BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001N22

Length=543
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AHZ89386.1|  beta-amylase 1                                          123   3e-31   Nicotiana tabacum [American tobacco]
gb|AAY89374.1|  beta-amylase 1                                          127   5e-31   Nicotiana langsdorffii x Nicotiana sanderae
ref|XP_009596880.1|  PREDICTED: beta-amylase 1, chloroplastic-like      126   2e-30   Nicotiana tomentosiformis
gb|AII99838.1|  beta-amylase                                            125   3e-30   Nicotiana tabacum [American tobacco]
ref|XP_009785196.1|  PREDICTED: beta-amylase 1, chloroplastic-like      125   3e-30   Nicotiana sylvestris
ref|XP_006340896.1|  PREDICTED: beta-amylase 1, chloroplastic-like      123   2e-29   Solanum tuberosum [potatoes]
ref|XP_009608726.1|  PREDICTED: beta-amylase 1, chloroplastic-like      121   1e-28   Nicotiana tomentosiformis
gb|EYU43788.1|  hypothetical protein MIMGU_mgv1a021359mg                114   2e-27   Erythranthe guttata [common monkey flower]
ref|XP_009777267.1|  PREDICTED: beta-amylase 1, chloroplastic-like      117   2e-27   Nicotiana sylvestris
ref|NP_001234556.1|  beta-amylase                                       116   7e-27   
emb|CDP20299.1|  unnamed protein product                                112   1e-25   Coffea canephora [robusta coffee]
ref|XP_011091372.1|  PREDICTED: beta-amylase 1, chloroplastic           110   1e-24   Sesamum indicum [beniseed]
gb|EPS66628.1|  beta-amylase 1, chloroplastic                           108   6e-24   Genlisea aurea
ref|XP_010023784.1|  PREDICTED: beta-amylase 1, chloroplastic           101   1e-21   Eucalyptus grandis [rose gum]
gb|EPS61951.1|  beta-amylase                                          99.4    7e-21   Genlisea aurea
ref|XP_010666969.1|  PREDICTED: beta-amylase 1, chloroplastic         98.2    2e-20   Beta vulgaris subsp. vulgaris [field beet]
emb|CBI35772.3|  unnamed protein product                              96.7    8e-20   Vitis vinifera
emb|CAN71375.1|  hypothetical protein VITISV_002992                   95.1    2e-19   Vitis vinifera
ref|XP_002285569.1|  PREDICTED: beta-amylase 1, chloroplastic         95.1    2e-19   Vitis vinifera
ref|XP_004296549.1|  PREDICTED: beta-amylase 1, chloroplastic         92.4    2e-18   Fragaria vesca subsp. vesca
ref|XP_010263970.1|  PREDICTED: beta-amylase 1, chloroplastic-lik...  90.1    1e-17   Nelumbo nucifera [Indian lotus]
ref|XP_010263969.1|  PREDICTED: beta-amylase 1, chloroplastic-lik...  90.1    1e-17   
ref|XP_002518196.1|  Beta-amylase, putative                           87.0    2e-16   Ricinus communis
gb|AFQ33614.1|  beta-amylase 2                                        86.7    3e-16   Citrus trifoliata [hardy orange]
ref|XP_006851336.1|  hypothetical protein AMTR_s00050p00205080        86.3    3e-16   Amborella trichopoda
ref|XP_011073736.1|  PREDICTED: beta-amylase 1, chloroplastic-like    86.3    3e-16   Sesamum indicum [beniseed]
ref|XP_007035340.1|  Beta-amylase 1 isoform 1                         86.3    4e-16   
ref|XP_004515248.1|  PREDICTED: beta-amylase 1, chloroplastic-like    85.5    5e-16   Cicer arietinum [garbanzo]
ref|XP_008775132.1|  PREDICTED: beta-amylase 1, chloroplastic         85.5    6e-16   Phoenix dactylifera
ref|XP_006296695.1|  hypothetical protein CARUB_v10013332mg           85.1    7e-16   Capsella rubella
gb|KDO55739.1|  hypothetical protein CISIN_1g008030mg                 84.3    1e-15   Citrus sinensis [apfelsine]
ref|XP_006493994.1|  PREDICTED: beta-amylase 1, chloroplastic-like    84.3    2e-15   Citrus sinensis [apfelsine]
ref|XP_004134029.1|  PREDICTED: beta-amylase 1, chloroplastic-like    84.0    2e-15   Cucumis sativus [cucumbers]
ref|XP_006420416.1|  hypothetical protein CICLE_v10004620mg           83.6    2e-15   Citrus clementina [clementine]
ref|XP_010264799.1|  PREDICTED: beta-amylase 1, chloroplastic-like    83.6    3e-15   Nelumbo nucifera [Indian lotus]
ref|XP_011041480.1|  PREDICTED: beta-amylase 1, chloroplastic-like    83.6    3e-15   Populus euphratica
ref|XP_007035341.1|  Beta-amylase 1 isoform 2                         83.2    3e-15   
ref|XP_010466824.1|  PREDICTED: beta-amylase 1, chloroplastic iso...  83.2    3e-15   Camelina sativa [gold-of-pleasure]
ref|XP_010466823.1|  PREDICTED: beta-amylase 1, chloroplastic iso...  83.2    4e-15   Camelina sativa [gold-of-pleasure]
ref|XP_004166730.1|  PREDICTED: beta-amylase 1, chloroplastic-like    82.8    6e-15   
ref|XP_010918964.1|  PREDICTED: beta-amylase 1, chloroplastic         82.4    6e-15   Elaeis guineensis
ref|XP_010513371.1|  PREDICTED: beta-amylase 1, chloroplastic-like    82.4    7e-15   Camelina sativa [gold-of-pleasure]
ref|XP_011029718.1|  PREDICTED: beta-amylase 1, chloroplastic-like    82.0    8e-15   Populus euphratica
ref|XP_010488521.1|  PREDICTED: beta-amylase 1, chloroplastic-like    82.0    1e-14   Camelina sativa [gold-of-pleasure]
ref|XP_002314522.2|  hypothetical protein POPTR_0010s07340g           81.3    2e-14   Populus trichocarpa [western balsam poplar]
ref|XP_008224054.1|  PREDICTED: beta-amylase 1, chloroplastic         81.3    2e-14   Prunus mume [ume]
ref|XP_002885629.1|  beta-amylase 7                                   80.9    2e-14   Arabidopsis lyrata subsp. lyrata
gb|KFK39690.1|  hypothetical protein AALP_AA3G276400                  80.9    2e-14   Arabis alpina [alpine rockcress]
emb|CDX94831.1|  BnaC03g43570D                                        80.5    3e-14   
ref|XP_008342553.1|  PREDICTED: LOW QUALITY PROTEIN: beta-amylase...  80.5    3e-14   Malus domestica [apple tree]
ref|XP_002311706.1|  beta-amylase family protein                      79.7    5e-14   
ref|XP_008368604.1|  PREDICTED: beta-amylase 1, chloroplastic-like    77.4    6e-14   
ref|XP_006418770.1|  hypothetical protein EUTSA_v10002460mg           79.3    8e-14   Eutrema salsugineum [saltwater cress]
gb|KDP33360.1|  hypothetical protein JCGZ_12909                       78.6    2e-13   Jatropha curcas
ref|XP_009350111.1|  PREDICTED: beta-amylase 1, chloroplastic         78.2    2e-13   Pyrus x bretschneideri [bai li]
gb|KEH26842.1|  beta-amylase                                          74.3    3e-13   Medicago truncatula
gb|KJB34580.1|  hypothetical protein B456_006G073600                  77.4    4e-13   Gossypium raimondii
ref|XP_008438436.1|  PREDICTED: beta-amylase 1, chloroplastic-like    77.0    5e-13   Cucumis melo [Oriental melon]
ref|XP_010550849.1|  PREDICTED: beta-amylase 1, chloroplastic         76.6    6e-13   Tarenaya hassleriana [spider flower]
ref|XP_008391283.1|  PREDICTED: beta-amylase 1, chloroplastic-like    75.9    1e-12   
emb|CDY45566.1|  BnaC09g21440D                                        74.7    3e-12   Brassica napus [oilseed rape]
ref|NP_189034.1|  beta-amylase 1                                      74.7    3e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_001756520.1|  predicted protein                                73.9    4e-12   
ref|XP_009102529.1|  PREDICTED: beta-amylase 1, chloroplastic         73.9    5e-12   Brassica rapa
emb|CDX77441.1|  BnaA07g05790D                                        73.9    5e-12   
gb|KJB68813.1|  hypothetical protein B456_011G1809002                 70.5    8e-12   Gossypium raimondii
ref|XP_001768786.1|  predicted protein                                72.4    1e-11   
ref|XP_004511752.1|  PREDICTED: beta-amylase 3, chloroplastic-like    72.0    2e-11   Cicer arietinum [garbanzo]
ref|XP_010111574.1|  Beta-amylase 1                                   72.0    2e-11   Morus notabilis
gb|AAL37169.1|AF319168_1  putative chloroplast-targeted beta-amylase  70.5    6e-11   Brassica napus [oilseed rape]
ref|XP_003558837.1|  PREDICTED: beta-amylase 1, chloroplastic-like    70.5    7e-11   Brachypodium distachyon [annual false brome]
ref|XP_008460711.1|  PREDICTED: beta-amylase 1, chloroplastic         70.5    7e-11   Cucumis melo [Oriental melon]
gb|KHG16283.1|  Beta-amylase 1, chloroplastic -like protein           70.5    7e-11   Gossypium arboreum [tree cotton]
ref|XP_001778149.1|  predicted protein                                70.1    9e-11   
ref|XP_002517513.1|  Beta-amylase, putative                           69.3    1e-10   
ref|XP_004147196.1|  PREDICTED: beta-amylase 1, chloroplastic-like    69.3    1e-10   Cucumis sativus [cucumbers]
gb|ACG29617.1|  beta-amylase                                          68.9    2e-10   Zea mays [maize]
tpg|DAA43306.1|  TPA: beta-amylase                                    68.9    2e-10   
ref|NP_001148159.1|  beta-amylase                                     68.9    2e-10   
gb|KJB72487.1|  hypothetical protein B456_011G1810002                 66.2    2e-10   Gossypium raimondii
ref|XP_004985749.1|  PREDICTED: beta-amylase 1, chloroplastic-lik...  68.6    3e-10   
ref|XP_007155732.1|  hypothetical protein PHAVU_003G226900g           68.6    3e-10   Phaseolus vulgaris [French bean]
ref|XP_004985750.1|  PREDICTED: beta-amylase 1, chloroplastic-lik...  68.6    3e-10   Setaria italica
ref|XP_004508980.1|  PREDICTED: beta-amylase 3, chloroplastic-like    68.2    3e-10   Cicer arietinum [garbanzo]
gb|AFI56496.1|  beta-amylase                                          68.2    4e-10   Vaccinium corymbosum [American blueberry]
gb|KEH31589.1|  beta-amylase                                          68.2    4e-10   Medicago truncatula
ref|XP_006573703.1|  PREDICTED: beta-amylase 3, chloroplastic-like    67.8    5e-10   Glycine max [soybeans]
gb|KHN42645.1|  Beta-amylase 3, chloroplastic                         67.8    5e-10   Glycine soja [wild soybean]
ref|XP_003539125.1|  PREDICTED: beta-amylase 3, chloroplastic-lik...  67.8    5e-10   Glycine max [soybeans]
gb|AGT17079.1|  beta-amylase                                          67.4    7e-10   Saccharum hybrid cultivar R570
gb|EMT02663.1|  hypothetical protein F775_42276                       64.3    7e-10   
emb|CDP13430.1|  unnamed protein product                              67.4    7e-10   Coffea canephora [robusta coffee]
ref|XP_002468533.1|  hypothetical protein SORBIDRAFT_01g047500        67.4    8e-10   Sorghum bicolor [broomcorn]
ref|XP_003611408.1|  Beta-amylase                                     67.0    8e-10   Medicago truncatula
ref|XP_009135884.1|  PREDICTED: beta-amylase 1, chloroplastic-like    67.0    9e-10   Brassica rapa
ref|XP_007152599.1|  hypothetical protein PHAVU_004G143600g           67.0    1e-09   Phaseolus vulgaris [French bean]
ref|XP_003611409.1|  Beta-amylase                                     66.6    1e-09   Medicago truncatula
gb|ABK24605.1|  unknown                                               66.6    1e-09   Picea sitchensis
ref|XP_009413253.1|  PREDICTED: beta-amylase 3, chloroplastic         66.6    1e-09   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009612895.1|  PREDICTED: beta-amylase 3, chloroplastic         66.6    1e-09   Nicotiana tomentosiformis
emb|CAN62440.1|  hypothetical protein VITISV_032500                   66.6    1e-09   Vitis vinifera
ref|XP_002467119.1|  hypothetical protein SORBIDRAFT_01g019850        66.6    1e-09   Sorghum bicolor [broomcorn]
ref|XP_004147264.1|  PREDICTED: beta-amylase 3, chloroplastic-like    66.2    1e-09   Cucumis sativus [cucumbers]
ref|XP_009601320.1|  PREDICTED: beta-amylase 3, chloroplastic-like    66.2    2e-09   Nicotiana tomentosiformis
gb|AFK46577.1|  unknown                                               65.1    2e-09   Lotus japonicus
ref|XP_003524296.1|  PREDICTED: beta-amylase 3, chloroplastic-like    65.9    2e-09   Glycine max [soybeans]
gb|AFO84076.1|  beta-amylase                                          65.9    2e-09   Actinidia chinensis
ref|NP_001236350.1|  beta-amylase                                     65.9    2e-09   Glycine max [soybeans]
ref|XP_007039632.1|  Chloroplast beta-amylase isoform 4               65.5    2e-09   
ref|XP_009597851.1|  PREDICTED: beta-amylase 3, chloroplastic-like    65.5    2e-09   Nicotiana tomentosiformis
ref|XP_007039631.1|  Chloroplast beta-amylase isoform 3               65.5    3e-09   
emb|CBI33977.3|  unnamed protein product                              65.5    3e-09   Vitis vinifera
gb|ABR18773.1|  beta-amylase                                          63.9    3e-09   Boehmeria nivea [Chinese silk-plant]
ref|XP_002282871.1|  PREDICTED: beta-amylase 3, chloroplastic         65.5    3e-09   Vitis vinifera
ref|XP_008448759.1|  PREDICTED: beta-amylase 3, chloroplastic         65.5    3e-09   Cucumis melo [Oriental melon]
gb|EMS61458.1|  Beta-amylase 1, chloroplastic                         64.7    3e-09   Triticum urartu
ref|XP_009792527.1|  PREDICTED: beta-amylase 3, chloroplastic-like    65.1    3e-09   Nicotiana sylvestris
ref|XP_006362484.1|  PREDICTED: beta-amylase 3, chloroplastic-like    65.1    4e-09   Solanum tuberosum [potatoes]
ref|XP_009400488.1|  PREDICTED: beta-amylase 1, chloroplastic         65.1    4e-09   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009136825.1|  PREDICTED: beta-amylase 3, chloroplastic         65.1    4e-09   Brassica rapa
ref|XP_004982940.1|  PREDICTED: beta-amylase 1, chloroplastic-like    65.1    4e-09   
ref|XP_006838474.1|  hypothetical protein AMTR_s00002p00150440        65.1    4e-09   
ref|XP_004245844.1|  PREDICTED: beta-amylase 3, chloroplastic         65.1    4e-09   Solanum lycopersicum
gb|ACY25894.1|  beta-amylase 1                                        63.9    4e-09   Euphorbia esula [wolf's milk]
ref|XP_007039629.1|  Chloroplast beta-amylase isoform 1               64.7    5e-09   
gb|AHJ09602.1|  chloroplast beta-amylase 3                            64.7    5e-09   Camellia sinensis [black tea]
