAB03533.1|  theta class glutathione transferase type 2              112   7e-27   
ref|XP_004400589.1|  PREDICTED: glutathione S-transferase theta-1...    112   8e-27   
gb|ACQ57872.1|  Glutathione S-transferase theta-1                       112   8e-27   
ref|XP_008155437.1|  PREDICTED: glutathione S-transferase theta-1...    112   1e-26   
ref|XP_004817175.1|  PREDICTED: LOW QUALITY PROTEIN: glutathione ...    112   1e-26   
ref|XP_004503732.1|  PREDICTED: tRNA 2'-phosphotransferase 1-like...    113   1e-26   
gb|EPQ20308.1|  Glutathione S-transferase theta-1                       108   1e-26   
gb|ACI66391.1|  Glutathione S-transferase theta-1                       112   1e-26   
ref|XP_311299.1|  AGAP000761-PA                                         112   1e-26   
gb|AFJ75812.1|  glutathione s-transferase T1                            112   1e-26   
ref|XP_002063969.1|  GK15954                                            111   1e-26   
ref|XP_002931957.2|  PREDICTED: glutathione S-transferase theta-1       112   1e-26   
ref|XP_009062390.1|  hypothetical protein LOTGIDRAFT_207042             111   1e-26   
gb|EGI60287.1|  Glutathione S-transferase theta-1                       111   2e-26   
gb|AIL23552.1|  glutathione S-transferase theta                         111   2e-26   
ref|XP_003387292.1|  PREDICTED: glutathione S-transferase theta-2...    111   2e-26   
emb|CAG09655.1|  unnamed protein product                                111   2e-26   
ref|NP_001085203.1|  glutathione S-transferase theta 1                  111   2e-26   
gb|KFO23710.1|  Calcineurin-binding protein cabin-1                     117   2e-26   
gb|AAH87825.1|  gstt1-prov protein                                      112   2e-26   
ref|XP_011062826.1|  PREDICTED: glutathione S-transferase theta-1...    111   2e-26   
ref|XP_787201.1|  PREDICTED: glutathione S-transferase theta-1-like     111   2e-26   
gb|ACE81253.1|  glutathione S-transferase theta 1                       111   2e-26   
gb|ACQ58896.1|  Glutathione S-transferase theta-1                       111   2e-26   
ref|XP_004607499.1|  PREDICTED: glutathione S-transferase theta-2...    111   3e-26   
pdb|4MPG|A  Chain A, Crystal Structure Of Human Glutathione Trans...    112   3e-26   
ref|XP_002113711.1|  expressed hypothetical protein                     110   3e-26   
ref|XP_002834662.1|  PREDICTED: glutathione S-transferase theta-2B      111   3e-26   
ref|NP_001165925.1|  glutathione S-transferase T2                       110   3e-26   
ref|XP_006938700.1|  PREDICTED: glutathione S-transferase theta-1...    111   3e-26   
ref|XP_005709172.1|  hypothetical protein Gasu_00240                    115   3e-26   
gb|ELK26410.1|  Glutathione S-transferase theta-1                       112   3e-26   
ref|XP_002925097.1|  PREDICTED: glutathione S-transferase theta-2B      110   4e-26   
ref|XP_003385601.2|  PREDICTED: glutathione S-transferase T1-like       111   4e-26   
pdb|4MPF|A  Chain A, Crystal Structure Of Human Glutathione Trans...    111   4e-26   
ref|XP_007092376.1|  PREDICTED: glutathione S-transferase theta-1...    110   4e-26   
ref|NP_001290604.1|  glutathione S-transferase theta-1                  110   4e-26   
ref|XP_004063211.1|  PREDICTED: glutathione S-transferase theta-2...    110   4e-26   
ref|NP_001074312.1|  glutathione S-transferase theta-2B                 110   5e-26   
gb|AAV38755.1|  glutathione S-transferase theta 2                       110   5e-26   
gb|AEW26632.1|  GSTT2                                                   110   5e-26   
ref|XP_005261772.1|  PREDICTED: glutathione S-transferase theta-2...    110   5e-26   
ref|XP_006746107.1|  PREDICTED: glutathione S-transferase theta-1...    110   5e-26   
ref|NP_000845.2|  glutathione S-transferase theta-2 isoform a           110   5e-26   
ref|XP_004063210.1|  PREDICTED: glutathione S-transferase theta-2...    110   5e-26   
ref|XP_005815453.1|  PREDICTED: glutathione S-transferase theta-1...    107   5e-26   
ref|NP_001289599.1|  glutathione S-transferase theta-2 isoform b        110   5e-26   
gb|AAC13317.1|  glutathione S-transferase theta 2                       110   5e-26   
ref|NP_956878.1|  glutathione S-transferase theta 1b                    110   5e-26   
gb|AEW26637.1|  GSTT2B                                                  110   6e-26   
ref|XP_003811115.1|  PREDICTED: glutathione S-transferase theta-2...    110   7e-26   
gb|AEW26633.1|  GSTT2B                                                  110   7e-26   
gb|ACO09513.1|  Glutathione S-transferase theta-1                       110   7e-26   
ref|XP_003811116.1|  PREDICTED: glutathione S-transferase theta-2...    110   7e-26   
dbj|BAH70628.1|  ACYPI007233                                            107   7e-26   
ref|XP_515243.2|  PREDICTED: glutathione S-transferase theta-2          110   7e-26   
ref|XP_316865.2|  AGAP000888-PA                                         110   7e-26   
gb|EJY68604.1|  Glutathione S-transferase domain-containing protein     110   7e-26   
emb|CDQ72597.1|  unnamed protein product                                110   7e-26   
ref|XP_006822361.1|  PREDICTED: glutathione S-transferase theta-1...    109   7e-26   
ref|XP_008285263.1|  PREDICTED: glutathione S-transferase theta-1...    110   8e-26   
emb|CAG33210.1|  GSTT2                                                  110   8e-26   
ref|XP_001369983.1|  PREDICTED: glutathione S-transferase theta-2...    109   9e-26   
dbj|BAG34980.1|  unnamed protein product                                109   1e-25   
ref|XP_003282572.1|  PREDICTED: glutathione S-transferase theta-2...    109   1e-25   
ref|XP_003282573.1|  PREDICTED: glutathione S-transferase theta-2...    109   1e-25   
ref|XP_007490766.1|  PREDICTED: glutathione S-transferase theta-2...    109   1e-25   



>ref|XP_004245615.1| PREDICTED: glutathione S-transferase T1-like [Solanum lycopersicum]
Length=250

 Score =   251 bits (640),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 117/153 (76%), Positives = 131/153 (86%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M +KLYVDRMSQPSRA++IFCK NGIDFEE+ I ++K Q  +PE+  INPMKQVPA++DG
Sbjct  1    MTLKLYVDRMSQPSRAVIIFCKLNGIDFEEIHINLSKRQQLSPEFKEINPMKQVPAIIDG  60

Query  286  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  462
             FKLFESHA L+YLA A  G+ADHWYPADL KRAKVDSV DWHHSNLRRGAAGY+FNT L
Sbjct  61   RFKLFESHAILRYLACAFPGIADHWYPADLYKRAKVDSVLDWHHSNLRRGAAGYIFNTVL  120

Query  463  APAFGLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            APAFGLP NP AAAEAEKVLLASL  +ES WLQ
Sbjct  121  APAFGLPLNPQAAAEAEKVLLASLAKVESVWLQ  153



>ref|XP_006343997.1| PREDICTED: glutathione S-transferase T1-like [Solanum tuberosum]
Length=250

 Score =   248 bits (633),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 115/153 (75%), Positives = 130/153 (85%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M +KLYVDRMSQPSRA++IFCK NGIDFEE+ I ++K Q  +PE+  INPMKQVPA++DG
Sbjct  1    MTLKLYVDRMSQPSRAVIIFCKLNGIDFEEIHINLSKRQQLSPEFKEINPMKQVPAIMDG  60

Query  286  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  462
             FKLFESHA L+YLA A  G+ADHWYPADL KRAKVDSV DWHHSNLRRG AGY+FNT L
Sbjct  61   RFKLFESHAILRYLACAFPGIADHWYPADLYKRAKVDSVLDWHHSNLRRGTAGYIFNTVL  120

Query  463  APAFGLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            APAFGLP NP AAAEA+KVLLASL  +ES WLQ
Sbjct  121  APAFGLPLNPQAAAEAKKVLLASLANIESVWLQ  153



>ref|XP_009600810.1| PREDICTED: glutathione S-transferase T1-like [Nicotiana tomentosiformis]
Length=250

 Score =   246 bits (629),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 118/153 (77%), Positives = 129/153 (84%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M +KLYVDRMSQPSRALLIFCK NGIDFEEV I ++K QH +PE+  +NPMKQVPA++DG
Sbjct  1    MTLKLYVDRMSQPSRALLIFCKLNGIDFEEVYINLSKRQHLSPEFKEVNPMKQVPAIMDG  60

Query  286  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  462
             FKLFESHA L+YLA A  GVADHWYPADL KRAKVDSV DWHHSNLRRGAA YVF+T  
Sbjct  61   RFKLFESHAILRYLACAFPGVADHWYPADLYKRAKVDSVLDWHHSNLRRGAAAYVFSTVF  120

Query  463  APAFGLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            APAFGLP N  AAAEAEKVLLASL  +ES WLQ
Sbjct  121  APAFGLPLNQQAAAEAEKVLLASLAKIESVWLQ  153



>ref|XP_009599399.1| PREDICTED: glutathione S-transferase T1-like [Nicotiana tomentosiformis]
Length=236

 Score =   244 bits (624),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 111/153 (73%), Positives = 133/153 (87%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M++KLYVDR+SQPSRA+LIFCK NGI+FEEV I+++KGQHR+PE+A INPMKQVPA+V G
Sbjct  1    MSLKLYVDRLSQPSRAILIFCKLNGIEFEEVPIELSKGQHRSPEFAEINPMKQVPAIVHG  60

Query  286  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  462
             FKLFESHA L+YLA+A   VADHWYP+DLQKRAK++SV DWHHSNLRRG+ GYV N+ L
Sbjct  61   SFKLFESHAILRYLASAFPEVADHWYPSDLQKRAKIESVLDWHHSNLRRGSVGYVLNSTL  120

Query  463  APAFGLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            APA GLP NP AAAE EKVL ASL  ++++WLQ
Sbjct  121  APALGLPLNPQAAAEGEKVLSASLAKIDTYWLQ  153



>ref|XP_009796155.1| PREDICTED: glutathione S-transferase T1-like [Nicotiana sylvestris]
Length=236

 Score =   243 bits (620),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 110/153 (72%), Positives = 132/153 (86%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M++KLYVDR+SQPSRALLIFCK NGI+FEEV I+++KGQHR+PE+A INPMKQVPA+V G
Sbjct  1    MSLKLYVDRLSQPSRALLIFCKLNGIEFEEVPIELSKGQHRSPEFAEINPMKQVPAIVHG  60

Query  286  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  462
             F LFESHA L+YLA+A   VADHWYP+DLQKRAK++SV DWHHSNLRRG+ GYV N+ L
Sbjct  61   SFTLFESHAILRYLASAFPEVADHWYPSDLQKRAKIESVLDWHHSNLRRGSVGYVLNSTL  120

Query  463  APAFGLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            APA GLP NP AAAE EK+L ASL  ++++WLQ
Sbjct  121  APALGLPLNPQAAAEGEKILSASLAKIDTYWLQ  153



>gb|EYU23489.1| hypothetical protein MIMGU_mgv1a012760mg [Erythranthe guttata]
Length=241

 Score =   239 bits (610),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 111/153 (73%), Positives = 129/153 (84%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M +K+Y DRMSQPSRA+LIFCKANG++FEEV IQ+AK QH +PE+A INPMKQVPA+V G
Sbjct  1    MELKVYADRMSQPSRAILIFCKANGLEFEEVPIQLAKKQHHSPEFAEINPMKQVPAIVHG  60

Query  286  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  462
            DFKLFESHA L YLA+A  GVADHWYPAD +KRAK+ SV DWHHSNLRRG+ GY+FN  +
Sbjct  61   DFKLFESHAILIYLASAFPGVADHWYPADARKRAKIHSVLDWHHSNLRRGSVGYIFNNTI  120

Query  463  APAFGLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            A AFGLP NP A AE EK+LLASL T+ES WL+
Sbjct  121  ALAFGLPLNPKAEAEGEKLLLASLSTIESLWLE  153



>ref|XP_006360687.1| PREDICTED: glutathione S-transferase T1-like [Solanum tuberosum]
Length=236

 Score =   237 bits (605),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 109/153 (71%), Positives = 129/153 (84%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M++K+YVDR+SQPSRA+LIFCK NGI+FEEV I ++KGQHRTPEY  +N MKQVPA+V  
Sbjct  1    MSLKIYVDRLSQPSRAILIFCKLNGIEFEEVNIDLSKGQHRTPEYQEVNIMKQVPAIVHD  60

Query  286  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  462
             FKLFESHA L+YLA+A    ADHWYP DLQKRA V+ V DWHHSNLRRG+AGYVFNT L
Sbjct  61   TFKLFESHAILRYLASAFPETADHWYPKDLQKRANVECVLDWHHSNLRRGSAGYVFNTIL  120

Query  463  APAFGLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            APAFGLP NP AAAE +K+L ASL T++++WLQ
Sbjct  121  APAFGLPLNPQAAAEGKKLLSASLATIDTYWLQ  153



>ref|XP_011080977.1| PREDICTED: glutathione S-transferase T1-like [Sesamum indicum]
Length=236

 Score =   235 bits (600),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 110/153 (72%), Positives = 130/153 (85%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M +KLYVDR+SQPSRA+LIFCKANGI+FEEV+I +AK QH  PE+A +NPMKQVPA+V G
Sbjct  1    MELKLYVDRISQPSRAILIFCKANGIEFEEVKIDLAKKQHHFPEFAEVNPMKQVPAIVHG  60

Query  286  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  462
            DFKLFESHA L YLA+A  GVA HWYPAD+QKRAK+ SV DWHHSNLRRG+ GY+FNTA+
Sbjct  61   DFKLFESHAILIYLASAFPGVAHHWYPADVQKRAKIHSVLDWHHSNLRRGSVGYIFNTAV  120

Query  463  APAFGLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            A A GLP NP AAAE E+++ ASL  L+SFWL+
Sbjct  121  ALALGLPANPQAAAEGEELMSASLAKLDSFWLE  153



>ref|XP_004252589.1| PREDICTED: glutathione S-transferase T1 [Solanum lycopersicum]
Length=236

 Score =   234 bits (597),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 108/153 (71%), Positives = 128/153 (84%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M++K+YVDR+SQPSRA+LIFCK NGI+FEEV I +AKGQHRTPEY  +N MKQVPA+V  
Sbjct  1    MSLKVYVDRLSQPSRAILIFCKLNGIEFEEVNIDLAKGQHRTPEYQEVNIMKQVPAIVHD  60

Query  286  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  462
             FKLFESHA L+YLA+A    ADHWYP DLQKRA V+ V DWHH+NLRRG+AGYVFNT L
Sbjct  61   TFKLFESHAILRYLASAFPETADHWYPKDLQKRANVECVLDWHHANLRRGSAGYVFNTIL  120

Query  463  APAFGLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            APAFGLP NP AAAE + +L ASL T++++WLQ
Sbjct  121  APAFGLPLNPQAAAEGKNLLSASLATIDTYWLQ  153



>emb|CDP09756.1| unnamed protein product [Coffea canephora]
Length=250

 Score =   234 bits (597),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 111/153 (73%), Positives = 128/153 (84%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M +KLY DRMSQPSRA+LIFC+ NGIDF+EV++ I+K Q  TPE+A INPMK+VPA+VDG
Sbjct  1    MKLKLYADRMSQPSRAVLIFCRVNGIDFDEVKVDISKRQQLTPEFAEINPMKKVPAIVDG  60

Query  286  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  462
             FKLFESHA L+YLA+A  GVADHWYPADL KRAK++SV DWHHSNLRRGAA  V N AL
Sbjct  61   RFKLFESHAILQYLASAFPGVADHWYPADLFKRAKINSVLDWHHSNLRRGAAPLVLNKAL  120

Query  463  APAFGLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            APA GLP NP AAAEAE +L ASL  +ESFWL+
Sbjct  121  APALGLPLNPKAAAEAEIILSASLAKIESFWLK  153



>ref|XP_004503735.1| PREDICTED: tRNA 2'-phosphotransferase 1-like isoform X4 [Cicer 
arietinum]
Length=250

 Score =   234 bits (596),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 108/153 (71%), Positives = 128/153 (84%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M +K+Y DRMSQPSRA+LIFCK NGIDFEE+QI+++K QH +PE+ AINP K+VPA+VDG
Sbjct  1    MKLKVYTDRMSQPSRAILIFCKVNGIDFEEIQIELSKRQHLSPEFQAINPFKKVPAIVDG  60

Query  286  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  462
             FKLFESHA L YLA+A  GVADHWYPAD+ +RAK+ +V DWHH NLRRGAAGYV NT L
Sbjct  61   RFKLFESHAILIYLASAFPGVADHWYPADVSRRAKIHAVLDWHHLNLRRGAAGYVLNTVL  120

Query  463  APAFGLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            AP  GLP N  AAAEAEKVL++SL T+E+ WLQ
Sbjct  121  APFLGLPLNKQAAAEAEKVLVSSLSTIENIWLQ  153



>gb|AAF64449.1|AF239927_1 glutathione S-transferase [Euphorbia esula]
Length=238

 Score =   233 bits (594),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 107/152 (70%), Positives = 127/152 (84%), Gaps = 1/152 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            MA+KLYV R+SQPSRAL+IFCK+NGI+FEE  I + K QH++P++  INPM QVP++V G
Sbjct  1    MALKLYVHRVSQPSRALVIFCKSNGIEFEEAHIDLMKKQHKSPDFLEINPMGQVPSMVHG  60

Query  286  DFKLFESHAALKYLAAAN-GVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  462
            DFKLFESHA L YL AA   VADHWYP+D+++RAKV SV DWHHSNLRRGA GY+FN+ L
Sbjct  61   DFKLFESHAILTYLTAAYPEVADHWYPSDIKQRAKVQSVLDWHHSNLRRGAVGYIFNSKL  120

Query  463  APAFGLPCNPHAAAEAEKVLLASLGTLESFWL  558
            APAFG+P NP AAAE EK LLASL TL+SFWL
Sbjct  121  APAFGIPLNPQAAAEGEKTLLASLSTLDSFWL  152



>ref|XP_011072506.1| PREDICTED: glutathione S-transferase T1-like [Sesamum indicum]
Length=236

 Score =   232 bits (592),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 111/153 (73%), Positives = 128/153 (84%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M +KLYVDR+SQPSRA+LIFCKAN I+FEEV I++ K QHR+PEYA INPMKQVPA+V G
Sbjct  1    MELKLYVDRLSQPSRAVLIFCKANEIEFEEVSIKLGKLQHRSPEYAEINPMKQVPAIVHG  60

Query  286  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  462
            DFKL ESHA L YLA+A  GVADHWYPAD+ KRAK+ SV DWHHSNLRRG+ GY FNT +
Sbjct  61   DFKLSESHAILIYLASAFPGVADHWYPADVHKRAKIHSVLDWHHSNLRRGSLGYHFNTGI  120

Query  463  APAFGLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            A AFGLP +P AAAE EK+L ASL T+ES WL+
Sbjct  121  ALAFGLPLDPKAAAEGEKLLSASLATIESLWLE  153



>gb|KDP25451.1| hypothetical protein JCGZ_20607 [Jatropha curcas]
Length=250

 Score =   231 bits (589),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 109/153 (71%), Positives = 124/153 (81%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M +K+Y DRMSQPSRA+LIFCK NGIDFEEV+I I+K Q  + E+  INPM +VPA+VDG
Sbjct  1    MKLKIYADRMSQPSRAVLIFCKVNGIDFEEVKIDISKRQQLSHEFKEINPMGKVPAIVDG  60

Query  286  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  462
             FKLFESHA L YLA A  GVADHWYPADL KRAK+ SV DWHHSNLR GA  YV NTAL
Sbjct  61   RFKLFESHAILTYLACAFRGVADHWYPADLSKRAKIQSVLDWHHSNLREGARKYVVNTAL  120

Query  463  APAFGLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            APA GLP NP AAA+AE+VLL+SL  +ESFWL+
Sbjct  121  APALGLPLNPRAAAKAEEVLLSSLSKIESFWLK  153



>ref|XP_007160052.1| hypothetical protein PHAVU_002G288600g [Phaseolus vulgaris]
 gb|ESW32046.1| hypothetical protein PHAVU_002G288600g [Phaseolus vulgaris]
Length=250

 Score =   231 bits (588),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 104/153 (68%), Positives = 127/153 (83%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M +K+Y DRMSQPSRA+LIFCK NGIDFEE++++++K QH +PE+ AINP+ QVPA+VDG
Sbjct  1    MKLKVYADRMSQPSRAILIFCKVNGIDFEEIKVELSKRQHLSPEFRAINPLGQVPAIVDG  60

Query  286  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  462
             FKLFESHA L YLA+A  GVADHWYPADL +RA++ SV DWHH NLRRGAAG+V NT L
Sbjct  61   RFKLFESHAILIYLASAFPGVADHWYPADLSRRARIHSVLDWHHQNLRRGAAGFVLNTVL  120

Query  463  APAFGLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            AP  GLP N  AAAEAEK+L++SL  LE+ WL+
Sbjct  121  APLLGLPLNQQAAAEAEKILISSLTKLENIWLK  153



>ref|XP_011072471.1| PREDICTED: glutathione S-transferase T1 [Sesamum indicum]
Length=250

 Score =   230 bits (587),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 107/153 (70%), Positives = 125/153 (82%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M +K+Y DRMSQPSRA++IFCK NGIDFEEV++ ++K QH TPE+  INPMK++PA+VDG
Sbjct  1    MTLKVYADRMSQPSRAVIIFCKLNGIDFEEVRVDLSKRQHLTPEFREINPMKKLPAIVDG  60

Query  286  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  462
             FKLFESHA L YLA    GVADHWYPADL KRAK+ SV DWHHSNLRRGAA YVFN+AL
Sbjct  61   RFKLFESHAILIYLACVFPGVADHWYPADLFKRAKIHSVLDWHHSNLRRGAATYVFNSAL  120

Query  463  APAFGLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            APA G+P NP  AAE EK+L ASL  +ES WL+
Sbjct  121  APALGMPLNPEVAAEGEKLLSASLAKIESVWLK  153



>ref|XP_007040202.1| Glutathione S-transferase THETA 1 [Theobroma cacao]
 gb|EOY24703.1| Glutathione S-transferase THETA 1 [Theobroma cacao]
Length=165

 Score =   227 bits (579),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 106/153 (69%), Positives = 125/153 (82%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M +K+Y +RMSQPSRA++IFCK NGID+EE+++ I+K QH TPE+A INPMK+VPA+VDG
Sbjct  1    MKLKVYAERMSQPSRAVIIFCKVNGIDYEEIKVDISKRQHLTPEFADINPMKKVPAIVDG  60

Query  286  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  462
             FKLFESHA L YLA A  GVADHWYPADL KR+K+ SV DWHHSNLR GA  YV NT L
Sbjct  61   RFKLFESHAILIYLACAFPGVADHWYPADLFKRSKIHSVLDWHHSNLRHGAVTYVLNTTL  120

Query  463  APAFGLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            APA GLP NP AAAEAEK+L +SL  +ES WL+
Sbjct  121  APALGLPLNPRAAAEAEKLLTSSLSKIESIWLK  153



>ref|XP_011029250.1| PREDICTED: glutathione S-transferase T1-like [Populus euphratica]
Length=247

 Score =   230 bits (586),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 108/153 (71%), Positives = 124/153 (81%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M +K+Y DRMSQPSRA+LIFCK N IDFEEV++ I+K QH TPE+  INPM++VP +VDG
Sbjct  1    MKLKVYADRMSQPSRAVLIFCKVNRIDFEEVRVDISKRQHLTPEFKEINPMRKVPTIVDG  60

Query  286  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  462
             FKLFESHA L YLA    GVADHWYPADL KRAK++SV DWHHSNLRRGAA YV NT L
Sbjct  61   RFKLFESHAILIYLACVFPGVADHWYPADLFKRAKINSVLDWHHSNLRRGAAEYVKNTTL  120

Query  463  APAFGLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            APA GLP +P AAAEAEKVL +SL  +ES WL+
Sbjct  121  APALGLPLDPQAAAEAEKVLFSSLSKIESVWLK  153



>ref|XP_010053279.1| PREDICTED: glutathione S-transferase T1 [Eucalyptus grandis]
 gb|KCW77542.1| hypothetical protein EUGRSUZ_D01861 [Eucalyptus grandis]
Length=248

 Score =   229 bits (583),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 106/153 (69%), Positives = 124/153 (81%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M +K+Y DRMSQPSRA++IFCK NGIDFEEV+I +AK QHR+PE+  +NPM QVPA+VDG
Sbjct  1    MTLKVYADRMSQPSRAVIIFCKVNGIDFEEVKIDLAKRQHRSPEFKDVNPMGQVPAIVDG  60

Query  286  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  462
             FKLFESHA L YL+ +  GVADHWYPADL +RAK+ S  DWHHSNLRRGAA YV NT L
Sbjct  61   RFKLFESHAILIYLSCSFPGVADHWYPADLSRRAKIHSALDWHHSNLRRGAAAYVLNTTL  120

Query  463  APAFGLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            APA GLP NP AAAE EK+L +SL  +ES WL+
Sbjct  121  APALGLPLNPAAAAEGEKLLSSSLLKIESIWLK  153



>ref|XP_009339919.1| PREDICTED: glutathione S-transferase T1 [Pyrus x bretschneideri]
Length=263

 Score =   229 bits (584),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 107/156 (69%), Positives = 126/156 (81%), Gaps = 1/156 (1%)
 Frame = +1

Query  97   REEMAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAV  276
            +EEM +K+YVDR+SQPSRA+LIF K NGI+FEE+++ I+K QH +PE+  INPM QVPA+
Sbjct  11   KEEMKLKVYVDRLSQPSRAILIFLKVNGIEFEEIKMDISKRQHLSPEFKKINPMGQVPAI  70

Query  277  VDGDFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFN  453
             DG F LFESHA L YLA A  GVADHWYPADL +RAK++SV DWHHSNLRRGAA YV N
Sbjct  71   ADGRFNLFESHAILVYLACAFPGVADHWYPADLFRRAKINSVLDWHHSNLRRGAAPYVLN  130

Query  454  TALAPAFGLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            T LAP  GLP NP AAAEAEK+L +SL  +ES WLQ
Sbjct  131  TVLAPVLGLPLNPQAAAEAEKLLSSSLSKIESIWLQ  166



>ref|XP_003630525.1| Glutathione transferase [Medicago truncatula]
 gb|AET05001.1| glutathione S-transferase theta [Medicago truncatula]
Length=188

 Score =   226 bits (576),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 103/153 (67%), Positives = 126/153 (82%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M +K+Y DRMSQPSRA+LIFCK NGIDFEE+ I+++K QH +PE+ AINP K+VPA+VDG
Sbjct  1    MKLKVYADRMSQPSRAILIFCKVNGIDFEEIHIELSKRQHLSPEFQAINPFKKVPAIVDG  60

Query  286  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  462
             FKLFESHA L YLA+A  GVA HWYPAD+ +RA++ +V DWHH NLRRGAAG+V NT L
Sbjct  61   RFKLFESHAILIYLASAFPGVAHHWYPADVSRRARIQAVLDWHHLNLRRGAAGFVLNTVL  120

Query  463  APAFGLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            AP  GLP N  AAAEAEKVL++SL T+E+ WL+
Sbjct  121  APLLGLPLNKQAAAEAEKVLISSLSTIENIWLK  153



>emb|CDP09752.1| unnamed protein product [Coffea canephora]
Length=242

 Score =   228 bits (580),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 105/154 (68%), Positives = 129/154 (84%), Gaps = 2/154 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAV-VD  282
            M +K++ DR SQPSRA+LIFCKANGI+FEEVQIQ+AKG+H++PEY AINPMKQVPA+ VD
Sbjct  1    MKLKVFADRGSQPSRAVLIFCKANGIEFEEVQIQLAKGEHKSPEYEAINPMKQVPAIEVD  60

Query  283  GDFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTA  459
            G F+LFESHA L++LA A  G+A+HWYPAD+ KRA++DS  DWHHS +RRG+ G V NT 
Sbjct  61   GKFRLFESHAILRFLATAFPGIAEHWYPADVFKRAQIDSALDWHHSTIRRGSVGVVLNTT  120

Query  460  LAPAFGLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            LAP FG P +P AAAEAEK+L ASL  +ESFWL+
Sbjct  121  LAPLFGQPLDPQAAAEAEKLLSASLAKIESFWLK  154



>ref|XP_006827675.1| hypothetical protein AMTR_s00009p00255220 [Amborella trichopoda]
 gb|ERM95091.1| hypothetical protein AMTR_s00009p00255220 [Amborella trichopoda]
Length=233

 Score =   226 bits (577),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 104/152 (68%), Positives = 123/152 (81%), Gaps = 1/152 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M +++Y DRMSQPSRA++IFCK NGIDFEEV+I I+K QH  PE+ AINPM QVPA+VDG
Sbjct  1    MKLRVYTDRMSQPSRAVIIFCKTNGIDFEEVRIDISKRQHLQPEFKAINPMGQVPALVDG  60

Query  286  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  462
              KLFESHA L+YL+ A  G+ DHWYP DL +RAK++SV DWHHSNLRRGAAGYV N AL
Sbjct  61   KLKLFESHAILRYLSYAFPGIPDHWYPGDLSRRAKIESVLDWHHSNLRRGAAGYVLNKAL  120

Query  463  APAFGLPCNPHAAAEAEKVLLASLGTLESFWL  558
            APA GL  NP AAAEAE++L +SL  +ES WL
Sbjct  121  APALGLQLNPQAAAEAEQILCSSLSKIESIWL  152



>ref|XP_003630524.1| Glutathione transferase [Medicago truncatula]
 gb|AET05000.1| glutathione S-transferase theta [Medicago truncatula]
Length=250

 Score =   226 bits (577),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 103/153 (67%), Positives = 126/153 (82%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M +K+Y DRMSQPSRA+LIFCK NGIDFEE+ I+++K QH +PE+ AINP K+VPA+VDG
Sbjct  1    MKLKVYADRMSQPSRAILIFCKVNGIDFEEIHIELSKRQHLSPEFQAINPFKKVPAIVDG  60

Query  286  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  462
             FKLFESHA L YLA+A  GVA HWYPAD+ +RA++ +V DWHH NLRRGAAG+V NT L
Sbjct  61   RFKLFESHAILIYLASAFPGVAHHWYPADVSRRARIQAVLDWHHLNLRRGAAGFVLNTVL  120

Query  463  APAFGLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            AP  GLP N  AAAEAEKVL++SL T+E+ WL+
Sbjct  121  APLLGLPLNKQAAAEAEKVLISSLSTIENIWLK  153



>gb|AFK47457.1| unknown [Medicago truncatula]
Length=250

 Score =   226 bits (577),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 103/153 (67%), Positives = 126/153 (82%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M +K+Y DRMSQPSRA+LIFCK NGIDFEE+ I+++K QH +PE+ AINP K+VPA+VDG
Sbjct  1    MKLKVYADRMSQPSRAILIFCKVNGIDFEEIHIELSKRQHLSPEFQAINPFKKVPAIVDG  60

Query  286  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  462
             FKLFESHA L YLA+A  GVA HWYPAD+ +RA++ +V DWHH NLRRGAAG+V NT L
Sbjct  61   RFKLFESHAILIYLASAFPGVAHHWYPADVSRRARIQAVLDWHHLNLRRGAAGFVLNTVL  120

Query  463  APAFGLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            AP  GLP N  AAAEAEKVL++SL T+E+ WL+
Sbjct  121  APLLGLPLNKQAAAEAEKVLISSLSTIENIWLK  153



>ref|XP_002509785.1| glutathione-s-transferase theta, gst, putative [Ricinus communis]
 gb|EEF51172.1| glutathione-s-transferase theta, gst, putative [Ricinus communis]
Length=250

 Score =   226 bits (576),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 110/153 (72%), Positives = 123/153 (80%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M +K+Y DRMSQPSRA+LIFCK N IDFEEV+I IA  Q  +PE+  INPM +VPA+VDG
Sbjct  1    MKLKVYGDRMSQPSRAVLIFCKVNRIDFEEVRIDIANRQQLSPEFKDINPMGKVPAIVDG  60

Query  286  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  462
             FKLFESHA L YLA A  GV DHWYPADL KRAK+ SV DWHHSNLRRGAA +V NTAL
Sbjct  61   RFKLFESHAILIYLACAFPGVPDHWYPADLFKRAKIHSVLDWHHSNLRRGAAAFVLNTAL  120

Query  463  APAFGLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            APA GLP NP AAAEAEK+L ASL  +ESFWL+
Sbjct  121  APALGLPLNPQAAAEAEKILSASLSKIESFWLK  153



>ref|XP_002298040.2| glutathione S-transferase family protein [Populus trichocarpa]
 gb|EEE82845.2| glutathione S-transferase family protein [Populus trichocarpa]
Length=247

 Score =   225 bits (574),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 106/153 (69%), Positives = 123/153 (80%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M +K+Y DRMSQPSRA+LIFCK N IDFEEV++ I+K QH TPE+  INPM+++PA+VDG
Sbjct  1    MKLKVYADRMSQPSRAVLIFCKVNRIDFEEVRVDISKRQHLTPEFKEINPMRKLPAIVDG  60