ref|XP_004244551.1|  PREDICTED: beta-amylase 3, chloroplastic-like    64.7    5e-09   Solanum lycopersicum
ref|XP_004300297.1|  PREDICTED: beta-amylase 3, chloroplastic         64.7    5e-09   Fragaria vesca subsp. vesca
ref|XP_006385589.1|  beta-amylase family protein                      64.7    5e-09   Populus trichocarpa [western balsam poplar]
ref|NP_001275172.1|  beta-amylase PCT-BMYI                            64.7    5e-09   Solanum tuberosum [potatoes]
gb|KDP45986.1|  hypothetical protein JCGZ_11889                       64.3    6e-09   Jatropha curcas
ref|XP_003574353.1|  PREDICTED: beta-amylase 3, chloroplastic         64.3    6e-09   Brachypodium distachyon [annual false brome]
ref|XP_003632025.2|  PREDICTED: beta-amylase 1, chloroplastic         64.3    6e-09   Vitis vinifera
gb|AAK96508.1|  AT4g17090/dl4575c                                     63.9    6e-09   Arabidopsis thaliana [mouse-ear cress]
gb|EAY88485.1|  hypothetical protein OsI_09956                        64.3    7e-09   Oryza sativa Indica Group [Indian rice]
ref|NP_001048926.1|  Os03g0141200                                     64.3    7e-09   
ref|NP_567523.1|  beta-amylase                                        64.3    7e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006285145.1|  hypothetical protein CARUB_v10006488mg           64.3    8e-09   Capsella rubella
ref|XP_010440058.1|  PREDICTED: beta-amylase 3, chloroplastic         64.3    8e-09   Camelina sativa [gold-of-pleasure]
ref|XP_002868085.1|  beta-amylase 8                                   64.3    8e-09   Arabidopsis lyrata subsp. lyrata
ref|XP_010449668.1|  PREDICTED: beta-amylase 3, chloroplastic-like    64.3    8e-09   Camelina sativa [gold-of-pleasure]
ref|XP_010434720.1|  PREDICTED: beta-amylase 3, chloroplastic-like    64.3    8e-09   Camelina sativa [gold-of-pleasure]
emb|CDY09643.1|  BnaC07g34180D                                        64.3    8e-09   Brassica napus [oilseed rape]
ref|XP_006414272.1|  hypothetical protein EUTSA_v10024842mg           64.3    8e-09   Eutrema salsugineum [saltwater cress]
emb|CAB46051.1|  putative beta-amylase                                63.9    8e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009397011.1|  PREDICTED: beta-amylase 3, chloroplastic-like    63.9    8e-09   Musa acuminata subsp. malaccensis [pisang utan]
gb|KFK45005.1|  hypothetical protein AALP_AA1G332100                  63.9    8e-09   Arabis alpina [alpine rockcress]
emb|CDX90487.1|  BnaA03g42940D                                        63.9    9e-09   
ref|XP_009772032.1|  PREDICTED: beta-amylase 3, chloroplastic-like    63.9    9e-09   Nicotiana sylvestris
emb|CDY35597.1|  BnaC01g21190D                                        63.9    9e-09   Brassica napus [oilseed rape]
ref|XP_009144721.1|  PREDICTED: beta-amylase 3, chloroplastic-like    63.9    9e-09   Brassica rapa
emb|CDY42960.1|  BnaA01g17940D                                        63.9    1e-08   Brassica napus [oilseed rape]
ref|XP_009802914.1|  PREDICTED: beta-amylase 3, chloroplastic-like    63.5    1e-08   Nicotiana sylvestris
gb|KJB51734.1|  hypothetical protein B456_008G230100                  63.5    1e-08   Gossypium raimondii
gb|KHG28698.1|  Beta-amylase 3, chloroplastic -like protein           63.5    1e-08   Gossypium arboreum [tree cotton]
gb|KJB39785.1|  hypothetical protein B456_007G030600                  63.2    2e-08   Gossypium raimondii
ref|XP_007223114.1|  hypothetical protein PRUPE_ppa005431mg           62.8    2e-08   
ref|XP_011032002.1|  PREDICTED: beta-amylase 3, chloroplastic-like    63.2    2e-08   Populus euphratica
ref|NP_001147532.1|  beta-amylase                                     63.2    2e-08   
ref|XP_006385389.1|  beta-amylase family protein                      62.8    2e-08   Populus trichocarpa [western balsam poplar]
ref|XP_010695452.1|  PREDICTED: beta-amylase 3, chloroplastic         62.8    2e-08   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010110537.1|  hypothetical protein L484_023371                 62.8    2e-08   Morus notabilis
ref|XP_011018667.1|  PREDICTED: beta-amylase 3, chloroplastic-like    62.8    2e-08   Populus euphratica
ref|XP_010055392.1|  PREDICTED: beta-amylase 3, chloroplastic         62.4    3e-08   Eucalyptus grandis [rose gum]
gb|AFO84077.1|  beta-amylase                                          62.4    3e-08   Actinidia chinensis
gb|EPS63004.1|  hypothetical protein M569_11781                       62.0    4e-08   Genlisea aurea
ref|XP_006844925.1|  hypothetical protein AMTR_s00058p00155330        62.0    4e-08   Amborella trichopoda
ref|XP_006477060.1|  PREDICTED: beta-amylase 3, chloroplastic iso...  62.0    4e-08   Citrus sinensis [apfelsine]
ref|XP_006477059.1|  PREDICTED: beta-amylase 3, chloroplastic iso...  61.6    5e-08   
ref|XP_009794895.1|  PREDICTED: beta-amylase 3, chloroplastic-like    61.6    5e-08   Nicotiana sylvestris
gb|ACY25895.1|  beta-amylase 2                                        60.5    5e-08   Euphorbia esula [wolf's milk]
emb|CDX93004.1|  BnaA03g37260D                                        61.6    5e-08   
gb|AFP89361.1|  beta-amylase                                          61.6    5e-08   Citrus limon [lemon]
gb|AFQ33613.1|  beta-amylase 1                                        61.6    6e-08   Citrus trifoliata [hardy orange]
ref|XP_006440139.1|  hypothetical protein CICLE_v10019566mg           61.2    6e-08   Citrus clementina [clementine]
dbj|BAJ96121.1|  predicted protein                                    60.8    1e-07   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ90222.1|  predicted protein                                    60.5    1e-07   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007209867.1|  hypothetical protein PRUPE_ppa003812mg           60.5    1e-07   Prunus persica
gb|EYU24930.1|  hypothetical protein MIMGU_mgv1a020099mg              60.5    1e-07   Erythranthe guttata [common monkey flower]
ref|XP_008794866.1|  PREDICTED: beta-amylase 3, chloroplastic         60.5    1e-07   Phoenix dactylifera
gb|EYU17858.1|  hypothetical protein MIMGU_mgv1a003946mg              60.1    1e-07   Erythranthe guttata [common monkey flower]
ref|XP_010531694.1|  PREDICTED: beta-amylase 3, chloroplastic-like    60.1    2e-07   Tarenaya hassleriana [spider flower]
ref|XP_008229498.1|  PREDICTED: beta-amylase 3, chloroplastic         60.1    2e-07   Prunus mume [ume]
ref|XP_011070282.1|  PREDICTED: beta-amylase 3, chloroplastic         60.1    2e-07   Sesamum indicum [beniseed]
ref|XP_009371857.1|  PREDICTED: beta-amylase 3, chloroplastic         59.7    2e-07   Pyrus x bretschneideri [bai li]
ref|XP_008373719.1|  PREDICTED: beta-amylase 3, chloroplastic         59.7    2e-07   
ref|XP_001782016.1|  predicted protein                                59.7    2e-07   
ref|XP_008361217.1|  PREDICTED: beta-amylase 3, chloroplastic-like    59.7    2e-07   
ref|XP_010919816.1|  PREDICTED: beta-amylase 3, chloroplastic iso...  59.3    3e-07   
ref|XP_010919815.1|  PREDICTED: beta-amylase 3, chloroplastic iso...  59.3    3e-07   Elaeis guineensis
ref|XP_010274550.1|  PREDICTED: beta-amylase 3, chloroplastic         58.9    4e-07   Nelumbo nucifera [Indian lotus]
ref|XP_004983616.1|  PREDICTED: beta-amylase 3, chloroplastic-lik...  58.2    8e-07   Setaria italica
ref|XP_004983617.1|  PREDICTED: beta-amylase 3, chloroplastic-lik...  58.2    8e-07   
ref|XP_006662612.1|  PREDICTED: beta-amylase 3, chloroplastic-like    57.0    1e-06   
tpg|DAA46353.1|  TPA: hypothetical protein ZEAMMB73_080734            56.6    2e-06   
gb|KIZ05231.1|  hypothetical protein MNEG_2733                        56.2    3e-06   Monoraphidium neglectum
gb|EMS55384.1|  Beta-amylase 1, chloroplastic                         55.8    3e-06   Triticum urartu
gb|AFW87826.1|  hypothetical protein ZEAMMB73_675891                  55.8    3e-06   
ref|XP_008658465.1|  PREDICTED: beta-amylase 3, chloroplastic-like    55.8    4e-06   Zea mays [maize]
ref|XP_002975660.1|  hypothetical protein SELMODRAFT_232533           55.5    5e-06   
dbj|BAJ95735.1|  predicted protein                                    55.5    5e-06   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002978844.1|  hypothetical protein SELMODRAFT_233213           55.5    5e-06   
emb|CAX51379.1|  beta-amylase                                         55.5    5e-06   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002464915.1|  hypothetical protein SORBIDRAFT_01g028700        55.1    7e-06   Sorghum bicolor [broomcorn]
gb|EMT09794.1|  Beta-amylase                                          55.1    8e-06   
ref|XP_008658990.1|  PREDICTED: uncharacterized protein LOC100502...  55.1    8e-06   
ref|XP_008364514.1|  PREDICTED: LOW QUALITY PROTEIN: beta-amylase...  54.7    8e-06   
ref|XP_003548316.1|  PREDICTED: beta-amylase 1, chloroplastic-like    54.3    1e-05   Glycine max [soybeans]
ref|XP_009802726.1|  PREDICTED: beta-amylase 1, chloroplastic-like    54.3    1e-05   Nicotiana sylvestris
ref|XP_009627593.1|  PREDICTED: beta-amylase 1, chloroplastic-like    53.9    2e-05   Nicotiana tomentosiformis
ref|XP_003062547.1|  glycoside hydrolase family 14 protein            53.5    2e-05   Micromonas pusilla CCMP1545
ref|XP_005846867.1|  hypothetical protein CHLNCDRAFT_134682           50.4    4e-05   Chlorella variabilis
ref|XP_002505301.1|  glycoside hydrolase family 14 protein            52.8    4e-05   Micromonas commoda
ref|XP_002681212.1|  beta-amylase                                     52.4    5e-05   Naegleria gruberi strain NEG-M
gb|KIZ05250.1|  hypothetical protein MNEG_2716                        51.2    9e-05   Monoraphidium neglectum
ref|XP_002968794.1|  hypothetical protein SELMODRAFT_145994           50.8    2e-04   
gb|EAZ16360.1|  hypothetical protein OsJ_31822                        50.8    2e-04   Oryza sativa Japonica Group [Japonica rice]
gb|EAY78842.1|  hypothetical protein OsI_33946                        50.8    2e-04   Oryza sativa Indica Group [Indian rice]
gb|AFI71858.1|  amylase                                               50.8    2e-04   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001064798.1|  Os10g0465700                                     50.8    2e-04   
ref|XP_002974185.1|  hypothetical protein SELMODRAFT_149606           50.8    2e-04   
ref|XP_002265698.1|  PREDICTED: inactive beta-amylase 4, chloropl...  50.4    2e-04   Vitis vinifera
ref|XP_003534086.1|  PREDICTED: beta-amylase 1, chloroplastic         50.4    2e-04   Glycine max [soybeans]
ref|XP_009403535.1|  PREDICTED: beta-amylase 3, chloroplastic-like    50.1    3e-04   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003532447.1|  PREDICTED: beta-amylase 1, chloroplastic-lik...  50.1    3e-04   Glycine max [soybeans]
ref|XP_006662424.1|  PREDICTED: beta-amylase 1, chloroplastic-like    50.1    3e-04   
ref|XP_010450097.1|  PREDICTED: inactive beta-amylase 4, chloropl...  50.1    3e-04   
ref|XP_010450090.1|  PREDICTED: inactive beta-amylase 4, chloropl...  50.1    4e-04   Camelina sativa [gold-of-pleasure]
ref|XP_005642810.1|  glycoside hydrolase                              49.7    4e-04   Coccomyxa subellipsoidea C-169
ref|XP_002864407.1|  beta-amylase 6                                   49.7    4e-04   Arabidopsis lyrata subsp. lyrata
ref|XP_010483034.1|  PREDICTED: inactive beta-amylase 4, chloropl...  49.7    4e-04   Camelina sativa [gold-of-pleasure]
ref|NP_568829.2|  inactive beta-amylase 4                             49.7    4e-04   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001190549.1|  inactive beta-amylase 4                          49.7    4e-04   
ref|XP_010483031.1|  PREDICTED: inactive beta-amylase 4, chloropl...  49.7    4e-04   Camelina sativa [gold-of-pleasure]
ref|XP_006280293.1|  hypothetical protein CARUB_v10026217mg           49.7    5e-04   Capsella rubella
ref|XP_010483036.1|  PREDICTED: inactive beta-amylase 4, chloropl...  49.7    5e-04   
gb|AAK76508.1|  putative beta-amylase                                 49.7    5e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010483035.1|  PREDICTED: inactive beta-amylase 4, chloropl...  49.7    5e-04   Camelina sativa [gold-of-pleasure]
dbj|BAH20280.1|  AT5G55700                                            49.7    5e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009132359.1|  PREDICTED: inactive beta-amylase 4, chloropl...  49.3    5e-04   
ref|XP_003571854.1|  PREDICTED: beta-amylase 1, chloroplastic-like    49.3    5e-04   Brachypodium distachyon [annual false brome]
ref|XP_008460412.1|  PREDICTED: beta-amylase 1, chloroplastic-like    49.3    5e-04   Cucumis melo [Oriental melon]
ref|XP_003060314.1|  glycoside hydrolase family 14 protein            49.3    5e-04   Micromonas pusilla CCMP1545
ref|XP_004144400.1|  PREDICTED: beta-amylase 1, chloroplastic-like    49.3    6e-04   Cucumis sativus [cucumbers]
ref|XP_004289151.1|  PREDICTED: beta-amylase-like                     49.3    6e-04   Fragaria vesca subsp. vesca
ref|XP_009132358.1|  PREDICTED: inactive beta-amylase 4, chloropl...  49.3    6e-04   Brassica rapa
ref|XP_009132357.1|  PREDICTED: inactive beta-amylase 4, chloropl...  49.3    6e-04   Brassica rapa
ref|XP_004503587.1|  PREDICTED: beta-amylase 1, chloroplastic-like    49.3    7e-04   Cicer arietinum [garbanzo]
emb|CDY36760.1|  BnaA03g11260D                                        49.3    7e-04   Brassica napus [oilseed rape]
gb|KCW89435.1|  hypothetical protein EUGRSUZ_A01734                   49.3    7e-04   Eucalyptus grandis [rose gum]
ref|XP_010051211.1|  PREDICTED: beta-amylase                          48.9    8e-04   
gb|KDP25257.1|  hypothetical protein JCGZ_20413                       48.9    8e-04   Jatropha curcas