Query  286  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  462
             FKLFESHA L YLA    GVADHWYPADL KRAK++SV DWHHSNLR GAA YV NT L
Sbjct  61   RFKLFESHAILIYLACVFPGVADHWYPADLFKRAKINSVLDWHHSNLRHGAAEYVKNTTL  120

Query  463  APAFGLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            AP  GLP +P AAAEAEKVL +SL  +ES WL+
Sbjct  121  APVLGLPLDPQAAAEAEKVLFSSLSKIESVWLK  153



>ref|XP_007209508.1| hypothetical protein PRUPE_ppa010414mg [Prunus persica]
 gb|EMJ10707.1| hypothetical protein PRUPE_ppa010414mg [Prunus persica]
Length=250

 Score =   224 bits (570),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 105/153 (69%), Positives = 124/153 (81%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M +K+YVDRMSQPSRA+LIF KANGI+FEEV+I IAK QH++PE+  INPM QVPA+ DG
Sbjct  1    MKLKVYVDRMSQPSRAILIFLKANGIEFEEVKIDIAKRQHKSPEFKKINPMGQVPAISDG  60

Query  286  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  462
             F LFESHA L YLA A  GVAD WYP+DL  RAK++SV DWHHSNLRRG+A +V +T L
Sbjct  61   RFNLFESHAILTYLACAFPGVADSWYPSDLFARAKINSVLDWHHSNLRRGSATFVLHTVL  120

Query  463  APAFGLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            AP FGLP NP AAAEAE +L +SL T+ES WL+
Sbjct  121  APVFGLPSNPQAAAEAETLLSSSLSTIESIWLK  153



>gb|EYU38357.1| hypothetical protein MIMGU_mgv1a012529mg [Erythranthe guttata]
Length=248

 Score =   224 bits (570),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 105/153 (69%), Positives = 122/153 (80%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M +KLY DRMSQPSRA++IFCK NGIDFEEV+I +++ QH TPE+  INPMK+VPA+VDG
Sbjct  1    MTLKLYADRMSQPSRAIIIFCKLNGIDFEEVKIDLSRRQHLTPEFREINPMKKVPAMVDG  60

Query  286  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  462
             FKL ESHA L YLA    GVADHWYPAD+  RAK+ SV DWHHSNLRRGAA YV N+ L
Sbjct  61   RFKLSESHAILMYLACVFPGVADHWYPADVFTRAKIHSVLDWHHSNLRRGAASYVLNSTL  120

Query  463  APAFGLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            APA GLP NP AAAE EK+L ASL  +E+ WL+
Sbjct  121  APALGLPLNPEAAAEGEKLLSASLMKIETVWLK  153



>ref|XP_008238862.1| PREDICTED: glutathione S-transferase T1 [Prunus mume]
Length=250

 Score =   223 bits (569),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 104/153 (68%), Positives = 124/153 (81%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M +K+YVDR+SQPSRA+LIF KANGI+FEEV+I IAK QH++PE+  INPM QVPA+ DG
Sbjct  1    MKLKVYVDRLSQPSRAILIFLKANGIEFEEVKIDIAKRQHKSPEFKKINPMGQVPAISDG  60

Query  286  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  462
             FKLFESHA L YLA A  GVAD WYP+DL  RAK++S+ DWHHSNLRRG+A YV +T L
Sbjct  61   RFKLFESHAILTYLACAFPGVADSWYPSDLFARAKINSILDWHHSNLRRGSATYVLHTVL  120

Query  463  APAFGLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            AP  GLP NP AAAEAE +L +SL T+ES WL+
Sbjct  121  APVLGLPSNPQAAAEAETLLSSSLSTIESIWLK  153



>ref|XP_009386058.1| PREDICTED: glutathione S-transferase T1-like [Musa acuminata 
subsp. malaccensis]
Length=248

 Score =   222 bits (566),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 102/153 (67%), Positives = 120/153 (78%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M +K+Y DRMSQPSRA++IFCK NGIDFEEV+I + K QHR+PE+  INPM QVPAVVDG
Sbjct  1    MTLKVYADRMSQPSRAIIIFCKVNGIDFEEVRIDLVKRQHRSPEFKEINPMGQVPAVVDG  60

Query  286  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  462
             +KLFESHA L YL+ A  G+ DHWYPADL  RAK+ S+ DWHH+NLRRGAA +V N AL
Sbjct  61   RYKLFESHAILSYLSCAFPGIPDHWYPADLFTRAKIQSILDWHHTNLRRGAATFVLNRAL  120

Query  463  APAFGLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
             PA GLP NP AA EAE +L ASL  +ES WL+
Sbjct  121  GPALGLPLNPQAANEAEIILRASLSKIESLWLK  153



>ref|XP_008794197.1| PREDICTED: glutathione S-transferase T1 isoform X1 [Phoenix dactylifera]
Length=250

 Score =   222 bits (566),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 104/153 (68%), Positives = 121/153 (79%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M +K+Y DR+SQPSRA++IFCK NGIDFEEV I + K QHR+PE+  INPM QVPA+VDG
Sbjct  1    MKLKVYADRLSQPSRAIVIFCKLNGIDFEEVPIDLTKRQHRSPEFKEINPMGQVPAIVDG  60

Query  286  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  462
             FKLFESHA L+YLA A  GV+DHWYPADL  RAK+DSV DWHH NLRRGAA Y  N+ +
Sbjct  61   RFKLFESHAILRYLACAFPGVSDHWYPADLFNRAKIDSVLDWHHLNLRRGAAFYALNSVI  120

Query  463  APAFGLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            AP FGLP N  AA EAEKVL +SL  +ES WL+
Sbjct  121  APVFGLPLNSQAANEAEKVLRSSLSKIESIWLK  153



>ref|XP_002509786.1| glutathione-s-transferase theta, gst, putative [Ricinus communis]
 gb|EEF51173.1| glutathione-s-transferase theta, gst, putative [Ricinus communis]
Length=237

 Score =   222 bits (565),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 102/152 (67%), Positives = 120/152 (79%), Gaps = 1/152 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M +KLY  R+SQPSRAL+ FCK NG++FEE+ I ++K QH++PE+  INPM QVPA+V G
Sbjct  1    MELKLYTHRVSQPSRALITFCKMNGLEFEEIVIDLSKRQHKSPEFKEINPMGQVPAIVHG  60

Query  286  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  462
            DFKLFESHA L YLA+A  GVADHWYP DLQKRAK+ SV DWHHSNLRRG+  Y+ NT L
Sbjct  61   DFKLFESHACLIYLASAFPGVADHWYPIDLQKRAKIHSVLDWHHSNLRRGSVMYILNTKL  120

Query  463  APAFGLPCNPHAAAEAEKVLLASLGTLESFWL  558
             P FGLP NP AAAE EK+L  SL  +ESFWL
Sbjct  121  GPVFGLPLNPQAAAEGEKLLSCSLKRIESFWL  152



>ref|XP_011463848.1| PREDICTED: glutathione S-transferase T1 [Fragaria vesca subsp. 
vesca]
Length=249

 Score =   222 bits (565),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 102/153 (67%), Positives = 121/153 (79%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M +K+Y DRMSQPSRA+LIFCK NGI+FEEVQ+ +AK Q  +PE+  INPM QVPA+ DG
Sbjct  1    MKLKVYADRMSQPSRAILIFCKVNGIEFEEVQMNLAKRQQLSPEFKKINPMGQVPAIADG  60

Query  286  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  462
             F LFESHA L YLA A  G+ADHWYPADL +RAK++SV DWHHSNLRRGAA YV NT L
Sbjct  61   KFNLFESHAILVYLACAFPGIADHWYPADLFRRAKINSVLDWHHSNLRRGAAAYVLNTVL  120

Query  463  APAFGLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            AP  G+P +P AA EAE++L ASL  +ES WL+
Sbjct  121  APVLGIPASPQAAVEAERLLSASLSKIESIWLK  153



>gb|ADB11337.1| theta class glutathione transferase GSTT1 [Populus trichocarpa]
Length=247

 Score =   221 bits (563),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 105/153 (69%), Positives = 122/153 (80%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M +K+Y DRMSQPSRA+LIFCK N IDFEEV++ I+K QH TPE+  INPM+++PA+VDG
Sbjct  1    MKLKVYADRMSQPSRAVLIFCKVNRIDFEEVRVDISKRQHLTPEFKEINPMRKLPAIVDG  60

Query  286  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  462
             FKLFESHA L YLA    GVADH YPADL KRAK++SV DWHHSNLR GAA YV NT L
Sbjct  61   RFKLFESHAILIYLACVFPGVADHRYPADLFKRAKINSVLDWHHSNLRHGAAEYVKNTTL  120

Query  463  APAFGLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            AP  GLP +P AAAEAEKVL +SL  +ES WL+
Sbjct  121  APVLGLPLDPQAAAEAEKVLFSSLSKIESVWLK  153



>gb|KDP25450.1| hypothetical protein JCGZ_20606 [Jatropha curcas]
Length=230

 Score =   220 bits (561),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 102/153 (67%), Positives = 119/153 (78%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            MA+K+Y  R+SQPSRA++IFCK NGI+FEE+ I ++K QH+TPE+  INPM QVPA+V  
Sbjct  1    MALKVYGHRVSQPSRAVMIFCKVNGIEFEEITIDLSKKQHKTPEFKEINPMGQVPAIVHD  60

Query  286  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  462
            DFKLFESHA L YLA A  GV DHWYPADL+KRAKV SV DWHHS LRRG+  YV N  L
Sbjct  61   DFKLFESHAVLTYLACAFPGVTDHWYPADLRKRAKVQSVLDWHHSTLRRGSVTYVINAKL  120

Query  463  APAFGLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            AP FG P NP AAAE EK+L  +L T+ES WLQ
Sbjct  121  APVFGQPLNPQAAAEGEKILTCALSTIESIWLQ  153



>ref|XP_010255416.1| PREDICTED: glutathione S-transferase T1 [Nelumbo nucifera]
Length=250

 Score =   220 bits (561),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 98/151 (65%), Positives = 121/151 (80%), Gaps = 1/151 (1%)
 Frame = +1

Query  112  VKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDGDF  291
            +K+Y DRMSQPSRA++IFCK NGI+FEE+++ ++K QH +PE+  INPM+QVPA++DG F
Sbjct  2    LKVYADRMSQPSRAVIIFCKVNGIEFEEIKVDLSKRQHISPEFKEINPMRQVPAIIDGRF  61

Query  292  KLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALAP  468
            KLFESHA L YLA A  GVADHWYP DL +RAK++SV DWHHSNLRRGAA +V NT L P
Sbjct  62   KLFESHAILSYLACAFPGVADHWYPTDLFRRAKINSVLDWHHSNLRRGAAPFVLNTVLGP  121

Query  469  AFGLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            A GL  NP   AEAEK+L +SL  +ES WL+
Sbjct  122  ALGLKSNPKVTAEAEKILTSSLSKIESIWLK  152



>ref|XP_004146527.1| PREDICTED: glutathione S-transferase T1-like [Cucumis sativus]
 ref|XP_004165234.1| PREDICTED: glutathione S-transferase T1-like [Cucumis sativus]
 gb|KGN53344.1| Glutathione S-transferase [Cucumis sativus]
Length=238

 Score =   220 bits (560),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 103/153 (67%), Positives = 122/153 (80%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            MA+K+Y DRMSQPSRA+LIFCK NGI FEEV++ ++K +H TPE+  INPM +VP +VDG
Sbjct  1    MALKVYADRMSQPSRAVLIFCKVNGIAFEEVKVTLSKFEHLTPEFKEINPMGKVPVIVDG  60

Query  286  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  462
             FKLFESHA L Y++ A  GVADHWYPADL +RAK+ SV DWHHSNLR GAA  +FNT L
Sbjct  61   RFKLFESHAILIYISCAFPGVADHWYPADLFRRAKIHSVLDWHHSNLRSGAAPLIFNTVL  120

Query  463  APAFGLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            AP FG P NP AAAEAEK+L  SL  +ESFWL+
Sbjct  121  APLFGRPLNPQAAAEAEKLLSKSLSKIESFWLK  153



>ref|XP_006476596.1| PREDICTED: glutathione S-transferase T1-like [Citrus sinensis]
Length=252

 Score =   220 bits (560),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 100/153 (65%), Positives = 123/153 (80%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M +K+Y DRMSQPSRA++IFCK NG+DFEE+++++AK +  +PE+  INPM +VPA+VDG
Sbjct  1    MKLKVYADRMSQPSRAVIIFCKVNGLDFEEIEVRLAKREQYSPEFKEINPMAKVPAIVDG  60

Query  286  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  462
              KLFESHA L YLA A  G+ADHWYP DL KRA++ SV DWHHSNLR GAA +V N  L
Sbjct  61   RLKLFESHAILIYLACAFPGIADHWYPNDLSKRARIHSVLDWHHSNLRFGAAKFVLNKKL  120

Query  463  APAFGLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            APAFGLP NP AAAEAEK+L +SL  +ESFWL+
Sbjct  121  APAFGLPLNPEAAAEAEKILSSSLSKIESFWLK  153



>ref|NP_198937.1| glutathione S-transferase THETA 1 [Arabidopsis thaliana]
 sp|Q9ZRT5.1|GSTT1_ARATH RecName: Full=Glutathione S-transferase T1; Short=AtGSTT1; AltName: 
Full=GST class-theta member 1; AltName: Full=Glutathione 
S-transferase 10 [Arabidopsis thaliana]
 emb|CAA10457.1| glutathione transferase AtGST 10 [Arabidopsis thaliana]
 dbj|BAB09723.1| glutathione transferase AtGST 10 [Arabidopsis thaliana]
 gb|AAK96850.1| glutathione transferase AtGST 10 [Arabidopsis thaliana]
 gb|AAL66881.1| glutathione transferase AtGST 10 [Arabidopsis thaliana]
 gb|AED94654.1| glutathione S-transferase THETA 1 [Arabidopsis thaliana]
Length=245

 Score =   219 bits (559),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 101/153 (66%), Positives = 121/153 (79%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M +K+Y DRMSQPSRA++IFCK NGI F+EV I +AK Q  +PE+  INP+ +VPA+VDG
Sbjct  2    MKLKVYADRMSQPSRAVIIFCKVNGIQFDEVLISLAKRQQLSPEFKDINPLGKVPAIVDG  61

Query  286  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  462
              KLFESHA L YL++A   VADHWYP DL KRAK+ SV DWHH+NLRRGAAGYV N+ L
Sbjct  62   RLKLFESHAILIYLSSAFPSVADHWYPNDLSKRAKIHSVLDWHHTNLRRGAAGYVLNSVL  121

Query  463  APAFGLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
             PA GLP NP AAAEAE++L  SL TLE+FWL+
Sbjct  122  GPALGLPLNPKAAAEAEQLLTKSLSTLETFWLK  154



>ref|XP_010909100.1| PREDICTED: glutathione S-transferase T1 isoform X2 [Elaeis guineensis]
Length=250

 Score =   219 bits (559),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 103/153 (67%), Positives = 121/153 (79%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M +K+Y DR+SQPSRA++IFCK NGIDFEEV+I +AKGQHR+PE+  INPM +VPA+VDG
Sbjct  1    MKLKVYADRLSQPSRAIVIFCKLNGIDFEEVRIDLAKGQHRSPEFKRINPMGKVPAIVDG  60

Query  286  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  462
             FKLFESHA L+YLA A  GV+DHWYPADL  RAK+DS+ DWHHSNLR GA   V N+ L
Sbjct  61   RFKLFESHAILRYLACAFPGVSDHWYPADLFSRAKIDSILDWHHSNLRYGAVSLVQNSVL  120

Query  463  APAFGLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            AP FG P N  AA EAEKVL  SL  +ES WL+
Sbjct  121  APIFGRPLNSQAANEAEKVLNLSLSKIESVWLK  153



>gb|AFK36240.1| unknown [Lotus japonicus]
Length=251

 Score =   219 bits (559),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 101/153 (66%), Positives = 123/153 (80%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M +K+Y DRMSQPSRA+LIFCK NGIDFEE++I+++K QH +PE+ AINP K+VPA+VDG
Sbjct  2    MKLKVYADRMSQPSRAVLIFCKVNGIDFEEIKIELSKRQHLSPEFHAINPFKKVPAIVDG  61

Query  286  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  462
             FKLFESHA L YLA A  GVADHWYP+D+ +RA++ SV DWHH NLR GAA YV NT L
Sbjct  62   RFKLFESHAILIYLACAFPGVADHWYPSDISRRARIQSVLDWHHLNLRPGAASYVLNTVL  121

Query  463  APAFGLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            AP  G   N  AAAEAEKVL++SL T+E+ WL+
Sbjct  122  APLLGRQLNQQAAAEAEKVLISSLSTIENIWLK  154



>ref|XP_009777222.1| PREDICTED: glutathione S-transferase T1-like [Nicotiana sylvestris]
Length=256

 Score =   219 bits (559),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 107/140 (76%), Positives = 118/140 (84%), Gaps = 1/140 (1%)
 Frame = +1

Query  145  SRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDGDFKLFESHAALKY  324
            SRALLIFCK NGIDFEEV I ++K QH +PE+  +NP+KQVPA++DG FKLFESHA L+Y
Sbjct  29   SRALLIFCKLNGIDFEEVYINLSKRQHLSPEFKEVNPLKQVPAIMDGRFKLFESHAILRY  88

Query  325  LAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALAPAFGLPCNPHAA  501
            LA A  GVADHWYPADL KRAKVDSV DWHHSNLRRGAA YVF+T LAPAFGLP N  AA
Sbjct  89   LACAFPGVADHWYPADLYKRAKVDSVLDWHHSNLRRGAAVYVFSTVLAPAFGLPLNQQAA  148

Query  502  AEAEKVLLASLGTLESFWLQ  561
            AEAEKVLLASL  +ES WLQ
Sbjct  149  AEAEKVLLASLAKIESVWLQ  168



>ref|XP_002868607.1| hypothetical protein ARALYDRAFT_916086 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44866.1| hypothetical protein ARALYDRAFT_916086 [Arabidopsis lyrata subsp. 
lyrata]
Length=245

 Score =   218 bits (556),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 102/153 (67%), Positives = 120/153 (78%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M +K+Y DRMSQPSRA++IFCK NGI F+EV I +AK Q  +PE+  INPM +VPA+VDG
Sbjct  2    MKLKVYADRMSQPSRAVIIFCKVNGIQFDEVLISLAKRQQLSPEFKDINPMGKVPAIVDG  61

Query  286  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  462
              KLFESHA L YL++A   VADHWYP DL KRAK+ SV DWHH+NLR GAAGYV N+ L
Sbjct  62   RLKLFESHAILIYLSSAFPSVADHWYPNDLSKRAKIHSVMDWHHTNLRPGAAGYVLNSVL  121

Query  463  APAFGLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            APA GLP NP AA EAEK+L  SL TLE+FWL+
Sbjct  122  APALGLPLNPKAAVEAEKLLTKSLSTLETFWLK  154



>gb|ACC93946.1| glutathione S-transferase [Panax ginseng]
Length=250

 Score =   218 bits (555),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 103/153 (67%), Positives = 120/153 (78%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M +K+Y DRMSQPSRA+LIFCK NGI+F+E++ +I+K Q ++PEY  INPM  VPA+VDG
Sbjct  1    MKLKVYADRMSQPSRAVLIFCKVNGIEFDEIKTEISKKQQKSPEYKEINPMGNVPAIVDG  60

Query  286  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  462
             FKLFESHA L YLA A  GVADHWYPADL KRAK+DSV  WHH+ LRRGAA  V N+ L
Sbjct  61   KFKLFESHAILVYLACAFPGVADHWYPADLFKRAKIDSVLHWHHTTLRRGAAPLVLNSRL  120

Query  463  APAFGLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            AP FGLP N  AAAEAEKVL  SL  +ES WL+
Sbjct  121  APVFGLPLNLQAAAEAEKVLTRSLAMIESIWLE  153



>ref|XP_008452024.1| PREDICTED: glutathione S-transferase T1 [Cucumis melo]
Length=238

 Score =   218 bits (554),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 101/153 (66%), Positives = 121/153 (79%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            MA+K+Y DR+SQPSRA+LIFCK NGI FEEV++ ++K +H TPE+  INPM +VP +VDG
Sbjct  1    MALKVYADRLSQPSRAVLIFCKVNGIAFEEVKVALSKFEHLTPEFKEINPMVKVPVIVDG  60

Query  286  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  462
             FKLFESHA L YL+ A  GVADHWYP+DL +RAK+ SV DWHHSNLR GAA  +FNT L
Sbjct  61   RFKLFESHAILIYLSCAFPGVADHWYPSDLFRRAKIHSVLDWHHSNLRSGAAPLIFNTVL  120

Query  463  APAFGLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            AP FG P NP  AAEAEK+L  SL  +ESFWL+
Sbjct  121  APLFGRPLNPQVAAEAEKILSKSLSKIESFWLK  153



>ref|XP_006439583.1| hypothetical protein CICLE_v10021831mg [Citrus clementina]
 gb|ESR52823.1| hypothetical protein CICLE_v10021831mg [Citrus clementina]
Length=252

 Score =   218 bits (555),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 99/153 (65%), Positives = 122/153 (80%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M +K+Y DRMSQPSRA++IFCK NG+DFEE+++++AK +  +PE+  INPM +VPA++DG
Sbjct  1    MKLKVYADRMSQPSRAVIIFCKVNGLDFEEIEVRLAKREQYSPEFKEINPMAKVPAIIDG  60

Query  286  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  462
              KLFESHA L YLA A  GVADHWYP DL KRA++ SV DWHHSNLR GAA +V N  L
Sbjct  61   RLKLFESHAILIYLACAFPGVADHWYPNDLSKRARIHSVLDWHHSNLRFGAAKFVLNKKL  120

Query  463  APAFGLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            APA GLP NP AAAEAEK+L +SL  +ESFWL+
Sbjct  121  APALGLPLNPEAAAEAEKILSSSLSKIESFWLK  153



>gb|KJB39646.1| hypothetical protein B456_007G023300 [Gossypium raimondii]
Length=251

 Score =   218 bits (554),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 103/153 (67%), Positives = 119/153 (78%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M +KLY DRMSQP RA++IFCK NGIDFEE+++ IAK Q+ TPEYA INPMKQ+PA+VDG
Sbjct  1    MKLKLYADRMSQPVRAVIIFCKKNGIDFEEIRVDIAKRQNLTPEYAEINPMKQLPAIVDG  60

Query  286  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  462
             FKLFESHA L YLA++  GVADHWYPAD+ KR+K+  V DWHHSNLRRG    V NT L
Sbjct  61   RFKLFESHAILVYLASSFPGVADHWYPADVFKRSKIHLVLDWHHSNLRRGPTTIVRNTVL  120

Query  463  APAFGLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            AP  G P NP AAAE EK L ASL  +ES WL+
Sbjct  121  APVLGRPLNPEAAAEGEKFLSASLSKIESVWLK  153



>gb|KDP36315.1| hypothetical protein JCGZ_09530 [Jatropha curcas]
Length=250

 Score =   218 bits (554),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 101/153 (66%), Positives = 119/153 (78%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M +K+Y DR SQP+RA+LIFCK NGIDFEE+ I + K Q  +PE+  INP+ +VPA+VDG
Sbjct  1    MKLKIYADRRSQPARAVLIFCKVNGIDFEEINIDLTKRQQLSPEFKEINPIGKVPAIVDG  60

Query  286  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  462
             FKLFESHA L YLA A  GVADHWYPADL KRAK+ SV DWHH NLR GA  YV NTA+
Sbjct  61   RFKLFESHAILSYLACAFPGVADHWYPADLFKRAKIQSVLDWHHLNLRLGALTYVVNTAM  120

Query  463  APAFGLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            APA GLP NP AAA+ EK+L +SL  +ESFWL+
Sbjct  121  APALGLPLNPRAAAKGEKILFSSLSKIESFWLK  153



>emb|CDP09754.1| unnamed protein product [Coffea canephora]
Length=234

 Score =   216 bits (551),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 103/154 (67%), Positives = 128/154 (83%), Gaps = 2/154 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAV-VD  282
            M +KL+V R+SQPSRA+LIFCK N I+FEEVQI ++KG+H +PE+  INPM +VPA+ VD
Sbjct  1    MKLKLFVHRLSQPSRAVLIFCKLNKIEFEEVQIDLSKGEHLSPEFKEINPMHKVPAMEVD  60

Query  283  GDFKLFESHAALKYLAAAN-GVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTA  459
            G FKLFESHA L++LA A+ GVADHWYPADL KRA+++SV DWHH+NLR G+AG VF++ 
Sbjct  61   GGFKLFESHAILRFLACASPGVADHWYPADLFKRAEINSVLDWHHANLRHGSAGLVFHSK  120

Query  460  LAPAFGLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            LAP FGLP +  AAAE EKVLLASL  +ESFWL+
Sbjct  121  LAPLFGLPSDVQAAAECEKVLLASLAKIESFWLK  154



>gb|EMS35634.1| Glutathione S-transferase theta-1 [Triticum urartu]
Length=233

 Score =   216 bits (550),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 99/151 (66%), Positives = 118/151 (78%), Gaps = 1/151 (1%)
 Frame = +1

Query  112  VKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDGDF  291
            +K+Y DR+SQPSRA++I CK N IDF+E+ + +AKGQHR PE+  INPM QVP +VDG F
Sbjct  4    LKVYADRLSQPSRAIIILCKVNRIDFQELTVDLAKGQHRAPEFTKINPMAQVPTIVDGRF  63

Query  292  KLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALAP  468
            KLFESHA L+YLA    GV DHWYPADL  RAK++SV DWHHSNLRRGAA YV +TAL P
Sbjct  64   KLFESHAILRYLATVFPGVPDHWYPADLFTRAKLESVLDWHHSNLRRGAATYVLHTALGP  123

Query  469  AFGLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            A GL  NP  A EAEK+L  SLGT+E+ WL+
Sbjct  124  ALGLTPNPETAKEAEKLLSRSLGTIETVWLK  154



>ref|XP_002272455.1| PREDICTED: glutathione S-transferase T1 [Vitis vinifera]
Length=248

 Score =   216 bits (551),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 99/153 (65%), Positives = 122/153 (80%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M +K+Y DRMSQPSRA++IFCK N IDFEEV++ +AK QH +P++  +NPM QVPA+VDG
Sbjct  1    MKLKIYADRMSQPSRAIIIFCKVNRIDFEEVRVDLAKRQHLSPDFKVVNPMGQVPAIVDG  60

Query  286  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  462
             F+LFESHA L YLA A  G+AD+WYP DL KRAK+ SV DWHHSNLRRGAA ++ NT L
Sbjct  61   RFQLFESHAILIYLACAFPGIADNWYPNDLFKRAKIHSVLDWHHSNLRRGAAPFLLNTVL  120

Query  463  APAFGLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
             PA G+  NP AAAEAEK+L +SL  +ESFWL+
Sbjct  121  GPALGIKVNPQAAAEAEKLLFSSLSKIESFWLE  153



>emb|CBI34681.3| unnamed protein product [Vitis vinifera]
Length=265

 Score =   217 bits (552),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 99/153 (65%), Positives = 122/153 (80%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M +K+Y DRMSQPSRA++IFCK N IDFEEV++ +AK QH +P++  +NPM QVPA+VDG
Sbjct  1    MKLKIYADRMSQPSRAIIIFCKVNRIDFEEVRVDLAKRQHLSPDFKVVNPMGQVPAIVDG  60

Query  286  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  462
             F+LFESHA L YLA A  G+AD+WYP DL KRAK+ SV DWHHSNLRRGAA ++ NT L
Sbjct  61   RFQLFESHAILIYLACAFPGIADNWYPNDLFKRAKIHSVLDWHHSNLRRGAAPFLLNTVL  120

Query  463  APAFGLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
             PA G+  NP AAAEAEK+L +SL  +ESFWL+
Sbjct  121  GPALGIKVNPQAAAEAEKLLFSSLSKIESFWLE  153



>ref|XP_004503770.1| PREDICTED: glutathione S-transferase T1-like [Cicer arietinum]
Length=252

 Score =   216 bits (549),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 97/151 (64%), Positives = 120/151 (79%), Gaps = 1/151 (1%)
 Frame = +1

Query  112  VKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDGDF  291
            +K+YVDRMSQPSRA+LIFC+ NGIDFEEVQI ++K  H +P++  +NP+++VPA++ G+F
Sbjct  5    LKVYVDRMSQPSRAILIFCRLNGIDFEEVQIDLSKRHHLSPQFTEVNPLQKVPAILHGNF  64

Query  292  KLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALAP  468
             LFESHA L YLA+A  G+ADHWYP D+ +RAK++SV DWHHSNLR GA  YV NT L P
Sbjct  65   NLFESHAILAYLASAFPGIADHWYPTDVFRRAKINSVLDWHHSNLRYGAVNYVINTVLGP  124

Query  469  AFGLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            A G P NP AAAEAEKVLL+SL  LE  WL 
Sbjct  125  ALGRPLNPKAAAEAEKVLLSSLSKLEDIWLN  155



>gb|KJB52089.1| hypothetical protein B456_008G246300 [Gossypium raimondii]
Length=250

 Score =   216 bits (549),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 106/153 (69%), Positives = 125/153 (82%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M +K+Y DRMSQPSRA++IFCK NGID+EE+++ I+KGQH TPE+A INPMKQ+PA+ DG
Sbjct  1    MKLKVYADRMSQPSRAVIIFCKVNGIDYEEIKVHISKGQHLTPEFAEINPMKQLPAIADG  60

Query  286  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  462
             FKLFESHA L YLA A  GVAD WYPAD+ KR+K+ SV DWHHSNLRRGAA YVFNT +
Sbjct  61   RFKLFESHAILIYLACAFPGVADQWYPADVFKRSKIHSVLDWHHSNLRRGAAPYVFNTTI  120

Query  463  APAFGLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            AP  G P NP AAAEAE +L +SL  LESFWL+
Sbjct  121  APILGRPLNPQAAAEAEIILSSSLSKLESFWLK  153



>gb|KHG19174.1| Glutathione S-transferase T1 -like protein [Gossypium arboreum]
Length=250

 Score =   215 bits (547),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 105/153 (69%), Positives = 124/153 (81%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M +K+Y DRMSQP RA++IFCK NGID+EE+++ I+KGQH TPE+A INPMKQ+PA+ DG
Sbjct  1    MKLKVYADRMSQPCRAVIIFCKVNGIDYEEIKVHISKGQHLTPEFAEINPMKQLPAIADG  60

Query  286  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  462
             FKLFESHA L YLA A  GVADHWYPAD+ KR+K+ SV DWHHSNLRRGAA YVFNT +
Sbjct  61   RFKLFESHAILIYLACAFPGVADHWYPADVFKRSKIHSVLDWHHSNLRRGAAPYVFNTTI  120

Query  463  APAFGLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            AP  G P NP  AAEAE +L +SL  LESFWL+
Sbjct  121  APILGRPLNPQVAAEAEIILSSSLSKLESFWLK  153



>ref|NP_001068175.1| Os11g0588300 [Oryza sativa Japonica Group]
 gb|AAK98534.1|AF402793_1 putative glutathione S-transferase OsGSTT1 [Oryza sativa Japonica 
Group]
 gb|ABA94506.1| Glutathione S-transferase, N-terminal domain containing protein, 
expressed [Oryza sativa Japonica Group]
 dbj|BAF28538.1| Os11g0588300 [Oryza sativa Japonica Group]
 gb|EAY81560.1| hypothetical protein OsI_36725 [Oryza sativa Indica Group]
 gb|EAZ18961.1| hypothetical protein OsJ_34497 [Oryza sativa Japonica Group]
 dbj|BAG96917.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87358.1| unnamed protein product [Oryza sativa Japonica Group]
Length=246

 Score =   214 bits (546),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 96/151 (64%), Positives = 119/151 (79%), Gaps = 1/151 (1%)
 Frame = +1

Query  112  VKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDGDF  291
            +K+Y DR SQPSRA++IFC+ N IDFEEV + + K +H +PE+  INPM QVPA+VDG F
Sbjct  5    LKVYADRRSQPSRAIIIFCRVNRIDFEEVTVDLFKREHLSPEFKKINPMGQVPAIVDGRF  64

Query  292  KLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALAP  468
            +LFESHA L+YLA    GVADHWYPADL  RAK++++ DWHHSNLRRGAA ++ NT LAP
Sbjct  65   RLFESHAILRYLATVFPGVADHWYPADLFTRAKLEAILDWHHSNLRRGAATFILNTVLAP  124

Query  469  AFGLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            + GLP +P AA EAEKVL  SLG +ES WL+
Sbjct  125  SLGLPSSPQAAKEAEKVLFRSLGLIESMWLK  155



>ref|XP_010447179.1| PREDICTED: glutathione S-transferase T1-like [Camelina sativa]
Length=244

 Score =   214 bits (546),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 99/153 (65%), Positives = 120/153 (78%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M +K+Y DRMSQPSRA++IFCK NGI F+E+ I ++K Q  TPE+  INPM +VPA+VDG
Sbjct  1    MKLKVYADRMSQPSRAVIIFCKVNGIQFDEILIILSKRQQLTPEFKDINPMGKVPAIVDG  60

Query  286  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  462
              KLFESHA L YL++A   V DHWYP DL KRAK+ SV DWHH++LR GAAGYV N+ L
Sbjct  61   RLKLFESHAILIYLSSAFPSVVDHWYPNDLSKRAKIHSVLDWHHTSLRPGAAGYVLNSVL  120

Query  463  APAFGLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            APA GLP NP AAA+AEK+L  SL TLE+FWL+
Sbjct  121  APALGLPLNPKAAADAEKLLTKSLSTLETFWLK  153



>ref|XP_002304489.1| glutathione S-transferase family protein [Populus trichocarpa]
 gb|EEE79468.1| glutathione S-transferase family protein [Populus trichocarpa]
Length=232

 Score =   214 bits (544),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 101/154 (66%), Positives = 123/154 (80%), Gaps = 2/154 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPA-VVD  282
            M +K+YVDR+SQPSRA++IFCK N IDFEEV I++ KGQH TPE+  INPM +VPA VVD
Sbjct  1    MELKVYVDRLSQPSRAIVIFCKVNKIDFEEVGIELLKGQHLTPEFKEINPMGKVPAIVVD  60

Query  283  GDFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTA  459
            G FKLFESHA L +LA+A  GVADHWYPADL +RA++ S+ DWHHSNLRRG+  ++ NT 
Sbjct  61   GKFKLFESHAILIFLASAFPGVADHWYPADLYRRAEIHSILDWHHSNLRRGSVEFIQNTL  120

Query  460  LAPAFGLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            LAP FG P NP AAAE EKVL +SL  +E+ WL+
Sbjct  121  LAPFFGRPLNPQAAAEGEKVLSSSLSKIEALWLK  154



>gb|ADB11338.1| theta class glutathione transferase GSTT2 [Populus trichocarpa]
Length=232

 Score =   213 bits (543),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 101/154 (66%), Positives = 123/154 (80%), Gaps = 2/154 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPA-VVD  282
            M +K+YVDR+SQPSRA++IFCK N IDFEEV I++ KGQH TPE+  INPM +VPA VVD
Sbjct  1    MELKVYVDRLSQPSRAIVIFCKVNKIDFEEVGIELLKGQHLTPEFKEINPMGKVPAIVVD  60

Query  283  GDFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTA  459
            G FKLFESHA L +LA+A  GVADHWYPADL +RA++ S+ DWHHSNLRRG+  ++ NT 
Sbjct  61   GKFKLFESHAILIFLASAFPGVADHWYPADLYRRAEIHSILDWHHSNLRRGSVEFIQNTL  120

Query  460  LAPAFGLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            LAP FG P NP AAAE EKVL +SL  +E+ WL+
Sbjct  121  LAPFFGRPLNPQAAAEGEKVLSSSLSKIEALWLK  154



>gb|KHG14410.1| Glutathione S-transferase T1 -like protein [Gossypium arboreum]
Length=485

 Score =   221 bits (562),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 104/153 (68%), Positives = 120/153 (78%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M +KLY DRMSQP RA++IFCK NGIDFEE+++ IAK QH TPEYA INPMKQ+PA+VDG
Sbjct  235  MKLKLYADRMSQPVRAVIIFCKKNGIDFEEIRVDIAKRQHLTPEYAEINPMKQLPAIVDG  294

Query  286  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  462
             F+LFESHA L YLA++  GVADHWYPAD+ KR+K+ SV DWHHSNLRRG    V NT L
Sbjct  295  RFELFESHAILVYLASSFPGVADHWYPADVFKRSKIHSVLDWHHSNLRRGPTTIVRNTVL  354

Query  463  APAFGLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            AP  G P NP AAAE EK L ASL  +ES WL+
Sbjct  355  APVLGRPLNPEAAAEGEKFLSASLSKIESVWLK  387


 Score =   202 bits (515),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 91/152 (60%), Positives = 118/152 (78%), Gaps = 1/152 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M +K+Y DR+SQP RA++IFC+ NGI++EE+++ +A  +H TPE++ INPM+Q+PA+V G
Sbjct  1    MKLKVYADRLSQPVRAVIIFCEVNGIEYEEIKVDLANREHLTPEFSEINPMQQLPAIVHG  60

Query  286  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  462
             FKLFESHA L YLA++  GVADHWYPAD+ KR+K+ SV DWHHSNLRRG    V N+ L
Sbjct  61   TFKLFESHAILIYLASSFPGVADHWYPADVYKRSKIHSVLDWHHSNLRRGPITIVQNSIL  120

Query  463  APAFGLPCNPHAAAEAEKVLLASLGTLESFWL  558
            AP F  P NP A AE EK+L A+L  +ESFWL
Sbjct  121  APVFRRPLNPEAVAEGEKILSAALSKIESFWL  152



>ref|XP_011022714.1| PREDICTED: glutathione S-transferase T1 [Populus euphratica]
Length=232

 Score =   213 bits (542),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 101/154 (66%), Positives = 123/154 (80%), Gaps = 2/154 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPA-VVD  282
            M +K+YVDR+SQPSRA++IFCKAN IDFEEV I++ KGQH TPE+  INPM +VPA VVD
Sbjct  1    MELKVYVDRLSQPSRAIVIFCKANKIDFEEVGIELLKGQHLTPEFKEINPMGKVPAIVVD  60

Query  283  GDFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTA  459
            G FKLFESH  L +LA+A  GVADHWYPADL +RA++ S+ DWHHSNLRRG+  ++ N  
Sbjct  61   GKFKLFESHTILIFLASAFPGVADHWYPADLYRRAEIHSILDWHHSNLRRGSTEFIQNAL  120

Query  460  LAPAFGLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            LAP FG P NP AAAEAEKVL +SL  +E+ WL+
Sbjct  121  LAPFFGRPLNPQAAAEAEKVLSSSLSKIEALWLK  154



>ref|XP_010553511.1| PREDICTED: glutathione S-transferase T1 [Tarenaya hassleriana]
Length=245

 Score =   212 bits (540),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 103/153 (67%), Positives = 123/153 (80%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M +K+Y DRMSQPSRA++IFCK NGI+FEEV + +AK +H +PE+  INPM +VPA+VDG
Sbjct  1    MKLKVYSDRMSQPSRAVIIFCKVNGIEFEEVVLSLAKRKHLSPEFKEINPMGKVPAIVDG  60

Query  286  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  462
             FKLFESHA L YL++A  G+ DHWYP DL KRAK+ SV DWHHSNLR GAAGYV NT L
Sbjct  61   RFKLFESHAILIYLSSAFPGIPDHWYPNDLSKRAKIHSVLDWHHSNLRAGAAGYVLNTVL  120

Query  463  APAFGLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            AP+ GLP NP AAAEAEK+L  SL  LE+FWL+
Sbjct  121  APSLGLPLNPRAAAEAEKLLSKSLSKLETFWLK  153



>ref|XP_010441287.1| PREDICTED: glutathione S-transferase T1-like [Camelina sativa]
Length=244

 Score =   212 bits (540),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 99/153 (65%), Positives = 119/153 (78%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M +K+Y DRMSQPSRA++IFCK NGI F+E  I ++K Q  TPE+  INPM +VPA+VDG
Sbjct  1    MMLKVYADRMSQPSRAVIIFCKVNGIQFDENLIILSKRQQLTPEFKDINPMGKVPAIVDG  60

Query  286  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  462
              KLFESHA L YL++A   V DHWYP DL KRAK+ SV DWHH++LR GAAGYV N+ L
Sbjct  61   RLKLFESHAILIYLSSAFPSVVDHWYPNDLSKRAKIHSVLDWHHTSLRPGAAGYVLNSVL  120

Query  463  APAFGLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            APA GLP NP AAA+AEK+L  SL TLE+FWL+
Sbjct  121  APALGLPLNPKAAADAEKLLTKSLSTLETFWLK  153



>ref|XP_010436071.1| PREDICTED: glutathione S-transferase T1 [Camelina sativa]
Length=244

 Score =   212 bits (540),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 99/153 (65%), Positives = 119/153 (78%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M +K+Y DRMSQPSRA++IFCK NGI F+E  I ++K Q  TPE+  INPM +VPA+VDG
Sbjct  1    MKLKVYADRMSQPSRAVIIFCKVNGIQFDENLIILSKRQQLTPEFKDINPMGKVPAIVDG  60

Query  286  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  462
              KLFESHA L YL++A   V DHWYP DL KRAK+ SV DWHH++LR GAAGYV N+ L
Sbjct  61   RLKLFESHAILIYLSSAFPSVVDHWYPNDLSKRAKIHSVLDWHHTSLRPGAAGYVLNSVL  120

Query  463  APAFGLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            APA GLP NP AAA+AEK+L  SL TLE+FWL+
Sbjct  121  APALGLPLNPKAAADAEKLLTKSLSTLETFWLK  153



>gb|KHG21896.1| Glutathione S-transferase T1 -like protein [Gossypium arboreum]
Length=250

 Score =   212 bits (539),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 98/153 (64%), Positives = 120/153 (78%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M +++Y DRMSQPSRA++IFCK NGID+ E+++ I+K +H TPE+A INPMKQ+PA+VDG
Sbjct  1    MKLEVYADRMSQPSRAVIIFCKVNGIDYTELKVDISKREHLTPEFAEINPMKQLPAIVDG  60

Query  286  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  462
             FKLFESH+ L YLA A  GVADHWYPADL KR+K+ SV  WHHSNLRR A  YV NT +
Sbjct  61   KFKLFESHSILIYLACAFPGVADHWYPADLFKRSKIHSVLYWHHSNLRRAAGTYVINTTI  120

Query  463  APAFGLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
             PA G P N  AA EAEK L++SL  +ESFWL+
Sbjct  121  LPALGYPSNQQAADEAEKFLVSSLSEIESFWLK  153



>gb|AGC13145.1| theta class glutathione S-transferase [Pinus tabuliformis]
Length=249

 Score =   211 bits (538),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 100/150 (67%), Positives = 118/150 (79%), Gaps = 1/150 (1%)
 Frame = +1

Query  112  VKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDGDF  291
            +++YVDRMSQPSRA+LIFCK N I+FEE  + + K +H+ PE+ AINP+  VPA+ DG F
Sbjct  4    LRVYVDRMSQPSRAVLIFCKVNKIEFEEHLVNLGKKEHKQPEFRAINPLGLVPAIHDGGF  63

Query  292  KLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALAP  468
            KLFESHA LKYLA A   V DHWYPADL KRAK+DSV DWHHSNLRRG+AG V N ALAP
Sbjct  64   KLFESHAILKYLACAYPSVPDHWYPADLSKRAKIDSVLDWHHSNLRRGSAGLVLNRALAP  123

Query  469  AFGLPCNPHAAAEAEKVLLASLGTLESFWL  558
            A GLP NP AA+EAE +L +SL  LE+ WL
Sbjct  124  ALGLPLNPQAASEAEILLKSSLSILETVWL  153



>ref|XP_006405381.1| hypothetical protein EUTSA_v10027900mg [Eutrema salsugineum]
 dbj|BAJ34350.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ46834.1| hypothetical protein EUTSA_v10027900mg [Eutrema salsugineum]
Length=244

 Score =   211 bits (537),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 96/153 (63%), Positives = 120/153 (78%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M +K+Y DRMSQPSRA++IFCK NGI F+E+ I +AK Q   PE+  INP+ +VPA+VDG
Sbjct  1    MKLKVYTDRMSQPSRAVIIFCKVNGIQFDEILISLAKRQQLAPEFKDINPLGKVPAIVDG  60

Query  286  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  462
              KLFESHA L YL++A   VADHWYP DL KRAK+ SV DWHH+NLR GAAGYV N+ L
Sbjct  61   RLKLFESHAILIYLSSAFPSVADHWYPNDLSKRAKIHSVLDWHHTNLRPGAAGYVLNSVL  120

Query  463  APAFGLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            AP+ GLP +P AA++A+K+L  SL TLE+FWL+
Sbjct  121  APSLGLPLDPQAASKADKLLTKSLSTLETFWLK  153



>gb|KJB25823.1| hypothetical protein B456_004G211100 [Gossypium raimondii]
Length=278

 Score =   212 bits (540),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 98/154 (64%), Positives = 122/154 (79%), Gaps = 1/154 (1%)
 Frame = +1

Query  103  EMAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVD  282
            +M +++Y DRMSQPSRA++IFCK NGID+ E+++ I+K +H TPE+A INPMKQ+PA+VD
Sbjct  28   KMKLEVYADRMSQPSRAVIIFCKVNGIDYTELKVDISKREHLTPEFAEINPMKQLPAIVD  87

Query  283  GDFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTA  459
            G FKLFESH+ L YLA A  GVADHWYPA+L KR+K+ SV  WHHSNLRR A  YV NT 
Sbjct  88   GKFKLFESHSILIYLACAFPGVADHWYPANLFKRSKIHSVLYWHHSNLRRAADTYVTNTT  147

Query  460  LAPAFGLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            + PA G P N  AAAEAEK+L +SL  +ESFWL+
Sbjct  148  ILPALGHPSNQQAAAEAEKLLFSSLSKIESFWLK  181



>gb|KJB25822.1| hypothetical protein B456_004G211100 [Gossypium raimondii]
Length=250

 Score =   211 bits (538),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 98/153 (64%), Positives = 121/153 (79%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M +++Y DRMSQPSRA++IFCK NGID+ E+++ I+K +H TPE+A INPMKQ+PA+VDG
Sbjct  1    MKLEVYADRMSQPSRAVIIFCKVNGIDYTELKVDISKREHLTPEFAEINPMKQLPAIVDG  60

Query  286  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  462
             FKLFESH+ L YLA A  GVADHWYPA+L KR+K+ SV  WHHSNLRR A  YV NT +
Sbjct  61   KFKLFESHSILIYLACAFPGVADHWYPANLFKRSKIHSVLYWHHSNLRRAADTYVTNTTI  120

Query  463  APAFGLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
             PA G P N  AAAEAEK+L +SL  +ESFWL+
Sbjct  121  LPALGHPSNQQAAAEAEKLLFSSLSKIESFWLK  153



>gb|KFK33026.1| hypothetical protein AALP_AA6G320800 [Arabis alpina]
Length=244

 Score =   211 bits (536),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 97/153 (63%), Positives = 118/153 (77%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M +K+Y DRMSQPSRA++IFCK NGI F+E+ I ++K Q  +PE+  INP+ +VPA+VDG
Sbjct  1    MKLKVYTDRMSQPSRAIIIFCKVNGIQFDEISIILSKRQQLSPEFKEINPLGKVPAIVDG  60

Query  286  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  462
              KLFESHA L YLA+A   V DHWYP DL KRAK+ SV DWHH+NLR GAAGYV NT L
Sbjct  61   RLKLFESHAILIYLASAFPSVLDHWYPNDLSKRAKIHSVMDWHHTNLRPGAAGYVMNTVL  120

Query  463  APAFGLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            AP  GL  +P AAA+AEK+L  SL TLE+FWL+
Sbjct  121  APHLGLTLDPQAAAKAEKLLTQSLSTLETFWLK  153



>ref|XP_006439582.1| hypothetical protein CICLE_v10021879mg [Citrus clementina]
 ref|XP_006476593.1| PREDICTED: glutathione S-transferase T1-like [Citrus sinensis]
 gb|ESR52822.1| hypothetical protein CICLE_v10021879mg [Citrus clementina]
Length=247

 Score =   210 bits (535),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 95/153 (62%), Positives = 118/153 (77%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M +K+Y DR+SQPSRA++IFCK NGIDFEE+++++A  +  +PE+  INPM +VPA+VDG
Sbjct  1    MKLKVYADRLSQPSRAVIIFCKVNGIDFEEIEVKLANREQHSPEFKDINPMAKVPAIVDG  60

Query  286  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  462
              KLFESHA L YL+ A  GVADHWYP DL KRAK+ SV DWHHSNLR G   YVFN  L
Sbjct  61   RLKLFESHAILTYLSCAFPGVADHWYPNDLLKRAKIHSVLDWHHSNLRLGTVKYVFNHKL  120

Query  463  APAFGLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            AP  GLP NP AAA+ +K+L +SL  +ESFWL+
Sbjct  121  APVVGLPLNPEAAAKGKKILSSSLSKIESFWLK  153



>emb|CDY71891.1| BnaC06g42280D [Brassica napus]
Length=241

 Score =   210 bits (534),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 99/153 (65%), Positives = 118/153 (77%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M +K+Y DRMSQPSRA++IFCK NGI+F+EV I +AK Q  +PE+  INP+ +VP +VDG
Sbjct  1    MKLKVYADRMSQPSRAVIIFCKVNGIEFDEVLIILAKRQQLSPEFKEINPLGKVPTIVDG  60

Query  286  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  462
             FKLFESHA L YLA+A   VADHWYP DL KRAK+ SV DWHH+NLR GAAGYV NT L
Sbjct  61   RFKLFESHAILIYLASAFPSVADHWYPNDLSKRAKIHSVLDWHHTNLRPGAAGYVMNTVL  120

Query  463  APAFGLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            AP  G   +  AAAEAEK+L  SL TLE+FWL+
Sbjct  121  APFLGRSLDSKAAAEAEKILTKSLSTLETFWLK  153



>ref|XP_006579426.1| PREDICTED: uncharacterized protein LOC100799229 isoform X2 [Glycine 
max]
Length=239

 Score =   209 bits (533),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 96/151 (64%), Positives = 117/151 (77%), Gaps = 1/151 (1%)
 Frame = +1

Query  112  VKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDGDF  291
            +K+Y DRMSQPSRA+LIFC+ NGIDFEE+++ I+K  H +PE+  +NP+++VPA+V G F
Sbjct  5    LKVYADRMSQPSRAVLIFCRFNGIDFEEIKVDISKRHHLSPEFREVNPLQKVPAIVHGSF  64

Query  292  KLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALAP  468
             L ESHA L YLA+A  G+ADHWYP+DL +RAK+ SV DWHHSNLR GA  YV NT L P
Sbjct  65   NLSESHAILVYLASAFPGIADHWYPSDLYRRAKIISVMDWHHSNLRHGAVNYVINTVLGP  124

Query  469  AFGLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            A G P NP AAAEAEKVLL+SL  LE  WL 
Sbjct  125  ATGRPLNPKAAAEAEKVLLSSLSKLEDIWLN  155



>gb|AHA46533.1| theta class glutathione S-transferase [Larix kaempferi]
Length=249

 Score =   210 bits (534),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 98/148 (66%), Positives = 116/148 (78%), Gaps = 1/148 (1%)
 Frame = +1

Query  118  LYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDGDFKL  297
            +YVDRMSQPSRA+LIFC  N I+FEE  + + K +H+ PEY AINP++QVPA+ DG FKL
Sbjct  6    VYVDRMSQPSRAVLIFCMVNRIEFEERLVNLGKREHKRPEYGAINPLQQVPAIDDGGFKL  65

Query  298  FESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALAPAF  474
            FESHA L+YLA A   V DHWYPADL KRAK+DSV DWHHS+LRRG+AG V N  LAPA 
Sbjct  66   FESHAILRYLACAYPRVPDHWYPADLSKRAKIDSVLDWHHSSLRRGSAGLVLNRVLAPAL  125

Query  475  GLPCNPHAAAEAEKVLLASLGTLESFWL  558
            GLP NP AA+EAE +L +SL  LE+ WL
Sbjct  126  GLPLNPQAASEAEILLKSSLSILETIWL  153



>emb|CAA10662.1| glutathione transferase, GST 10b [Arabidopsis thaliana]
Length=245

 Score =   209 bits (532),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 96/153 (63%), Positives = 116/153 (76%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M +K+Y D+MSQPSRA+LIFCK N I F+E+ I + K Q  +PE+  INPM +VPA+VDG
Sbjct  2    MKLKVYADKMSQPSRAVLIFCKVNEIQFDEILISLGKRQQLSPEFKEINPMGKVPAIVDG  61

Query  286  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  462
              KLFESHA L YL++A   V DHWYP DL KRAK+ SV DWHH+NLR GA+GYV N+ L
Sbjct  62   RLKLFESHAILIYLSSAYASVVDHWYPNDLSKRAKIHSVLDWHHTNLRPGASGYVLNSVL  121

Query  463  APAFGLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            APA  LP NP AAAEAE +L  SL TLE+FWL+
Sbjct  122  APALSLPLNPKAAAEAENILTNSLSTLETFWLK  154



>gb|KHN23653.1| Glutathione S-transferase T1 [Glycine soja]
Length=252

 Score =   209 bits (533),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 96/151 (64%), Positives = 117/151 (77%), Gaps = 1/151 (1%)
 Frame = +1

Query  112  VKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDGDF  291
            +K+Y DRMSQPSRA+LIFC+ NGIDFEE+++ I+K  H +PE+  +NP+++VPA+V G F
Sbjct  5    LKVYADRMSQPSRAVLIFCRFNGIDFEEIKVDISKRHHLSPEFREVNPLQKVPAIVHGSF  64

Query  292  KLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALAP  468
             L ESHA L YLA+A  G+ADHWYP+DL +RAK+ SV DWHHSNLR GA  YV NT L P
Sbjct  65   NLSESHAILVYLASAFPGIADHWYPSDLYRRAKIISVMDWHHSNLRHGAVNYVINTVLGP  124

Query  469  AFGLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            A G P NP AAAEAEKVLL+SL  LE  WL 
Sbjct  125  ATGRPLNPKAAAEAEKVLLSSLSKLEDIWLN  155



>ref|XP_006579425.1| PREDICTED: uncharacterized protein LOC100799229 isoform X1 [Glycine 
max]
 gb|AJE59642.1| theta class glutathione S-transferase [Glycine max]
Length=252

 Score =   209 bits (533),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 96/151 (64%), Positives = 117/151 (77%), Gaps = 1/151 (1%)
 Frame = +1

Query  112  VKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDGDF  291
            +K+Y DRMSQPSRA+LIFC+ NGIDFEE+++ I+K  H +PE+  +NP+++VPA+V G F
Sbjct  5    LKVYADRMSQPSRAVLIFCRFNGIDFEEIKVDISKRHHLSPEFREVNPLQKVPAIVHGSF  64

Query  292  KLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALAP  468
             L ESHA L YLA+A  G+ADHWYP+DL +RAK+ SV DWHHSNLR GA  YV NT L P
Sbjct  65   NLSESHAILVYLASAFPGIADHWYPSDLYRRAKIISVMDWHHSNLRHGAVNYVINTVLGP  124

Query  469  AFGLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            A G P NP AAAEAEKVLL+SL  LE  WL 
Sbjct  125  ATGRPLNPKAAAEAEKVLLSSLSKLEDIWLN  155



>ref|XP_009125179.1| PREDICTED: glutathione S-transferase T1-like [Brassica rapa]
Length=241

 Score =   209 bits (531),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 98/153 (64%), Positives = 119/153 (78%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M +K+Y DRMSQPSRA++IFCK NGI+F+EV I +AK Q  +PE+  INP+ +VP++VDG
Sbjct  1    MKLKVYADRMSQPSRAIIIFCKVNGIEFDEVLIILAKRQQLSPEFKEINPLGKVPSIVDG  60

Query  286  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  462
             FKLFESHA L YLA+A   VADHWYP D+ KRAK+ SV DWHH+NLR GAAGYV NT L
Sbjct  61   RFKLFESHAILIYLASAFPSVADHWYPNDVSKRAKIHSVLDWHHTNLRPGAAGYVMNTVL  120

Query  463  APAFGLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            AP  G   +  AAAEAEK+L  SL TLE+FWL+
Sbjct  121  APFLGRSLDSKAAAEAEKILTKSLSTLETFWLK  153



>emb|CDX67492.1| BnaA07g15320D [Brassica napus]
Length=241

 Score =   208 bits (530),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 98/153 (64%), Positives = 118/153 (77%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M +K+Y DRMSQPSRA++IFCK NGI+F+EV I +AK Q  +PE+  INP+ +VP++VDG
Sbjct  1    MKLKVYADRMSQPSRAVIIFCKVNGIEFDEVLIILAKRQQFSPEFKEINPLGKVPSIVDG  60

Query  286  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  462
             FKLFESH  L YLA+A   VADHWYP DL KRAK+ SV DWHH+NLR GAAGYV NT L
Sbjct  61   RFKLFESHTILIYLASAFPSVADHWYPNDLSKRAKIHSVLDWHHTNLRPGAAGYVMNTVL  120

Query  463  APAFGLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            AP  G   +  AAAEAEK+L  SL TLE+FWL+
Sbjct  121  APFLGRSLDSKAAAEAEKILTKSLSTLETFWLK  153



>gb|EMT22242.1| hypothetical protein F775_32578 [Aegilops tauschii]
Length=242

 Score =   208 bits (530),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 98/158 (62%), Positives = 118/158 (75%), Gaps = 8/158 (5%)
 Frame = +1

Query  112  VKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDGDF  291
            +K+Y DR+SQPSRA++I CK N IDF+E+ + +A+GQHR PE+  INPM QVP +VDG F
Sbjct  5    LKVYADRLSQPSRAIIILCKVNRIDFQELTVDLARGQHRAPEFTKINPMAQVPTIVDGRF  64

Query  292  KLFES-------HAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYV  447
            KLFES       HA L+YLA    GV DHWYPADL  RAK++SV DWHHSNLRRGAA YV
Sbjct  65   KLFESMFLLPVSHAILRYLATVFPGVPDHWYPADLFTRAKLESVLDWHHSNLRRGAATYV  124

Query  448  FNTALAPAFGLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
             +TAL PA GL  NP  A EAEK+L  SLGT+E+ WL+
Sbjct  125  LHTALGPALGLTPNPETAKEAEKLLSRSLGTIETVWLK  162



>ref|NP_001242886.1| uncharacterized protein LOC100799229 [Glycine max]
 gb|ACU20910.1| unknown [Glycine max]
Length=227

 Score =   207 bits (528),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 95/151 (63%), Positives = 116/151 (77%), Gaps = 1/151 (1%)
 Frame = +1

Query  112  VKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDGDF  291
            +K+Y DRMSQPSRA+LIFC+ NGIDFEE+++ I+K  H +PE+  +NP+++VPA+V G F
Sbjct  5    LKVYADRMSQPSRAVLIFCRFNGIDFEEIKVDISKRHHLSPEFREVNPLQKVPAIVHGSF  64

Query  292  KLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALAP  468
             L ESHA L YL +A  G+ADHWYP+DL +RAK+ SV DWHHSNLR GA  YV NT L P
Sbjct  65   NLSESHAILVYLVSAFPGIADHWYPSDLYRRAKIISVMDWHHSNLRHGAVNYVINTVLGP  124

Query  469  AFGLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            A G P NP AAAEAEKVLL+SL  LE  WL 
Sbjct  125  ATGRPLNPKAAAEAEKVLLSSLSKLEDIWLN  155



>ref|XP_003630527.1| Glutathione S-transferase theta [Medicago truncatula]
Length=251

 Score =   207 bits (528),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 93/151 (62%), Positives = 117/151 (77%), Gaps = 1/151 (1%)
 Frame = +1

Query  112  VKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDGDF  291
            +K+Y DRMSQPSRA+LIFC+ NGIDFEE+++ ++K  H +PE+  +NP+ +VPA++ G+F
Sbjct  4    LKVYADRMSQPSRAVLIFCRFNGIDFEEIKVDLSKRHHLSPEFTEVNPLHKVPAILHGNF  63

Query  292  KLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALAP  468
             LFESHA L YL++A  GVADHWYP D+ +R K++SV DWHHSNLR GA  YV NT L P
Sbjct  64   NLFESHAILVYLSSAFPGVADHWYPTDVFRRVKINSVLDWHHSNLRYGAVNYVSNTVLGP  123

Query  469  AFGLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            A G P NP AAAEAEKVLL+SL  LE  WL 
Sbjct  124  ALGRPLNPEAAAEAEKVLLSSLSKLEDIWLN  154



>gb|AET05003.2| glutathione S-transferase, amino-terminal domain protein [Medicago 
truncatula]
Length=252

 Score =   207 bits (528),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 93/151 (62%), Positives = 117/151 (77%), Gaps = 1/151 (1%)
 Frame = +1

Query  112  VKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDGDF  291
            +K+Y DRMSQPSRA+LIFC+ NGIDFEE+++ ++K  H +PE+  +NP+ +VPA++ G+F
Sbjct  5    LKVYADRMSQPSRAVLIFCRFNGIDFEEIKVDLSKRHHLSPEFTEVNPLHKVPAILHGNF  64

Query  292  KLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALAP  468
             LFESHA L YL++A  GVADHWYP D+ +R K++SV DWHHSNLR GA  YV NT L P
Sbjct  65   NLFESHAILVYLSSAFPGVADHWYPTDVFRRVKINSVLDWHHSNLRYGAVNYVSNTVLGP  124

Query  469  AFGLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            A G P NP AAAEAEKVLL+SL  LE  WL 
Sbjct  125  ALGRPLNPEAAAEAEKVLLSSLSKLEDIWLN  155



>gb|AEB77874.1| glutathione S-transferase protein [Bruguiera gymnorhiza]
Length=250

 Score =   207 bits (527),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 96/153 (63%), Positives = 118/153 (77%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M +K++ DR SQPSRA+++FCK NGIDFEE+++ + + +  +PE+  INPM +VPA+VDG
Sbjct  1    MKLKVFADRKSQPSRAVILFCKVNGIDFEEIKVDLMQKKQFSPEFKEINPMGKVPAIVDG  60

Query  286  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  462
             FKLFESHA L YLA A  GVADHWYPADL KRAK+ SV DWHHS LRRG+ G V N  L
Sbjct  61   RFKLFESHAILIYLACAFPGVADHWYPADLFKRAKIHSVLDWHHSYLRRGSVGIVLNGKL  120

Query  463  APAFGLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
             PA GLP NP AAAEAEK+L +SL  +ES WL+
Sbjct  121  GPALGLPLNPQAAAEAEKLLSSSLSKIESVWLK  153



>ref|NP_001152125.1| glutathione S-transferase theta-1 [Zea mays]
 gb|ACG45968.1| glutathione S-transferase theta-1 [Zea mays]
 gb|ACN25412.1| unknown [Zea mays]
 tpg|DAA52620.1| TPA: glutathione S-transferase theta-1 [Zea mays]
Length=249

 Score =   207 bits (527),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 95/151 (63%), Positives = 117/151 (77%), Gaps = 1/151 (1%)
 Frame = +1

Query  112  VKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDGDF  291
            VK+Y DR SQPSRA++IFC+ N IDFEEV + + K QH TPE+  INPM QVPA+VDG F
Sbjct  4    VKVYADRRSQPSRAVIIFCRVNQIDFEEVTVDLFKSQHLTPEFKKINPMGQVPAIVDGRF  63

Query  292  KLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALAP  468
            KLFESHA L+YLA+   GVADHWYP+DL  RAK++S+ DWHHSNLRRGAA  V +TALAP
Sbjct  64   KLFESHAILRYLASVFPGVADHWYPSDLFTRAKIESILDWHHSNLRRGAATLVMHTALAP  123

Query  469  AFGLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
              GL  +  A  +AEK+++ SLG +ES WL+
Sbjct  124  FLGLTTSHEAVKQAEKLVMQSLGVIESVWLK  154



>gb|KHN23652.1| Glutathione S-transferase T1 [Glycine soja]
 gb|AJE59641.1| theta class glutathione S-transferase [Glycine max]
Length=250

 Score =   207 bits (527),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 99/153 (65%), Positives = 125/153 (82%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M +K+Y DRMSQPSRA+LIFCK NGIDFEE+++ ++K Q  +PE+ A+NP+++VPA+VDG
Sbjct  1    MKLKVYADRMSQPSRAVLIFCKVNGIDFEEIKVDLSKRQQLSPEFRAVNPLRKVPAIVDG  60

Query  286  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  462
             FKLFESHA L YLA+A  GVADHWYPADL +RA++ SV DWHH NLRRGAA +V NT L
Sbjct  61   RFKLFESHAILIYLASAFPGVADHWYPADLSRRARIHSVLDWHHQNLRRGAASFVLNTVL  120

Query  463  APAFGLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            AP  GL  N  AAAEAEK+L++SL T+E+ WL+
Sbjct  121  APLLGLRANQQAAAEAEKILISSLSTIENIWLK  153



>ref|NP_001236903.1| glutathione S-transferase GST 23 [Glycine max]
 gb|AAG34813.1|AF243378_1 glutathione S-transferase GST 23 [Glycine max]
Length=250

 Score =   207 bits (527),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 99/153 (65%), Positives = 125/153 (82%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M +K+Y DRMSQPSRA+LIFCK NGIDFEE+++ ++K Q  +PE+ A+NP+++VPA+VDG
Sbjct  1    MKLKVYADRMSQPSRAVLIFCKVNGIDFEEIKVDLSKRQQLSPEFRAVNPLRKVPAIVDG  60

Query  286  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  462
             FKLFESHA L YLA+A  GVADHWYPADL +RA++ SV DWHH NLRRGAA +V NT L
Sbjct  61   RFKLFESHAILIYLASAFPGVADHWYPADLSRRARIHSVLDWHHQNLRRGAASFVLNTVL  120

Query  463  APAFGLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            AP  GL  N  AAAEAEK+L++SL T+E+ WL+
Sbjct  121  APLLGLRANQQAAAEAEKILISSLSTIENIWLK  153



>ref|XP_006282694.1| hypothetical protein CARUB_v10005614mg [Capsella rubella]
 gb|EOA15592.1| hypothetical protein CARUB_v10005614mg [Capsella rubella]
Length=244

 Score =   207 bits (526),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 97/153 (63%), Positives = 117/153 (76%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M +K+YVDRMSQPSRA++IFCK NGI F+E  I +AK Q  T E+  INP+ +VPA+VDG
Sbjct  1    MKLKVYVDRMSQPSRAVIIFCKVNGIQFDETLISLAKRQQLTSEFKDINPIGKVPAIVDG  60