>gb|AHZ89386.1| beta-amylase 1, partial [Nicotiana tabacum]
Length=201

 Score =   123 bits (308),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 73/153 (48%), Positives = 90/153 (59%), Gaps = 30/153 (20%)
 Frame = +1

Query  166  LPMSLAHQIGFISRTPVEVRTESVTREAPAKTAVSISPLWRR---NLRISVKNLAAKAVL  336
            + MS+ HQI  +S TP+   T     E PAK   + S +WR    NLR+SV+   A   +
Sbjct  1    MAMSMPHQICALSGTPLTAETGG---EVPAKGNTTASAVWRTPLTNLRVSVQKTGADVDM  57

Query  337  ------------RGGMEADLSAAV------------EREHKMGSDRGGSRGVPVFVMMPL  444
                        +GGM  DLS A             EREH++G+     +GVPVFVMMPL
Sbjct  58   LSPTPSPPLSPLKGGMRPDLSVACQALMEAPAETAAEREHRLGNSPEKGKGVPVFVMMPL  117

Query  445  DTVKMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            D+VKMDHT+NRKKAMN SLQALKSAGVEGIM+D
Sbjct  118  DSVKMDHTVNRKKAMNASLQALKSAGVEGIMMD  150



>gb|AAY89374.1| beta-amylase 1 [Nicotiana langsdorffii x Nicotiana sanderae]
Length=576

 Score =   127 bits (320),  Expect = 5e-31, Method: Composition-based stats.
 Identities = 74/153 (48%), Positives = 90/153 (59%), Gaps = 30/153 (20%)
 Frame = +1

Query  166  LPMSLAHQIGFISRTPVEVRTESVTREAPAKTAVSISPLWRR---NLRISVKNLAAKAVL  336
            + MS+ HQIG +S TP+   T     E PAK   + S  WR    NLR+SV+   A   +
Sbjct  1    MAMSMPHQIGALSGTPLTAETGG---EVPAKGNTTASAAWRTPLTNLRVSVQKTGADVDM  57

Query  337  ------------RGGMEADLS------------AAVEREHKMGSDRGGSRGVPVFVMMPL  444
                        +GGM  DLS             A EREH++G+     +GVPVFVMMPL
Sbjct  58   LSPTPSPPLSPLKGGMRPDLSVACQALMEAPAETAAEREHRLGNSPEKGKGVPVFVMMPL  117

Query  445  DTVKMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            D+VKMDHT+NRKKAMN SLQALKSAGVEGIM+D
Sbjct  118  DSVKMDHTVNRKKAMNASLQALKSAGVEGIMMD  150



>ref|XP_009596880.1| PREDICTED: beta-amylase 1, chloroplastic-like [Nicotiana tomentosiformis]
Length=576

 Score =   126 bits (316),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 73/153 (48%), Positives = 90/153 (59%), Gaps = 30/153 (20%)
 Frame = +1

Query  166  LPMSLAHQIGFISRTPVEVRTESVTREAPAKTAVSISPLWRR---NLRISVKNLAAKAVL  336
            + MS+ HQIG +S TP+   T     E PAK   + S +WR    NLR+SV+   A   +
Sbjct  1    MAMSMPHQIGALSGTPLTAETGG---EVPAKGNTTASAVWRTPLTNLRVSVQKTGADVDM  57

Query  337  ------------RGGMEADLSAAV------------EREHKMGSDRGGSRGVPVFVMMPL  444
                        +GGM  DLS A             E+EH++G      +GVPVFVMMPL
Sbjct  58   LSPTPSPPLSPLKGGMRPDLSVACQALMEAPAETAEEKEHRLGISPEKGKGVPVFVMMPL  117

Query  445  DTVKMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            D+VKMDHT+NRKKAMN SLQALKSAGVEGIM+D
Sbjct  118  DSVKMDHTVNRKKAMNASLQALKSAGVEGIMMD  150



>gb|AII99838.1| beta-amylase [Nicotiana tabacum]
Length=576

 Score =   125 bits (314),  Expect = 3e-30, Method: Composition-based stats.
 Identities = 73/153 (48%), Positives = 90/153 (59%), Gaps = 30/153 (20%)
 Frame = +1

Query  166  LPMSLAHQIGFISRTPVEVRTESVTREAPAKTAVSISPLWRR---NLRISVKNLAAKAVL  336
            + MS+ HQIG +S TP+   T     E PAK   + S +WR    NLR+SV+   A   +
Sbjct  1    MAMSMPHQIGALSGTPLTAETGG---EVPAKGNTTASAVWRTPLTNLRVSVQKTGADVDM  57

Query  337  ------------RGGMEADLSAAV------------EREHKMGSDRGGSRGVPVFVMMPL  444
                        +GGM  DLS A             E+EH++G      +GVPVFVMMPL
Sbjct  58   LSPTPSPPLSPLKGGMRPDLSVACQALMEAPAETAEEKEHRLGISPEKGKGVPVFVMMPL  117

Query  445  DTVKMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            D+VKMDHT+NRKKAMN SLQALKSAGVEGIM+D
Sbjct  118  DSVKMDHTVNRKKAMNASLQALKSAGVEGIMMD  150



>ref|XP_009785196.1| PREDICTED: beta-amylase 1, chloroplastic-like [Nicotiana sylvestris]
Length=576

 Score =   125 bits (314),  Expect = 3e-30, Method: Composition-based stats.
 Identities = 73/153 (48%), Positives = 90/153 (59%), Gaps = 30/153 (20%)
 Frame = +1

Query  166  LPMSLAHQIGFISRTPVEVRTESVTREAPAKTAVSISPLWRR---NLRISVKNLAAKAVL  336
            + MS+ HQI  +S TP+   T     E PAK   + S +WR    NLR+SV+   A   +
Sbjct  1    MAMSMPHQICALSGTPLTAETGG---EVPAKGNTTASAVWRTPLTNLRVSVQKTGADVDM  57

Query  337  ------------RGGMEADLS------------AAVEREHKMGSDRGGSRGVPVFVMMPL  444
                        +GGM  DLS             A EREH++G+     +GVPVFVMMPL
Sbjct  58   LSPTPSPPLSPLKGGMRPDLSVACQALMEAPAETAAEREHRLGNSPEKGKGVPVFVMMPL  117

Query  445  DTVKMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            D+VKMDHT+NRKKAMN SLQALKSAGVEGIM+D
Sbjct  118  DSVKMDHTVNRKKAMNASLQALKSAGVEGIMMD  150



>ref|XP_006340896.1| PREDICTED: beta-amylase 1, chloroplastic-like [Solanum tuberosum]
Length=579

 Score =   123 bits (308),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 70/153 (46%), Positives = 90/153 (59%), Gaps = 27/153 (18%)
 Frame = +1

Query  166  LPMSLAHQIGFISRTPVEVRTESVTREAPAKTAVSISPLWRR---NLRISVKNLAAKA--  330
            + MSL HQIG +S T +   T  V+ E PAK + + S +WR    NL++SV+   A+   
Sbjct  1    MAMSLPHQIGALSGTSLTAETGGVSCEVPAKGSSATSAMWRTPMTNLKVSVQKTGAEIDR  60

Query  331  ----------------------VLRGGMEADLSAAVEREHKMGSDRGGSRGVPVFVMMPL  444
                                    +  MEA +   VERE+K+ +     +GVPVFVMMPL
Sbjct  61   VSPSPSPPMSPMMGGGMRPDLLACQALMEAQVDEVVEREYKVRNSSEKEKGVPVFVMMPL  120

Query  445  DTVKMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            D+VKMDHT+NRKKAMN SLQALKSAGVEGIM+D
Sbjct  121  DSVKMDHTVNRKKAMNASLQALKSAGVEGIMMD  153



>ref|XP_009608726.1| PREDICTED: beta-amylase 1, chloroplastic-like [Nicotiana tomentosiformis]
Length=565

 Score =   121 bits (303),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 70/145 (48%), Positives = 91/145 (63%), Gaps = 25/145 (17%)
 Frame = +1

Query  166  LPMSLAHQIGFISRTPVEVRTESVTREAPAKTAVSISPLWR---RNLRISVKNLAAK---  327
            + MSL HQIG +S T +   TESV+ EAPAKT ++ S LWR    NLR+SV+   ++   
Sbjct  1    MAMSLPHQIGALSGTAISSETESVSGEAPAKTTLTTSALWRAPVTNLRVSVQKSGSQVDI  60

Query  328  -------------AVLRGGMEADLSAAVEREHKMGSDRGGSRGVPVFVMMPLDTVKMDHT  468
                         A+         +A V++EHK+G      +GVPV+VMMPLD+VK D+T
Sbjct  61   ASPSPPLSPVTCHALTEARDALAETAEVKKEHKLG------KGVPVYVMMPLDSVKTDNT  114

Query  469  MNRKKAMNVSLQALKSAGVEGIMVD  543
            +NRKKAM  SLQALKSAGVEGIM+D
Sbjct  115  VNRKKAMKASLQALKSAGVEGIMMD  139



>gb|EYU43788.1| hypothetical protein MIMGU_mgv1a021359mg, partial [Erythranthe 
guttata]
Length=240

 Score =   114 bits (284),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 69/147 (47%), Positives = 89/147 (61%), Gaps = 25/147 (17%)
 Frame = +1