Query  286  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  462
              KLFESHA L YL++A   V DHWYP DL +RAK+ SV DWHH++LR GAAGYV  + L
Sbjct  61   RLKLFESHAILIYLSSAFPSVVDHWYPNDLSQRAKIHSVLDWHHTSLRPGAAGYVLYSVL  120

Query  463  APAFGLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            APA GLP NP  AAEAEK+L  SL TLE+FWL+
Sbjct  121  APALGLPLNPEKAAEAEKLLTKSLSTLETFWLK  153



>ref|XP_003563992.1| PREDICTED: glutathione S-transferase T1 [Brachypodium distachyon]
Length=274

 Score =   207 bits (526),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 95/152 (63%), Positives = 118/152 (78%), Gaps = 2/152 (1%)
 Frame = +1

Query  112  VKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAA-INPMKQVPAVVDGD  288
            +K+Y DR SQPSRA++IFC+AN IDF+EV + + K QH TPE+ + INPM QVPA+VDG 
Sbjct  38   LKVYADRRSQPSRAIIIFCRANRIDFDEVTVDLFKAQHLTPEFKSKINPMGQVPAIVDGR  97

Query  289  FKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  465
            FKLFESHA L+YLA+   GV DHWYPADL  RAK++S+ DWHHSNLRRGA  +V NT L 
Sbjct  98   FKLFESHAILRYLASVFPGVPDHWYPADLFTRAKIESILDWHHSNLRRGAVTFVLNTVLG  157

Query  466  PAFGLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            P+ GLP +P AA E EK+L+ SL T+E  WL+
Sbjct  158  PSLGLPTSPEAAKEGEKLLVRSLRTIEYVWLK  189



>dbj|BAB11100.1| glutathione transferase [Arabidopsis thaliana]
Length=242

 Score =   205 bits (522),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 97/153 (63%), Positives = 115/153 (75%), Gaps = 3/153 (2%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M +K+Y DRMSQPSRA+LIFCK N I F+E+ I + K Q  +PE+  INPM +VPA+VDG
Sbjct  1    MKLKVYADRMSQPSRAVLIFCKVNEIQFDEILISLGKRQQLSPEFKEINPMGKVPAIVDG  60

Query  286  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  462
              KLFESHA L YL++A   V DHWYP DL KRAK+ SV DWHH+NLR   AGYV N+ L
Sbjct  61   RLKLFESHAILIYLSSAYASVVDHWYPNDLSKRAKIHSVLDWHHTNLR--PAGYVLNSVL  118

Query  463  APAFGLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            APA GLP NP AAAEAE +L  SL TLE+FWL+
Sbjct  119  APALGLPLNPKAAAEAENILTNSLSTLETFWLK  151



>ref|XP_009140078.1| PREDICTED: glutathione S-transferase T1-like [Brassica rapa]
Length=246

 Score =   205 bits (521),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 96/153 (63%), Positives = 117/153 (76%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M +K+Y DRMSQPSRA++IFCK NGI+F+EV I +AK Q  +PE+  INP+ +VP +VDG
Sbjct  1    MKLKVYADRMSQPSRAVIIFCKVNGIEFDEVLIILAKRQQLSPEFKEINPLGKVPTIVDG  60

Query  286  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  462
              KLFESHA L YL++A   VADHWYP DL KRAK+ SV DWHHSNLR GAAGYV N+ L
Sbjct  61   RLKLFESHAILIYLSSAFPSVADHWYPNDLSKRAKIHSVLDWHHSNLRPGAAGYVMNSVL  120

Query  463  APAFGLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            AP  G   +  AAAEAE++L  SL TLE+FWL+
Sbjct  121  APFLGRSLDSKAAAEAEQILTKSLSTLETFWLK  153



>ref|XP_003532409.1| PREDICTED: glutathione S-transferase T2-like isoform X1 [Glycine 
max]
 gb|AJE59643.1| theta class glutathione S-transferase [Glycine max]
Length=252

 Score =   205 bits (521),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 94/151 (62%), Positives = 120/151 (79%), Gaps = 1/151 (1%)
 Frame = +1

Query  112  VKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDGDF  291
            +K+Y D+MSQPSRA+LIFC+ NGIDFEE+++ I+K  H +PE+  INP+++VPA+V G F
Sbjct  5    LKVYADQMSQPSRAVLIFCRFNGIDFEEIKVDISKRHHLSPEFREINPLQKVPAIVHGSF  64

Query  292  KLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALAP  468
             L ESHA L YLA+A  G+ADHWYP++L +RAK++SV DWHHSNL+ GAA YV NT L P
Sbjct  65   NLSESHAILVYLASAFPGIADHWYPSNLFRRAKINSVMDWHHSNLQHGAANYVINTVLGP  124

Query  469  AFGLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            A G P +P AAAEAEKVLL+SL  LE+ WL 
Sbjct  125  ATGRPLSPKAAAEAEKVLLSSLSKLENIWLN  155



>gb|EPS65585.1| hypothetical protein M569_09192 [Genlisea aurea]
Length=237

 Score =   204 bits (519),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 101/153 (66%), Positives = 119/153 (78%), Gaps = 2/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M +KLY DRMSQPSRA++IFCK NGI+FEEV+I ++K Q+ TPE+  INPMK+VPA+VDG
Sbjct  1    MCLKLYADRMSQPSRAVIIFCKMNGIEFEEVRIDLSKRQNLTPEFIEINPMKKVPALVDG  60

Query  286  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  462
             FKLFESHA L YLA+   GVADHWYPADL KRAK+ SV DWHH N R+ A  YV N+ +
Sbjct  61   RFKLFESHAILIYLASVFPGVADHWYPADLFKRAKIHSVLDWHHLNSRQ-AGSYVLNSTI  119

Query  463  APAFGLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            APA G P +  A AEAEK L ASL  LESFWL+
Sbjct  120  APALGWPHSAVATAEAEKALSASLEKLESFWLE  152



>emb|CDY39752.1| BnaA04g11010D [Brassica napus]
Length=246

 Score =   204 bits (519),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 96/153 (63%), Positives = 117/153 (76%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M +K+Y DRMSQPSRA++IFCK NGI+F+EV I +AK Q  +PE+  INP+ +VP +VDG
Sbjct  1    MKLKVYADRMSQPSRAVIIFCKVNGIEFDEVLIILAKRQQLSPEFKEINPLGKVPTIVDG  60

Query  286  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  462
              KLFESHA L YL++A   VADHWYP DL KRAK+ SV DWHHSNLR GAAGYV N+ L
Sbjct  61   RLKLFESHAILIYLSSAFPSVADHWYPNDLSKRAKIHSVLDWHHSNLRPGAAGYVMNSVL  120

Query  463  APAFGLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            AP  G   +  AAAEAE++L  SL TLE+FWL+
Sbjct  121  APFLGGSLDSKAAAEAEQILTKSLSTLETFWLK  153



>gb|ADE75690.1| unknown [Picea sitchensis]
Length=248

 Score =   204 bits (518),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 96/150 (64%), Positives = 114/150 (76%), Gaps = 1/150 (1%)
 Frame = +1

Query  112  VKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDGDF  291
            +++YVDRMSQPSRA+LIFC  N I+FEE  + + K +H+ PE+ AINP+  VP + DG F
Sbjct  4    LRVYVDRMSQPSRAVLIFCMVNKIEFEEHLVNLGKKEHKQPEFRAINPLGLVPTIDDGGF  63

Query  292  KLFESHAALKYLAAAN-GVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALAP  468
            KLFESHA LKYLA A   V DHWYPADL KRAK+DSV DWHHSNLRRG+AG V N  LAP
Sbjct  64   KLFESHAILKYLACAYPRVPDHWYPADLSKRAKIDSVLDWHHSNLRRGSAGLVLNRVLAP  123

Query  469  AFGLPCNPHAAAEAEKVLLASLGTLESFWL  558
            A GLP N  AA+EAE +L +SL  LE+ WL
Sbjct  124  ALGLPLNSQAASEAEILLKSSLSMLETIWL  153



>emb|CDY46386.1| BnaC04g33050D [Brassica napus]
Length=245

 Score =   203 bits (517),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 95/153 (62%), Positives = 117/153 (76%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M +K+Y DRMSQPSRA++IFCK NGI+F+EV I +AK Q  +PE+  INP+ +VP +VDG
Sbjct  1    MKLKVYADRMSQPSRAVIIFCKVNGIEFDEVLIILAKRQQLSPEFKEINPLGKVPTIVDG  60

Query  286  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  462
              KLFESHA L YL++A   VADHWYP DL KRAK+ SV DWHH+NLR GAAGYV N+ L
Sbjct  61   RLKLFESHAILIYLSSAFPSVADHWYPNDLSKRAKIHSVLDWHHTNLRPGAAGYVMNSVL  120

Query  463  APAFGLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            AP  G   +  AAAEAE++L  SL TLE+FWL+
Sbjct  121  APFLGGSLDSKAAAEAEQILTKSLSTLETFWLK  153



>ref|XP_004980948.1| PREDICTED: glutathione S-transferase T1-like [Setaria italica]
Length=250

 Score =   203 bits (517),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 94/151 (62%), Positives = 116/151 (77%), Gaps = 1/151 (1%)
 Frame = +1

Query  112  VKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDGDF  291
            +K+Y DR SQPSRA++IFC+ N IDFEEV + + K QH TP++  INP+ QVPA+VDG F
Sbjct  4    IKVYADRRSQPSRAVIIFCRVNQIDFEEVTVDLFKSQHLTPQFRKINPLGQVPAIVDGRF  63

Query  292  KLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALAP  468
            KLFESHA L+YLA+   GVADHWYPADL  RAK++S+ DWHHSNLRRGAA  V +TALAP
Sbjct  64   KLFESHAILRYLASVFPGVADHWYPADLFTRAKIESILDWHHSNLRRGAATLVMHTALAP  123

Query  469  AFGLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
              GL  +P A  +AEK+L  SL  +ES WL+
Sbjct  124  FLGLTTSPDAVKQAEKLLSQSLERIESVWLK  154



>ref|XP_010676473.1| PREDICTED: glutathione S-transferase T1 [Beta vulgaris subsp. 
vulgaris]
Length=247

 Score =   203 bits (516),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 96/153 (63%), Positives = 118/153 (77%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M +K++ DRMSQPSRA+++FCK N I+FEEV+I + K QH + E+A INP++QVPA+VDG
Sbjct  1    MTLKVFADRMSQPSRAVILFCKLNKINFEEVRIVLFKRQHFSQEFAEINPLRQVPAIVDG  60

Query  286  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  462
             FKL+ESHA L YL+ A  GVADHWYPAD+ KRAK+ SV DWHH NLR GA  YV NT L
Sbjct  61   RFKLYESHAILIYLSCAFPGVADHWYPADVSKRAKIHSVLDWHHLNLRYGAMRYVVNTTL  120

Query  463  APAFGLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
             PA G P +  AAA AEKVL +SL T+ES WL+
Sbjct  121  GPALGRPLDSQAAARAEKVLDSSLATIESVWLE  153



>ref|NP_198940.3| glutathione S-transferase THETA 2 [Arabidopsis thaliana]
 sp|Q8L727.1|GSTT2_ARATH RecName: Full=Glutathione S-transferase T2; Short=AtGSTT2; AltName: 
Full=GST class-theta member 2; AltName: Full=Glutathione 
S-transferase 10B [Arabidopsis thaliana]
 gb|AAM98138.1| glutathione transferase [Arabidopsis thaliana]
 gb|AAP37720.1| At5g41240 [Arabidopsis thaliana]
 gb|AED94656.1| glutathione S-transferase THETA 2 [Arabidopsis thaliana]
Length=591

 Score =   211 bits (538),  Expect = 2e-61, Method: Composition-based stats.
 Identities = 98/153 (64%), Positives = 117/153 (76%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M +K+Y DRMSQPSRA+LIFCK N I F+E+ I + K Q  +PE+  INPM +VPA+VDG
Sbjct  1    MKLKVYADRMSQPSRAVLIFCKVNEIQFDEILISLGKRQQLSPEFKEINPMGKVPAIVDG  60

Query  286  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  462
              KLFESHA L YL++A   V DHWYP DL KRAK+ SV DWHH+NLR GA+GYV N+ L
Sbjct  61   RLKLFESHAILIYLSSAYASVVDHWYPNDLSKRAKIHSVLDWHHTNLRPGASGYVLNSVL  120

Query  463  APAFGLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            APA GLP NP AAAEAE +L  SL TLE+FWL+
Sbjct  121  APALGLPLNPKAAAEAENILTNSLSTLETFWLK  153



>ref|XP_009386057.1| PREDICTED: glutathione S-transferase T1-like [Musa acuminata 
subsp. malaccensis]
Length=232

 Score =   202 bits (513),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 94/153 (61%), Positives = 112/153 (73%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M +K+Y  R+SQPSRA++IFCK NGIDFEEV I    G+HR P++  INPM +VPA+V G
Sbjct  1    MTLKVYGHRLSQPSRAIIIFCKVNGIDFEEVTIDFTTGKHRLPDFKEINPMAEVPAIVHG  60

Query  286  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  462
            D KLFESHA L YLA+A  GV D WYPAD+  RAK+ S+ DWHHSNLRRGA  Y  N+AL
Sbjct  61   DLKLFESHAILCYLASAFPGVPDGWYPADIISRAKIQSILDWHHSNLRRGALNYCINSAL  120

Query  463  APAFGLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
             P   LP NP AA E EK+L ASL  LE+ WL+
Sbjct  121  GPVRSLPLNPQAAIEDEKILSASLSKLETVWLK  153



>ref|XP_004245614.1| PREDICTED: glutathione S-transferase T1 [Solanum lycopersicum]
Length=250

 Score =   202 bits (513),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 94/153 (61%), Positives = 112/153 (73%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M +KLYVDRMSQ  R ++IFCK NGIDFEEV I ++K Q  +PEY  INP++Q+PA++DG
Sbjct  1    MTLKLYVDRMSQACREVIIFCKLNGIDFEEVHIDLSKRQQLSPEYREINPIRQIPAIMDG  60

Query  286  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  462
             FKL ESHA LKYLA A   +ADHWYPADL KRAKV+SV DWH +N  RG   Y F + L
Sbjct  61   RFKLSESHAILKYLACAFPRIADHWYPADLYKRAKVESVLDWHRTNFPRGPGSYTFYSVL  120

Query  463  APAFGLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            AP  GLP N  AAA  EK+ +A L T+ES WLQ
Sbjct  121  APTVGLPLNTKAAARTEKMFIACLATIESVWLQ  153



>ref|XP_007160051.1| hypothetical protein PHAVU_002G288500g [Phaseolus vulgaris]
 gb|ESW32045.1| hypothetical protein PHAVU_002G288500g [Phaseolus vulgaris]
Length=253

 Score =   197 bits (502),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 89/150 (59%), Positives = 112/150 (75%), Gaps = 1/150 (1%)
 Frame = +1

Query  112  VKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDGDF  291
            +K+Y DRMSQPSRA+LIFC+ NGI F E+++ I+KG H + E+  +NP+++VPA+V G F
Sbjct  6    LKVYADRMSQPSRAVLIFCRLNGIGFVEIKVDISKGHHLSSEFTEVNPLQKVPAIVHGSF  65

Query  292  KLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALAP  468
             L ESHA L YL +A  G+ADHWYP+D+ +RAK++SV DWHHSNLR GA  YV NT L P
Sbjct  66   NLSESHAILVYLNSAFPGIADHWYPSDIFRRAKINSVMDWHHSNLRNGAVSYVINTVLGP  125

Query  469  AFGLPCNPHAAAEAEKVLLASLGTLESFWL  558
            A G   NP  AAEAEKVL +SL  LE  WL
Sbjct  126  ATGRTLNPKTAAEAEKVLFSSLSNLEDIWL  155



>ref|XP_002449793.1| hypothetical protein SORBIDRAFT_05g023450 [Sorghum bicolor]
 gb|EES08781.1| hypothetical protein SORBIDRAFT_05g023450 [Sorghum bicolor]
Length=252

 Score =   197 bits (500),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 93/151 (62%), Positives = 112/151 (74%), Gaps = 1/151 (1%)
 Frame = +1

Query  112  VKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDGDF  291
            +K+Y  R SQP RA++IFC+AN IDFEEV + + K Q+ TPE+  INPM QVPA+VDG F
Sbjct  4    IKVYAHRWSQPCRAVIIFCRANKIDFEEVTVDLFKSQNLTPEFRKINPMAQVPAIVDGRF  63

Query  292  KLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALAP  468
            KLFESHA L+YLA    GVADHWYPADL  RAK++S+ DWHHSNLR GA  +V+ TALAP
Sbjct  64   KLFESHAILRYLATVFPGVADHWYPADLFTRAKIESILDWHHSNLRLGAGTFVYYTALAP  123

Query  469  AFGLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
              GL   P A   AEKVL+ SL  +ES WL+
Sbjct  124  FLGLRPRPEATKHAEKVLMQSLARIESVWLK  154



>emb|CDP09755.1| unnamed protein product [Coffea canephora]
Length=234

 Score =   196 bits (497),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 94/154 (61%), Positives = 122/154 (79%), Gaps = 2/154 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAV-VD  282
            M +KL+VDR+SQP RA+LIFCK N I+FEEV+I+++KG+  +PE+  INPM++VPA+ VD
Sbjct  1    MKLKLFVDRLSQPCRAILIFCKMNEIEFEEVRIELSKGEQLSPEFKEINPMQKVPAMKVD  60

Query  283  GDFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTA  459
              F+LFESHA L++LA A  GVADHWYPADL KRA++DSV DWHH+NLR G+AG VF++ 
Sbjct  61   ERFRLFESHAILRFLAGAFPGVADHWYPADLFKRAEIDSVLDWHHANLRHGSAGLVFHSK  120

Query  460  LAPAFGLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            LA   G P +  AAA+ EKVL ASL  +ES WL+
Sbjct  121  LARLSGRPLDLRAAADCEKVLSASLAKIESVWLK  154



>ref|XP_002967178.1| hypothetical protein SELMODRAFT_144252 [Selaginella moellendorffii]
 gb|EFJ31777.1| hypothetical protein SELMODRAFT_144252 [Selaginella moellendorffii]
Length=250

 Score =   196 bits (499),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 95/161 (59%), Positives = 118/161 (73%), Gaps = 4/161 (2%)
 Frame = +1

Query  82   PPERDREEMAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMK  261
            P +RD +   + LYVD MSQPSRA+LIFC+ N ID E   + +AKGQ RTPE+ AINPM 
Sbjct  6    PHKRDSK---LHLYVDFMSQPSRAILIFCRINNIDAEIHVVNVAKGQQRTPEFKAINPMG  62

Query  262  QVPAVVDGDFKLFESHAALKYLAAAN-GVADHWYPADLQKRAKVDSVCDWHHSNLRRGAA  438
            QVPA+VD  FKLFESHA L+YLAA    V DHWYP+DL +RA++DS+ DWHH+NLRRGAA
Sbjct  63   QVPAIVDHGFKLFESHAILRYLAATYPKVPDHWYPSDLSRRARIDSILDWHHANLRRGAA  122

Query  439  GYVFNTALAPAFGLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            G V    LAP  GL  +P  A+++EK+L +SL  +E  WLQ
Sbjct  123  GLVMALVLAPVLGLSKDPKLASDSEKLLRSSLSKIEDVWLQ  163



>ref|XP_002960542.1| hypothetical protein SELMODRAFT_74927 [Selaginella moellendorffii]
 gb|EFJ38081.1| hypothetical protein SELMODRAFT_74927 [Selaginella moellendorffii]
Length=248

 Score =   196 bits (498),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 95/161 (59%), Positives = 118/161 (73%), Gaps = 4/161 (2%)
 Frame = +1

Query  82   PPERDREEMAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMK  261
            P +RD +   + LYVD MSQPSRA+LIFC+ N ID E   + +AKGQ RTPE+ AINPM 
Sbjct  4    PHKRDSK---LHLYVDFMSQPSRAILIFCQINNIDAEIHVVNVAKGQQRTPEFKAINPMG  60

Query  262  QVPAVVDGDFKLFESHAALKYLAAAN-GVADHWYPADLQKRAKVDSVCDWHHSNLRRGAA  438
            QVPA+VD  FKLFESHA L+YLAA    V DHWYP+DL +RA++DS+ DWHH+NLRRGAA
Sbjct  61   QVPAIVDHGFKLFESHAILRYLAATYPKVPDHWYPSDLSRRARIDSILDWHHANLRRGAA  120

Query  439  GYVFNTALAPAFGLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            G V    LAP  GL  +P  A+++EK+L +SL  +E  WLQ
Sbjct  121  GLVMALVLAPVLGLSKDPRLASDSEKLLRSSLSKIEDVWLQ  161



>ref|NP_198938.1| glutathione S-transferase THETA 3 [Arabidopsis thaliana]
 sp|Q9FHE1.1|GSTT3_ARATH RecName: Full=Glutathione S-transferase T3; Short=AtGSTT3; AltName: 
Full=GST class-theta member 3; AltName: Full=Glutathione 
S-transferase 10C [Arabidopsis thaliana]
 dbj|BAB11098.1| glutathione transferase-like [Arabidopsis thaliana]
 gb|AED94655.1| glutathione S-transferase THETA 3 [Arabidopsis thaliana]
Length=590

 Score =   203 bits (517),  Expect = 2e-58, Method: Composition-based stats.
 Identities = 95/153 (62%), Positives = 116/153 (76%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M +K+Y DRMSQPSRA+LIFCK N I F+E+ I +A  Q  +PE+  INPM +VPA+VDG
Sbjct  1    MKLKVYADRMSQPSRAVLIFCKVNEIQFDEILIYLANRQQLSPEFKDINPMGKVPAIVDG  60

Query  286  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  462
              KL ESHA L YL++A   V DHWYP DL KRA++ SV DWHH+NLR GAAGYV N+ L
Sbjct  61   KLKLSESHAILIYLSSAYPSVVDHWYPTDLSKRARIHSVLDWHHTNLRPGAAGYVLNSVL  120

Query  463  APAFGLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
             PA GLP NP AAAEAE++L  SL TL++FWL+
Sbjct  121  GPALGLPLNPKAAAEAEQLLTKSLTTLDTFWLK  153



>ref|XP_006343999.1| PREDICTED: glutathione S-transferase T1-like isoform X2 [Solanum 
tuberosum]
Length=181

 Score =   191 bits (486),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 90/153 (59%), Positives = 109/153 (71%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M +KLYVDRMSQ  R ++IFCK NGIDFEEV I ++K Q  +PEY  INP++Q+PA++DG
Sbjct  1    MTLKLYVDRMSQACREVIIFCKLNGIDFEEVHIDLSKRQQLSPEYREINPIRQIPAIMDG  60

Query  286  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  462
             FKL ESHA L+YLA A   +ADHWYPADL KRAKV+SV DW  +   RG   YVF + L
Sbjct  61   RFKLSESHAILRYLACAFPRIADHWYPADLYKRAKVESVLDWQRTTFPRGPGSYVFYSVL  120

Query  463  APAFGLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
                G+P N  AAA  EK L+ASL  +ES WLQ
Sbjct  121  GTTVGMPLNTKAAARTEKNLIASLALIESVWLQ  153



>ref|XP_006343998.1| PREDICTED: glutathione S-transferase T1-like isoform X1 [Solanum 
tuberosum]
Length=250

 Score =   192 bits (488),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 90/153 (59%), Positives = 109/153 (71%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M +KLYVDRMSQ  R ++IFCK NGIDFEEV I ++K Q  +PEY  INP++Q+PA++DG
Sbjct  1    MTLKLYVDRMSQACREVIIFCKLNGIDFEEVHIDLSKRQQLSPEYREINPIRQIPAIMDG  60

Query  286  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  462
             FKL ESHA L+YLA A   +ADHWYPADL KRAKV+SV DW  +   RG   YVF + L
Sbjct  61   RFKLSESHAILRYLACAFPRIADHWYPADLYKRAKVESVLDWQRTTFPRGPGSYVFYSVL  120

Query  463  APAFGLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
                G+P N  AAA  EK L+ASL  +ES WLQ
Sbjct  121  GTTVGMPLNTKAAARTEKNLIASLALIESVWLQ  153



>ref|XP_001778018.1| predicted protein [Physcomitrella patens]
 gb|EDQ57127.1| predicted protein [Physcomitrella patens]
 gb|AFZ39142.1| theta class glutathione S-transferase [Physcomitrella patens]
Length=257

 Score =   191 bits (485),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 87/151 (58%), Positives = 111/151 (74%), Gaps = 1/151 (1%)
 Frame = +1

Query  112  VKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDGDF  291
            +KLY D MSQPSRA+L+FC+ N ID ++  I I KG H+TPE+ AINP+ +VP +VDG F
Sbjct  7    LKLYADLMSQPSRAVLLFCRVNNIDVDQQLINIQKGDHKTPEFKAINPLGKVPCIVDGRF  66

Query  292  KLFESHAALKYLAAAN-GVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALAP  468
            KL ESHA ++YLAA   GVADHWYP D+Q+R+K++SV DWHH NLRRG+   VF+  LAP
Sbjct  67   KLAESHAIMEYLAATRPGVADHWYPTDVQRRSKINSVLDWHHLNLRRGSMTLVFHKVLAP  126

Query  469  AFGLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
              G+  +P AAAE   +L  SL  LE+ WLQ
Sbjct  127  IVGVKADPRAAAEGLSILQQSLQVLETVWLQ  157



>gb|AFV96155.1| glutathion-S-transferase theta, partial [Brassica oleracea]
Length=200

 Score =   188 bits (477),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 89/143 (62%), Positives = 109/143 (76%), Gaps = 1/143 (1%)
 Frame = +1

Query  136  SQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDGDFKLFESHAA  315
            SQPSRA++IFCK NGI+F+EV I +AK Q  +PE+  INP+ +VP +VDG  KLFESHA 
Sbjct  1    SQPSRAVIIFCKVNGIEFDEVLIILAKRQQLSPEFKEINPLGKVPTIVDGRLKLFESHAI  60

Query  316  LKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALAPAFGLPCNP  492
            L YL++A   VADHWYP DL KRAK+ SV DWHH+NLR GAAGYV N+ LAP  G   + 
Sbjct  61   LIYLSSAFPSVADHWYPNDLSKRAKIHSVLDWHHTNLRPGAAGYVMNSVLAPFLGGSLDS  120

Query  493  HAAAEAEKVLLASLGTLESFWLQ  561
             AAAEAE++L  SL TLE+FWL+
Sbjct  121  KAAAEAEQILTKSLSTLETFWLK  143



>ref|XP_008794198.1| PREDICTED: glutathione S-transferase T1 isoform X2 [Phoenix dactylifera]
Length=232

 Score =   189 bits (479),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 91/152 (60%), Positives = 106/152 (70%), Gaps = 17/152 (11%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M +K+Y DR+SQPSRA++IFCK NGIDFEEV I + K QHR+PE+  INPM QVPA+VDG
Sbjct  1    MKLKVYADRLSQPSRAIVIFCKLNGIDFEEVPIDLTKRQHRSPEFKEINPMGQVPAIVDG  60

Query  286  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  465
             FKLFE                  YPADL  RAK+DSV DWHH NLRRGAA Y  N+ +A
Sbjct  61   RFKLFER-----------------YPADLFNRAKIDSVLDWHHLNLRRGAAFYALNSVIA  103

Query  466  PAFGLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            P FGLP N  AA EAEKVL +SL  +ES WL+
Sbjct  104  PVFGLPLNSQAANEAEKVLRSSLSKIESIWLK  135



>gb|KJB52088.1| hypothetical protein B456_008G246300 [Gossypium raimondii]
Length=232

 Score =   186 bits (472),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 93/152 (61%), Positives = 112/152 (74%), Gaps = 17/152 (11%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M +K+Y DRMSQPSRA++IFCK NGID+EE+++ I+KGQH TPE+A INPMKQ+PA+ DG
Sbjct  1    MKLKVYADRMSQPSRAVIIFCKVNGIDYEEIKVHISKGQHLTPEFAEINPMKQLPAIADG  60

Query  286  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  465
             FKLFE                  YPAD+ KR+K+ SV DWHHSNLRRGAA YVFNT +A
Sbjct  61   RFKLFER-----------------YPADVFKRSKIHSVLDWHHSNLRRGAAPYVFNTTIA  103

Query  466  PAFGLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            P  G P NP AAAEAE +L +SL  LESFWL+
Sbjct  104  PILGRPLNPQAAAEAEIILSSSLSKLESFWLK  135



>ref|XP_008651869.1| PREDICTED: LOW QUALITY PROTEIN: glutathione S-transferase T1-like 
[Zea mays]
Length=140

 Score =   182 bits (462),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 85/137 (62%), Positives = 104/137 (76%), Gaps = 1/137 (1%)
 Frame = +1

Query  112  VKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDGDF  291
            VK+Y DR SQPSRA++IFC+ N IDFEEV + + K QH TPE+  INPM QVPA+VDG F
Sbjct  4    VKVYADRRSQPSRAVIIFCRVNQIDFEEVTVDLFKSQHLTPEFKKINPMGQVPAIVDGRF  63

Query  292  KLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALAP  468
            KLFESHA L+YLA+   GVADHWYP+DL  RAK++S+ DWHHSNLRRGAA  V +TAL P
Sbjct  64   KLFESHAILRYLASVFPGVADHWYPSDLFTRAKIESILDWHHSNLRRGAATLVMHTALLP  123

Query  469  AFGLPCNPHAAAEAEKV  519
            +  L  +  A  +AE +
Sbjct  124  SLVLRQSXEAVKQAESL  140



>ref|XP_002961176.1| hypothetical protein SELMODRAFT_270213 [Selaginella moellendorffii]
 gb|EFJ38715.1| hypothetical protein SELMODRAFT_270213 [Selaginella moellendorffii]
Length=224

 Score =   185 bits (470),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 85/153 (56%), Positives = 111/153 (73%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            MA+ LY+D +SQPSRA+ IFC+ N I+ E   + + K +H+TPEY A+NPM QVPA+VD 
Sbjct  1    MALHLYIDLLSQPSRAIYIFCRVNNIEAEIHHLDLMKREHQTPEYKAVNPMGQVPAIVDN  60

Query  286  DFKLFESHAALKYLAAAN-GVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  462
             FKLFESHA L+YLA    GV+ +WYP+D  +RA++DSV DWHH NLRRGAAG  FN  L
Sbjct  61   GFKLFESHAILRYLATTKPGVSSNWYPSDPLRRARIDSVLDWHHGNLRRGAAGLFFNEVL  120

Query  463  APAFGLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            AP  G+P +    AE +K L AS+ T+E+ WL+
Sbjct  121  APYLGIPKDESKLAEFDKTLQASVDTIENVWLE  153



>ref|XP_002966830.1| hypothetical protein SELMODRAFT_144283 [Selaginella moellendorffii]
 gb|EFJ31429.1| hypothetical protein SELMODRAFT_144283 [Selaginella moellendorffii]
Length=224

 Score =   185 bits (470),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 85/153 (56%), Positives = 111/153 (73%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            MA+ LY+D +SQPSRA+ IFC+ N I+ E   + + KG+H+TPEY A+NPM QVPA+VD 
Sbjct  1    MALHLYIDLLSQPSRAIYIFCRVNNIEAEIHHLDLMKGEHQTPEYKAVNPMGQVPAIVDN  60

Query  286  DFKLFESHAALKYLAAAN-GVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  462
             FKLFESHA L+YLA    GV+ +WYP+D  + A++DSV DWHH NLRRGAAG  FN  L
Sbjct  61   GFKLFESHAILRYLATTKPGVSSNWYPSDPLRGARIDSVLDWHHGNLRRGAAGLFFNEVL  120

Query  463  APAFGLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            AP  G+P +    AE +K L AS+ T+E+ WL+
Sbjct  121  APYLGIPKDESKLAEFDKTLQASVDTIENVWLE  153



>ref|XP_002509787.1| glutathione-s-transferase theta, gst, putative [Ricinus communis]
 gb|EEF51174.1| glutathione-s-transferase theta, gst, putative [Ricinus communis]
Length=238

 Score =   185 bits (469),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 90/153 (59%), Positives = 110/153 (72%), Gaps = 2/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M +KLYV R+S+PSRAL+ FCK NGI+FEE++I + KGQH++PE+  I   +   +  + 
Sbjct  1    MELKLYVHRLSEPSRALIAFCKLNGIEFEEIEIDLVKGQHKSPEFKVITETEYHASKFEK  60

Query  286  DF-KLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTA  459
             + +    HA L YLA+A  GVADHWYPADLQKRAKV +V DWHHSNLRRG+  YV NT 
Sbjct  61   LYHRTMYCHAILGYLASAFPGVADHWYPADLQKRAKVHAVLDWHHSNLRRGSVMYVLNTK  120

Query  460  LAPAFGLPCNPHAAAEAEKVLLASLGTLESFWL  558
            L P  GLP NP AAAE EKVL  SL T+ES WL
Sbjct  121  LGPVLGLPVNPQAAAEGEKVLSCSLETIESVWL  153



>ref|XP_010676472.1| PREDICTED: glutathione S-transferase T1-like [Beta vulgaris subsp. 
vulgaris]
Length=239

 Score =   184 bits (468),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 84/152 (55%), Positives = 113/152 (74%), Gaps = 1/152 (1%)
 Frame = +1

Query  109  AVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDGD  288
             +K+Y DR SQP+RA+++FC  NGI+FEE  I++   +H +PE+  INP++++P +  GD
Sbjct  5    VLKIYGDRKSQPTRAVMLFCNLNGIEFEEHTIELFNQEHLSPEFQEINPVREIPVIFHGD  64

Query  289  FKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  465
             +LFESHA L YLA+    VA+HWYPAD +KRA V SV DWHH +LRRGA GY+ NT LA
Sbjct  65   LRLFESHAILIYLASVFPDVANHWYPADAKKRALVHSVLDWHHCHLRRGAMGYLLNTILA  124

Query  466  PAFGLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            PA GL  NP +AAE EK+L ++L  +ESFWL+
Sbjct  125  PARGLTMNPQSAAECEKILNSALWHMESFWLK  156



>tpg|DAA43810.1| TPA: hypothetical protein ZEAMMB73_384133 [Zea mays]
Length=130

 Score =   179 bits (453),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 98/124 (79%), Gaps = 1/124 (1%)
 Frame = +1

Query  112  VKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDGDF  291
            VK+Y DR SQPSRA++IFC+ N IDFEEV + + K QH TPE+  INPM QVPA+VDG F
Sbjct  4    VKVYADRRSQPSRAVIIFCRVNQIDFEEVTVDLFKSQHLTPEFKKINPMGQVPAIVDGRF  63

Query  292  KLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALAP  468
            KLFESHA L+YLA+   GVADHWYP+DL  RAK++S+ DWHHSNLRRGAA  V +TAL P
Sbjct  64   KLFESHAILRYLASVFPGVADHWYPSDLFTRAKIESILDWHHSNLRRGAATLVMHTALLP  123

Query  469  AFGL  480
            +  L
Sbjct  124  SLVL  127



>gb|KJB25825.1| hypothetical protein B456_004G211100 [Gossypium raimondii]
Length=232

 Score =   180 bits (456),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 85/152 (56%), Positives = 107/152 (70%), Gaps = 17/152 (11%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M +++Y DRMSQPSRA++IFCK NGID+ E+++ I+K +H TPE+A INPMKQ+PA+VDG
Sbjct  1    MKLEVYADRMSQPSRAVIIFCKVNGIDYTELKVDISKREHLTPEFAEINPMKQLPAIVDG  60

Query  286  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  465
             FKLFE                  YPA+L KR+K+ SV  WHHSNLRR A  YV NT + 
Sbjct  61   KFKLFER-----------------YPANLFKRSKIHSVLYWHHSNLRRAADTYVTNTTIL  103

Query  466  PAFGLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            PA G P N  AAAEAEK+L +SL  +ESFWL+
Sbjct  104  PALGHPSNQQAAAEAEKLLFSSLSKIESFWLK  135



>gb|KJB52086.1| hypothetical protein B456_008G246300 [Gossypium raimondii]
Length=214

 Score =   175 bits (444),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 79/114 (69%), Positives = 95/114 (83%), Gaps = 1/114 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M +K+Y DRMSQPSRA++IFCK NGID+EE+++ I+KGQH TPE+A INPMKQ+PA+ DG
Sbjct  1    MKLKVYADRMSQPSRAVIIFCKVNGIDYEEIKVHISKGQHLTPEFAEINPMKQLPAIADG  60

Query  286  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGY  444
             FKLFESHA L YLA A  GVAD WYPAD+ KR+K+ SV DWHHSNLRRGA  +
Sbjct  61   RFKLFESHAILIYLACAFPGVADQWYPADVFKRSKIHSVLDWHHSNLRRGAESF  114



>gb|ACI16511.1| glutathione S-transferase [Cucumis sativus]
Length=184

 Score =   174 bits (440),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 82/126 (65%), Positives = 98/126 (78%), Gaps = 1/126 (1%)
 Frame = +1

Query  187  FEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDGDFKLFESHAALKYLAAA-NGVADHWYP  363
            FEEV++ ++K +H TPE+  INPM +VP +VDG FKLFESHA L Y++ A  GVADHWYP
Sbjct  1    FEEVKVTLSKFEHLTPEFKEINPMGKVPVIVDGRFKLFESHAILIYISCAFPGVADHWYP  60

Query  364  ADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALAPAFGLPCNPHAAAEAEKVLLASLGTL  543
            ADL +RAK+ SV DWHHSNLR GAA  +FNT LAP FG P NP AAAEAEK+L  SL  +
Sbjct  61   ADLFRRAKIHSVLDWHHSNLRSGAAPLIFNTVLAPLFGRPLNPQAAAEAEKLLSKSLSKI  120

Query  544  ESFWLQ  561
            ESFWL+
Sbjct  121  ESFWLK  126



>emb|CDP09753.1| unnamed protein product [Coffea canephora]
Length=131

 Score =   172 bits (435),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 80/124 (65%), Positives = 99/124 (80%), Gaps = 2/124 (2%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAV-VD  282
            M +KL+VDR+SQP RA+LIFCK NGI+FEEV I   K ++ +PEY  INPM+ VPA+ VD
Sbjct  1    MKLKLFVDRLSQPCRAILIFCKLNGIEFEEVTIDFCKRENISPEYQKINPMQLVPAIEVD  60

Query  283  GDFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTA  459
            G+FKLFESHA L++LA+A  GVADHWYPADL +RA++DSV DW HSNLR G  G VFN+ 
Sbjct  61   GEFKLFESHAILRFLASAFPGVADHWYPADLFERAQIDSVLDWRHSNLRHGTTGLVFNST  120

Query  460  LAPA  471
            + PA
Sbjct  121  VGPA  124



>ref|XP_003630526.1| Glutathione transferase [Medicago truncatula]
Length=126

 Score =   169 bits (427),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 80/121 (66%), Positives = 97/121 (80%), Gaps = 2/121 (2%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M +K+Y DRMSQPSRA+LIFCK NGIDFEE+ I+++K QH +PE+ AINP K+VPA+VDG
Sbjct  1    MKLKVYADRMSQPSRAILIFCKVNGIDFEEIHIELSKRQHLSPEFQAINPFKKVPAIVDG  60

Query  286  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGA-AGYVFNTA  459
             FKLFESHA L YLA+A  GVA HWYPAD+ +RA++ +V DWHH NLRRGA A Y  N  
Sbjct  61   RFKLFESHAILIYLASAFPGVAHHWYPADVSRRARIQAVLDWHHLNLRRGAGALYCRNNP  120

Query  460  L  462
            L
Sbjct  121  L  121



>ref|XP_006584714.1| PREDICTED: glutathione S-transferase T2-like isoform X2 [Glycine 
max]
 gb|KHN16830.1| Glutathione S-transferase T2 [Glycine soja]
Length=234

 Score =   172 bits (435),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 81/149 (54%), Positives = 105/149 (70%), Gaps = 17/149 (11%)
 Frame = +1

Query  112  VKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDGDF  291
            +K+Y D+MSQPSRA+LIFC+ NGIDFEE+++ I+K  H +PE+  INP+++VPA+V G F
Sbjct  5    LKVYADQMSQPSRAVLIFCRFNGIDFEEIKVDISKRHHLSPEFREINPLQKVPAIVHGSF  64

Query  292  KLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALAPA  471
             L E                  YP++L +RAK++SV DWHHSNL+ GAA YV NT L PA
Sbjct  65   NLSER-----------------YPSNLFRRAKINSVMDWHHSNLQHGAANYVINTVLGPA  107

Query  472  FGLPCNPHAAAEAEKVLLASLGTLESFWL  558
             G P +P AAAEAEKVLL+SL  LE+ WL
Sbjct  108  TGRPLSPKAAAEAEKVLLSSLSKLENIWL  136



>gb|KCW77543.1| hypothetical protein EUGRSUZ_D01861 [Eucalyptus grandis]
Length=212

 Score =   168 bits (425),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 82/152 (54%), Positives = 96/152 (63%), Gaps = 35/152 (23%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M +K+Y DRMSQPSRA++IFCK NGIDFEEV+I +AK QHR+PE+               
Sbjct  1    MTLKVYADRMSQPSRAVIIFCKVNGIDFEEVKIDLAKRQHRSPEF---------------  45

Query  286  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  465
                                 DHWYPADL +RAK+ S  DWHHSNLRRGAA YV NT LA
Sbjct  46   --------------------KDHWYPADLSRRAKIHSALDWHHSNLRRGAAAYVLNTTLA  85

Query  466  PAFGLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            PA GLP NP AAAE EK+L +SL  +ES WL+
Sbjct  86   PALGLPLNPAAAAEGEKLLSSSLLKIESIWLK  117



>gb|KJB52087.1| hypothetical protein B456_008G246300 [Gossypium raimondii]
Length=225

 Score =   166 bits (420),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 75/107 (70%), Positives = 90/107 (84%), Gaps = 1/107 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M +K+Y DRMSQPSRA++IFCK NGID+EE+++ I+KGQH TPE+A INPMKQ+PA+ DG
Sbjct  1    MKLKVYADRMSQPSRAVIIFCKVNGIDYEEIKVHISKGQHLTPEFAEINPMKQLPAIADG  60

Query  286  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNL  423
             FKLFESHA L YLA A  GVAD WYPAD+ KR+K+ SV DWHHSNL
Sbjct  61   RFKLFESHAILIYLACAFPGVADQWYPADVFKRSKIHSVLDWHHSNL  107



>ref|XP_002960536.1| hypothetical protein SELMODRAFT_402877 [Selaginella moellendorffii]
 gb|EFJ38075.1| hypothetical protein SELMODRAFT_402877 [Selaginella moellendorffii]
Length=239

 Score =   166 bits (419),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 81/155 (52%), Positives = 104/155 (67%), Gaps = 8/155 (5%)
 Frame = +1

Query  118  LYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDGDFKL  297
            LYV+ +SQPSRA++IFCK N I+ E   + I KG+H+T E+ AINPM QVPA+V+  FKL
Sbjct  10   LYVNIISQPSRAIIIFCKLNNIEAEVHHLDILKGEHKTTEFKAINPMGQVPAIVENGFKL  69

Query  298  FE-------SHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFN  453
            FE       SHA LKYLA    GV D+WYP+D Q+RA++DS+ DWHH NLRRGA G    
Sbjct  70   FERLTSKIRSHAILKYLAGTCPGVPDNWYPSDPQQRAQIDSILDWHHGNLRRGATGLFMA  129

Query  454  TALAPAFGLPCNPHAAAEAEKVLLASLGTLESFWL  558
              + P  G P +  A A+AEK L ++L  +E  WL
Sbjct  130  EVIFPMNGAPKDTKAIADAEKTLQSALSNIEDIWL  164



>ref|XP_002967183.1| hypothetical protein SELMODRAFT_407994 [Selaginella moellendorffii]
 gb|EFJ31782.1| hypothetical protein SELMODRAFT_407994 [Selaginella moellendorffii]
Length=239

 Score =   166 bits (419),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 81/155 (52%), Positives = 104/155 (67%), Gaps = 8/155 (5%)
 Frame = +1

Query  118  LYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDGDFKL  297
            LYV+ +SQPSRA++IFCK N I+ E   + I KG+H+T E+ AINPM QVPA+V+  FKL
Sbjct  10   LYVNIISQPSRAIIIFCKLNNIEAEVHHLDILKGEHKTTEFKAINPMGQVPAIVENGFKL  69

Query  298  FE-------SHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFN  453
            FE       SHA LKYLA    GV D+WYP+D Q+RA++DS+ DWHH NLRRGA G    
Sbjct  70   FERLTSRLCSHAILKYLAGTCPGVPDNWYPSDPQQRAQIDSILDWHHGNLRRGATGLFLA  129

Query  454  TALAPAFGLPCNPHAAAEAEKVLLASLGTLESFWL  558
              + P  G P +  A A+AEK L ++L  +E  WL
Sbjct  130  EVIFPMNGAPKDTKAIADAEKTLQSALSNIEDIWL  164



>gb|KJB25824.1| hypothetical protein B456_004G211100 [Gossypium raimondii]
Length=229

 Score =   162 bits (411),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 88/153 (58%), Positives = 110/153 (72%), Gaps = 22/153 (14%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M +++Y DRMSQPSRA++IFCK NGID+ E+++ I+K +H TPE+A INPMKQ+PA+VDG
Sbjct  1    MKLEVYADRMSQPSRAVIIFCKVNGIDYTELKVDISKREHLTPEFAEINPMKQLPAIVDG  60

Query  286  DFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  462
             FKLFESH+ L YLA A  GVADHWYPA+L KR+K+ SV  WHHSNLRR           
Sbjct  61   KFKLFESHSILIYLACAFPGVADHWYPANLFKRSKIHSVLYWHHSNLRRA----------  110

Query  463  APAFGLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
                       AAAEAEK+L +SL  +ESFWL+
Sbjct  111  -----------AAAEAEKLLFSSLSKIESFWLK  132



>ref|XP_009774395.1| PREDICTED: glutathione S-transferase T1-like, partial [Nicotiana 
sylvestris]
Length=172

 Score =   159 bits (403),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 85/154 (55%), Positives = 102/154 (66%), Gaps = 24/154 (16%)
 Frame = +1

Query  142  PSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDGDFKLFESHAALK  321
            PSRALLIFCK NGIDFEEV I ++K QH +PE+  +NP+KQVPA++DG FKLFESHA L+
Sbjct  1    PSRALLIFCKLNGIDFEEVYINLSKRQHLSPEFKEVNPLKQVPAIMDGRFKLFESHAILR  60

Query  322  YLAAA-NGVADHWYPADLQKRAKVDSVCDWH-------------HSNLRRGAAGYVFNTA  459
            YLA A  GVADH +           + CD++                +   +A YVF+T 
Sbjct  61   YLACAFPGVADHCF----------QTFCDYYLLICHTFSCFLQCSEAVLMFSAVYVFSTV  110

Query  460  LAPAFGLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            LAPAFGLP N  AAAEAEKVLLASL  +ES WLQ
Sbjct  111  LAPAFGLPLNQQAAAEAEKVLLASLAKIESVWLQ  144



>ref|XP_008678005.1| PREDICTED: glutathione S-transferase T1-like [Zea mays]
Length=237

 Score =   156 bits (394),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 74/150 (49%), Positives = 92/150 (61%), Gaps = 17/150 (11%)
 Frame = +1

Query  112  VKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDGDF  291
            +K+Y  R S PSRA++IFC+ N IDFEEV + + K +HRTPE+  INPM QVP +VDG F
Sbjct  4    IKVYAHRWSSPSRAVIIFCRVNKIDFEEVTVDLFKSRHRTPEFKKINPMAQVPVIVDGRF  63

Query  292  KLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALAPA  471
            KLFE                  YP DL  RAK++S+ DWHHSNL  GA  +V+ TALAP 
Sbjct  64   KLFER-----------------YPTDLFSRAKIESILDWHHSNLHFGAGTFVYYTALAPF  106

Query  472  FGLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
             G    P     AEK L+ SL  +ES WL+
Sbjct  107  LGFRPRPETTKHAEKSLMQSLARIESVWLK  136



>ref|XP_006663010.1| PREDICTED: glutathione S-transferase T1-like [Oryza brachyantha]
Length=194

 Score =   148 bits (374),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 69/103 (67%), Positives = 81/103 (79%), Gaps = 1/103 (1%)
 Frame = +1

Query  256  MKQVPAVVDGDFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRG  432
            M QVPA+VDG F+LFESHA L+YLA    GVADHWYPADL  RAK+++V DWHH+NLRRG
Sbjct  1    MGQVPAIVDGRFRLFESHAILRYLATVFPGVADHWYPADLFTRAKIEAVLDWHHTNLRRG  60

Query  433  AAGYVFNTALAPAFGLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            AA YV NT LAP+ GLP +P AA EAEK+L  SL  +ES WL+
Sbjct  61   AATYVLNTVLAPSLGLPSSPEAAKEAEKLLFRSLRLIESMWLK  103



>ref|XP_008794199.1| PREDICTED: glutathione S-transferase T1 isoform X3 [Phoenix dactylifera]
Length=200

 Score =   147 bits (371),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 71/103 (69%), Positives = 80/103 (78%), Gaps = 1/103 (1%)
 Frame = +1

Query  256  MKQVPAVVDGDFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRG  432
            M QVPA+VDG FKLFESHA L+YLA A  GV+DHWYPADL  RAK+DSV DWHH NLRRG
Sbjct  1    MGQVPAIVDGRFKLFESHAILRYLACAFPGVSDHWYPADLFNRAKIDSVLDWHHLNLRRG  60

Query  433  AAGYVFNTALAPAFGLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            AA Y  N+ +AP FGLP N  AA EAEKVL +SL  +ES WL+
Sbjct  61   AAFYALNSVIAPVFGLPLNSQAANEAEKVLRSSLSKIESIWLK  103



>gb|AEB91980.1| glutathione S-transferase theta 1 [Locusta migratoria]
Length=231

 Score =   144 bits (363),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 67/153 (44%), Positives = 96/153 (63%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M++K+Y D +SQPSRA+++F  AN I +E  +I +  G+  + E+A +NPMK+VP + DG
Sbjct  1    MSLKVYYDLLSQPSRAVVLFLLANDIPYEAREINVLHGEQFSEEFAKLNPMKKVPVIKDG  60

Query  286  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  465
            DF L ES A L+YL     V DHWYPAD +K+A+VD   +W H+N R   A Y  N  + 
Sbjct  61   DFTLTESVAILRYLCRERDVPDHWYPADSKKQARVDEYLEWQHTNTRSNCALYFLNKFML  120

Query  466  PAF-GLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            PA  G   NP   A  E+ ++A+L  +E  WL+
Sbjct  121  PAIKGTQPNPETVARRERKMVATLNEVEEIWLR  153



>ref|XP_002463456.1| hypothetical protein SORBIDRAFT_01g000230 [Sorghum bicolor]
 gb|EER90454.1| hypothetical protein SORBIDRAFT_01g000230 [Sorghum bicolor]
Length=200

 Score =   141 bits (356),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 66/103 (64%), Positives = 81/103 (79%), Gaps = 1/103 (1%)
 Frame = +1

Query  256  MKQVPAVVDGDFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRG  432
            M QVPA+VDG FKLFESHA L+YLA+   GV+DHWYPADL  RAK++S+ DWHH+NLRRG
Sbjct  1    MGQVPAIVDGRFKLFESHAILRYLASVFPGVSDHWYPADLFTRAKIESILDWHHTNLRRG  60

Query  433  AAGYVFNTALAPAFGLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            AA  V +TALAP  GL  +P A  +AEK+L+ SLG +ES WL+
Sbjct  61   AATLVQHTALAPFLGLTTSPEAVKQAEKLLMQSLGVIESVWLK  103



>ref|XP_011072496.1| PREDICTED: glutathione S-transferase T1-like [Sesamum indicum]
Length=189

 Score =   140 bits (353),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 66/103 (64%), Positives = 81/103 (79%), Gaps = 1/103 (1%)
 Frame = +1

Query  256  MKQVPAVVDGDFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRG  432
            M++VPA++  DFKLFESHA L YLA+A  GVADHWYPAD+ KRAK+ SV DWHHSNLRRG
Sbjct  1    MRKVPAIMHADFKLFESHAILVYLASAFPGVADHWYPADVHKRAKIHSVLDWHHSNLRRG  60

Query  433  AAGYVFNTALAPAFGLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            +  Y+FNT +AP FGLP +  AA   EK+L ASL  +ES+WL+
Sbjct  61   SVEYLFNTLVAPEFGLPLDQKAADVGEKLLSASLAMIESYWLE  103



>ref|XP_005848771.1| hypothetical protein CHLNCDRAFT_57549 [Chlorella variabilis]
 gb|EFN56669.1| hypothetical protein CHLNCDRAFT_57549 [Chlorella variabilis]
Length=243

 Score =   142 bits (357),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 70/150 (47%), Positives = 95/150 (63%), Gaps = 1/150 (1%)
 Frame = +1

Query  115  KLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDGDFK  294
            KL+VDR+SQPSR  LIFC+  GI FEE  + + K +   PE+ A+NP+ +VPA+ DG F 
Sbjct  7    KLFVDRLSQPSRTCLIFCRVAGIPFEEKVVTLGKKEQLRPEFLAVNPLGKVPALQDGAFC  66

Query  295  LFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALAPAF  474
            L ES A LKYL  +   ADHWYP DL+ RA++D+V  WH S+LR G+   V+N A++   
Sbjct  67   LPESSAILKYLCGSRRAADHWYPRDLRARAQLDAVMAWHASSLRIGSMLVVWNRAISLNL  126

Query  475  GLPCN-PHAAAEAEKVLLASLGTLESFWLQ  561
            G P N P   +     L+ +L  LE  WL+
Sbjct  127  GFPSNEPLVTSYGLPTLVTALEHLERVWLR  156



>ref|XP_003485831.1| PREDICTED: glutathione S-transferase theta-1-like [Bombus impatiens]
Length=239

 Score =   141 bits (355),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 67/153 (44%), Positives = 92/153 (60%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M++KLY D +SQPSRAL IF K   I FE   + +AKG+H  PEY  I+P ++VPA+   
Sbjct  1    MSLKLYYDLLSQPSRALYIFLKVCDIPFEGKFVNLAKGEHLNPEYQRIHPFQKVPAIEHN  60

Query  286  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  465
             F + ES A L+YL     +ADHWYP DL+++ KVD   +W H N R   A Y F   + 
Sbjct  61   GFNMMESVAILRYLCRKFKIADHWYPEDLKRQLKVDEYLEWQHLNTRLNCASYFFMKYMK  120

Query  466  PAF-GLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            P   G   NP +  + EK ++ +L  LE+FWL+
Sbjct  121  PLLTGKSMNPESLTQYEKRMIQTLDDLENFWLK  153



>ref|XP_010909099.1| PREDICTED: glutathione S-transferase T1 isoform X1 [Elaeis guineensis]
Length=200

 Score =   139 bits (349),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 68/103 (66%), Positives = 77/103 (75%), Gaps = 1/103 (1%)
 Frame = +1

Query  256  MKQVPAVVDGDFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRG  432
            M +VPA+VDG FKLFESHA L+YLA A  GV+DHWYPADL  RAK+DS+ DWHHSNLR G
Sbjct  1    MGKVPAIVDGRFKLFESHAILRYLACAFPGVSDHWYPADLFSRAKIDSILDWHHSNLRYG  60

Query  433  AAGYVFNTALAPAFGLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            A   V N+ LAP FG P N  AA EAEKVL  SL  +ES WL+
Sbjct  61   AVSLVQNSVLAPIFGRPLNSQAANEAEKVLNLSLSKIESVWLK  103



>ref|XP_003397510.1| PREDICTED: glutathione S-transferase theta-1-like [Bombus terrestris]
Length=239

 Score =   139 bits (351),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 68/153 (44%), Positives = 91/153 (59%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M++KLY D +SQPSRAL IF K   I FE   + +AKG+H  PEY  I+P ++VPA+   
Sbjct  1    MSLKLYYDLLSQPSRALYIFLKVCDIPFEGKFVNLAKGEHLNPEYQRIHPFQKVPAIEHN  60

Query  286  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  465
             F + ES A L+YL     VADHWYP DL+ + KVD   +W H N R   A Y F   + 
Sbjct  61   GFNMMESVAILRYLCREFKVADHWYPQDLKLQLKVDEYLEWQHLNTRLNCASYFFMKYMK  120

Query  466  PAF-GLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            P   G   NP +  + EK ++ +L  LE+FWL+
Sbjct  121  PLLTGKSMNPESLMQYEKRMMQTLDDLENFWLK  153



>ref|XP_009769998.1| PREDICTED: glutathione S-transferase T1-like [Nicotiana sylvestris]
Length=85

 Score =   134 bits (337),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 62/85 (73%), Positives = 72/85 (85%), Gaps = 1/85 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M +KLYVDRMSQPSRALLIFCK NGIDFEEV I ++K QH +PE+  +NP+KQVPA++DG
Sbjct  1    MTLKLYVDRMSQPSRALLIFCKLNGIDFEEVYINLSKRQHLSPEFKEVNPLKQVPAIMDG  60

Query  286  DFKLFESHAALKYLAAA-NGVADHW  357
             FKLFESHA L+YLA A  GVADHW
Sbjct  61   RFKLFESHAILRYLACAFPGVADHW  85



>ref|XP_001767888.1| predicted protein [Physcomitrella patens]
 gb|EDQ67402.1| predicted protein, partial [Physcomitrella patens]
Length=224

 Score =   138 bits (347),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 71/154 (46%), Positives = 90/154 (58%), Gaps = 9/154 (6%)
 Frame = +1

Query  112  VKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDGDF  291
            +KLYVD  SQP+RA+ IFC+ N I+  E+ + + K ++RTPE+  INPM  VP + D  F
Sbjct  1    LKLYVDLGSQPARAVTIFCRVNKIEAHEIGVDLRKLENRTPEFRKINPMGLVPCIDDHGF  60

Query  292  KLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA--  465
            KL ESHA ++YLA  + VADHWYP D QKRA VD+  DWHH NLR+  +  V N  L   
Sbjct  61   KLHESHAIMRYLATTHNVADHWYPKDPQKRALVDAALDWHHLNLRKYGSQLVINRVLVKV  120

Query  466  -------PAFGLPCNPHAAAEAEKVLLASLGTLE  546
                   P  G       A +A K L   L  LE
Sbjct  121  PAHKNFFPNLGEETRKSLADDASKTLPQILDALE  154



>gb|AFZ39143.1| theta class glutathione S-transferase [Physcomitrella patens]
Length=251

 Score =   139 bits (349),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 72/158 (46%), Positives = 91/158 (58%), Gaps = 9/158 (6%)
 Frame = +1

Query  100  EEMAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVV  279
            E   +KLYVD  SQP+RA+ IFC+ N I+  E+ + + K ++RTPE+  INPM  VP + 
Sbjct  8    ETGGLKLYVDLGSQPARAVTIFCRVNKIEAHEIGVDLRKLENRTPEFRKINPMGLVPCID  67

Query  280  DGDFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTA  459
            D  FKL ESHA ++YLA  + VADHWYP D QKRA VD+  DWHH NLR+  +  V N  
Sbjct  68   DHGFKLHESHAIMRYLATTHNVADHWYPKDPQKRALVDAALDWHHLNLRKYGSQLVINRV  127

Query  460  LA---------PAFGLPCNPHAAAEAEKVLLASLGTLE  546
            L          P  G       A +A K L   L  LE
Sbjct  128  LVKVPAHKNFFPNLGEETRKSLADDASKTLPQILDALE  165



>emb|CDW81275.1| glutathione s-transferase theta-1 [Stylonychia lemnae]
Length=238

 Score =   138 bits (347),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 61/151 (40%), Positives = 90/151 (60%), Gaps = 1/151 (1%)
 Frame = +1

Query  112  VKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDGDF  291
            + LY D  SQP+RA  +F K N + FE  Q+++ K +  +PE+  INP  +VPA+ DGD 
Sbjct  7    ITLYGDYASQPTRACYVFLKYNKVPFEFKQVRVTKLEQYSPEFKKINPNAKVPALTDGDI  66

Query  292  KLFESHAALKYLAAANGVADHWYP-ADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALAP  468
             +FESH  L+YL  +  + DHWYP  D ++RAK+D   DWHH+ +R GA GY+F   ++ 
Sbjct  67   SMFESHTILRYLHESRKLPDHWYPRTDFRERAKIDEYLDWHHNGIRLGAGGYIFRKYMSS  126

Query  469  AFGLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
              G P    +  E+   L  S   +E +WL+
Sbjct  127  LTGKPAPKESINESLMNLKKSFKLMEQYWLK  157



>ref|XP_003727085.1| PREDICTED: glutathione S-transferase theta-1-like isoform 2 [Strongylocentrotus 
purpuratus]
Length=224

 Score =   136 bits (342),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 67/153 (44%), Positives = 95/153 (62%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M+VK++ D MSQP+R++L+F +AN I +    I + K +H++ EYAA+NPMK++PA+ DG
Sbjct  1    MSVKIFYDLMSQPARSVLMFARANKIPYTPCPIAMRKSEHQSEEYAAVNPMKKIPAMQDG  60

Query  286  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  465
            +FKL ES A +KYL A +   DHWYP+DLQ RAKVD    W H N R   A       + 
Sbjct  61   EFKLTESIAIVKYLQAKHACPDHWYPSDLQTRAKVDEYLAWQHMNTRINVAKVFLKEVIF  120

Query  466  PAF-GLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            P   G P +P A A   + +  +L  LE  +L+
Sbjct  121  PRMTGTPADPAALAPDIQRIEETLDNLEKHFLK  153



>ref|XP_002157119.2| PREDICTED: glutathione S-transferase T1-like [Hydra vulgaris]
Length=222

 Score =   135 bits (341),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 68/153 (44%), Positives = 92/153 (60%), Gaps = 3/153 (2%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M++K++ D MSQPSR++L+F K   I +  V ++IAKG  RT EY  I+P ++VPA+ DG
Sbjct  1    MSLKIFYDAMSQPSRSVLLFLKCTKIPYVPVLVEIAKGGTRTAEYKLISPSQKVPAMQDG  60

Query  286  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  465
            DF L ES A LKYL     V  HWYP +  +R+KVD    WHH NLR GA+G VF +   
Sbjct  61   DFLLMESSAILKYLCETRDVDSHWYPKNQMERSKVDEYLAWHHLNLRSGASGIVFKSIFK  120

Query  466  PAF-GLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            P   G P  P       K+   SL   +S++L+
Sbjct  121  PMLTGQP--PSDVTSELKLFQKSLEMFDSYFLK  151



>ref|XP_005524538.1| PREDICTED: glutathione S-transferase theta-1-like [Pseudopodoces 
humilis]
Length=244

 Score =   136 bits (342),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 68/153 (44%), Positives = 91/153 (59%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M ++LY+D +SQP RAL IF +AN I FE  ++Q++KGQH+T E+  +N + +VPA+ DG
Sbjct  1    MGLELYLDLLSQPCRALYIFARANNIPFEFKRVQLSKGQHKTEEFQKVNVLMKVPALRDG  60

Query  286  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  465
             F L ES A L YL       DHWYP+DLQKRA+VD    W H+N+R  A+      AL 
Sbjct  61   SFTLAESIAILLYLVRKFKTPDHWYPSDLQKRARVDEYLSWQHANIRAKASKLFITKALL  120

Query  466  PAF-GLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            P   G P  P     A + L  +L   E  +LQ
Sbjct  121  PLLTGQPLPPEKLESATEELNVALKQFEEKFLQ  153



>gb|EWS75951.1| glutathione S-transferase, amine-terminal domain protein [Tetrahymena 
thermophila SB210]
Length=229

 Score =   135 bits (340),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 65/155 (42%), Positives = 96/155 (62%), Gaps = 4/155 (3%)
 Frame = +1

Query  100  EEMAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVV  279
            ++  + LY+D MSQPSR + IFC  N I  +  +++I KGQ R+ EY  INP  +VP + 
Sbjct  4    QQQTLSLYMDWMSQPSRCVAIFCMINKIPVDISEVKILKGQLRSQEYKRINPNMRVPTIK  63

Query  280  DGDFKLFESHAALKYLAA--ANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFN  453
            DG F L+ESHA LKYL A  A  + +HWYP D+++RA VD   DWHH+N+ R A  Y+FN
Sbjct  64   DGKFVLYESHAILKYLIASRAQYIPEHWYPKDIKERALVDQYLDWHHTNI-RNAGMYIFN  122

Query  454  TALAPAFGLPCNPHAAAEAEKVLLASLGTLESFWL  558
              + P+ G+    +      K+ + SL  +++ +L
Sbjct  123  YFVLPSLGIQSKQNKET-IYKLFIQSLKMIDTIFL  156



>ref|XP_010573725.1| PREDICTED: glutathione S-transferase theta-1-like [Haliaeetus 
leucocephalus]
Length=244

 Score =   135 bits (339),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 67/153 (44%), Positives = 90/153 (59%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M ++LY+D +SQP RAL IF ++NGI FE  Q+++ KGQHRT E+  +N + +VPA+ DG
Sbjct  1    MGLELYLDLLSQPCRALYIFARSNGIPFEFKQVELMKGQHRTEEFRKVNVLMKVPALRDG  60

Query  286  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLR-RGAAGYVFNTAL  462
             F L ES A L YLA      DHWYP+DLQKRA+VD    W H N+R +G+  ++    L
Sbjct  61   SFTLAESIAILLYLARKFKTPDHWYPSDLQKRARVDEYLSWQHVNIRGKGSKLFLMKVLL  120

Query  463  APAFGLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
                G P  P       + L   L   E  +LQ
Sbjct  121  PLLTGQPLPPEKLESVTEELNVVLKQFEEKFLQ  153



>emb|CDP22238.1| unnamed protein product [Coffea canephora]
Length=86

 Score =   129 bits (325),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 75/86 (87%), Gaps = 2/86 (2%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAV-VD  282
            M +K++ DR SQPSRA+LI CKANGI+FEEVQIQ+AKG+H++PEY AINPMKQVPA+ VD
Sbjct  1    MKLKVFADRGSQPSRAVLILCKANGIEFEEVQIQLAKGEHKSPEYEAINPMKQVPAIEVD  60

Query  283  GDFKLFESHAALKYLAAA-NGVADHW  357
            G F+LFESHA L++LA A  G+A+HW
Sbjct  61   GKFRLFESHAILRFLATAFPGIAEHW  86



>gb|ELK15601.1| Glutathione S-transferase theta-1 [Pteropus alecto]
Length=226

 Score =   134 bits (336),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 69/153 (45%), Positives = 92/153 (60%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M ++LY+D +SQP RA+ IF K NGI FE   +++ KGQH +  +A +NP+K+VPA+ DG
Sbjct  1    MGLELYLDLLSQPCRAVYIFAKKNGIPFELRTVELLKGQHLSNAFAQVNPLKKVPALKDG  60