Query  172  MSLAHQIGFISRTPVEVRTESVTREAPAKTAVSISPLWRR----NLRISVKNLAAKA---  330
            MSL HQIG IS +P+   + S + +AP  T  S+S +WR     NL +SV++    A   
Sbjct  3    MSLPHQIGAISGSPLAADSGSASSDAPPST--SVSAVWRSPLTTNLCVSVQSNGTDADRV  60

Query  331  -------VLRGGMEADLSAAV-------EREHKMGSDRG--GSRGVPVFVMMPLDTVKMD  462
                    + GG+  DLS A        ERE+ +G  R     +GVPV+VMMPLD+V  +
Sbjct  61   SPSPPLSPVHGGVRPDLSVAAQALMTPPEREYAVGGSRAEEAGKGVPVYVMMPLDSVTWN  120

Query  463  HTMNRKKAMNVSLQALKSAGVEGIMVD  543
            HT+NRKKAMN SLQALKSAGVEGIM+D
Sbjct  121  HTVNRKKAMNASLQALKSAGVEGIMMD  147



>ref|XP_009777267.1| PREDICTED: beta-amylase 1, chloroplastic-like [Nicotiana sylvestris]
Length=565

 Score =   117 bits (293),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 72/145 (50%), Positives = 92/145 (63%), Gaps = 25/145 (17%)
 Frame = +1

Query  166  LPMSLAHQIGFISRTPVEVRTESVTREAPAKTAVSISPLWR---RNLRISVKNLAAKA--  330
            + MSL HQIG +S T +   TESV+ EAPAKT ++ S L R    NLR+S++N   +A  
Sbjct  1    MAMSLRHQIGALSGTAISSETESVSGEAPAKTTLTTSALRRASVTNLRVSMQNSGTEADK  60

Query  331  -------------VLRGGMEA-DLSAAVEREHKMGSDRGGSRGVPVFVMMPLDTVKMDHT  468
                          L    +A   +A VE+E K+G      +GVPV+VMMPLD+VKMD+T
Sbjct  61   VLTSPPLSPVTCHALAEARDALAETAEVEKEDKLG------KGVPVYVMMPLDSVKMDNT  114

Query  469  MNRKKAMNVSLQALKSAGVEGIMVD  543
            +NRKKAM  SLQALKSAGVEGIM+D
Sbjct  115  VNRKKAMKASLQALKSAGVEGIMMD  139



>ref|NP_001234556.1| beta-amylase [Solanum lycopersicum]
 gb|ADK97800.1| beta-amylase [Solanum lycopersicum]
Length=580

 Score =   116 bits (290),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 68/154 (44%), Positives = 88/154 (57%), Gaps = 28/154 (18%)
 Frame = +1

Query  166  LPMSLAHQIGFISRTPVEVRTESVTREAPAKTAVSISPLWRR---NLRISVKNLAAK---  327
            + MSL HQIG +S T +   T  V+ E PAK + + S +WR    NL++SV+    +   
Sbjct  1    MAMSLPHQIGALSGTSLTAETGGVSCEVPAKGSSATSAMWRTPMTNLKVSVQKTGNEIDR  60

Query  328  ----------------------AVLRGGMEADLSAAVEREHKMGSDRGGSRGVPVFVMMP  441
                                     +  MEA +   VERE+K+ +     +GVPVFVMMP
Sbjct  61   VSPSPSPPMSPMMGGGMRPDLSVACQALMEAQVEEVVEREYKVRNSSEKEKGVPVFVMMP  120

Query  442  LDTVKMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            LD+VK DHT+NRKKAMN SLQALKSAGVEGIM+D
Sbjct  121  LDSVKTDHTVNRKKAMNASLQALKSAGVEGIMMD  154



>emb|CDP20299.1| unnamed protein product [Coffea canephora]
Length=582

 Score =   112 bits (281),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 69/156 (44%), Positives = 91/156 (58%), Gaps = 30/156 (19%)
 Frame = +1

Query  166  LPMSLAHQIGFISRTPVEVRTESVTRE-APAKTAVSISPLWRR---NLRISVKN------  315
            + MS+ HQIG ++ TP+   +  +T E A +   VS S +WR    NLR+SV+       
Sbjct  1    MAMSMPHQIGALAGTPIAAESGGLTGEGAQSAATVSTSAVWRSPVTNLRVSVQKPGDVER  60

Query  316  -----LAAKAVLRGGMEADLSAA-------------VEREHKM--GSDRGGSRGVPVFVM  435
                     + +R GM  DLS A             VE+ H+    S +   +GVPVFVM
Sbjct  61   VSPLSSPPLSPVRAGMRPDLSVACQAFATAVETEPAVEKVHRFPESSTQKKEKGVPVFVM  120

Query  436  MPLDTVKMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            MPLD+VKMD+T+NR+KAMN SLQALKSAGVEGIM+D
Sbjct  121  MPLDSVKMDNTVNRRKAMNASLQALKSAGVEGIMMD  156



>ref|XP_011091372.1| PREDICTED: beta-amylase 1, chloroplastic [Sesamum indicum]
Length=580

 Score =   110 bits (274),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 68/154 (44%), Positives = 92/154 (60%), Gaps = 32/154 (21%)
 Frame = +1

Query  172  MSLAHQIGFISRTPVEVRTESVTREAPAKTAVSISPLWR----RNLRISVKNLAAK----  327
            MSL HQIG IS +P+      V+ EAP  ++ ++S +WR     NLR+SV+    +    
Sbjct  3    MSLPHQIGAISGSPLAADAGGVSGEAP--SSATVSAVWRVPVATNLRVSVQKTGMEMDRV  60

Query  328  ------AVLRGGMEADLSAAVE--------------REHKMG--SDRGGSRGVPVFVMMP  441
                  + +RGG+  DLS A +              RE+ +G  S +   +GVPV+VMMP
Sbjct  61   SPSPPLSPVRGGLRPDLSVAAQALMSAPVTTEDVQDREYVVGGVSHKEDKKGVPVYVMMP  120

Query  442  LDTVKMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            LD+V  +HT+NRKKAMN SLQALKSAGVEGIM+D
Sbjct  121  LDSVTWNHTVNRKKAMNASLQALKSAGVEGIMMD  154



>gb|EPS66628.1| beta-amylase 1, chloroplastic [Genlisea aurea]
Length=580

 Score =   108 bits (269),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 71/155 (46%), Positives = 89/155 (57%), Gaps = 33/155 (21%)
 Frame = +1

Query  172  MSLAHQIGFISRTPVEVRTES-VTREAPAKTAVSISPLWR----RNLRISVK--------  312
            MSL HQIG IS  P+ +  +   + EAP  ++ ++S +WR      LR+SV+        
Sbjct  3    MSLPHQIGAISGAPLSIDHQGGHSGEAP--SSATVSAIWRPALASTLRVSVQKSGPDLER  60

Query  313  -NLAAKAVLRGGMEADLSAAV----------------EREHKMGSDRG-GSRGVPVFVMM  438
             + +     RGG+  DLS A                 EREH  GS  G G  GVPVFVMM
Sbjct  61   VSPSPPLSPRGGVRPDLSVAAQALMMPSLAAEEDSRQEREHGGGSAHGEGRSGVPVFVMM  120

Query  439  PLDTVKMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            PLD+V  DHT+NRKKAMN SLQALK+AGVEGIM+D
Sbjct  121  PLDSVTFDHTVNRKKAMNASLQALKTAGVEGIMMD  155



>ref|XP_010023784.1| PREDICTED: beta-amylase 1, chloroplastic [Eucalyptus grandis]
 gb|KCW60153.1| hypothetical protein EUGRSUZ_H02879 [Eucalyptus grandis]
Length=584

 Score =   101 bits (252),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 64/159 (40%), Positives = 89/159 (56%), Gaps = 34/159 (21%)
 Frame = +1

Query  166  LPMSLAHQIGFISRTPVEVRTESVTREAPAKTAVSISPLWRR---NLRISVKNLAA----  324
            + +S+ HQIG ++ TP+   + S   E P+   VS + +W+    ++R   +   A    
Sbjct  1    MALSMTHQIGTLAGTPIHAESGSGAGE-PSTATVSAAAVWKSPAPSIRCRAQKPDALDAL  59

Query  325  -------KAVLRGGMEADLSAAVE--------------REHK-----MGSDRGGSRGVPV  426
                   ++ + GG+  DLS A +              REHK      GS   GS GVPV
Sbjct  60   SPPLSPCRSPVLGGIRPDLSVACQAFAAEMEALPQAAVREHKEVAPAAGSREKGSGGVPV  119

Query  427  FVMMPLDTVKMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            FVMMPLD+V M++T+NR+KAMN SLQALKSAGVEGIM+D
Sbjct  120  FVMMPLDSVTMNNTVNRRKAMNASLQALKSAGVEGIMMD  158



>gb|EPS61951.1| beta-amylase [Genlisea aurea]
Length=560

 Score = 99.4 bits (246),  Expect = 7e-21, Method: Composition-based stats.
 Identities = 63/144 (44%), Positives = 85/144 (59%), Gaps = 20/144 (14%)
 Frame = +1

Query  166  LPMSLAHQIGFISRTPVEVRTESVTREAPAKTAVSISPLWR----RNLRISVKNLAAKA-  330
            + MSL HQIG IS  P+++    V+ EAP  ++ + + +W+     NLR+SV++   +  
Sbjct  1    MAMSLPHQIGAISGAPLKIDATGVSGEAP--SSATFTAVWKPASASNLRVSVQHGGTEVD  58

Query  331  --------VLRGGMEADLSA---AVEREHKMGSDRGGSR--GVPVFVMMPLDTVKMDHTM  471
                      R G+  DLS    A+     +  D    R  GVPVFVMMPLD+V  +H +
Sbjct  59   RLSPSPPLSPRSGLRPDLSVTAQAMMSPSFVTDDEQQERRSGVPVFVMMPLDSVTWNHAV  118

Query  472  NRKKAMNVSLQALKSAGVEGIMVD  543
            NRKKAMN SLQALKSAGVEGIM+D
Sbjct  119  NRKKAMNASLQALKSAGVEGIMMD  142



>ref|XP_010666969.1| PREDICTED: beta-amylase 1, chloroplastic [Beta vulgaris subsp. 
vulgaris]
Length=579

 Score = 98.2 bits (243),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 61/154 (40%), Positives = 86/154 (56%), Gaps = 29/154 (19%)
 Frame = +1

Query  166  LPMSLAHQIGFISRTPVEVRTESVTREAPAKTAVSISPLWRRNLRISVK-----------  312
            + MSL HQIG +S TPV +   + T        +S S +W+    +  K           
Sbjct  1    MAMSLTHQIGALSGTPVTIEA-ATTNTGETSATLSTSAVWKSPAPLKCKVTRTGGDKTTT  59

Query  313  NLAAKAV--LRGGMEADLSAA--------------VEREHKMGS-DRGGSRGVPVFVMMP  441
            ++ +  V   R  + ADL+AA               E+E+ + + D+   +GVPV+VMMP
Sbjct  60   DMLSPPVSPCRSPLRADLTAACQAFTTTMSQSDIATEKEYAVAAKDKEAKKGVPVYVMMP  119

Query  442  LDTVKMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            LD+VKMD+T+NR+KAMN SL ALKSAGVEGIM+D
Sbjct  120  LDSVKMDNTINRRKAMNASLLALKSAGVEGIMMD  153



>emb|CBI35772.3| unnamed protein product [Vitis vinifera]
Length=570

 Score = 96.7 bits (239),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 61/153 (40%), Positives = 90/153 (59%), Gaps = 26/153 (17%)
 Frame = +1

Query  157  KLILPMSLAHQIGFISRTPVEVRTESVTREAPAKTAVSISPLWRRNLRI-------SVKN  315
            +L+  MS+ HQ+G IS TPV   + + T E+ A  A+S + +W+  L          ++ 
Sbjct  72   QLMAAMSITHQMGAISGTPVVSESGNGTAESTA--ALSAAAVWKLPLPAIRCRAGAEIEG  129

Query  316  LAAK-----AVLRGGMEADLSAAV------------EREHKMGSDRGGSRGVPVFVMMPL  444
            L+       + + GGM ADLS A             ERE+++G  +   +GVPV+VMMPL
Sbjct  130  LSPPVSPCLSPVMGGMRADLSVACQAFATEIEAAPAEREYRVGGTKAKGKGVPVYVMMPL  189

Query  445  DTVKMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            D+V M + +NR+KAM  S+QALKSAGVEG+M+D
Sbjct  190  DSVTMGNGVNRRKAMKASMQALKSAGVEGVMMD  222



>emb|CAN71375.1| hypothetical protein VITISV_002992 [Vitis vinifera]
Length=570

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 60/148 (41%), Positives = 86/148 (58%), Gaps = 26/148 (18%)
 Frame = +1

Query  172  MSLAHQIGFISRTPVEVRTESVTREAPAKTAVSISPLWRRNLRI-------SVKNLAAK-  327
            MS+ HQ+G IS TPV   +ES    A +  A+S + +W+  L          ++ L+   
Sbjct  1    MSITHQMGAISGTPV--VSESGNGTAESTAALSAAAVWKLPLPAIRCRAGAEIEGLSPPV  58

Query  328  ----AVLRGGMEADLSAAV------------EREHKMGSDRGGSRGVPVFVMMPLDTVKM  459
                + + GGM ADLS A             ERE+++G  +   +GVPV+VMMPLD+V M
Sbjct  59   SPCLSPVMGGMRADLSVACQAFATEIEAAPAEREYRVGGTKAKGKGVPVYVMMPLDSVTM  118

Query  460  DHTMNRKKAMNVSLQALKSAGVEGIMVD  543
             + +NR+KAM  S+QALKSAGVEG+M+D
Sbjct  119  GNGVNRRKAMKASMQALKSAGVEGVMMD  146



>ref|XP_002285569.1| PREDICTED: beta-amylase 1, chloroplastic [Vitis vinifera]
Length=573

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 60/148 (41%), Positives = 86/148 (58%), Gaps = 26/148 (18%)
 Frame = +1

Query  172  MSLAHQIGFISRTPVEVRTESVTREAPAKTAVSISPLWRRNLRI-------SVKNLAAK-  327
            MS+ HQ+G IS TPV   +ES    A +  A+S + +W+  L          ++ L+   
Sbjct  4    MSITHQMGAISGTPV--VSESGNGTAESTAALSAAAVWKLPLPAIRCRAGAEIEGLSPPV  61

Query  328  ----AVLRGGMEADLSAAV------------EREHKMGSDRGGSRGVPVFVMMPLDTVKM  459
                + + GGM ADLS A             ERE+++G  +   +GVPV+VMMPLD+V M
Sbjct  62   SPCLSPVMGGMRADLSVACQAFATEIEAAPAEREYRVGGTKAKGKGVPVYVMMPLDSVTM  121

Query  460  DHTMNRKKAMNVSLQALKSAGVEGIMVD  543
             + +NR+KAM  S+QALKSAGVEG+M+D
Sbjct  122  GNGVNRRKAMKASMQALKSAGVEGVMMD  149



>ref|XP_004296549.1| PREDICTED: beta-amylase 1, chloroplastic [Fragaria vesca subsp. 
vesca]
Length=578

 Score = 92.4 bits (228),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 59/152 (39%), Positives = 80/152 (53%), Gaps = 26/152 (17%)
 Frame = +1

Query  166  LPMSLAHQIGFISRTPVEVR-------------TESVTREAPAK--TAVSISPLWRRNLR  300
            +  S+ HQIG ++ TP+ V              T S  R++PA   T    +P  +    
Sbjct  1    MAFSITHQIGALAGTPISVTEPNKSSGESTASVTASAVRKSPAAGLTCKIQNPEGKETGM  60

Query  301  ISVKNLAAKAVLRGGMEADLSAAVER-----------EHKMGSDRGGSRGVPVFVMMPLD  447
            ++      ++ + G    DLS A +            EH++        GVPVFVMMPLD
Sbjct  61   LTPPMSPCRSPVLGATRPDLSVACQAYATEVEAAPVLEHELRGHVEKINGVPVFVMMPLD  120

Query  448  TVKMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            +V M+HT+NRKKAMN SLQALKSAGVEGIM+D
Sbjct  121  SVTMNHTVNRKKAMNASLQALKSAGVEGIMMD  152



>ref|XP_010263970.1| PREDICTED: beta-amylase 1, chloroplastic-like isoform X2 [Nelumbo 
nucifera]
Length=568

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 61/141 (43%), Positives = 83/141 (59%), Gaps = 24/141 (17%)
 Frame = +1

Query  178  LAHQIGFISRTPV---EVRTESVTREAPAKTAVSISPLWRRNLRISVKNLAAKAVLRGG-  345
            +AHQIG +S TPV   E R ES  +       VS+S LW+   R +  NL  +   +G  
Sbjct  5    IAHQIGALSVTPVASSETRKESGDQPT---AVVSVSALWKTPSRPT--NLRPRTQKQGQV  59

Query  346  ----MEADLSAAVE-----------REHKMGSDRGGSRGVPVFVMMPLDTVKMDHTMNRK  480
                MEA LS A +           R+ ++G+ +   +GVPV+VMMPLD+V M + +N++
Sbjct  60   VGREMEASLSVACQALVTETAMVERRDGEVGAAQVKGKGVPVYVMMPLDSVTMSNGVNKR  119

Query  481  KAMNVSLQALKSAGVEGIMVD  543
            KAMN SL ALKSAGVEG+MVD
Sbjct  120  KAMNASLMALKSAGVEGVMVD  140



>ref|XP_010263969.1| PREDICTED: beta-amylase 1, chloroplastic-like isoform X1 [Nelumbo 
nucifera]
Length=576

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 61/141 (43%), Positives = 83/141 (59%), Gaps = 24/141 (17%)
 Frame = +1

Query  178  LAHQIGFISRTPV---EVRTESVTREAPAKTAVSISPLWRRNLRISVKNLAAKAVLRGG-  345
            +AHQIG +S TPV   E R ES  +       VS+S LW+   R +  NL  +   +G  
Sbjct  5    IAHQIGALSVTPVASSETRKESGDQPT---AVVSVSALWKTPSRPT--NLRPRTQKQGQV  59

Query  346  ----MEADLSAAVE-----------REHKMGSDRGGSRGVPVFVMMPLDTVKMDHTMNRK  480
                MEA LS A +           R+ ++G+ +   +GVPV+VMMPLD+V M + +N++
Sbjct  60   VGREMEASLSVACQALVTETAMVERRDGEVGAAQVKGKGVPVYVMMPLDSVTMSNGVNKR  119

Query  481  KAMNVSLQALKSAGVEGIMVD  543
            KAMN SL ALKSAGVEG+MVD
Sbjct  120  KAMNASLMALKSAGVEGVMVD  140



>ref|XP_002518196.1| Beta-amylase, putative [Ricinus communis]
 gb|EEF44329.1| Beta-amylase, putative [Ricinus communis]
Length=574

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 56/154 (36%), Positives = 84/154 (55%), Gaps = 34/154 (22%)
 Frame = +1

Query  166  LPMSLAHQIGFISRTPVEVRTESVTREAPAKTAVSISPLWRR---NLRISVKNLAAK---  327
            + M++ HQIG ++ TP+       T   P+++  ++S +W+    N R  ++        
Sbjct  1    MAMNITHQIGALAGTPIS------TEPIPSESTATVSAVWKTPTPNARCKIQKADTTEQK  54

Query  328  --------AVLRGGMEADLSAAV--------------EREHKMGSDRGGSRGVPVFVMMP  441
                    + +  GM ADLS A               ER ++ G  +   +GVPV+VMMP
Sbjct  55   SQPTSPCMSPILSGMRADLSVACRAFADVATLEPSIEERMYRDGGGKEEGKGVPVYVMMP  114

Query  442  LDTVKMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            LD+V M++ +NR+KAMN SLQALKSAGVEGIM+D
Sbjct  115  LDSVTMNNGVNRRKAMNASLQALKSAGVEGIMMD  148



>gb|AFQ33614.1| beta-amylase 2 [Citrus trifoliata]
Length=580

 Score = 86.7 bits (213),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 58/161 (36%), Positives = 85/161 (53%), Gaps = 37/161 (23%)
 Frame = +1

Query  166  LPMSLAHQIGFISRTPVEVRTESVTREAPAKTAVSISPLWRR---NLRISVKNLAAKAVL  336
            + + L HQIG ++ T +++ T  V+R++ A   V+ S +W+    +LR +++    K  +
Sbjct  1    MALHLTHQIGTLAGTSIQMDTGVVSRDSTA--TVNASAVWKPVSIDLRCAIQKPDLKDTI  58

Query  337  R-----------GGMEADLSAAVE---------------------REHKMGSDRGGSRGV  420
                          M ADLS A                         HK G  +   +GV
Sbjct  59   SPPVSPCRSPVLSSMRADLSVACRAFATESPTAAAVTEFSEEVGGEMHKQGGLQEKGKGV  118

Query  421  PVFVMMPLDTVKMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            PVFVMMPLD+V M +T+NRKKAM+ SL+ALKSAGVEG+M+D
Sbjct  119  PVFVMMPLDSVTMSNTVNRKKAMDASLRALKSAGVEGVMMD  159



>ref|XP_006851336.1| hypothetical protein AMTR_s00050p00205080 [Amborella trichopoda]
 gb|ERN12917.1| hypothetical protein AMTR_s00050p00205080 [Amborella trichopoda]
Length=587

 Score = 86.3 bits (212),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 62/167 (37%), Positives = 83/167 (50%), Gaps = 43/167 (26%)
 Frame = +1

Query  166  LPMSLAHQIGFISRTPVE---VRTESVTREAPAKTAVSISPLWRRN---LRISVKNLAAK  327
            + +S++HQIG +S TP+        SV+ ++ A   VS +  W+     LR  ++N   +
Sbjct  1    MALSISHQIGALSGTPIRDSAASEPSVSSDSMA--VVSATATWKSPSTPLRCRIQNQGIE  58

Query  328  AV-------------------LRGGMEADLSAAV---------------EREH-KMGSDR  402
            A                     R     DLS A                EREH  + S  
Sbjct  59   AEGPSPPLSPCCSSPPPEEWWKRQVGRPDLSVACQAFETAIAEQEVGKQEREHGSLKSKE  118

Query  403  GGSRGVPVFVMMPLDTVKMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
             G  G+PVFVM+PLD+V  +H MNRK+AMN SLQALKSAGVEGIM+D
Sbjct  119  NGKGGIPVFVMLPLDSVTQNHGMNRKRAMNASLQALKSAGVEGIMLD  165



>ref|XP_011073736.1| PREDICTED: beta-amylase 1, chloroplastic-like [Sesamum indicum]
Length=583

 Score = 86.3 bits (212),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 60/159 (38%), Positives = 85/159 (53%), Gaps = 35/159 (22%)
 Frame = +1

Query  166  LPMSLAHQIGFISRTPVEVRTESVTREAPAKTAVSISPLWR----------------RNL  297
            + M+L HQIG IS   +      V  EAP+ +  +++ +WR                 N 
Sbjct  1    MAMNLPHQIGAISGAALCADAGVVPGEAPSSS--TVTAVWRSSGTSNMGVSMTMNGLENG  58

Query  298  RIS--------VKNLAAKAVLRGGMEADLSAAV------EREHKMGSDRGGSR---GVPV  426
            R+S        + ++  +  L    EA +SA +      +RE+  G +  G     GVPV
Sbjct  59   RVSPSPPFTPPLGSVRPEISLSLAAEALMSAPISTGDVPDREYIAGGNARGEEKKNGVPV  118

Query  427  FVMMPLDTVKMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            +VMMPLD+V  +HT+NRKKAMN SLQAL+SAGVEGIM+D
Sbjct  119  YVMMPLDSVTWNHTVNRKKAMNASLQALRSAGVEGIMMD  157



>ref|XP_007035340.1| Beta-amylase 1 isoform 1 [Theobroma cacao]
 gb|EOY06266.1| Beta-amylase 1 isoform 1 [Theobroma cacao]
Length=652

 Score = 86.3 bits (212),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 66/166 (40%), Positives = 85/166 (51%), Gaps = 39/166 (23%)
 Frame = +1

Query  157  KLILPMSLAHQIGFISRTPVEVRTESVTREAPAKTAVSISPLWRR---NLRISV------  309
            K I+ ++LA QIG ++ T  ++ TE    E  +   VS S +WR    NLR         
Sbjct  63   KEIMALNLASQIGTLAGT--QIPTEVSNGEQLSSGTVSASAVWRAPAANLRCKTSQDTVS  120

Query  310  ----------KNLAAKAVLRGGM-EADLSAA------------VEREH-----KMGSDRG  405
                      ++  +++ L   M   DLSAA            VE E      K G  + 
Sbjct  121  PPSLTPPLTPRSPGSRSPLMSPMLRPDLSAACQAFTTLAPPETVEEEAAGVAWKEGGRKE  180

Query  406  GSRGVPVFVMMPLDTVKMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
              RGVPV+VMMPLD+V   +T+NRKKAMN SL ALKSAGVEGIMVD
Sbjct  181  EKRGVPVYVMMPLDSVTYGNTLNRKKAMNASLHALKSAGVEGIMVD  226



>ref|XP_004515248.1| PREDICTED: beta-amylase 1, chloroplastic-like [Cicer arietinum]
Length=573

 Score = 85.5 bits (210),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 59/152 (39%), Positives = 87/152 (57%), Gaps = 30/152 (20%)
 Frame = +1

Query  166  LPMSLAHQIGFISRTPVEVRTESVTREAPAKTAVSISPLWRR---NLRI--SVKNLAAKA  330
            + +S+ HQIG +  TPV   T S        + V+ + +W+    NLR+  S  ++ A+ 
Sbjct  1    MALSMTHQIGSLVGTPVPSETTSAE----TTSTVNAAAVWKSPAMNLRVKASRSDVIAEG  56

Query  331  V----------LRGGMEADLSAA-----------VEREHKMGSDRGGSRGVPVFVMMPLD  447
            +          + GG+  DL+AA           VE+EHK GS      GVPV+VMMPLD
Sbjct  57   LTPPVSPCRSPVLGGIRPDLTAACQAFTIESETAVEKEHKAGSRSVKGNGVPVYVMMPLD  116

Query  448  TVKMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            +V M +++NRKKA+N ++ ALKSAGVEG+M+D
Sbjct  117  SVTMTNSVNRKKAVNAAMAALKSAGVEGVMMD  148



>ref|XP_008775132.1| PREDICTED: beta-amylase 1, chloroplastic [Phoenix dactylifera]
Length=572

 Score = 85.5 bits (210),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 61/157 (39%), Positives = 82/157 (52%), Gaps = 36/157 (23%)
 Frame = +1