Query  286  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  465
            DF L ES A L YL     V DHWYP DLQ RA+VD    W H+ LRR     +++ A+ 
Sbjct  61   DFILTESVAILLYLTRKYKVPDHWYPQDLQARARVDEYLAWQHTTLRRNCLRALWHKAMF  120

Query  466  PAF-GLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
              F G P +P   A     L  +L  LE  +LQ
Sbjct  121  SVFLGEPVSPEMLAATLAELDVTLKILEDKFLQ  153



>ref|XP_006908737.1| PREDICTED: glutathione S-transferase theta-1-like [Pteropus alecto]
Length=240

 Score =   134 bits (336),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 69/153 (45%), Positives = 92/153 (60%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M ++LY+D +SQP RA+ IF K NGI FE   +++ KGQH +  +A +NP+K+VPA+ DG
Sbjct  1    MGLELYLDLLSQPCRAVYIFAKKNGIPFELRTVELLKGQHLSNAFAQVNPLKKVPALKDG  60

Query  286  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  465
            DF L ES A L YL     V DHWYP DLQ RA+VD    W H+ LRR     +++ A+ 
Sbjct  61   DFILTESVAILLYLTRKYKVPDHWYPQDLQARARVDEYLAWQHTTLRRNCLRALWHKAMF  120

Query  466  PAF-GLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
              F G P +P   A     L  +L  LE  +LQ
Sbjct  121  SVFLGEPVSPEMLAATLAELDVTLKILEDKFLQ  153



>ref|XP_004346352.1| glutathione S-transferase domain-containing protein [Capsaspora 
owczarzaki ATCC 30864]
 gb|KJE95201.1| glutathione S-transferase domain-containing protein [Capsaspora 
owczarzaki ATCC 30864]
Length=231

 Score =   133 bits (334),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 66/151 (44%), Positives = 89/151 (59%), Gaps = 1/151 (1%)
 Frame = +1

Query  109  AVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDGD  288
             + LY D MSQPSRA+LI  +AN + F    I + KG    PE+  INP K++P + D  
Sbjct  4    GLSLYFDAMSQPSRAVLILLRANNLPFTPKIINVVKGDQYKPEFKKINPNKKIPVIDDNG  63

Query  289  FKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALAP  468
            F LFESHA L+YL     + DHWYP D QKRA VD   DWHH+   R AA +     +AP
Sbjct  64   FVLFESHAILRYLCNKYNLPDHWYPKDPQKRALVDQYLDWHHT-YTRTAAHHFREKYMAP  122

Query  469  AFGLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
             FG+  +  ++AE+ K    +L  L++ +LQ
Sbjct  123  RFGIQIDEKSSAESFKTFQFALKQLDTNFLQ  153



>ref|XP_010396446.1| PREDICTED: glutathione S-transferase theta-1-like [Corvus cornix 
cornix]
Length=244

 Score =   133 bits (334),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 66/153 (43%), Positives = 89/153 (58%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M ++LY+D +SQP RAL IF ++N I FE  ++Q+AKGQH+T E+  +N + +VPA+ DG
Sbjct  1    MGLELYLDLLSQPCRALYIFARSNNIPFEFKRVQLAKGQHKTEEFQKVNVLMKVPALRDG  60

Query  286  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  465
             F L ES A L YL       DHWYP+DLQKRA+VD    W H+N+R   +       L 
Sbjct  61   SFTLAESIAILLYLVQKFKTPDHWYPSDLQKRARVDEYLSWQHANIRAKGSKLFLTKVLL  120

Query  466  PAF-GLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            P   G P  P     A + L  +L   E  +LQ
Sbjct  121  PLLTGQPLPPEKLEFATEELNVALKQFEEKFLQ  153



>ref|XP_009006212.1| PREDICTED: glutathione S-transferase theta-1 isoform X1 [Callithrix 
jacchus]
Length=230

 Score =   132 bits (332),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 67/153 (44%), Positives = 91/153 (59%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M ++LY+D +SQP RA+ IF K NGI FE   + + KGQH +  ++ +NP+K+VPA+ DG
Sbjct  1    MGLELYLDLLSQPCRAIYIFAKKNGIPFELRTVDLIKGQHLSDAFSQVNPLKKVPALKDG  60

Query  286  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  465
            DF L ES A L YL     V DHWYP DLQ RA+VD    W H+ LRR     +++  + 
Sbjct  61   DFTLSESVAILLYLTHKYKVPDHWYPQDLQARARVDEYLAWQHTTLRRSCLRALWHKVMF  120

Query  466  PAF-GLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            P F G P +P   A     L  ++  LE  +LQ
Sbjct  121  PVFLGEPVSPQTLAATLAELDVNVQLLEDKFLQ  153



>ref|XP_001489453.1| PREDICTED: glutathione S-transferase theta-1-like [Equus caballus]
Length=240

 Score =   132 bits (333),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 68/153 (44%), Positives = 90/153 (59%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M ++LY+D +SQP RA+ IF K NGI FE   +++ KGQH + ++A +NP+K+VP + DG
Sbjct  1    MGLELYLDLLSQPCRAVYIFAKKNGIPFELRTVELLKGQHFSADFAQLNPLKKVPVLKDG  60

Query  286  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  465
            DF L ES A L YL       DHWYP DLQ RA+VD    W H+ LRR     +++  + 
Sbjct  61   DFTLTESVAILLYLTRKYKTPDHWYPQDLQARARVDEYLAWQHTALRRNCLRTLWHKLML  120

Query  466  PAF-GLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            P F G P  P   A     L  SL  LE  +LQ
Sbjct  121  PVFMGEPVAPEMLAATLAELDGSLQLLEDKFLQ  153



>ref|XP_007973334.1| PREDICTED: glutathione S-transferase theta-1 [Chlorocebus sabaeus]
Length=240

 Score =   132 bits (333),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 69/153 (45%), Positives = 92/153 (60%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M ++LY+D +SQP RA+ IF K NGI FE   + + KGQH +  +A +NP+K+VPA+ DG
Sbjct  1    MGLELYLDLLSQPCRAVYIFAKKNGIPFELRIVDLIKGQHLSDAFAQVNPLKKVPALKDG  60

Query  286  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  465
            DF L ES A L YL     V D+WYP DLQ RA+VD    W H+ LRR     +++ A+ 
Sbjct  61   DFTLTESVAILLYLTRKYKVPDYWYPQDLQARARVDEYLAWQHTTLRRSCLRALWHKAMF  120

Query  466  PAF-GLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            P F G P +P   A     L  +L  LE  +LQ
Sbjct  121  PVFLGEPVSPQTLAATLAELDVNLQWLEDKFLQ  153



>ref|XP_010368118.1| PREDICTED: glutathione S-transferase theta-1 isoform X1 [Rhinopithecus 
roxellana]
Length=240

 Score =   132 bits (332),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 68/153 (44%), Positives = 91/153 (59%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M ++LY+D +SQP RA+ IF K NGI FE   + + KGQH +  +A +NP+K+VPA+ DG
Sbjct  1    MGLELYLDLLSQPCRAVYIFAKKNGIPFELRVVDLIKGQHLSDAFAQVNPLKKVPALKDG  60

Query  286  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  465
            DF L ES A L YL     V D+WYP DLQ RA+VD    W H+ LRR     +++  + 
Sbjct  61   DFTLTESVAILLYLTRKYKVPDYWYPQDLQARARVDEYLAWQHTTLRRSCLRALWHKMMF  120

Query  466  PAF-GLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            P F G P +P   A     L  +L  LE  +LQ
Sbjct  121  PVFLGEPVSPQTLAATLVELDVTLQLLEDKFLQ  153



>ref|XP_005595439.1| PREDICTED: glutathione S-transferase theta-1 isoform X1 [Macaca 
fascicularis]
Length=240

 Score =   132 bits (332),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 68/153 (44%), Positives = 91/153 (59%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M ++LY+D +SQP RA+ IF K NGI FE   + + KGQH +  +A +NP+K+VPA+ DG
Sbjct  1    MGLELYLDLLSQPCRAVYIFAKKNGIPFELRIVDLIKGQHLSDAFAQVNPLKKVPALKDG  60

Query  286  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  465
            DF L ES A L YL     V D+WYP DLQ RA+VD    W H+ LRR     +++  + 
Sbjct  61   DFTLTESVAILLYLTRKYKVPDYWYPQDLQARARVDEYLAWQHTTLRRSCLRALWHKVMF  120

Query  466  PAF-GLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            P F G P +P   A     L  +L  LE  +LQ
Sbjct  121  PVFLGEPVSPQTLAATLAELDVNLQLLEDKFLQ  153



>ref|XP_003919137.1| PREDICTED: glutathione S-transferase theta-1 isoform X1 [Papio 
anubis]
Length=240

 Score =   132 bits (332),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 68/153 (44%), Positives = 91/153 (59%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M ++LY+D +SQP RA+ IF K NGI FE   + + KGQH +  +A +NP+K+VPA+ DG
Sbjct  1    MGLELYLDLLSQPCRAVYIFAKKNGIPFELRIVDLIKGQHLSDAFAQVNPLKKVPALKDG  60

Query  286  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  465
            DF L ES A L YL     V D+WYP DLQ RA+VD    W H+ LRR     +++  + 
Sbjct  61   DFTLTESVAILLYLTRKYKVPDYWYPQDLQARARVDEYLAWQHTTLRRSCLRALWHKVMF  120

Query  466  PAF-GLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            P F G P +P   A     L  +L  LE  +LQ
Sbjct  121  PVFLGEPVSPQTLAATLAELDVNLQLLEDKFLQ  153



>ref|XP_006822345.1| PREDICTED: glutathione S-transferase theta-1-like [Saccoglossus 
kowalevskii]
Length=228

 Score =   132 bits (331),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 66/153 (43%), Positives = 90/153 (59%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M + +Y D MSQP R++L+FC+ NGI +E+  + I KG+H + E++ INP  ++PA+ DG
Sbjct  1    MVLTVYYDVMSQPCRSVLLFCEVNGIPYEKEVVSIGKGEHMSEEFSQINPENKLPAIKDG  60

Query  286  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  465
             F L ES A LKYLAA    ADHWYP DLQKRAKVD    WHH N R+ A    +   L 
Sbjct  61   LFCLRESVAILKYLAAKYNTADHWYPRDLQKRAKVDEYLAWHHGNTRKDAIFVFWTEVLI  120

Query  466  PAF-GLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            P   G   N     +A      ++  +E  +L+
Sbjct  121  PRMRGTEINQPRLKKAVAAFDNTMDKIEKIFLK  153



>gb|AII00841.1| glutathione S-transferase theta 1 [Canis lupus familiaris]
Length=240

 Score =   132 bits (331),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 69/153 (45%), Positives = 92/153 (60%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M ++LY+D +SQP RA+ IF K NGI FE   +++ KGQH +  +A +NP+K+VPA+ DG
Sbjct  1    MGLELYLDLLSQPCRAVYIFAKRNGIPFELRPVELRKGQHLSDAFAQVNPLKKVPALRDG  60

Query  286  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  465
            DF L ES A L YL     V DHWYP DLQ  A+VD    W H+ LRR     +++  + 
Sbjct  61   DFTLTESVAILLYLNRKYKVPDHWYPQDLQACARVDEYLAWQHTTLRRNCLRALWHKVMF  120

Query  466  PAF-GLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            P F G P +P   A     L A+L  LE  +LQ
Sbjct  121  PVFLGEPVSPEMLAATLAELDATLQLLEDKFLQ  153



>ref|XP_534751.3| PREDICTED: glutathione S-transferase theta-1 [Canis lupus familiaris]
Length=240

 Score =   132 bits (331),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 69/153 (45%), Positives = 92/153 (60%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M ++LY+D +SQP RA+ IF K NGI FE   +++ KGQH +  +A +NP+K+VPA+ DG
Sbjct  1    MGLELYLDLLSQPCRAVYIFAKRNGIPFELRPVELRKGQHLSDAFAQVNPLKKVPALRDG  60

Query  286  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  465
            DF L ES A L YL     V DHWYP DLQ  A+VD    W H+ LRR     +++  + 
Sbjct  61   DFTLTESVAILLYLNRKYKVPDHWYPQDLQACARVDEYLAWQHTTLRRNCLRALWHKVMF  120

Query  466  PAF-GLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            P F G P +P   A     L A+L  LE  +LQ
Sbjct  121  PVFLGEPVSPEMLAATLAELDATLQLLEDKFLQ  153



>gb|ABQ82132.1| glutathione S-transferase theta [Alitta succinea]
Length=226

 Score =   131 bits (330),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 65/151 (43%), Positives = 93/151 (62%), Gaps = 1/151 (1%)
 Frame = +1

Query  112  VKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDGDF  291
            +KLY D MSQPSRA+ IF KA GI FEE  + + KG+H+T E+A INP + VP + DG F
Sbjct  4    LKLYFDLMSQPSRAVWIFLKATGIPFEEKPVALRKGEHQTEEFAKINPFQLVPVIDDGGF  63

Query  292  KLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALAP-  468
             L+ES +  KYLA +  +ADHWYP++L+ RA+++S   WH   +R  A+       + P 
Sbjct  64   VLYESLSICKYLAKSRNLADHWYPSELKHRARIESYLQWHCLMVRLFASQVFRIQVIEPR  123

Query  469  AFGLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            A   P +    A+ E +L   L + E+ WL+
Sbjct  124  AMNKPVDRQRLAKYENILSVVLDSFETVWLK  154



>ref|XP_008155438.1| PREDICTED: glutathione S-transferase theta-1 [Eptesicus fuscus]
Length=240

 Score =   132 bits (331),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 68/153 (44%), Positives = 91/153 (59%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M ++LY+D +SQP RA+ IF K N I FE   +++ KGQH + ++A +NP K+VPA+ DG
Sbjct  1    MGLELYLDLLSQPCRAVYIFAKKNRIPFELRTVELLKGQHLSDDFAQVNPNKKVPALKDG  60

Query  286  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  465
            DF L ES A L YL     V DHWYP +LQ RA+VD    W H+ LRR     +++  + 
Sbjct  61   DFTLTESVAILLYLTRKFKVPDHWYPQELQARARVDEYLAWQHTTLRRNCLRTLWHKVMF  120

Query  466  PAF-GLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            P F G P  P   A     L A+L  LE  +LQ
Sbjct  121  PVFLGEPVAPETLAATLAELDATLQILEDSFLQ  153



>gb|EJY86624.1| Glutathione S-transferase T1 [Oxytricha trifallax]
Length=240

 Score =   132 bits (331),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 64/151 (42%), Positives = 85/151 (56%), Gaps = 2/151 (1%)
 Frame = +1

Query  112  VKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVD--G  285
            + L+ D  SQP+RA+  F + N I F+  +I I   QH +PEY  INP  +VPA+ D   
Sbjct  11   LTLFGDFQSQPTRAIFCFLQINKIPFKFNEISILHKQHLSPEYRKINPTGKVPAIYDPLH  70

Query  286  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  465
            D  +FESHA L+YL       DHWYP D +++AKV+   DWHHSNLR+GA G   N  L 
Sbjct  71   DIHIFESHAILRYLHQTRNCGDHWYPKDFKQKAKVEEYLDWHHSNLRQGAQGVFLNGYLF  130

Query  466  PAFGLPCNPHAAAEAEKVLLASLGTLESFWL  558
            P             +  +L  SL  LE++WL
Sbjct  131  PLLQKRVAHDDLVNSHSILTKSLKLLETYWL  161



>gb|EJY80394.1| Glutathione S-transferase T1 [Oxytricha trifallax]
Length=240

 Score =   131 bits (330),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 64/151 (42%), Positives = 85/151 (56%), Gaps = 2/151 (1%)
 Frame = +1

Query  112  VKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVD--G  285
            + L+ D  SQP+RA+  F + N I F+  +I I   QH +PEY  INP  +VPA+ D   
Sbjct  11   LTLFGDFQSQPTRAIFCFLQINKIPFKFNEISILHKQHLSPEYRKINPTGKVPAIYDPLH  70

Query  286  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  465
            D  +FESHA L+YL       DHWYP D +++AKV+   DWHHSNLR+GA G   N  L 
Sbjct  71   DIHIFESHAILRYLHQTRNCGDHWYPKDFKQKAKVEEYLDWHHSNLRQGAQGVFLNGYLF  130

Query  466  PAFGLPCNPHAAAEAEKVLLASLGTLESFWL  558
            P             +  +L  SL  LE++WL
Sbjct  131  PLLQKRVAHDDLVNSHSILTKSLRLLETYWL  161



>ref|XP_003994894.3| PREDICTED: glutathione S-transferase theta-1 [Felis catus]
Length=240

 Score =   131 bits (330),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 68/153 (44%), Positives = 91/153 (59%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M ++LY+D +SQP RA+ IF K N I FE   +++ KGQH +  +A +NP+K+VPA+ DG
Sbjct  1    MGLELYLDLLSQPCRAIYIFAKKNRIPFEMRTVELLKGQHLSDAFAQVNPLKKVPALKDG  60

Query  286  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  465
            DF L ES A L YL     VADHWYP DLQ  A+VD    W H+ LRR     +++  + 
Sbjct  61   DFTLAESVAILLYLTRKYKVADHWYPQDLQACARVDEYLAWQHTTLRRSCLRALWHKVMF  120

Query  466  PAF-GLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            P F G P +P   A     L  +L  LE  +LQ
Sbjct  121  PVFLGEPVSPEMLATTLAELDVTLQLLEDKFLQ  153



>ref|XP_007092375.1| PREDICTED: glutathione S-transferase theta-1-like [Panthera tigris 
altaica]
Length=240

 Score =   131 bits (330),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 68/153 (44%), Positives = 91/153 (59%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M ++LY+D +SQP RA+ IF K N I FE   +++ KGQH +  +A +NP+K+VPA+ DG
Sbjct  1    MGLELYLDLLSQPCRAIYIFAKKNRIPFEMRTVELLKGQHLSDAFAQVNPLKKVPALKDG  60

Query  286  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  465
            DF L ES A L YL     VADHWYP DLQ  A+VD    W H+ LRR     +++  + 
Sbjct  61   DFTLAESVAILLYLTRKYKVADHWYPQDLQACARVDEYLAWQHTTLRRSCLRALWHKVMF  120

Query  466  PAF-GLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            P F G P +P   A     L  +L  LE  +LQ
Sbjct  121  PVFLGEPVSPEMLATTLAELDVTLQLLEDKFLQ  153



>ref|XP_002830963.1| PREDICTED: glutathione S-transferase theta-1 isoform X1 [Pongo 
abelii]
Length=240

 Score =   131 bits (330),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 67/153 (44%), Positives = 90/153 (59%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M ++LY+D +SQP RA+ IF K N I FE   + + KGQH +  +A +NP+K+VPA+ DG
Sbjct  1    MGLELYLDLLSQPCRAVYIFAKKNDIAFELRMVDLIKGQHLSDAFAQVNPLKKVPALKDG  60

Query  286  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  465
            DF L ES A L YL     + DHWYP DLQ RA+VD    W H+ LRR     +++  + 
Sbjct  61   DFTLTESVAILLYLTRKYKLPDHWYPQDLQARARVDEYLAWQHTTLRRSCLRALWHKMMF  120

Query  466  PAF-GLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            P F G P +P   A     L  +L  LE  +LQ
Sbjct  121  PVFLGEPVSPQTLAATLAELDVTLQLLEDKFLQ  153



>ref|XP_004680982.1| PREDICTED: glutathione S-transferase theta-1-like [Condylura 
cristata]
Length=240

 Score =   131 bits (329),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 69/153 (45%), Positives = 90/153 (59%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M ++LY+D +SQP RA+ IF K NGI FE   +++ KGQH +  +A +NP+K+VPA+ DG
Sbjct  1    MGLELYLDLLSQPCRAVYIFAKKNGIPFELRTVELLKGQHLSDAFAQVNPLKKVPALKDG  60

Query  286  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  465
            +F L ES A L YL     V DHWYP DLQ RA+VD    W H  LRR     +++  + 
Sbjct  61   NFTLTESVAILLYLTHKYKVPDHWYPPDLQTRARVDEYLAWQHQTLRRNCLRALWHKVMF  120

Query  466  PAF-GLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            PAF G    P   A     L  SL  LE  +LQ
Sbjct  121  PAFLGEQVAPEVLAATLAELDVSLQLLEDKFLQ  153



>gb|AHC08064.1| theta glutathione S-transferase [Locusta migratoria]
Length=231

 Score =   130 bits (328),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 67/152 (44%), Positives = 85/152 (56%), Gaps = 1/152 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M++K Y D  SQPSRA+L+  K N I FE  +I + KG+H + EYA INP ++VP +V G
Sbjct  1    MSLKFYYDIFSQPSRAVLLLLKLNKIPFESKKINLLKGEHFSEEYAKINPFQKVPVIVHG  60

Query  286  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  465
            DF LFES A L+YL     VADHWYP D + +AKVD   +W H  +R     Y     L 
Sbjct  61   DFALFESVAILRYLCREFEVADHWYPKDSKAQAKVDEYVEWQHIEIRANLVNYFRTKFLL  120

Query  466  PAF-GLPCNPHAAAEAEKVLLASLGTLESFWL  558
            P   G P +       EK +   L  LE  WL
Sbjct  121  PVVTGRPADGKKVIVYEKKVTDILNKLEETWL  152



>ref|XP_008500992.1| PREDICTED: LOW QUALITY PROTEIN: glutathione S-transferase theta-1-like 
[Calypte anna]
Length=242

 Score =   131 bits (329),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 65/153 (42%), Positives = 87/153 (57%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M ++LY+D +SQP RAL IF + N I FE  ++++ KGQHRT E+  +N + +VPA+ DG
Sbjct  1    MGLELYLDLLSQPCRALYIFARNNNIPFEFKKVELMKGQHRTEEFRKVNILMKVPALKDG  60

Query  286  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  465
             F L ES A L YLA      DHWYP+DL+KRA+VD    W H N+R   +      AL 
Sbjct  61   SFTLSESIAILLYLARKFKTPDHWYPSDLEKRARVDEYLSWQHINIRGKGSKLFLTKALV  120

Query  466  PAF-GLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            P   G P +P       + L   L   E  +LQ
Sbjct  121  PVLTGQPLSPEKLEGVTEELNIVLKQFEEVFLQ  153



>ref|XP_005054826.1| PREDICTED: glutathione S-transferase theta-1-like [Ficedula albicollis]
Length=241

 Score =   130 bits (328),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 65/153 (42%), Positives = 91/153 (59%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M ++LY+D +SQP RAL IF ++N I FE  ++Q+AKGQH+T E+  +N + +VPA+ DG
Sbjct  1    MGLELYLDLLSQPCRALYIFARSNNIPFEFKKVQLAKGQHKTEEFRKVNVLMKVPALKDG  60

Query  286  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLR-RGAAGYVFNTAL  462
             F L ES A L YL       DHWYP+DLQKRA+VD    W H+N+R +G+  ++    L
Sbjct  61   SFTLAESIAILLYLVQKFKTPDHWYPSDLQKRARVDEYLSWQHANIRAKGSKLFLTKVML  120

Query  463  APAFGLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
                G P  P       + L  +L   E  +LQ
Sbjct  121  PLITGQPLPPEKQEFITEELNVALKQFEEKFLQ  153



>gb|EHH25431.1| hypothetical protein EGK_21202 [Macaca mulatta]
Length=240

 Score =   130 bits (328),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 67/153 (44%), Positives = 91/153 (59%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M ++LY+D +SQP RA+ IF K NGI FE   + + KGQH +  +A +NP+K+VPA+ DG
Sbjct  1    MGLELYLDLLSQPCRAVYIFAKKNGIPFELRIVDLIKGQHLSDAFAQVNPLKKVPALKDG  60

Query  286  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  465
            DF L ES A L YL     V D+WYP +LQ RA+VD    W H+ LRR     +++  + 
Sbjct  61   DFTLTESVAILLYLTCKYKVPDYWYPQNLQARARVDEYLAWQHTTLRRSCLRALWHKVMF  120

Query  466  PAF-GLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            P F G P +P   A     L  +L  LE  +LQ
Sbjct  121  PVFLGEPVSPQTLAATLAELDVNLQLLEDKFLQ  153



>ref|XP_006130307.1| PREDICTED: glutathione S-transferase theta-1-like [Pelodiscus 
sinensis]
Length=239

 Score =   130 bits (328),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 66/153 (43%), Positives = 88/153 (58%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M V+L++D +SQP RAL IF K N I FE   +++ KGQH + E+  +N +K+VPA+ DG
Sbjct  1    MVVELFLDLLSQPCRALFIFAKKNNIPFEFKHVELIKGQHLSEEFGKVNVLKKVPALKDG  60

Query  286  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  465
             F L ES A L YL       DHWYP+DL+KRA+VD    W H+ +R       F   L 
Sbjct  61   TFTLAESIAILLYLRRKFNTPDHWYPSDLRKRARVDEYLSWQHTAIREKGCRIFFTKVLM  120

Query  466  P-AFGLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            P A G P +P    EA K +  +L   E  +LQ
Sbjct  121  PLAVGQPFSPDKLEEAVKEMNFTLVQFEEKFLQ  153



>gb|EHH61703.1| hypothetical protein EGM_19746 [Macaca fascicularis]
Length=240

 Score =   130 bits (328),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 67/153 (44%), Positives = 91/153 (59%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M ++LY+D +SQP RA+ IF K NGI FE   + + KGQH +  +A +NP+K+VPA+ DG
Sbjct  1    MGLELYLDLLSQPCRAVYIFAKKNGIPFELRIVDLIKGQHLSDAFAQVNPLKKVPALKDG  60

Query  286  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  465
            DF L ES A L YL     V D+WYP +LQ RA+VD    W H+ LRR     +++  + 
Sbjct  61   DFTLTESVAILLYLTRKYKVPDYWYPQNLQARARVDEYLAWQHTTLRRSCLRALWHKVMF  120

Query  466  PAF-GLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            P F G P +P   A     L  +L  LE  +LQ
Sbjct  121  PVFLGEPVSPQTLAATLAELDVNLQLLEDKFLQ  153



>ref|XP_004466461.1| PREDICTED: glutathione S-transferase theta-1-like isoform 3 [Dasypus 
novemcinctus]
Length=240

 Score =   130 bits (328),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 67/153 (44%), Positives = 89/153 (58%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M ++LY+D +SQP RA+ IF K NGI FE   + + KG+H +  +  +NP+K VP + DG
Sbjct  1    MGLELYLDLLSQPCRAVYIFAKRNGIPFELHPVDLRKGEHLSQGFVQVNPLKMVPVLKDG  60

Query  286  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  465
            DF L ES A L YL     V DHWYP DLQ RA+VD    W H+ LRR     +++  + 
Sbjct  61   DFVLTESVAILLYLTRKYKVPDHWYPQDLQARARVDEYLAWQHTTLRRNCLRSLWHKVML  120

Query  466  PAF-GLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            P F G P +P   A     L A+L  LE  +LQ
Sbjct  121  PVFLGEPVSPETLAATLADLEATLQLLEDKFLQ  153



>ref|XP_001089367.1| PREDICTED: glutathione S-transferase theta-1 isoform 2 [Macaca 
mulatta]
Length=240

 Score =   130 bits (327),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 67/153 (44%), Positives = 90/153 (59%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M ++LY+D +SQP RA+ IF K NGI FE   + + KGQH +  +A +NP+K+VPA+ DG
Sbjct  1    MGLELYLDLLSQPCRAVYIFAKKNGIPFELRIVDLIKGQHLSDAFAQVNPLKKVPALKDG  60

Query  286  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  465
            DF L ES A L YL     V D+WYP DLQ RA+VD    W H  +RR     +++  + 
Sbjct  61   DFTLTESVAILLYLTRKYKVPDYWYPQDLQARARVDEYLAWQHMTMRRSCLRALWHKVMF  120

Query  466  PAF-GLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            P F G P +P   A     L  +L  LE  +LQ
Sbjct  121  PVFLGEPVSPQTLAATLAELDVNLQLLEDKFLQ  153



>ref|XP_007957332.1| PREDICTED: glutathione S-transferase theta-1-like [Orycteropus 
afer afer]
Length=240

 Score =   130 bits (327),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 67/153 (44%), Positives = 89/153 (58%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M ++LY+D +SQP RA+ IF K NGI FE   +++ KGQH++  +A +NPM++VPA+ DG
Sbjct  1    MGLELYLDLLSQPCRAVYIFAKKNGIPFELRTVELLKGQHQSDAFAQVNPMQKVPALKDG  60

Query  286  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  465
            DF L ES A L YL+      DHWYP DLQ RA+VD    W H+ LR   A   ++  + 
Sbjct  61   DFTLAESVAILLYLSRKYQTPDHWYPQDLQTRARVDEYLAWQHTGLRNSFALPTYHQVMI  120

Query  466  PAF-GLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            P F G    P   A     L   L  LE  +LQ
Sbjct  121  PVFLGESVRPETLAATLATLDRCLQLLEDKFLQ  153



>ref|XP_008566801.1| PREDICTED: glutathione S-transferase theta-1 isoform X1 [Galeopterus 
variegatus]
Length=240

 Score =   130 bits (327),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 67/153 (44%), Positives = 91/153 (59%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M ++LY+D +SQP RA+ IF + NGI FE   +++ KGQH +  +A +NPMK+VPA+ DG
Sbjct  1    MGLELYLDLLSQPCRAVYIFARKNGIPFELRTVELLKGQHLSDAFAQVNPMKKVPALKDG  60

Query  286  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  465
            DF L ES A L YL     V D+WYP DLQ  A+VD    W H+ LRR     +++  + 
Sbjct  61   DFTLTESVAILLYLMRKYKVPDYWYPQDLQACARVDEYLAWQHTTLRRNCLRALWHKVML  120

Query  466  PAF-GLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            P F G P +P   A     L  +L  LE  +LQ
Sbjct  121  PVFLGEPVSPQMLAATLAELDETLQLLEDKFLQ  153



>ref|XP_008066997.1| PREDICTED: glutathione S-transferase theta-1 [Tarsius syrichta]
Length=240

 Score =   130 bits (327),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 67/153 (44%), Positives = 91/153 (59%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M ++LY+D +SQP RA+ IF K NGI FE   +++ +GQH +  +A +NP+K+VPA+ DG
Sbjct  1    MGLELYLDLLSQPCRAVYIFAKKNGIPFELRPVELIRGQHLSDAFAQVNPLKKVPALRDG  60

Query  286  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  465
            DF L ES A L YL     V D+WYP DLQ RA VD    W H+ LRR     +++  + 
Sbjct  61   DFTLTESVAILLYLTRKYKVPDYWYPQDLQARALVDEYLAWQHTALRRNCLRTLWHKVMF  120

Query  466  PAF-GLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            P F G P +P   A     L  +L  LE  +LQ
Sbjct  121  PVFMGEPVSPQMLAATLAELDVTLQLLEDKFLQ  153



>ref|XP_005886352.1| PREDICTED: glutathione S-transferase theta-1-like [Myotis brandtii]
 gb|EPQ20307.1| Glutathione S-transferase theta-1 [Myotis brandtii]
Length=240

 Score =   130 bits (327),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 66/153 (43%), Positives = 91/153 (59%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M ++LY+D +SQP RA+ IF + NGI FE   +++ KGQH +  +A +NP+K+VPA+ DG
Sbjct  1    MGLELYLDLLSQPCRAVYIFRQENGIPFELRTVELLKGQHLSDAFAQVNPLKKVPALKDG  60

Query  286  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  465
            DF L ES A L YL     V DHWYP +LQ RA+VD    W H+ LR+     ++   + 
Sbjct  61   DFTLTESVAILLYLTRKFKVPDHWYPQELQARARVDEYMAWQHTTLRKNCLRTLWYKVMF  120

Query  466  PAF-GLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            P F G P +P   A     L A+L   E  +LQ
Sbjct  121  PVFLGEPVSPETLAATLAELDATLQIFEDNFLQ  153



>ref|NP_000844.2| glutathione S-transferase theta-1 isoform a [Homo sapiens]
 ref|XP_525647.2| PREDICTED: glutathione S-transferase theta-1 isoform X1 [Pan 
troglodytes]
 sp|P30711.4|GSTT1_HUMAN RecName: Full=Glutathione S-transferase theta-1; AltName: Full=GST 
class-theta-1; AltName: Full=Glutathione transferase T1-1 
[Homo sapiens]
 gb|AAL31549.1|AF435971_1 glutathione transferase T1-1 [Homo sapiens]
 gb|AAG02374.1| glutathione S-transferase theta 1 [Homo sapiens]
 dbj|BAB39498.1| glutathione S-transferase TT1 [Homo sapiens]
 gb|EAW59631.1| glutathione S-transferase theta 1, isoform CRA_c [Homo sapiens]
Length=240

 Score =   130 bits (327),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 67/153 (44%), Positives = 90/153 (59%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M ++LY+D +SQP RA+ IF K N I FE   + + KGQH +  +A +NP+K+VPA+ DG
Sbjct  1    MGLELYLDLLSQPCRAVYIFAKKNDIPFELRIVDLIKGQHLSDAFAQVNPLKKVPALKDG  60

Query  286  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  465
            DF L ES A L YL     V D+WYP DLQ RA+VD    W H+ LRR     +++  + 
Sbjct  61   DFTLTESVAILLYLTRKYKVPDYWYPQDLQARARVDEYLAWQHTTLRRSCLRALWHKVMF  120

Query  466  PAF-GLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            P F G P +P   A     L  +L  LE  +LQ
Sbjct  121  PVFLGEPVSPQTLAATLAELDVTLQLLEDKFLQ  153



>ref|XP_004063215.1| PREDICTED: glutathione S-transferase theta-1 [Gorilla gorilla 
gorilla]
Length=240

 Score =   130 bits (327),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 67/153 (44%), Positives = 90/153 (59%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M ++LY+D +SQP RA+ IF K N I FE   + + KGQH +  +A +NP+K+VPA+ DG
Sbjct  1    MGLELYLDLLSQPCRAVYIFAKKNDIPFELRIVDLIKGQHLSDAFAQVNPLKKVPALKDG  60

Query  286  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  465
            DF L ES A L YL     V D+WYP DLQ RA+VD    W H+ LRR     +++  + 
Sbjct  61   DFTLTESVAILLYLTRKYKVPDYWYPQDLQARARVDEYLAWQHTTLRRSCLRALWHKVMF  120

Query  466  PAF-GLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            P F G P +P   A     L  +L  LE  +LQ
Sbjct  121  PVFLGEPVSPQTLAATLAELDVTLQLLEDKFLQ  153



>ref|XP_008961689.1| PREDICTED: glutathione S-transferase theta-1 isoform X1 [Pan 
paniscus]
Length=240

 Score =   130 bits (327),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 67/153 (44%), Positives = 90/153 (59%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M ++LY+D +SQP RA+ IF K N I FE   + + KGQH +  +A +NP+K+VPA+ DG
Sbjct  1    MGLELYLDLLSQPCRAVYIFAKKNDIPFELRIVDLIKGQHLSDAFAQVNPLKKVPALKDG  60

Query  286  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  465
            DF L ES A L YL     V D+WYP DLQ RA+VD    W H+ LRR     +++  + 
Sbjct  61   DFTLTESVAILLYLTRKYKVPDYWYPQDLQARARVDEYLAWQHTTLRRSCLRALWHKVMF  120

Query  466  PAF-GLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            P F G P +P   A     L  +L  LE  +LQ
Sbjct  121  PVFLGEPVSPQTLAATLAELDVTLQLLEDKFLQ  153



>pdb|2C3Q|A Chain A, Human Glutathione-S-Transferase T1-1 W234r Mutant, Complex 
With S-Hexylglutathione
 pdb|2C3Q|B Chain B, Human Glutathione-S-Transferase T1-1 W234r Mutant, Complex 
With S-Hexylglutathione
 pdb|2C3Q|C Chain C, Human Glutathione-S-Transferase T1-1 W234r Mutant, Complex 
With S-Hexylglutathione
 pdb|2C3Q|D Chain D, Human Glutathione-S-Transferase T1-1 W234r Mutant, Complex 
With S-Hexylglutathione
 pdb|2C3T|A Chain A, Human Glutathione-S-Transferase T1-1, W234r Mutant, 
Apo Form
 pdb|2C3T|B Chain B, Human Glutathione-S-Transferase T1-1, W234r Mutant, 
Apo Form
 pdb|2C3T|C Chain C, Human Glutathione-S-Transferase T1-1, W234r Mutant, 
Apo Form
 pdb|2C3T|D Chain D, Human Glutathione-S-Transferase T1-1, W234r Mutant, 
Apo Form
Length=247

 Score =   130 bits (327),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 67/153 (44%), Positives = 90/153 (59%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M ++LY+D +SQP RA+ IF K N I FE   + + KGQH +  +A +NP+K+VPA+ DG
Sbjct  8    MGLELYLDLLSQPCRAVYIFAKKNDIPFELRIVDLIKGQHLSDAFAQVNPLKKVPALKDG  67

Query  286  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  465
            DF L ES A L YL     V D+WYP DLQ RA+VD    W H+ LRR     +++  + 
Sbjct  68   DFTLTESVAILLYLTRKYKVPDYWYPQDLQARARVDEYLAWQHTTLRRSCLRALWHKVMF  127

Query  466  PAF-GLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            P F G P +P   A     L  +L  LE  +LQ
Sbjct  128  PVFLGEPVSPQTLAATLAELDVTLQLLEDKFLQ  160



>gb|AAV38754.1| glutathione S-transferase theta 1 [Homo sapiens]
Length=240

 Score =   130 bits (326),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 67/153 (44%), Positives = 90/153 (59%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M ++LY+D +SQP RA+ IF K N I FE   + + KGQH +  +A +NP+K+VPA+ DG
Sbjct  1    MGLELYLDLLSQPCRAVYIFAKKNDIPFELRIVDLIKGQHLSDAFAQVNPLKKVPALKDG  60

Query  286  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  465
            DF L ES A L YL     V D+WYP DLQ RA+VD    W H+ LRR     +++  + 
Sbjct  61   DFTLTESVAILLYLTRKYKVPDYWYPQDLQARARVDEYLAWQHTTLRRSCLRALWHKVMF  120

Query  466  PAF-GLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            P F G P +P   A     L  +L  LE  +LQ
Sbjct  121  PVFLGEPVSPQTLAATLAELDVTLQLLEDKFLQ  153



>ref|XP_004362055.1| hypothetical protein DFA_06351 [Dictyostelium fasciculatum]
 gb|EGG24204.1| hypothetical protein DFA_06351 [Dictyostelium fasciculatum]
Length=221

 Score =   129 bits (325),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 65/147 (44%), Positives = 83/147 (56%), Gaps = 0/147 (0%)
 Frame = +1

Query  118  LYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDGDFKL  297
            LY D++SQP+RA+L     N I  E   I IAKG+  T E+A INP K+VP + DGD  L
Sbjct  6    LYGDQLSQPTRAILFILLNNKIPHEFKTISIAKGEQNTEEFAKINPWKKVPVIQDGDLTL  65

Query  298  FESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALAPAFG  477
             ESH  L+Y+A    +   +   DL +R KVD   DWHH  LR+ A+   + T +AP FG
Sbjct  66   IESHTILRYIAQKYKLDQLYSNTDLIERCKVDMYLDWHHIGLRKPASTVFYFTFVAPLFG  125

Query  478  LPCNPHAAAEAEKVLLASLGTLESFWL  558
            +P N    A   K L  SL   ES WL
Sbjct  126  IPVNQELLASESKNLQTSLSKFESIWL  152



>ref|XP_003803343.1| PREDICTED: glutathione S-transferase theta-1-like [Otolemur garnettii]
Length=240

 Score =   130 bits (326),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 67/153 (44%), Positives = 90/153 (59%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M ++LY+D +SQP RA+ IF K N I FE   +++ KGQH +  +A +NP+K+VPA+ DG
Sbjct  1    MVLELYLDLLSQPCRAIYIFAKKNRIPFEMRTVELLKGQHLSDAFAQVNPLKKVPALKDG  60

Query  286  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  465
            DF L ES A L YL     V D+WYP DLQ RA+VD    W H+ LRR     +++  + 
Sbjct  61   DFILTESVAILLYLTRKYQVPDYWYPQDLQARARVDEYLAWQHTALRRNCLRALWHKVML  120

Query  466  PAF-GLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            P F G P  P   A     L  +L  LE  +LQ
Sbjct  121  PVFLGEPVPPQTLAATLSELDVTLQLLEDKFLQ  153



>pdb|2C3N|A Chain A, Human Glutathione-S-Transferase T1-1, Apo Form
 pdb|2C3N|B Chain B, Human Glutathione-S-Transferase T1-1, Apo Form
 pdb|2C3N|C Chain C, Human Glutathione-S-Transferase T1-1, Apo Form
 pdb|2C3N|D Chain D, Human Glutathione-S-Transferase T1-1, Apo Form
Length=247

 Score =   130 bits (326),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 67/153 (44%), Positives = 90/153 (59%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M ++LY+D +SQP RA+ IF K N I FE   + + KGQH +  +A +NP+K+VPA+ DG
Sbjct  8    MGLELYLDLLSQPCRAVYIFAKKNDIPFELRIVDLIKGQHLSDAFAQVNPLKKVPALKDG  67

Query  286  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  465
            DF L ES A L YL     V D+WYP DLQ RA+VD    W H+ LRR     +++  + 
Sbjct  68   DFTLTESVAILLYLTRKYKVPDYWYPQDLQARARVDEYLAWQHTTLRRSCLRALWHKVMF  127

Query  466  PAF-GLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            P F G P +P   A     L  +L  LE  +LQ
Sbjct  128  PVFLGEPVSPQTLAATLAELDVTLQLLEDKFLQ  160



>ref|XP_003938575.1| PREDICTED: glutathione S-transferase theta-1 isoform X1 [Saimiri 
boliviensis boliviensis]
Length=240

 Score =   130 bits (326),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 67/153 (44%), Positives = 92/153 (60%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M ++LY+D +SQP RA+ IF K NGI FE   + + KGQ+ +  +A +NP+K+VPA+ DG
Sbjct  1    MGLELYLDLLSQPCRAVYIFAKKNGIPFELRTVDLIKGQNLSDAFARVNPLKKVPALKDG  60

Query  286  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  465
            DF L ES A L YL     V D+WYP DLQ RA+VD    W H+ LRR     +++  + 
Sbjct  61   DFTLSESVAILLYLTHKYKVPDYWYPQDLQARARVDEYLAWQHTTLRRSCLRALWHKVMF  120

Query  466  PAF-GLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            P F G P +P   A     L  +L  LE+ +LQ
Sbjct  121  PVFLGEPVSPQTLAATLAELDVNLQLLENKFLQ  153



>gb|AHH29314.1| glutathione S-transferase T1 [Macaca mulatta]
Length=240

 Score =   130 bits (326),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 67/153 (44%), Positives = 90/153 (59%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M ++LY+D +SQP RA+ IF K NGI FE   + + KGQH +  +A +NP+K+VPA+ DG
Sbjct  1    MGLELYLDLLSQPCRAVYIFAKKNGIPFELRIVDLIKGQHLSDAFAQVNPLKKVPALKDG  60

Query  286  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  465
            DF L ES A L YL     V D+WYP DLQ  A+VD    W H+ LRR     +++  + 
Sbjct  61   DFTLTESVAILLYLTRKYKVPDYWYPQDLQASARVDEYLAWQHTTLRRSCLRALWHKVMF  120

Query  466  PAF-GLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            P F G P +P   A     L  +L  LE  +LQ
Sbjct  121  PVFLGEPVSPQTLAATLAELDVNLQLLEDKFLQ  153



>gb|AHH29313.1| glutathione S-transferase T1 [Macaca fascicularis]
Length=240

 Score =   130 bits (326),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 67/153 (44%), Positives = 90/153 (59%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M ++LY+D +SQP RA+ IF K NGI FE   + + KGQH +  +A +NP+K+VPA+ DG
Sbjct  1    MGLELYLDLLSQPCRAVYIFAKKNGIPFELRIVDLIKGQHLSDAFAQVNPLKKVPALKDG  60

Query  286  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  465
            DF L ES A L YL     V D+WYP DLQ RA+VD    W H+ LRR     +++  + 
Sbjct  61   DFTLTESVAILLYLTRKYKVPDYWYPQDLQARARVDEYLAWQHTTLRRSCLRALWHKVMF  120

Query  466  PAF-GLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            P F   P +P   A     L  +L  LE  +LQ
Sbjct  121  PVFLDEPVSPQTLAATLAELDVNLQLLEDKFLQ  153



>emb|CAA55935.1| glutathione transferase T1 [Homo sapiens]
Length=240

 Score =   129 bits (325),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 67/153 (44%), Positives = 90/153 (59%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M ++LY+D +SQP RA+ IF K N I FE   + + KGQH +  +A +NP+K+VPA+ DG
Sbjct  1    MGLELYLDLLSQPCRAVYIFAKKNDIPFELRIVDLIKGQHLSDAFAQVNPLKKVPALKDG  60

Query  286  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  465
            DF L ES A L YL     V D+WYP DLQ RA+VD    W H+ LRR     +++  + 
Sbjct  61   DFTLTESVAILLYLTRKYKVPDYWYPQDLQARARVDEYLAWQHTTLRRSCLRALWHKVMF  120

Query  466  PAF-GLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            P F G P +P   A     L  +L  LE  +LQ
Sbjct  121  PVFLGGPVSPQTLAATLAELDVTLQLLEDKFLQ  153



>ref|XP_004607625.1| PREDICTED: glutathione S-transferase theta-1-like [Sorex araneus]
Length=240

 Score =   129 bits (325),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 66/153 (43%), Positives = 88/153 (58%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M ++LY+D +SQP RA+ IF K NGI FE   +++ KGQH +  +A +NP+K+VPA+ DG
Sbjct  1    MGLELYLDLLSQPCRAVYIFAKKNGIPFEMRTVELLKGQHHSDAFAQVNPLKKVPALKDG  60

Query  286  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  465
            DF L ES A L YL+      DHWYP DLQ RA+VD    W H+ LR      ++   + 
Sbjct  61   DFTLAESVAILLYLSRKFETPDHWYPQDLQARARVDEYLAWQHTTLRTSCTRALWQKMII  120

Query  466  PAF-GLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            P F G P  P   A     L   L  LE  +L+
Sbjct  121  PKFVGQPVPPEVLASTLTELDRCLQLLEDKFLK  153



>ref|XP_005023587.1| PREDICTED: glutathione S-transferase theta-1-like [Anas platyrhynchos]
Length=242

 Score =   129 bits (324),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 65/153 (42%), Positives = 85/153 (56%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M ++LY+D +SQP RAL IF + N I FE   +++ KGQHRT E+  +N + +VPA+ DG
Sbjct  1    MGLELYLDLLSQPCRALYIFARTNNIPFEFKHVELMKGQHRTEEFRKVNMLMKVPALKDG  60

Query  286  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  465
             F L ES A L YLA      DHWYP+DLQKRA+VD    W H N+R   +       L 
Sbjct  61   SFTLAESIAILLYLARKFKTPDHWYPSDLQKRARVDEYLSWQHVNIRGKGSKLFLTKVLL  120

Query  466  PAF-GLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            P   G P +P       + L   L   E  +LQ
Sbjct  121  PLLTGQPLSPEKLEGVTEELNVVLKQFEEKFLQ  153



>ref|NP_956815.1| glutathione S-transferase theta-like [Danio rerio]
 gb|AAH55612.1| Zgc:66350 [Danio rerio]
 gb|AAI65095.1| Zgc:66350 protein [Danio rerio]
Length=242

 Score =   129 bits (324),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 70/152 (46%), Positives = 87/152 (57%), Gaps = 1/152 (1%)
 Frame = +1

Query  109  AVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDGD  288
            AVK Y+D MSQP RA+LIF K N I     QI I KG+ +TPE+  +NPM++VP + D  
Sbjct  6    AVKAYLDLMSQPCRAVLIFLKHNKIPHTVEQIAIRKGEQKTPEFTKLNPMQKVPVLEDNG  65

Query  289  FKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALAP  468
            F L ES A LKYLA    V DHWYP   +KRA+VD    WHH N R  AA   +   L P
Sbjct  66   FVLTESDAILKYLATTYKVPDHWYPKLPEKRARVDEYTAWHHMNTRMHAATVFWQEVLLP  125

Query  469  AF-GLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
               G P N     +A   L  +L  LE+ +L+
Sbjct  126  LMTGQPANTAKLEKALSDLSGTLDKLENMFLK  157



>ref|XP_004466459.1| PREDICTED: glutathione S-transferase theta-1-like isoform 1 [Dasypus 
novemcinctus]
Length=259

 Score =   129 bits (325),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 67/153 (44%), Positives = 89/153 (58%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M ++LY+D +SQP RA+ IF K NGI FE   + + KG+H +  +  +NP+K VP + DG
Sbjct  1    MGLELYLDLLSQPCRAVYIFAKRNGIPFELHPVDLRKGEHLSQGFVQVNPLKMVPVLKDG  60

Query  286  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  465
            DF L ES A L YL     V DHWYP DLQ RA+VD    W H+ LRR     +++  + 
Sbjct  61   DFVLTESVAILLYLTRKYKVPDHWYPQDLQARARVDEYLAWQHTTLRRNCLRSLWHKVML  120

Query  466  PAF-GLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            P F G P +P   A     L A+L  LE  +LQ
Sbjct  121  PVFLGEPVSPETLAATLADLEATLQLLEDKFLQ  153



>ref|XP_002200008.1| PREDICTED: glutathione S-transferase theta-1-like [Taeniopygia 
guttata]
Length=241

 Score =   129 bits (324),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 65/153 (42%), Positives = 87/153 (57%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M ++LY+D +SQP RAL IF ++N I FE  ++Q+AKGQH+T E+  +N + +VPA+ DG
Sbjct  1    MGLELYLDLLSQPCRALYIFARSNKIPFEFKRVQLAKGQHKTEEFRKVNVLMKVPALRDG  60

Query  286  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  465
             F L ES A L YL       DHWYP+DLQKRA+VD    W H N+R   +    +  L 
Sbjct  61   SFTLAESIAILLYLVQKFKTPDHWYPSDLQKRARVDEYLSWQHVNIRAKGSKLFLSKVLL  120

Query  466  PAF-GLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            P   G P  P       + L   L   E  +LQ
Sbjct  121  PLITGQPLPPEKLQFVTEELNVVLKQFEEKFLQ  153



>ref|XP_011400420.1| Glutathione S-transferase theta-2B [Auxenochlorella protothecoides]
 gb|KFM27453.1| Glutathione S-transferase theta-2B [Auxenochlorella protothecoides]
Length=702

 Score =   134 bits (338),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 70/165 (42%), Positives = 98/165 (59%), Gaps = 3/165 (2%)
 Frame = +1

Query  73   RWSPPER-DREEMAVK-LYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAA  246
            R +P +R DR  M    LY D +SQP RA+++ C+ NGID E   I I +G+HR+ ++ A
Sbjct  448  RSNPRDRPDRSTMPRPVLYADMLSQPCRAVVVLCQQNGIDVEIKPISIGRGEHRSADFKA  507

Query  247  INPMKQVPAVVDGDFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLR  426
            +NP+ ++P +VDGD  + +S A L YL   N V D+WYPAD  K+A+V++V  WH S LR
Sbjct  508  VNPLCKLPYLVDGDVHIGDSIAILIYLCTVNRVPDNWYPADPVKQARVNTVLGWHGSTLR  567

Query  427  RGAAGYVFNTALAPAFGLPCN-PHAAAEAEKVLLASLGTLESFWL  558
             G+   +FN  LAP  G P N P         L  +L T+   WL
Sbjct  568  TGSTITIFNRVLAPLRGTPSNEPLVKDFGLPTLQTALQTINDVWL  612



>ref|XP_790223.2| PREDICTED: glutathione S-transferase theta-1-like [Strongylocentrotus 
purpuratus]
Length=227

 Score =   128 bits (322),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 64/154 (42%), Positives = 87/154 (56%), Gaps = 3/154 (2%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M +K+YVD  SQP RAL++F K + I  E V++ + KG  + PE+AAINP+KQ PA+ DG
Sbjct  1    MVIKVYVDLGSQPCRALVVFLKHSSIPHEIVELDLGKGDQKKPEFAAINPLKQFPAIKDG  60

Query  286  DFKLFESHAALKYLAA--ANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTA  459
            DF L E+ A  +YL        +DHWYPAD  +RAKVD    +HH  +R           
Sbjct  61   DFCLAETVAIFRYLTTQFPKSFSDHWYPADPHRRAKVDEYLSFHHQGIRAPVDAVFMTEV  120

Query  460  LAPAF-GLPCNPHAAAEAEKVLLASLGTLESFWL  558
            + P   G P +P    E EKV+  +L   E  +L
Sbjct  121  MLPIITGKPLSPEKMKEEEKVMREALAKFERVFL  154



>ref|XP_007063803.1| PREDICTED: glutathione S-transferase theta-1-like [Chelonia mydas]
Length=242

 Score =   129 bits (323),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 65/153 (42%), Positives = 87/153 (57%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M ++LY+D +SQP R + IF K N I FE   +++ KGQH   E+  +N +K+VPA+ DG
Sbjct  1    MGLELYLDLLSQPCRTVYIFAKKNNIPFEFKHVELFKGQHYREEFGKVNILKKVPALKDG  60

Query  286  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  465
             F L ES A L YL+      DHWYP+D+QKRA+VD    WHH+N+R  A   ++   L 
Sbjct  61   VFTLAESTAILLYLSRKYNTPDHWYPSDIQKRARVDEYLSWHHTNIRANAPKTLWIKVLI  120

Query  466  PAF-GLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            P F G    P    E    L  SL   E  +LQ
Sbjct  121  PLFTGQTLPPEKLQEVMDELAISLKQFEEKFLQ  153



>ref|XP_006106312.1| PREDICTED: glutathione S-transferase theta-1-like [Myotis lucifugus]
Length=240

 Score =   129 bits (323),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 64/148 (43%), Positives = 87/148 (59%), Gaps = 1/148 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M ++LY+D +SQP RA+ IF K NGI FE   +++ KGQH +  +  +NP+K+VPA+ DG
Sbjct  1    MGLELYLDLLSQPCRAVYIFAKKNGIPFELRTVELLKGQHLSDAFVQVNPLKKVPALKDG  60

Query  286  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  465
            DF L ES A L YL     V DHWYP +LQ RA+VD    W H+ LR+     ++   + 
Sbjct  61   DFTLTESVAILLYLTRKFKVPDHWYPQELQARARVDEYMAWQHTTLRKNCLRTLWYKVMF  120

Query  466  PAF-GLPCNPHAAAEAEKVLLASLGTLE  546
            P F G P +P   A     L A+L   E
Sbjct  121  PVFLGEPVSPETLAATLAELDATLQIFE  148



>ref|XP_006213356.1| PREDICTED: glutathione S-transferase theta-1-like isoform X1 
[Vicugna pacos]
Length=240

 Score =   128 bits (322),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 66/153 (43%), Positives = 89/153 (58%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M ++LY+D +SQP RA+ IF K N I FE   + + KGQH +  +A I+P+++VP + DG
Sbjct  1    MGLELYLDLLSQPCRAVYIFAKKNSIPFELRTVDLRKGQHLSDAFAQISPLQKVPVLKDG  60

Query  286  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  465
            DF L ES A L YL     V DHWYP DLQ RA+VD    W H+ LRR     +++  + 
Sbjct  61   DFTLTESVAILLYLTRKYKVPDHWYPQDLQARARVDEYLAWQHTALRRNCLRALWHKVML  120

Query  466  PAF-GLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            P F G P +P   A     L  +L  LE  +LQ
Sbjct  121  PVFLGEPVSPEMLAATLAELDVTLQVLEDKFLQ  153



>ref|XP_005334521.1| PREDICTED: glutathione S-transferase theta-1-like [Ictidomys 
tridecemlineatus]
Length=240

 Score =   128 bits (322),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 66/153 (43%), Positives = 87/153 (57%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M ++LY+D MSQP RA+ IF K NGI F+   +++ KGQH T  +  +NP+++VPA+ DG
Sbjct  1    MGLELYLDLMSQPCRAVYIFAKKNGIPFQLRTVELLKGQHYTDSFGQVNPLRKVPALKDG  60

Query  286  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  465
            DF L ES A L YL+      DHWYP DLQ RA+VD    W H+ LR      ++   L 
Sbjct  61   DFTLAESVAILLYLSRKYKAPDHWYPQDLQARARVDEYLSWQHTTLRSCCTRAMWQKMLF  120

Query  466  PAF-GLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            P F G P  P   A     L   L  LE  +L+
Sbjct  121  PVFLGQPVPPETLAATLAELDRCLQLLEDKFLR  153



>ref|XP_001929409.1| PREDICTED: glutathione S-transferase theta-1-like isoform X1 
[Sus scrofa]
Length=240

 Score =   128 bits (322),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 65/153 (42%), Positives = 89/153 (58%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M ++LY+D +SQP RA+ IF K NGI FE   + + KGQH + ++A +NP+++VPA+ DG
Sbjct  1    MVLELYLDLLSQPCRAVYIFAKKNGIPFELRTVDLLKGQHFSDDFAQVNPLRKVPALKDG  60

Query  286  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  465
            DF L ES A L YL+      DHWYP DLQ RA+VD    W H++L+      ++   L 
Sbjct  61   DFTLAESVAILLYLSRKYEAPDHWYPQDLQTRARVDEYLSWQHTDLQTSCIRTMWQKMLL  120

Query  466  PAF-GLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            P F G P  P   A     L   L  LE  +L+
Sbjct  121  PVFLGQPVPPETLASTLAKLDRCLQLLEDKFLK  153



>ref|XP_005987168.1| PREDICTED: glutathione S-transferase theta-1-like isoform X3 
[Latimeria chalumnae]
Length=242

 Score =   128 bits (322),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 66/152 (43%), Positives = 89/152 (59%), Gaps = 1/152 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            MA++LY D +SQP RAL IF +  G+ +   +  + +G+H++ EYA INPM+ +PA+V+ 
Sbjct  1    MALELYSDLLSQPCRALAIFLRVLGVPYTTRKTSLLEGEHKSAEYARINPMQSIPAMVEE  60

Query  286  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  465
             F L ES A +KYLAA     DHWYPAD+++RAKVD    WHH   RR A        L 
Sbjct  61   GFVLTESVAIIKYLAARYNAPDHWYPADVRRRAKVDEYLAWHHLQTRRHAMKVFILEGLL  120

Query  466  PAF-GLPCNPHAAAEAEKVLLASLGTLESFWL  558
            P   GLP      A A   L+  L  LE+ +L
Sbjct  121  PKLTGLPVEEEKLATALAELVEVLDKLETMFL  152



>gb|AAX29474.1| glutathione S-transferase theta 1 [synthetic construct]
Length=241

 Score =   128 bits (321),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 67/153 (44%), Positives = 89/153 (58%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M ++LY+D +SQP RA+ IF K N I FE   + + KGQH +   A +NP+K+VPA+ DG
Sbjct  1    MGLELYLDLLSQPCRAVYIFAKKNDIPFELRIVDLIKGQHLSDACAQVNPLKKVPALKDG  60

Query  286  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  465
            DF L ES A L YL     V D+WYP DLQ RA+VD    W H+ LRR     +++  + 
Sbjct  61   DFTLTESVAILLYLTRKYKVPDYWYPQDLQARARVDEYLAWQHTTLRRSCLRALWHKVMF  120

Query  466  PAF-GLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            P F G P +P   A     L  +L  LE  +LQ
Sbjct  121  PVFLGEPVSPQTLAATLAELDVTLQLLEDKFLQ  153



>gb|AAH07065.1| Glutathione S-transferase theta 1 [Homo sapiens]
 gb|ABM84406.1| glutathione S-transferase theta 1 [synthetic construct]
 gb|ABM87756.1| glutathione S-transferase theta 1 [synthetic construct]
 gb|AIC54513.1| GSTT1, partial [synthetic construct]
Length=240

 Score =   127 bits (320),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 67/153 (44%), Positives = 89/153 (58%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M ++LY+D +SQP RA+ IF K N I FE   + + KGQH +   A +NP+K+VPA+ DG
Sbjct  1    MGLELYLDLLSQPCRAVYIFAKKNDIPFELRIVDLIKGQHLSDACAQVNPLKKVPALKDG  60

Query  286  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  465
            DF L ES A L YL     V D+WYP DLQ RA+VD    W H+ LRR     +++  + 
Sbjct  61   DFTLTESVAILLYLTRKYKVPDYWYPQDLQARARVDEYLAWQHTTLRRSCLRALWHKVMF  120

Query  466  PAF-GLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            P F G P +P   A     L  +L  LE  +LQ
Sbjct  121  PVFLGEPVSPQTLAATLAELDVTLQLLEDKFLQ  153



>ref|XP_005288627.1| PREDICTED: glutathione S-transferase theta-1-like [Chrysemys 
picta bellii]
Length=242

 Score =   127 bits (320),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 65/153 (42%), Positives = 87/153 (57%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M ++LY+D +SQP RA+ IF K N + FE   +++ KGQH   E+  +N +K+VPA+ DG
Sbjct  1    MGLELYLDLLSQPCRAVYIFAKKNNVPFEFKHVELFKGQHYREEFGKVNILKKVPALKDG  60

Query  286  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  465
             F L ES A L YL+      DHWYP+D QKRA+VD    WHH+N+R  A   ++   L 
Sbjct  61   VFTLAESTAILLYLSRKYNTPDHWYPSDTQKRARVDEYLSWHHTNIRGNAGKALWIKVLI  120

Query  466  PAF-GLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            P F G    P    E    L  SL   E  +LQ
Sbjct  121  PLFTGQTLPPEKLQEVMDELAISLKQFEEKFLQ  153



>ref|XP_011332867.1| PREDICTED: glutathione S-transferase theta-1-like [Cerapachys 
biroi]
 gb|EZA58046.1| Glutathione S-transferase theta-1 [Cerapachys biroi]
Length=229

 Score =   127 bits (319),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 65/153 (42%), Positives = 86/153 (56%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            MA+KLY D +SQPSRA+ IF K   I FE+  I + K +H +PEY  +NP K+VPA+   
Sbjct  1    MALKLYYDLLSQPSRAMYIFLKVCNIPFEKHIINLGKLEHFSPEYEQVNPFKKVPAIEHS  60

Query  286  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  465
             FKL ES   ++YL     V DHWYP D +++AKVD   +W H N R   + Y     L 
Sbjct  61   GFKLTESIGIMRYLCREFKVDDHWYPHDSKQQAKVDEYLEWQHLNTRLYGSTYFLVKFLN  120

Query  466  P-AFGLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            P     P  P   AE+E  L   L  +E+ WL+
Sbjct  121  PLMLNRPAKPEKVAESESRLSDCLDLIENIWLK  153



>ref|XP_005147828.1| PREDICTED: glutathione S-transferase theta-1-like [Melopsittacus 
undulatus]
Length=242

 Score =   127 bits (320),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 63/153 (41%), Positives = 89/153 (58%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M ++LY+D +SQP RAL IF ++N I FE  Q+++ KG+H+T E+  +N + +VPA+ DG
Sbjct  1    MGLELYLDLLSQPCRALYIFARSNNIPFEFKQVELIKGEHKTEEFQKVNLLMKVPAMRDG  60

Query  286  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLR-RGAAGYVFNTAL  462
             F L ES A L Y+       DHWYP+DLQKRA+VD    W H N+R +G+  ++    L
Sbjct  61   SFTLAESIAILLYMVRKFKTPDHWYPSDLQKRARVDEYLSWQHVNIRGKGSKVFLMKVLL  120

Query  463  APAFGLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
                G P  P     A + L   L   E  +LQ
Sbjct  121  PLLTGQPLPPEKLEGATEELNVVLKQFEDKFLQ  153



>ref|XP_005987166.1| PREDICTED: glutathione S-transferase theta-1-like isoform X1 
[Latimeria chalumnae]
 ref|XP_005987167.1| PREDICTED: glutathione S-transferase theta-1-like isoform X2 
[Latimeria chalumnae]
Length=242

 Score =   127 bits (319),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 66/152 (43%), Positives = 89/152 (59%), Gaps = 1/152 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            MA++LY D +SQP RAL IF +  G+ +   +  + +G+H++ EYA INPM+ +PA+V+ 
Sbjct  1    MALELYSDLLSQPCRALAIFLRVLGVPYTTRKTSLLEGEHKSAEYARINPMQSIPAMVEE  60

Query  286  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  465
             F L ES A +KYLAA     DHWYPAD+++RAKVD    WHH   RR A        L 
Sbjct  61   GFVLTESVAIIKYLAARYNAPDHWYPADVRRRAKVDEYLAWHHLQTRRHAMKVFILEGLL  120

Query  466  PAF-GLPCNPHAAAEAEKVLLASLGTLESFWL  558
            P   GLP      A A   L+  L  LE+ +L
Sbjct  121  PKLTGLPVEEEKLATALAELVEVLDKLETMFL  152



>gb|KFO57915.1| Glutathione S-transferase theta-1, partial [Corvus brachyrhynchos]
Length=240

 Score =   127 bits (319),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 64/153 (42%), Positives = 87/153 (57%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M ++LY+D +SQP RAL IF ++N    E  ++Q+AKGQH+T E+  +N + +VPA+ DG
Sbjct  1    MGLELYLDLLSQPCRALYIFARSNNNPLEFKRVQLAKGQHKTEEFQKVNVLMKVPALRDG  60

Query  286  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  465
             F L ES A L YL       DHWYP+DLQKRA+VD    W H+N+R   +       L 
Sbjct  61   SFTLAESIAILLYLVQKFKTPDHWYPSDLQKRARVDEYLSWQHANIRAKGSKLFLTKVLL  120

Query  466  PAF-GLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            P   G P  P     A + L  +L   E  +LQ
Sbjct  121  PLLTGQPLPPEKLEFATEELNVALKQFEEKFLQ  153



>ref|XP_005288626.1| PREDICTED: glutathione S-transferase theta-1-like [Chrysemys 
picta bellii]
Length=239

 Score =   127 bits (319),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 64/153 (42%), Positives = 86/153 (56%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M V+L++D  SQP RAL IF K N I FE   +++ KG H + E+  +N +K+VPA+ DG
Sbjct  1    MVVELFLDLRSQPCRALFIFAKKNNIPFEFKDVELLKGHHLSEEFGKVNVLKKVPALKDG  60

Query  286  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  465
             F L ES A L YL+      DHWYP+DLQKRA+VD    W H+ +R           L 
Sbjct  61   AFTLAESIAILLYLSRKFNTPDHWYPSDLQKRARVDEYLSWQHTTIREKGCKIFITKVLV  120

Query  466  P-AFGLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            P   G P +P    EA + L ++L   E  +LQ
Sbjct  121  PLVVGQPFSPEKLEEAVEELNSALKQFEEKFLQ  153



>ref|XP_004742534.1| PREDICTED: glutathione S-transferase theta-1-like isoform X2 
[Mustela putorius furo]
 ref|XP_004817181.1| PREDICTED: glutathione S-transferase theta-1-like [Mustela putorius 
furo]
Length=240