Query  166  LPMSLAHQIGFISRTPVEVRTESVTREAPAKTAVSISPLWR-----RNLR----------  300
            + ++L HQIG +  TPV         E PA TAVS + +WR      NLR          
Sbjct  1    MALNLGHQIGVLCGTPVAEHGG----EQPA-TAVSAAAVWRPQVPLANLRCRRLGAGEID  55

Query  301  -ISVKNLAAKAVLRGGMEADLSAAVE---------------REHKMGSDRGGSRGVPVFV  432
             +S      ++ + G    DLS A +               RE+   ++ G  +GVPV+V
Sbjct  56   QMSPPVSPCRSPVLGATRPDLSVACQALVTDAAAETAEGEVREYGGRAEMGMGKGVPVYV  115

Query  433  MMPLDTVKMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            M+PLDTV+    +NR+KAMN SLQALKSAGVEG+MVD
Sbjct  116  MLPLDTVRPGGGVNRRKAMNASLQALKSAGVEGVMVD  152



>ref|XP_006296695.1| hypothetical protein CARUB_v10013332mg [Capsella rubella]
 gb|EOA29593.1| hypothetical protein CARUB_v10013332mg [Capsella rubella]
Length=573

 Score = 85.1 bits (209),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 53/145 (37%), Positives = 79/145 (54%), Gaps = 19/145 (13%)
 Frame = +1

Query  166  LPMSLAHQIGFISRTPV---EVRTESVTREAPAKTAVSISPLWRRNLRISVKNLAAKAVL  336
            + ++L+HQ+G ++ TP+   E+   S++   P+   +   P+              ++ +
Sbjct  1    MALNLSHQLGVLAGTPIKSGEMTDSSLSVSPPSARMMMSKPININYKSHGTDPSPPRSPV  60

Query  337  RGGMEADLSAAVE--------------REHKMGS--DRGGSRGVPVFVMMPLDTVKMDHT  468
             G   ADLS A +              R +K G   ++    GVPVFVMMPLD+V M +T
Sbjct  61   LGATRADLSVACQAYAVESGVETVEEQRTYKEGGIVEKREGGGVPVFVMMPLDSVTMGNT  120

Query  469  MNRKKAMNVSLQALKSAGVEGIMVD  543
            +NR+KAM  SLQALKSAGVEGIM+D
Sbjct  121  VNRRKAMKASLQALKSAGVEGIMID  145



>gb|KDO55739.1| hypothetical protein CISIN_1g008030mg [Citrus sinensis]
Length=580

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 55/161 (34%), Positives = 84/161 (52%), Gaps = 37/161 (23%)
 Frame = +1

Query  166  LPMSLAHQIGFISRTPVEVRTESVTREAPAKTAVSISPLWR---RNLRISVKNLAAKAVL  336
            + ++L HQIG ++ TP+++ T  V+ ++     V+ S +W+    +LR +++    K  +
Sbjct  1    MALNLTHQIGTLAGTPIQMDTGVVSGDSTG--TVNASAVWKPVSTDLRCAIQKPDLKDTM  58

Query  337  R-----------GGMEADLSAAVE---------------------REHKMGSDRGGSRGV  420
                          M ADLS A                         +K G  +    GV
Sbjct  59   SPPVSPCRSPVLSSMRADLSVACRAFATESPTAAAVTEFSEEVGGEMYKQGGLQEKGNGV  118

Query  421  PVFVMMPLDTVKMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            PVFVMMPLD+V M +T+NRKKA++ SL+ALKSAGVEG+M+D
Sbjct  119  PVFVMMPLDSVTMSNTVNRKKAIDASLRALKSAGVEGVMMD  159



>ref|XP_006493994.1| PREDICTED: beta-amylase 1, chloroplastic-like [Citrus sinensis]
Length=580

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 54/161 (34%), Positives = 85/161 (53%), Gaps = 37/161 (23%)
 Frame = +1

Query  166  LPMSLAHQIGFISRTPVEVRTESVTREAPAKTAVSISPLWR---RNLRISVKNLAAKAVL  336
            + ++L HQIG ++ TP+++ +  V+ ++     V+ S +W+    +LR +++    K  +
Sbjct  1    MALNLTHQIGTLAGTPIQMDSGVVSGDSTG--TVNASAVWKPVSTDLRCAIQKPDLKDTM  58

Query  337  R-----------GGMEADLSAAVE---------------------REHKMGSDRGGSRGV  420
                          M ADLS A                         +K G  +   +GV
Sbjct  59   SPPVSPCRSPVLSSMRADLSVACRAFATESPTAAAVTEFSEEVGGEMYKQGGLQEKGKGV  118

Query  421  PVFVMMPLDTVKMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            PVFVMMPLD+V M +T+NRKKA++ SL+ALKSAGVEG+M+D
Sbjct  119  PVFVMMPLDSVTMSNTVNRKKAIDASLRALKSAGVEGVMMD  159



>ref|XP_004134029.1| PREDICTED: beta-amylase 1, chloroplastic-like [Cucumis sativus]
 gb|KGN56795.1| hypothetical protein Csa_3G133950 [Cucumis sativus]
Length=577

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 63/150 (42%), Positives = 87/150 (58%), Gaps = 27/150 (18%)
 Frame = +1

Query  172  MSLAHQIGFISRTPVEVRTESVTREAPAKTAV--------SISPLWRRNLRIS-VKNLA-  321
            +S+ HQIG ++ TPV     +++    A  AV        S SPL  R  R   V  L+ 
Sbjct  3    LSITHQIGALAGTPVTSEASNIS-AGEASLAVNTAMLRKSSASPLRCRVQRTDGVDALSP  61

Query  322  ----AKAVLRGGMEADLSAAVE------------REHKMGSDRGGSRGVPVFVMMPLDTV  453
                 ++ + GG+  DLS A +            RE+K   ++G  +GVPV+VMMPLD+V
Sbjct  62   PLSPCRSPVLGGIRPDLSVACQAFATEVEAPTEVREYKEEGEKGKEKGVPVYVMMPLDSV  121

Query  454  KMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
             M++T+NR+KAMN SLQALKSAGVEGIM+D
Sbjct  122  TMENTVNRRKAMNASLQALKSAGVEGIMMD  151



>ref|XP_006420416.1| hypothetical protein CICLE_v10004620mg [Citrus clementina]
 gb|ESR33656.1| hypothetical protein CICLE_v10004620mg [Citrus clementina]
Length=580

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 58/161 (36%), Positives = 88/161 (55%), Gaps = 37/161 (23%)
 Frame = +1

Query  166  LPMSLAHQIGFISRTPVEVRTESVTREAPAKTAVSISPLWR---RNLRISVKNLAAKAVL  336
            + ++L HQIG ++ TP+++ T  V+ ++     V+ S +W+    +LR +++    K  +
Sbjct  1    MALNLTHQIGTLAGTPIQMDTGVVSGDSTG--TVNASAVWKPVSTDLRCAIQKPDLKDTM  58

Query  337  R-----------GGMEADLSAAV--------------EREHKMGSD---RGG----SRGV  420
                          M ADLS A               E   ++G +   +GG      GV
Sbjct  59   SPPVSPCRSPVLSSMRADLSVACRAFATESPTAAAVTEFSEEVGGEMYKQGGLQEKGNGV  118

Query  421  PVFVMMPLDTVKMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            PVFVMMPLD+V M +T+NRKKAM+ SL+ALKSAGVEG+M+D
Sbjct  119  PVFVMMPLDSVTMSNTVNRKKAMDASLRALKSAGVEGVMMD  159



>ref|XP_010264799.1| PREDICTED: beta-amylase 1, chloroplastic-like [Nelumbo nucifera]
Length=594

 Score = 83.6 bits (205),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 59/169 (35%), Positives = 83/169 (49%), Gaps = 45/169 (27%)
 Frame = +1

Query  166  LPMSLAHQIGFISRTPVEVRTESVTREAPAKTAVSISPLWRR-----NLRISVKNLAAK-  327
            + +S+ HQIG +S TP+ V  ES    +     VS S +W+      NLR  ++    + 
Sbjct  1    MALSITHQIGALSGTPIPV--ESGNGPSDQTAVVSASAVWKTPAQPTNLRCRIQKQGPEK  58

Query  328  ------------AVLRGGMEADLSAAVE-------------------------REHKMGS  396
                         V  GG+ A +S A +                         RE   GS
Sbjct  59   DALSPPLSPCLSPVFGGGIGAGMSVACQAFAADVTETAMEEEEIGVGREVREYREGGAGS  118

Query  397  DRGGSRGVPVFVMMPLDTVKMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
             +   +GVPV+VMMPLD+V M + +NR+KAMNVS+ ALKSAGVEG+M+D
Sbjct  119  AQVRGKGVPVYVMMPLDSVTMSNGVNRRKAMNVSMMALKSAGVEGVMMD  167



>ref|XP_011041480.1| PREDICTED: beta-amylase 1, chloroplastic-like [Populus euphratica]
Length=586

 Score = 83.6 bits (205),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 48/124 (39%), Positives = 73/124 (59%), Gaps = 12/124 (10%)
 Frame = +1

Query  205  RTPV-----EVRTESVTREAPAKTAVSISPLW------RRNLRISVKNLAAKAVLRGGME  351
            +TP+     ++R +    +    T+   SP+       R +L ++ +  A + +    ++
Sbjct  38   KTPIPNIRCQIRKQETIEQKSQPTSPCRSPILSGCNGIRPDLSVACRAFATETLEFMTLD  97

Query  352  ADLSAAVEREHKMGSDRGGSRGVPVFVMMPLDTVKMDHTMNRKKAMNVSLQALKSAGVEG  531
               +A  E+ +K G      +GVPV+VMMPLD+V M +T+NRKKAMN SLQALKSAGVEG
Sbjct  98   ESKAAEEEKMYKEGKTEK-EKGVPVYVMMPLDSVTMGNTLNRKKAMNASLQALKSAGVEG  156

Query  532  IMVD  543
            +MVD
Sbjct  157  LMVD  160



>ref|XP_007035341.1| Beta-amylase 1 isoform 2, partial [Theobroma cacao]
 gb|EOY06267.1| Beta-amylase 1 isoform 2, partial [Theobroma cacao]
Length=521

 Score = 83.2 bits (204),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 66/166 (40%), Positives = 85/166 (51%), Gaps = 39/166 (23%)
 Frame = +1

Query  157  KLILPMSLAHQIGFISRTPVEVRTESVTREAPAKTAVSISPLWRR---NLRISV------  309
            K I+ ++LA QIG ++ T  ++ TE    E  +   VS S +WR    NLR         
Sbjct  23   KEIMALNLASQIGTLAGT--QIPTEVSNGEQLSSGTVSASAVWRAPAANLRCKTSQDTVS  80

Query  310  ----------KNLAAKAVLRGGM-EADLSAA------------VERE-----HKMGSDRG  405
                      ++  +++ L   M   DLSAA            VE E      K G  + 
Sbjct  81   PPSLTPPLTPRSPGSRSPLMSPMLRPDLSAACQAFTTLAPPETVEEEAAGVAWKEGGRKE  140

Query  406  GSRGVPVFVMMPLDTVKMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
              RGVPV+VMMPLD+V   +T+NRKKAMN SL ALKSAGVEGIMVD
Sbjct  141  EKRGVPVYVMMPLDSVTYGNTLNRKKAMNASLHALKSAGVEGIMVD  186



>ref|XP_010466824.1| PREDICTED: beta-amylase 1, chloroplastic isoform X2 [Camelina 
sativa]
Length=575

 Score = 83.2 bits (204),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 56/148 (38%), Positives = 81/148 (55%), Gaps = 23/148 (16%)
 Frame = +1

Query  166  LPMSLAHQIGFISRTPV---EVRTESVTREAP--AKTAVSISPLWRRNLRISVKNLAAKA  330
            + ++++HQ+G ++ TP+   E+   S+   +P  A+  +S  P+ R             +
Sbjct  1    MALNISHQLGVLAGTPIKSGEMTDSSILSVSPPSARMMMSSKPMNRNYKSHGTDPSPPMS  60

Query  331  VLRGGMEADLSAAVE-----------------REHKMGSDRGGSRGVPVFVMMPLDTVKM  459
             + G   ADLS A +                 +E  +G  R G  GVPVFVMMPLD+V M
Sbjct  61   PVLGATRADLSVACKAYAVESGVETIEEQRSYKEGGIGEKREGG-GVPVFVMMPLDSVTM  119

Query  460  DHTMNRKKAMNVSLQALKSAGVEGIMVD  543
             +T+NR+KAM  SLQALKSAGVEGIM+D
Sbjct  120  GNTVNRRKAMKASLQALKSAGVEGIMID  147



>ref|XP_010466823.1| PREDICTED: beta-amylase 1, chloroplastic isoform X1 [Camelina 
sativa]
 ref|XP_010466825.1| PREDICTED: beta-amylase 1, chloroplastic isoform X3 [Camelina 
sativa]
Length=575

 Score = 83.2 bits (204),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 56/148 (38%), Positives = 81/148 (55%), Gaps = 23/148 (16%)
 Frame = +1

Query  166  LPMSLAHQIGFISRTPV---EVRTESVTREAP--AKTAVSISPLWRRNLRISVKNLAAKA  330
            + ++++HQ+G ++ TP+   E+   S+   +P  A+  +S  P+ R             +
Sbjct  1    MALNISHQLGVLAGTPIKSGEMTDSSILSVSPPSARMMMSSKPMNRNYKSHGTDPSPPMS  60