 Score =   127 bits (319),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 66/153 (43%), Positives = 89/153 (58%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M ++LY+D +SQP RA+ IF K NGI FE  Q+++ KGQH +  +A +NP+++VPA+ DG
Sbjct  1    MGLELYLDLLSQPCRAVYIFAKKNGIPFELRQVELLKGQHHSDAFAQVNPLRKVPALKDG  60

Query  286  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  465
            DF L ES A L YL+    V DHWYP DLQ RA+VD    W H+ LR      ++   + 
Sbjct  61   DFTLAESVAILLYLSRKYEVPDHWYPQDLQARARVDEYLAWQHTALRSSCTRAMWQKMMF  120

Query  466  PAF-GLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            P F G    P   A     L   L  LE  +L+
Sbjct  121  PVFLGEQVPPETLASTLAELDRCLQLLEDKFLK  153



>ref|XP_008630325.1| PREDICTED: glutathione S-transferase theta-1-like [Corvus brachyrhynchos]
Length=244

 Score =   127 bits (319),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 64/153 (42%), Positives = 87/153 (57%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M ++LY+D +SQP RAL IF ++N    E  ++Q+AKGQH+T E+  +N + +VPA+ DG
Sbjct  1    MGLELYLDLLSQPCRALYIFARSNNNPLEFKRVQLAKGQHKTEEFQKVNVLMKVPALRDG  60

Query  286  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  465
             F L ES A L YL       DHWYP+DLQKRA+VD    W H+N+R   +       L 
Sbjct  61   SFTLAESIAILLYLVQKFKTPDHWYPSDLQKRARVDEYLSWQHANIRAKGSKLFLTKVLL  120

Query  466  PAF-GLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            P   G P  P     A + L  +L   E  +LQ
Sbjct  121  PLLTGQPLPPEKLEFATEELNVALKQFEEKFLQ  153



>ref|XP_003639976.1| PREDICTED: glutathione S-transferase theta-1-like [Canis lupus 
familiaris]
Length=240

 Score =   127 bits (319),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 58/123 (47%), Positives = 79/123 (64%), Gaps = 0/123 (0%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M ++LY+D +SQP RA+ IF K NGI FE   +++ KGQH +  +A +NP+K+VPA+ DG
Sbjct  1    MGLELYLDLLSQPCRAVYIFAKKNGIPFELRPVELLKGQHHSDAFAQVNPLKKVPALKDG  60

Query  286  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  465
            DF L ES A L YL+    V DHWYP DLQ RA+VD    W H+ LR      ++   ++
Sbjct  61   DFTLAESVAILLYLSRKYEVPDHWYPQDLQARARVDEYLAWQHTTLRSSCTRAMWQKMMS  120

Query  466  PAF  474
            P F
Sbjct  121  PVF  123



>ref|XP_005334522.1| PREDICTED: glutathione S-transferase theta-1-like [Ictidomys 
tridecemlineatus]
Length=240

 Score =   127 bits (319),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 64/153 (42%), Positives = 90/153 (59%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M ++LY+D +SQP RA+ IF K NGI F+   +++ KGQH +  +  +NP+K+VPA+ DG
Sbjct  1    MGLELYLDLLSQPCRAVYIFAKKNGIPFQLRTVELLKGQHLSDAFVQVNPLKKVPALKDG  60

Query  286  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  465
            DF L ES A L YL     V +HWYP DLQ RA+VD    W H+ LRR     +++  + 
Sbjct  61   DFILTESVAILLYLTHKYKVPEHWYPQDLQTRARVDEYLAWQHTTLRRNCLRALWHKVML  120

Query  466  PAF-GLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            P F G   +P    +    L  +L  LE  +LQ
Sbjct  121  PNFLGEQVSPKTLEDTVAELDVTLQLLEDKFLQ  153



>ref|XP_009090481.1| PREDICTED: glutathione S-transferase theta-1-like [Serinus canaria]
Length=241

 Score =   127 bits (318),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 65/153 (42%), Positives = 87/153 (57%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M +++Y+D +SQP RAL IF ++N I FE  ++Q+ KGQH+T E+  +N + +VPA+ DG
Sbjct  1    MGLEMYLDLLSQPCRALYIFARSNNIPFEFKRVQLTKGQHKTEEFRQVNVLMKVPALRDG  60

Query  286  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  465
             F L ES A L YLA      DHWYPADLQKRA+VD    W H ++R        +  L 
Sbjct  61   SFTLAESIAILLYLAQKFKTPDHWYPADLQKRARVDEYLSWQHVSIRAKGIKLFLSKVLL  120

Query  466  PAF-GLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            P   G P  P     A + L   L   E  +LQ
Sbjct  121  PLITGQPLPPEKLEFAIEELNVVLKQFEEKFLQ  153



>ref|XP_003281783.1| PREDICTED: glutathione S-transferase theta-1-like [Nomascus leucogenys]
Length=240

 Score =   127 bits (318),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 66/153 (43%), Positives = 89/153 (58%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M ++LY+D +SQP RA+ IF K N I FE   + + KGQH +  +A +NP+K+VPA+ D 
Sbjct  1    MGLELYLDLLSQPCRAVYIFAKKNDIPFELRIVDLIKGQHLSDAFAQVNPLKKVPALKDE  60

Query  286  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  465
            DF L ES A L YL     V D+WYP DLQ RA+VD    W H+ LRR     +++  + 
Sbjct  61   DFTLTESVAILLYLTRKYKVPDYWYPQDLQARARVDEYLAWQHTTLRRSCLRALWHKMMF  120

Query  466  PAF-GLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            P F G P +P   A     L  +L  LE  +LQ
Sbjct  121  PVFLGEPVSPQTLAATLAELDVTLQLLEDKFLQ  153



>ref|XP_006513055.1| PREDICTED: glutathione S-transferase, theta 3 isoform X1 [Mus 
musculus]
Length=200

 Score =   125 bits (315),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 66/153 (43%), Positives = 87/153 (57%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M ++LY+D MSQP RA+ IF K NGI F+   I++ KGQ  T  +A +NP+++VPA+ DG
Sbjct  1    MGLELYLDLMSQPCRAVYIFAKKNGIPFQLRTIELLKGQQYTDSFAQVNPLRKVPALKDG  60

Query  286  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  465
            DF L ES A L YL+      DHWYP DLQ RA+VD    W H+ LR      ++   + 
Sbjct  61   DFVLAESVAILLYLSRKYKAPDHWYPQDLQTRARVDEYLAWQHTALRSCCTRAMWQKMMF  120

Query  466  PAF-GLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            P F G P  P   A     L   L  LE  +L+
Sbjct  121  PVFLGQPVPPEMLASTLAELDGCLQVLEDKFLR  153



>ref|XP_010985616.1| PREDICTED: glutathione S-transferase theta-1 [Camelus dromedarius]
Length=240

 Score =   126 bits (317),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 65/153 (42%), Positives = 88/153 (58%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M ++LY+D +SQP RA+ IF K N I FE   + + KGQH +  +A I+P+++VP + DG
Sbjct  1    MGLELYLDLLSQPCRAVYIFAKKNSIPFELRTVDLRKGQHLSDAFAQISPLQKVPVLKDG  60

Query  286  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  465
            DF L ES A L Y+     V DHWYP DLQ RA+VD    W H  LRR     +++  + 
Sbjct  61   DFTLTESVAILLYMTRKYKVPDHWYPQDLQARARVDEYLAWQHMALRRNCLRALWHKVML  120

Query  466  PAF-GLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            P F G P +P   A     L  +L  LE  +LQ
Sbjct  121  PVFLGEPVSPEMLAATLAELDVTLQVLEDKFLQ  153



>gb|AEA86294.1| putative glutathione S-transferase theta-2 [Solanum nigrum]
Length=161

 Score =   124 bits (311),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 61/99 (62%), Positives = 70/99 (71%), Gaps = 1/99 (1%)
 Frame = +1

Query  268  PAVVDGDFKLFESHAALKYLAAA-NGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGY  444
            PA++DG FKL ESHA L+YLA A   +ADHWYPADL KRAKV+SV DWH +   RG   Y
Sbjct  1    PAIMDGRFKLSESHAILRYLACAFPRIADHWYPADLYKRAKVESVMDWHRTTFPRGPGSY  60

Query  445  VFNTALAPAFGLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
             F + LAPA GLP N  AAA  EK  +ASL T+ES WLQ
Sbjct  61   AFYSVLAPAVGLPLNTKAAARTEKNFIASLATIESVWLQ  99



>dbj|BAB22023.1| unnamed protein product [Mus musculus]
Length=240

 Score =   126 bits (317),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 66/153 (43%), Positives = 90/153 (59%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M ++LY+D +SQP RA+ IF K N I F+   +++ KG+H +  +A +NPMK+VPA++DG
Sbjct  1    MVLELYLDLLSQPRRAIYIFAKKNNIPFQMHTVELRKGEHLSDAFARVNPMKRVPAMMDG  60

Query  286  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  465
             F L ES A L YLA    V DHWYP DLQ RA+VD    W H+ LRR     +++  + 
Sbjct  61   GFTLCESVAILLYLAHKYKVPDHWYPQDLQARARVDEYLAWQHTGLRRSCLRALWHKVMF  120

Query  466  PAF-GLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            P F G    P   A     L  +L  LE  +LQ
Sbjct  121  PVFLGEQIPPETLAATLAELDVNLQVLEDKFLQ  153



>ref|XP_003508143.1| PREDICTED: glutathione S-transferase theta-1 [Cricetulus griseus]
 ref|XP_007619964.1| PREDICTED: glutathione S-transferase theta-1 [Cricetulus griseus]
 gb|EGW12153.1| Glutathione S-transferase theta-1 [Cricetulus griseus]
 gb|ERE92753.1| glutathione S-transferase theta-1-like protein [Cricetulus griseus]
Length=241

 Score =   126 bits (317),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 66/153 (43%), Positives = 88/153 (58%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M ++LY+D MSQP RA+ IF K N I F+   I++ KGQH T ++A +NP+++VPA+ DG
Sbjct  1    MGLELYLDLMSQPCRAVYIFAKKNDIPFQLRTIELLKGQHYTDDFAQVNPLRKVPALKDG  60

Query  286  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  465
            DF L ES A L YL+      DHWYP DLQ RA+VD    W H+ LR      ++   + 
Sbjct  61   DFILAESVAILLYLSRKYKAPDHWYPQDLQARARVDEYLSWQHTALRSCCTRAMWQKMMF  120

Query  466  PAF-GLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            P + G P  P   A     L   L  LE  +LQ
Sbjct  121  PKYLGQPVAPETLAATLAELDRCLQMLEDKFLQ  153



>ref|XP_797684.3| PREDICTED: glutathione S-transferase theta-1-like [Strongylocentrotus 
purpuratus]
Length=226

 Score =   125 bits (315),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 67/158 (42%), Positives = 92/158 (58%), Gaps = 7/158 (4%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M VK+YVD +SQP RAL++F K   I FE   I +  G H+ PE+  + P+  VPA+ DG
Sbjct  1    MVVKVYVDLLSQPCRALILFLKNTKIPFEIETINLNDGGHKKPEFVKMTPLCTVPAIQDG  60

Query  286  DFKLFESHAALKYLAA--ANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTA  459
            DF + E+ A ++YLA   A+ V DHWYP DL+KRA+VD    +HH+  R G  G  F+  
Sbjct  61   DFGMGETVAIIRYLATKYADLVPDHWYPKDLEKRARVDEYMAFHHTGTRGGCGGLFFSEV  120

Query  460  LAPAFGLPCNPHAAAEA----EKVLLASLGTLESFWLQ  561
            L P F      HA+ E     E+ +   L  LE+ +LQ
Sbjct  121  LIPVFS-GGKQHASEERLKRDEENMTKQLDKLENAFLQ  157



>ref|NP_598755.1| glutathione S-transferase, theta 3 [Mus musculus]
 gb|AAM33420.1|AF508157_1 glutathione S-transferase theta 3 [Mus musculus]
 gb|AAH03903.1| Glutathione S-transferase, theta 3 [Mus musculus]
 gb|AAH57964.1| Glutathione S-transferase, theta 3 [Mus musculus]
 dbj|BAE32415.1| unnamed protein product [Mus musculus]
 dbj|BAE40180.1| unnamed protein product [Mus musculus]
 dbj|BAE23741.1| unnamed protein product [Mus musculus]
 gb|EDL31889.1| glutathione S-transferase, theta 3 [Mus musculus]
Length=241

 Score =   126 bits (316),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 66/153 (43%), Positives = 87/153 (57%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M ++LY+D MSQP RA+ IF K NGI F+   I++ KGQ  T  +A +NP+++VPA+ DG
Sbjct  1    MGLELYLDLMSQPCRAVYIFAKKNGIPFQLRTIELLKGQQYTDSFAQVNPLRKVPALKDG  60

Query  286  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  465
            DF L ES A L YL+      DHWYP DLQ RA+VD    W H+ LR      ++   + 
Sbjct  61   DFVLAESVAILLYLSRKYKAPDHWYPQDLQTRARVDEYLAWQHTALRSCCTRAMWQKMMF  120

Query  466  PAF-GLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            P F G P  P   A     L   L  LE  +L+
Sbjct  121  PVFLGQPVPPEMLASTLAELDGCLQVLEDKFLR  153



>emb|CAA66665.1| glutathione S-transferase theta [Mus musculus]
Length=240

 Score =   126 bits (316),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 66/153 (43%), Positives = 90/153 (59%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M ++LY+D +SQP RA+ IF K N I F+   +++ KG+H +  +A +NPMK+VPA++DG
Sbjct  1    MVLELYLDLLSQPCRAIYIFAKKNNIPFQMHTVELRKGEHLSDAFARVNPMKKVPAMMDG  60

Query  286  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  465
             F L ES A L YLA    V DHWYP DLQ RA+VD    W H+ LRR     +++  + 
Sbjct  61   GFTLCESVAILLYLAHKYKVPDHWYPQDLQARARVDEYLAWQHTGLRRSCLRALWHKVMF  120

Query  466  PAF-GLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            P F G    P   A     L  +L  LE  +LQ
Sbjct  121  PVFLGEQIPPETLAATLAELDVNLQVLEDKFLQ  153



>ref|NP_032211.3| glutathione S-transferase theta-1 [Mus musculus]
 sp|Q64471.4|GSTT1_MOUSE RecName: Full=Glutathione S-transferase theta-1; AltName: Full=GST 
class-theta-1 [Mus musculus]
 gb|AAH12254.1| Glutathione S-transferase, theta 1 [Mus musculus]
 gb|AAH55020.1| Glutathione S-transferase, theta 1 [Mus musculus]
 gb|EDL31888.1| glutathione S-transferase, theta 1, isoform CRA_c [Mus musculus]
Length=240

 Score =   126 bits (316),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 66/153 (43%), Positives = 90/153 (59%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M ++LY+D +SQP RA+ IF K N I F+   +++ KG+H +  +A +NPMK+VPA++DG
Sbjct  1    MVLELYLDLLSQPCRAIYIFAKKNNIPFQMHTVELRKGEHLSDAFARVNPMKRVPAMMDG  60

Query  286  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  465
             F L ES A L YLA    V DHWYP DLQ RA+VD    W H+ LRR     +++  + 
Sbjct  61   GFTLCESVAILLYLAHKYKVPDHWYPQDLQARARVDEYLAWQHTGLRRSCLRALWHKVMF  120

Query  466  PAF-GLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            P F G    P   A     L  +L  LE  +LQ
Sbjct  121  PVFLGEQIPPETLAATLAELDVNLQVLEDKFLQ  153



>ref|XP_006048174.1| PREDICTED: glutathione S-transferase theta-1-like [Bubalus bubalis]
Length=240

 Score =   125 bits (315),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 66/153 (43%), Positives = 89/153 (58%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M ++LY+D +SQP RA+ IF K N I FE   + + KGQH +  +A +NP+++VP + DG
Sbjct  1    MGLELYLDLLSQPCRAIYIFAKKNRIPFELRTVDLRKGQHLSDAFAQVNPLQKVPVLKDG  60

Query  286  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  465
            DF L ES A L YLA    V DHWYP DLQ  A+VD    W H+ LRR     +++  + 
Sbjct  61   DFILTESVAILLYLARKYKVPDHWYPQDLQACARVDEYLAWQHTALRRNCLRALWHKVML  120

Query  466  PAF-GLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            P F G P +P   A     L  +L  LE  +LQ
Sbjct  121  PVFLGEPVSPEMLATTLAELDMALQVLEGKFLQ  153



>ref|XP_005396465.1| PREDICTED: glutathione S-transferase theta-1-like [Chinchilla 
lanigera]
Length=240

 Score =   125 bits (315),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 63/148 (43%), Positives = 88/148 (59%), Gaps = 6/148 (4%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M ++LY+D MSQP RA+ IF K NGI F+   +++ KGQH T  +A INP+++VPA+ DG
Sbjct  1    MGLELYLDLMSQPCRAVYIFAKKNGIPFQLRTVELLKGQHYTDSFAQINPLRKVPALKDG  60

Query  286  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  465
            DF L ES A L YL+      DHWYP DLQ RA+VD    W H+ LR   +  ++   + 
Sbjct  61   DFTLAESVAILLYLSRKYKTPDHWYPQDLQARARVDEFLSWQHTALRSCCSRAMWQKMMF  120

Query  466  PAFGLPCNPHAAAEAEKVLLASLGTLES  549
            P       P      ++ LL++L  L+S
Sbjct  121  PVVMRQPVP------QETLLSTLAELDS  142



>ref|XP_004636372.1| PREDICTED: glutathione S-transferase theta-1-like [Octodon degus]
Length=240

 Score =   125 bits (315),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 57/122 (47%), Positives = 77/122 (63%), Gaps = 0/122 (0%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M ++LY+D MSQP RA+ IFCK NGI F+   +++ KGQH T  +A +NP+++VPA+ DG
Sbjct  1    MGLELYLDLMSQPCRAVYIFCKKNGIPFQLRPVELLKGQHYTDSFAQVNPLRKVPALKDG  60

Query  286  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  465
            DF L ES A L YL+      DHWYP DLQ RA+VD    W H+ LR      ++   + 
Sbjct  61   DFTLAESVAILLYLSRKYKTPDHWYPQDLQARARVDEFLSWQHTALRSCCLRAMWQKMMF  120

Query  466  PA  471
            P 
Sbjct  121  PV  122



>ref|XP_008248399.1| PREDICTED: glutathione S-transferase theta-1-like isoform X2 
[Oryctolagus cuniculus]
Length=198

 Score =   124 bits (312),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 62/139 (45%), Positives = 80/139 (58%), Gaps = 3/139 (2%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M ++LY+D MSQP RA+ IF K NGI F+   + + KGQH T  +  +NP+++VPA+ DG
Sbjct  1    MGLELYLDLMSQPCRAVYIFAKKNGIPFQLCPVDLLKGQHYTESFTQVNPLRKVPALKDG  60

Query  286  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  465
            DF L ES A L YL+      DHWYP DLQ RA+VD    W H+ LR       +   L 
Sbjct  61   DFTLAESVAILLYLSRKYKAPDHWYPQDLQARARVDEYLSWQHTTLRSCCTRATWQKLLF  120

Query  466  PAF---GLPCNPHAAAEAE  513
            P F    +P    AA  AE
Sbjct  121  PVFLGQAVPPETLAATLAE  139



>gb|EMP32140.1| Glutathione S-transferase theta-1 [Chelonia mydas]
Length=388

 Score =   129 bits (323),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 68/164 (41%), Positives = 91/164 (55%), Gaps = 3/164 (2%)
 Frame = +1

Query  73   RWSPPERDREEMAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAIN  252
            RW   +  R  M ++LY+D +SQP R + IF K N I FE   +++ KGQH   E+  +N
Sbjct  138  RWRAEDAGR--MGLELYLDLLSQPCRTVYIFAKKNNIPFEFKHVELFKGQHYREEFGKVN  195

Query  253  PMKQVPAVVDGDFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRG  432
             +K+VPA+ DG F L ES A L YL+      DHWYP+D+QKRA+VD    WHH+N+R  
Sbjct  196  ILKKVPALKDGVFTLAESTAILLYLSRKYNTPDHWYPSDIQKRARVDEYLSWHHTNIRAN  255

Query  433  AAGYVFNTALAPAF-GLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            A   ++   L P F G    P    E    L  SL   E  +LQ
Sbjct  256  APKTLWIKVLIPLFTGQTLPPEKLQEVMDELAISLKQFEEKFLQ  299


 Score = 70.9 bits (172),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 43/70 (61%), Gaps = 0/70 (0%)
 Frame = +1

Query  217  GQHRTPEYAAINPMKQVPAVVDGDFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDS  396
            GQ  +  +  +N +++VPA+ DGDF L ES A L YL+      DHWYP D++KRA VD 
Sbjct  8    GQQHSDGFGKVNVLRKVPALKDGDFTLPESPAILAYLSQKYKTPDHWYPLDMKKRAWVDE  67

Query  397  VCDWHHSNLR  426
               W HS +R
Sbjct  68   YLAWQHSAIR  77



>ref|XP_004742535.1| PREDICTED: glutathione S-transferase theta-1-like isoform X1 
[Mustela putorius furo]
 ref|XP_004817179.1| PREDICTED: glutathione S-transferase theta-1-like isoform X1 
[Mustela putorius furo]
Length=240

 Score =   125 bits (315),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 65/153 (42%), Positives = 89/153 (58%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M ++LY+D +SQP RA+ IF K N I FE   + + KGQH +  +A +NP+K+VPA+ DG
Sbjct  1    MGLELYLDLLSQPCRAIYIFAKKNRIPFELRPVDLLKGQHLSDAFARVNPLKKVPALKDG  60

Query  286  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  465
            DF L ES A L YL     V +HWYP D+Q RA VD    W H+ LRR     +++  + 
Sbjct  61   DFTLAESVAILLYLTRKYKVPEHWYPQDVQARALVDEYLAWQHTTLRRSCLRALWHKVMF  120

Query  466  PAF-GLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            P F G P +P   A     L  ++  LE  +LQ
Sbjct  121  PVFLGEPVSPEMLAATLAELDVTMQLLEDKFLQ  153



>ref|XP_007906035.1| PREDICTED: LOW QUALITY PROTEIN: glutathione S-transferase theta-1-like 
[Callorhinchus milii]
Length=242

 Score =   125 bits (315),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 66/153 (43%), Positives = 85/153 (56%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M +++Y+D  SQP R++ +F K     FE   + +  GQ  + EYA INP +QVPA+ DG
Sbjct  1    MGLEMYLDLNSQPCRSVFLFAKKTRXPFEFKHVSLFTGQQHSEEYAKINPKRQVPAIKDG  60

Query  286  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLR-RGAAGYVFNTAL  462
            DF L ES A LKYLA      DHWYP DLQKRA+VD    W HS +R  G+  ++F   L
Sbjct  61   DFTLSESVAILKYLARKYQTPDHWYPNDLQKRARVDEYLAWQHSTVRPHGSKVFMFKLLL  120

Query  463  APAFGLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
                G P        A + L  SL T E  +LQ
Sbjct  121  PALTGEPIPEVKVQAALEDLRGSLKTFEEIYLQ  153



>gb|KDR15740.1| Glutathione S-transferase theta-1 [Zootermopsis nevadensis]
Length=226

 Score =   125 bits (314),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 63/154 (41%), Positives = 91/154 (59%), Gaps = 1/154 (1%)
 Frame = +1

Query  103  EMAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVD  282
            +M +KLY + +SQPSRA+ +  KAN I  E   + +AKG+H + EY  +NP+K+VP + D
Sbjct  4    KMPLKLYGNLLSQPSRAVFMLLKANQIPHEFKFVDMAKGEHLSEEYEKLNPLKKVPVIED  63

Query  283  GDFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTAL  462
              F L ES A L+YL     V DHWYP D +++AKVD   +W H + R   + Y  +  L
Sbjct  64   NGFILRESVAILRYLCREKNVPDHWYPKDNKQQAKVDEYLEWQHLDTRLNCSMYFQHKFL  123

Query  463  APAF-GLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
             P   G P N    AE E+ +  +LG +E+ WL+
Sbjct  124  IPLIKGEPPNEKKVAEFERRMKTTLGLIENVWLE  157



>ref|NP_001039697.1| glutathione S-transferase theta-1 [Bos taurus]
 sp|Q2NL00.3|GSTT1_BOVIN RecName: Full=Glutathione S-transferase theta-1; AltName: Full=GST 
class-theta-1 [Bos taurus]
 gb|AAI11290.1| Glutathione S-transferase theta 1 [Bos taurus]
 tpg|DAA20393.1| TPA: glutathione S-transferase theta-1 [Bos taurus]
Length=240

 Score =   125 bits (315),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 66/153 (43%), Positives = 89/153 (58%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M ++LY+D +SQP RA+ IF K N I FE   + + KGQH +  +A +NP+++VP + DG
Sbjct  1    MGLELYLDLLSQPCRAIYIFAKKNRIPFELRTVDLRKGQHLSDAFAQVNPLQKVPILKDG  60

Query  286  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  465
            DF L ES A L YLA    V DHWYP DLQ  A+VD    W H+ LRR     +++  + 
Sbjct  61   DFILTESVAILLYLARKYKVPDHWYPQDLQACARVDEYLAWQHTALRRNCLRALWHKVML  120

Query  466  PAF-GLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            P F G P +P   A     L  +L  LE  +LQ
Sbjct  121  PVFLGEPVSPEMLATTLAELDMALQVLEGKFLQ  153



>ref|XP_001195869.2| PREDICTED: glutathione S-transferase theta-1-like isoform 1 [Strongylocentrotus 
purpuratus]
Length=224

 Score =   125 bits (314),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 61/153 (40%), Positives = 92/153 (60%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M+VK++ D MSQP+R++L+F +AN I +    I + K +H++ EYAA+NPMK++PA+ DG
Sbjct  1    MSVKIFYDLMSQPARSVLMFARANKIPYTPCPIAMRKSEHQSEEYAAVNPMKKIPAMQDG  60

Query  286  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  465
            +FKL ES +  KYL      ADHW+P  LQ+R++V+   DW H N R           + 
Sbjct  61   EFKLTESVSITKYLHEKFDCADHWFPKSLQQRSRVNEYLDWQHFNTRPRMTKVFLAEVIF  120

Query  466  PAF-GLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            P   G P +P A A   + +  +L  LE  +L+
Sbjct  121  PRMTGTPADPAALAPDIQRIEETLDNLEKHFLK  153



>ref|XP_010858349.1| PREDICTED: glutathione S-transferase theta-1 isoform X1 [Bison 
bison bison]
Length=240

 Score =   125 bits (315),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 66/153 (43%), Positives = 89/153 (58%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M ++LY+D +SQP RA+ IF K N I FE   + + KGQH +  +A +NP+++VP + DG
Sbjct  1    MGLELYLDLLSQPCRAIYIFAKKNRIAFELRTVDLRKGQHLSDAFAQVNPLQKVPVLKDG  60

Query  286  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  465
            DF L ES A L YLA    V DHWYP DLQ  A+VD    W H+ LRR     +++  + 
Sbjct  61   DFILTESVAILLYLARKYKVPDHWYPQDLQACARVDEYLAWQHTALRRNCLRALWHKVML  120

Query  466  PAF-GLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            P F G P +P   A     L  +L  LE  +LQ
Sbjct  121  PVFLGEPVSPEMLATTLAELDMALQVLEGKFLQ  153



>ref|XP_008248398.1| PREDICTED: glutathione S-transferase theta-1-like isoform X1 
[Oryctolagus cuniculus]
Length=208

 Score =   124 bits (312),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 62/139 (45%), Positives = 80/139 (58%), Gaps = 3/139 (2%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M ++LY+D MSQP RA+ IF K NGI F+   + + KGQH T  +  +NP+++VPA+ DG
Sbjct  1    MGLELYLDLMSQPCRAVYIFAKKNGIPFQLCPVDLLKGQHYTESFTQVNPLRKVPALKDG  60

Query  286  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  465
            DF L ES A L YL+      DHWYP DLQ RA+VD    W H+ LR       +   L 
Sbjct  61   DFTLAESVAILLYLSRKYKAPDHWYPQDLQARARVDEYLSWQHTTLRSCCTRATWQKLLF  120

Query  466  PAF---GLPCNPHAAAEAE  513
            P F    +P    AA  AE
Sbjct  121  PVFLGQAVPPETLAATLAE  139



>ref|XP_010953752.1| PREDICTED: glutathione S-transferase theta-2 isoform X1 [Camelus 
bactrianus]
 ref|XP_010985618.1| PREDICTED: glutathione S-transferase theta-1-like isoform X2 
[Camelus dromedarius]
Length=208

 Score =   124 bits (312),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 57/123 (46%), Positives = 77/123 (63%), Gaps = 0/123 (0%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M ++LY+D +SQP RA+ IF K NGI FE   + + KGQH + ++A +NP+K+VPA+ DG
Sbjct  1    MGLELYLDLLSQPCRAVYIFAKKNGIPFELRTVDLLKGQHHSDDFAQVNPLKKVPALKDG  60

Query  286  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  465
            DF L ES A L YL+      DHWYP DLQ RA+VD    W H+ LR      ++   + 
Sbjct  61   DFTLAESVAILLYLSRKYETPDHWYPQDLQARARVDEYLAWQHTALRTSCTRTLWQKMMF  120

Query  466  PAF  474
            P F
Sbjct  121  PVF  123



>ref|XP_006640254.1| PREDICTED: glutathione S-transferase theta-1-like [Lepisosteus 
oculatus]
Length=228

 Score =   125 bits (313),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 65/152 (43%), Positives = 88/152 (58%), Gaps = 1/152 (1%)
 Frame = +1

Query  109  AVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDGD  288
            A+++Y+D +SQP RA+LIF K N I      + I KG +RTPE+  +NPM++VP +VD  
Sbjct  6    ALEVYLDLLSQPCRAVLIFLKHNNIPHTVKTVAIRKGDNRTPEFTKLNPMQKVPVIVDHG  65

Query  289  FKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLR-RGAAGYVFNTALA  465
            F L ES A LKYLA     A HWYP D ++RA+VD    WHH+N R R A  ++    L 
Sbjct  66   FVLTESDAILKYLATQYKTAAHWYPQDPERRARVDEYTAWHHTNTRPRAAKVFMLEVLLP  125

Query  466  PAFGLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
               G   +P     A   L  +L  LES +L+
Sbjct  126  RMTGQAPDPSKLERALTELDETLDKLESMFLK  157



>ref|XP_003994893.1| PREDICTED: glutathione S-transferase theta-1-like [Felis catus]
Length=240

 Score =   125 bits (314),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 66/153 (43%), Positives = 87/153 (57%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M ++LY+D +SQP RA+ IF K NGI FE   +++ KGQH +  +A +NP+K+VPA+ DG
Sbjct  1    MGLELYLDLISQPCRAVYIFAKKNGIPFELRTVELLKGQHHSDAFAQVNPLKKVPALKDG  60

Query  286  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  465
            DF L ES A L YL     V DHWYP DLQ RA+VD    W H+ LR      ++   + 
Sbjct  61   DFTLAESVAILLYLCRKYEVPDHWYPQDLQARARVDEYLAWQHTALRNSCTRAMWQKMMF  120

Query  466  PAF-GLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            P F G    P   A     L   L  LE  +L+
Sbjct  121  PVFLGEQVPPETLASTLAELERCLQLLEDKFLK  153



>ref|XP_006874993.1| PREDICTED: glutathione S-transferase theta-1-like [Chrysochloris 
asiatica]
Length=240

 Score =   125 bits (314),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 65/153 (42%), Positives = 87/153 (57%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M ++L++D +SQP RA+ IF K N I FE   +++ KGQH +  +A +NPM+QVPA+ DG
Sbjct  1    MGLELFLDLLSQPCRAVYIFAKRNRIPFELRTVELLKGQHHSDAFAQVNPMRQVPALKDG  60

Query  286  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  465
            DF L ES A L YL+      DHWYP DLQ RA+VD    W H+ LR      ++   + 
Sbjct  61   DFTLAESVAILLYLSRKYQTPDHWYPQDLQTRARVDEYLAWQHTALRYSCTRALWQKVMF  120

Query  466  PAF-GLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            P F G P  P   A     L   L  L+  +LQ
Sbjct  121  PVFLGEPVPPEMLAATLAKLDRCLQLLQDKFLQ  153



>ref|XP_007092374.1| PREDICTED: glutathione S-transferase theta-1-like [Panthera tigris 
altaica]
Length=240

 Score =   125 bits (314),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 66/153 (43%), Positives = 87/153 (57%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  MAVKLYVDRMSQPSRALLIFCKANGIDFEEVQIQIAKGQHRTPEYAAINPMKQVPAVVDG  285
            M ++LY+D +SQP RA+ IF K NGI FE   +++ KGQH +  +A +NP+K+VPA+ DG
Sbjct  1    MGLELYLDLISQPCRAVYIFAKKNGIPFELRTVELLKGQHHSDAFAQVNPLKKVPALKDG  60

Query  286  DFKLFESHAALKYLAAANGVADHWYPADLQKRAKVDSVCDWHHSNLRRGAAGYVFNTALA  465
            DF L ES A L YL     V DHWYP DLQ RA+VD    W H+ LR      ++   + 
Sbjct  61   DFTLAESVAILLYLCRKYEVPDHWYPQDLQARARVDEYLAWQHTALRNSCTRAMWQKMMF  120

Query  466  PAF-GLPCNPHAAAEAEKVLLASLGTLESFWLQ  561
            P F G    P   A     L   L  LE  +L+
Sbjct  121  PVFLGEQVPPETLASTLAELERCLQLLEDKFLK  153



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 644970849880