Query  331  VLRGGMEADLSAAVE-----------------REHKMGSDRGGSRGVPVFVMMPLDTVKM  459
             + G   ADLS A +                 +E  +G  R G  GVPVFVMMPLD+V M
Sbjct  61   PVLGATRADLSVACKAYAVESGVETIEEQRSYKEGGIGEKREGG-GVPVFVMMPLDSVTM  119

Query  460  DHTMNRKKAMNVSLQALKSAGVEGIMVD  543
             +T+NR+KAM  SLQALKSAGVEGIM+D
Sbjct  120  GNTVNRRKAMKASLQALKSAGVEGIMID  147



>ref|XP_004166730.1| PREDICTED: beta-amylase 1, chloroplastic-like [Cucumis sativus]
Length=577

 Score = 82.8 bits (203),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 63/150 (42%), Positives = 86/150 (57%), Gaps = 27/150 (18%)
 Frame = +1

Query  172  MSLAHQIGFISRTPVEVRTESVTREAPAKTAV--------SISPLWRRNLRIS-VKNLA-  321
            +S+ HQIG ++ TPV     +++    A  AV        S SPL  R  R   V  L+ 
Sbjct  3    LSITHQIGALAGTPVTSEASNIS-AGEASLAVNTAMLRKSSASPLRCRVQRTDGVDALSP  61

Query  322  ----AKAVLRGGMEADLSAAVE------------REHKMGSDRGGSRGVPVFVMMPLDTV  453
                 ++ + GG+  DLS A +            RE+K   ++G  +GVPV+VMMPLD+V
Sbjct  62   PLSPCRSPVLGGIRPDLSVACQAFATEVEAPTEVREYKEEGEKGKEKGVPVYVMMPLDSV  121

Query  454  KMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
             M +T+NR+KAMN SLQALKSAGVEGIM+D
Sbjct  122  TMGNTVNRRKAMNASLQALKSAGVEGIMMD  151



>ref|XP_010918964.1| PREDICTED: beta-amylase 1, chloroplastic [Elaeis guineensis]
Length=571

 Score = 82.4 bits (202),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 58/153 (38%), Positives = 79/153 (52%), Gaps = 29/153 (19%)
 Frame = +1

Query  166  LPMSLAHQIGFISRTPVEVRTESVTREAPAKTA------VSISPLWRRNL------RISV  309
            + ++L HQIG    TPV    +   + APA  A      V ++ L  R L      +IS 
Sbjct  1    MALNLGHQIGVFCGTPVA--DQGGEQPAPASAAAVWKPQVPLAKLRCRRLGVGEIDQISP  58

Query  310  KNLAAKAVLRGGMEADLSAAVE---------------REHKMGSDRGGSRGVPVFVMMPL  444
                 ++ + G    DLS A +                E+  G + G  +GVPV+VM+PL
Sbjct  59   PVSPCRSPVLGATHPDLSVACQALVTDAAAETAEGEVHEYGGGVEMGKGKGVPVYVMLPL  118

Query  445  DTVKMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            DTV+    +NR+KAMN SLQALKSAGVEG+MVD
Sbjct  119  DTVRPGGGVNRRKAMNASLQALKSAGVEGVMVD  151



>ref|XP_010513371.1| PREDICTED: beta-amylase 1, chloroplastic-like [Camelina sativa]
Length=576

 Score = 82.4 bits (202),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 56/148 (38%), Positives = 82/148 (55%), Gaps = 22/148 (15%)
 Frame = +1

Query  166  LPMSLAHQIGFISRTPV---EVRTESVTREAP--AKTAVSISPLWRRNLRISVKNLAAKA  330
            + ++++HQ+G ++ TP+   E+   S+   +P  A+  +S  P+ R             +
Sbjct  1    MALNISHQLGVLAGTPIKSGEMTDSSMLSASPPSARMMMSSKPMNRNYKSHGTDPSPPMS  60

Query  331  VLRGGMEADLSAA---------------VEREHKMGS--DRGGSRGVPVFVMMPLDTVKM  459
             + G   ADLS A               V+R +K G   ++    GVPVFVMMPLD+V M
Sbjct  61   PVLGATRADLSVACKAYAVESGVETMEEVQRTYKEGGIVEKREGGGVPVFVMMPLDSVTM  120

Query  460  DHTMNRKKAMNVSLQALKSAGVEGIMVD  543
             +T+NR+KAM  SLQALKSAGVEGIM+D
Sbjct  121  GNTVNRRKAMKASLQALKSAGVEGIMID  148



>ref|XP_011029718.1| PREDICTED: beta-amylase 1, chloroplastic-like [Populus euphratica]
Length=582

 Score = 82.0 bits (201),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 55/156 (35%), Positives = 80/156 (51%), Gaps = 32/156 (21%)
 Frame = +1

Query  172  MSLAHQIGFISRTPVEVR--TESVTREAPAKTAVSISPLWRRNLRISVKNLAAKA-----  330
            M++ HQIG ++ TP++    T + T   P+  AV  +P      +I+  + A +      
Sbjct  1    MNITHQIGALAGTPIQAESITNTETTATPSAAAVWKTPTPNIRCKITKPDTAEQKSQPTS  60

Query  331  -------VLRGGMEADLSAA-----------------VEREHKMGSDRG-GSRGVPVFVM  435
                       G+ +DLS A                  E+E      +    +GVPV+VM
Sbjct  61   PCRSPILSASNGIRSDLSVACRAFATETMDLVSFDETTEQEKTYKEVKTVKEKGVPVYVM  120

Query  436  MPLDTVKMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            MPLD+V M +T+NR+KAMN SLQALKSAGVEG+M+D
Sbjct  121  MPLDSVTMGNTVNRRKAMNASLQALKSAGVEGVMMD  156



>ref|XP_010488521.1| PREDICTED: beta-amylase 1, chloroplastic-like [Camelina sativa]
Length=575

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 55/147 (37%), Positives = 81/147 (55%), Gaps = 21/147 (14%)
 Frame = +1

Query  166  LPMSLAHQIGFISRTPV---EVRTESVTREAP--AKTAVSISPLWRRNLRISVKNLAAKA  330
            + ++++HQ+G ++ TP+   E+   S+   +P  A+  +S  P+ R             +
Sbjct  1    MALNISHQLGVLAGTPIKSGEMTDSSILSVSPPSARMMMSSKPMNRNYKSHGTDPSPPMS  60

Query  331  VLRGGMEADLSAAV--------------EREHKMGS--DRGGSRGVPVFVMMPLDTVKMD  462
             + G   ADLS A               +R +K G   ++    GVPVFVMMPLD+V M 
Sbjct  61   PVLGATRADLSVACKAYAVETGVETIEEQRSYKEGGIVEKREGGGVPVFVMMPLDSVTMG  120

Query  463  HTMNRKKAMNVSLQALKSAGVEGIMVD  543
            +T+NR+KAM  SLQALKSAGVEGIM+D
Sbjct  121  NTVNRRKAMKASLQALKSAGVEGIMID  147



>ref|XP_002314522.2| hypothetical protein POPTR_0010s07340g [Populus trichocarpa]
 gb|EEF00693.2| hypothetical protein POPTR_0010s07340g [Populus trichocarpa]
Length=586

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 42/86 (49%), Positives = 59/86 (69%), Gaps = 1/86 (1%)
 Frame = +1

Query  286  RRNLRISVKNLAAKAVLRGGMEADLSAAVEREHKMGSDRGGSRGVPVFVMMPLDTVKMDH  465
            R +L ++ +  A + +    ++   +A  E+ +K G      +GVPV+VMMPLD+V M +
Sbjct  76   RPDLSVACRAFATETLEFMTLDESKAAEEEKMYKEGKTEK-EKGVPVYVMMPLDSVTMGN  134

Query  466  TMNRKKAMNVSLQALKSAGVEGIMVD  543
            T+NRKKAMN SLQALKSAGVEG+MVD
Sbjct  135  TLNRKKAMNASLQALKSAGVEGLMVD  160



>ref|XP_008224054.1| PREDICTED: beta-amylase 1, chloroplastic [Prunus mume]
Length=569

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 41/78 (53%), Positives = 53/78 (68%), Gaps = 10/78 (13%)
 Frame = +1

Query  340  GGMEADLSAAVE----------REHKMGSDRGGSRGVPVFVMMPLDTVKMDHTMNRKKAM  489
            G    DLS A +          REH++   +    GVPV+VMMPLD+V M++++NRKKAM
Sbjct  68   GSTRPDLSVACQAFATEMESPVREHQVRGAQNKGTGVPVYVMMPLDSVTMNNSVNRKKAM  127

Query  490  NVSLQALKSAGVEGIMVD  543
            N SLQALKSAGVEG+M+D
Sbjct  128  NASLQALKSAGVEGVMMD  145



>ref|XP_002885629.1| beta-amylase 7 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61888.1| beta-amylase 7 [Arabidopsis lyrata subsp. lyrata]
Length=572

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 55/144 (38%), Positives = 79/144 (55%), Gaps = 18/144 (13%)
 Frame = +1

Query  166  LPMSLAHQIGFISRTPV---EVRTESVTREAPAKTAVSISPLWRRNLRISVKNLAAKAVL  336
            + ++L+HQ+G ++ TP+   E+   S++   P+   ++   + R             + +
Sbjct  1    MALNLSHQLGVLAGTPIKSGEMTDSSLSISPPSARMMTPKAMNRNYKAHGTDPSPPMSPI  60

Query  337  RGGMEADLSAAV--------------EREHKMGSDRGGSRG-VPVFVMMPLDTVKMDHTM  471
             GG  ADLS A               +R +K G   G   G VPVFVMMPLD+V M +T+
Sbjct  61   LGGTRADLSVACKAFAVENGVETIEEQRTYKEGGIGGEGGGGVPVFVMMPLDSVTMGNTV  120

Query  472  NRKKAMNVSLQALKSAGVEGIMVD  543
            NR+KAM  SLQALKSAGVEGIM+D
Sbjct  121  NRRKAMKASLQALKSAGVEGIMID  144



>gb|KFK39690.1| hypothetical protein AALP_AA3G276400 [Arabis alpina]
Length=569

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 56/144 (39%), Positives = 82/144 (57%), Gaps = 21/144 (15%)
 Frame = +1

Query  166  LPMSLAHQIGFISRTPVEVRTESVTREAPAKTAVSISPLWRR-------NLRISVKNLAA  324
            + ++L+HQ+G ++ TP++    +V       +++S+SP   R       N +   +N++ 
Sbjct  1    MALNLSHQLGALTGTPIKSSEMTV---PSVDSSLSVSPPSARMHKPMNLNYKDPNRNVSP  57

Query  325  K-AVLRGGMEADLSAA-----VEREHKM-----GSDRGGSRGVPVFVMMPLDTVKMDHTM  471
              + + G    DLS A     VE E +           G  GVPVFVMMPLD+V M +T+
Sbjct  58   PMSPVLGSTRGDLSVACKAFAVEEEQRTYKEGGIGGEKGKGGVPVFVMMPLDSVTMGNTV  117

Query  472  NRKKAMNVSLQALKSAGVEGIMVD  543
            NR+KAM  SLQALKSAGVEGIM+D
Sbjct  118  NRRKAMKASLQALKSAGVEGIMID  141



>emb|CDX94831.1| BnaC03g43570D [Brassica napus]
Length=545

 Score = 80.5 bits (197),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 54/126 (43%), Positives = 78/126 (62%), Gaps = 9/126 (7%)
 Frame = +1

Query  166  LPMSLAHQIGFISRTPVEVRTESVTREAPAKTAVSISPLWRRNLRISVKNLAAKAVLRGG  345
            + + L HQ+G ++ TP++ R E  T  A +  +VS  P  R +  +++ +  A+     G
Sbjct  1    MALRLPHQLGALAGTPIKSR-EITTPSANSSLSVS-PPSARVHKAMNLNHNKAR-----G  53

Query  346  MEADLSAAVEREHKMGSDRGGSRGVPVFVMMPLDTVKMDHTMNRKKAMNVSLQALKSAGV  525
            M   L+ AVE   +  + R G  GVPVFVMMPLD+V M + +NR+KAM  SLQAL+S GV
Sbjct  54   MNPVLAFAVETTEERRTHREG--GVPVFVMMPLDSVTMGNAVNRRKAMRASLQALRSGGV  111

Query  526  EGIMVD  543
            EGIM+D
Sbjct  112  EGIMID  117



>ref|XP_008342553.1| PREDICTED: LOW QUALITY PROTEIN: beta-amylase 1, chloroplastic 
[Malus domestica]
Length=571

 Score = 80.5 bits (197),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 58/148 (39%), Positives = 79/148 (53%), Gaps = 28/148 (19%)
 Frame = +1

Query  172  MSLAHQIGFISRTPVEVRTESVTREAPAKTAVSISPLWRR---NLRISVKNLAAKAVLR-  339
            +S+ HQIG +S TPV     S +    +  +VS SP+W+    +L   ++       L  
Sbjct  3    LSMTHQIGALSGTPVTATEASSS----SVESVSTSPMWKSPAASLTCKIQKPEGMDGLSP  58

Query  340  ----------GGMEADLSAAVER----------EHKMGSDRGGSRGVPVFVMMPLDTVKM  459
                      G   ADLS A             EH++   R    GVPV+VMMPLD+V M
Sbjct  59   PLSPCRSPGLGSSRADLSMACRAFATEVESPVLEHQVRGARDKGTGVPVYVMMPLDSVTM  118

Query  460  DHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            ++++NRKKAMN SLQALKSAG EG+M+D
Sbjct  119  NNSVNRKKAMNASLQALKSAGAEGVMMD  146



>ref|XP_002311706.1| beta-amylase family protein [Populus trichocarpa]
 gb|EEE89073.1| beta-amylase family protein [Populus trichocarpa]
Length=562

 Score = 79.7 bits (195),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 50/139 (36%), Positives = 79/139 (57%), Gaps = 18/139 (13%)
 Frame = +1

Query  172  MSLAHQIGFISRTPVEVRT---------ESVTREAPAKTAVSISPLW------RRNLRIS  306
            M++ HQIG ++ TP++  +          S   +    T+   SP+       R +L ++
Sbjct  1    MNITHQIGALAGTPIQAESITNTETTATASAAAQKSQPTSPCRSPILSAGNGIRPDLSVA  60

Query  307  VKNLAAKAVLRGGMEADLSAAVEREHKMGSDRGGSRGVPVFVMMPLDTVKMDHTMNRKKA  486
             +  A + +    +  D +   E+ +K   +    +GVPV+VMMPLD+V M +T+NR+KA
Sbjct  61   CRAFATETM--DLVSFDETTEQEKTYKE-VNTVKEKGVPVYVMMPLDSVTMSNTLNRRKA  117

Query  487  MNVSLQALKSAGVEGIMVD  543
            MN SLQALKSAGVEG+M+D
Sbjct  118  MNASLQALKSAGVEGVMMD  136



>ref|XP_008368604.1| PREDICTED: beta-amylase 1, chloroplastic-like [Malus domestica]
Length=314

 Score = 77.4 bits (189),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 59/152 (39%), Positives = 78/152 (51%), Gaps = 36/152 (24%)
 Frame = +1

Query  172  MSLAHQIGFISRTPVEVRTESVTREAPAKTAVSISPLWRRNLRISVKNLAAKAVLRGGME  351
            +S+ HQIG  S TPV     S +    +  +VS SP+W+      V +L  K     GM+
Sbjct  3    LSMTHQIGARSGTPVTTTEASSS----SVESVSTSPMWKS----PVASLTCKIQKPEGMD  54

Query  352  ------------------ADLSAAVER----------EHKMGSDRGGSRGVPVFVMMPLD  447
                              ADLS A             EH++        GVPV+VMMPLD
Sbjct  55   GLSPPLSPCRSPGLGSSRADLSMACRAFATEVESPVLEHQVRGAHDKGTGVPVYVMMPLD  114

Query  448  TVKMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            +V M++++NRKKAMN SLQALKSAG EG+M+D
Sbjct  115  SVTMNNSVNRKKAMNASLQALKSAGAEGVMMD  146



>ref|XP_006418770.1| hypothetical protein EUTSA_v10002460mg [Eutrema salsugineum]
 gb|ESQ37206.1| hypothetical protein EUTSA_v10002460mg [Eutrema salsugineum]
Length=582

 Score = 79.3 bits (194),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 63/159 (40%), Positives = 83/159 (52%), Gaps = 42/159 (26%)
 Frame = +1

Query  172  MSLAHQIGFISRTPVEVRTESVTREAP-AKTAVSISPLWRRNLRISVKNLAAKA------  330
            ++L+HQ+G ++ TP+    +S    AP A +++S+SP     +     NL  KA      
Sbjct  3    LNLSHQLGTLAGTPI----KSGEMTAPSADSSLSVSP--PSAMMPKAMNLNYKAHGMDPN  56

Query  331  ---------VLRGGMEADLSAAV-----------------EREHKMGSDRGGSR--GVPV  426
                     VLR    ADLS A                  +R +K G   G     GVPV
Sbjct  57   RNVSPPMSPVLRSN-RADLSVACKAFAVESTVSGFETMEEQRTYKEGGITGKKENGGVPV  115

Query  427  FVMMPLDTVKMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            FVMMPLD+V M +T+NR+KAM  SLQALKSAGVEGIM+D
Sbjct  116  FVMMPLDSVTMGNTVNRRKAMKASLQALKSAGVEGIMID  154



>gb|KDP33360.1| hypothetical protein JCGZ_12909 [Jatropha curcas]
Length=583

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 59/157 (38%), Positives = 83/157 (53%), Gaps = 31/157 (20%)
 Frame = +1

Query  166  LPMSLAHQIGFISRTPVEVR----TESVTREAPAKTAVSISPLWRRNLRI---------S  306
            + M++ HQIG ++ TP+ +     T S +    +  AV  SP      +I         S
Sbjct  1    MAMNITHQIGALAGTPISIEPITTTTSESTATVSAAAVWKSPTTTLMCKIQKPDAVEQKS  60

Query  307  VKNLAAKAVLRGGMEADLSAAV------------------EREHKMGSDRGGSRGVPVFV  432
                  ++ +  G+ ADLS A                   ER ++ GS +   +GVPVFV
Sbjct  61   QPTSPCRSPILSGIRADLSVACRAFVTETSALETAIEGLEERMYRGGSGKEKGKGVPVFV  120

Query  433  MMPLDTVKMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            MMPLD+V M +T+NR+KAMN SLQALKSAGVEG+M+D
Sbjct  121  MMPLDSVTMGNTVNRRKAMNASLQALKSAGVEGVMMD  157



>ref|XP_009350111.1| PREDICTED: beta-amylase 1, chloroplastic [Pyrus x bretschneideri]
Length=571

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 56/148 (38%), Positives = 78/148 (53%), Gaps = 28/148 (19%)
 Frame = +1

Query  172  MSLAHQIGFISRTPVEVRTESVTREAPAKTAVSISPLWRRNL--------------RISV  309
            +S+ HQI  +S TP+  R+   T  +    +VS SP+W+                 R+S 
Sbjct  3    LSMTHQISALSGTPI--RSTDATSSS--VESVSASPMWKSPAAGLTCKIQKPEGVDRLSP  58

Query  310  KNLAAKAVLRGGMEADLSAAVER----------EHKMGSDRGGSRGVPVFVMMPLDTVKM  459
                 ++ + G    DLS A             EH++        GVPV+VMMPLD+V M
Sbjct  59   PLSPCRSPVLGASRPDLSMACRAFAAKAESPVLEHQVRGPHYKGTGVPVYVMMPLDSVTM  118

Query  460  DHTMNRKKAMNVSLQALKSAGVEGIMVD  543
             +++NRKKAMN SLQALKSAGVEG+M+D
Sbjct  119  HNSVNRKKAMNASLQALKSAGVEGVMMD  146



>gb|KEH26842.1| beta-amylase [Medicago truncatula]
Length=198

 Score = 74.3 bits (181),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 54/144 (38%), Positives = 79/144 (55%), Gaps = 28/144 (19%)
 Frame = +1

Query  187  QIGFISRTPVEVRTESVTREAPAKTAVSISPLWRR---NLRISVK-------------NL  318
            QIG +  TP+ +  ES + E P   +++ + +W+    NLR  V              + 
Sbjct  7    QIGSLVGTPIPI--ESTSTE-PTTASMNAAAVWKTPATNLRCQVTRSEVIENGLSPPMSP  63

Query  319  AAKAVLRG-GMEADLSAA-------VEREH-KMGSDRGGSRGVPVFVMMPLDTVKMDHTM  471
                VL G G+  DL++A       VE E+   G  +    GVPV+VMMPLD+V M + +
Sbjct  64   CRSPVLSGTGIRPDLTSAAQAFTTEVENEYVSGGKTKKEKSGVPVYVMMPLDSVTMGNGV  123

Query  472  NRKKAMNVSLQALKSAGVEGIMVD  543
            NRKKA+N ++ ALKSAGVEG+M+D
Sbjct  124  NRKKAVNAAMAALKSAGVEGVMMD  147



>gb|KJB34580.1| hypothetical protein B456_006G073600 [Gossypium raimondii]
Length=589

 Score = 77.4 bits (189),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 58/165 (35%), Positives = 76/165 (46%), Gaps = 41/165 (25%)
 Frame = +1

Query  166  LPMSLAHQIGFISRTPVEVRTESVTREAPAKTAVSISPLWRR---NLRISVKNLAAKAVL  336
            + M+L HQIG +S    ++ TE    E P+ T  S S +W+    NLR +     A   +
Sbjct  1    MAMNLGHQIGTLSGK--QIPTEFAAGEQPSSTTASPSAVWKSPAGNLRSNSPQENASPPM  58

Query  337  RGG------------------MEADLSAAVER------------------EHKMGSDRGG  408
                                 +  DLS A +                   E   G  +  
Sbjct  59   LTPPLTPNSAGEWSYLINLPMLRPDLSVACQAFATSSPLEMTEEEVAGTAEWTDGGRKDE  118

Query  409  SRGVPVFVMMPLDTVKMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
             +GV VFVMMPLD+V   +T+NRKKAMN SL ALKSAGVEGIM+D
Sbjct  119  KKGVSVFVMMPLDSVTNGNTVNRKKAMNASLHALKSAGVEGIMID  163



>ref|XP_008438436.1| PREDICTED: beta-amylase 1, chloroplastic-like [Cucumis melo]
Length=577

 Score = 77.0 bits (188),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 63/149 (42%), Positives = 87/149 (58%), Gaps = 25/149 (17%)
 Frame = +1

Query  172  MSLAHQIGFISRTPVEVRTESVTR---EAPAKTAV----SISPLWRRNLRIS-VKNLA--  321
            +S+ HQIG ++ TP+     + +     A   TAV    + SPL  R  R   V  L+  
Sbjct  3    LSITHQIGALAGTPMTSEASNTSAGEASAAVNTAVLRKSASSPLRCRVQRTEGVDALSPP  62

Query  322  ---AKAVLRGGMEADLSAAVE------------REHKMGSDRGGSRGVPVFVMMPLDTVK  456
                ++ + GG+  DLS A +            RE+K G ++G  +GVPV+VMMPLD+V 
Sbjct  63   LSPCRSPVLGGIRPDLSVACQAFATEVAAPTEVREYKEGGEKGKEKGVPVYVMMPLDSVT  122

Query  457  MDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            M +T+NR+KAMN SLQALKSAGVEGIM+D
Sbjct  123  MGNTVNRRKAMNASLQALKSAGVEGIMMD  151



>ref|XP_010550849.1| PREDICTED: beta-amylase 1, chloroplastic [Tarenaya hassleriana]
Length=591

 Score = 76.6 bits (187),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 57/161 (35%), Positives = 80/161 (50%), Gaps = 39/161 (24%)
 Frame = +1

Query  166  LPMSLAHQIGFISRTPVEVRTESVTREAPAKTAVSISP--LWR---RNLRISVKNLAAKA  330
            + ++  HQIG ++  P+       T  A   +++S+SP   W+    N++  ++   A  
Sbjct  1    MALNFTHQIGALAGNPI---IAGDTTSAAGDSSLSVSPPSAWKPMGMNIQCKIQGPEANR  57

Query  331  VLR-----------GGMEADLSAA-------------------VEREHKMGSDRGGSRGV  420
             +            G    DLS A                   + RE  +G  R  + GV
Sbjct  58   SVSPPVSPISTPVLGASRPDLSVACRASAVAAAAAVETAEEQRMYREGGIGG-RKENGGV  116

Query  421  PVFVMMPLDTVKMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            PVFVMMPLD+V M +T+NRKKAM  SLQALKSAGVEGIM+D
Sbjct  117  PVFVMMPLDSVTMGNTVNRKKAMKASLQALKSAGVEGIMID  157



>ref|XP_008391283.1| PREDICTED: beta-amylase 1, chloroplastic-like [Malus domestica]
Length=571

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 55/148 (37%), Positives = 79/148 (53%), Gaps = 28/148 (19%)
 Frame = +1

Query  172  MSLAHQIGFISRTPVEVRTESVTREAPAKTAVSISPLWRR-----NLRIS----VKNLA-  321
            +S+ HQI  +S TP+     +    + +  +VS SP+W+        +I     V  L+ 
Sbjct  3    LSMTHQISALSGTPIR----TTDASSSSVESVSASPMWKSPAAGLTCKIQKPERVDGLSP  58

Query  322  ----AKAVLRGGMEADLSAAVER----------EHKMGSDRGGSRGVPVFVMMPLDTVKM  459
                 ++ + G    DLS A             EH++        GVPV+VMMPLD+V M
Sbjct  59   PLSPCRSPVLGSSRPDLSMACRAFATEAESPVLEHQVRGAHDKGTGVPVYVMMPLDSVTM  118

Query  460  DHTMNRKKAMNVSLQALKSAGVEGIMVD  543
             +++NRKKAMN SLQALKSAGVEG+M+D
Sbjct  119  HNSVNRKKAMNASLQALKSAGVEGVMMD  146



>emb|CDY45566.1| BnaC09g21440D [Brassica napus]
Length=564

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 59/141 (42%), Positives = 83/141 (59%), Gaps = 24/141 (17%)
 Frame = +1

Query  172  MSLAHQIGFISRTPV---EVRTESVTREAPAKTAVSISPLWRRNLRISV-KNLAAK-AVL  336
             +L HQ+G ++ TP+   E+ T S      A++++S+SP   R + IS+ +N++   + +
Sbjct  3    FNLTHQLGALAGTPIKSGEMTTPS------AESSLSVSPPSAR-MPISMNRNVSPPMSPV  55

Query  337  RGGMEADLSAA--------VEREHKMGSDRGGSRG----VPVFVMMPLDTVKMDHTMNRK  480
             G   ADLS A        VE +        G       VPVFVMMPLD+V M +T+NR+
Sbjct  56   LGSRRADLSVACKAFAVETVEEQRTYKEGGIGGEKGKGGVPVFVMMPLDSVTMGNTVNRR  115

Query  481  KAMNVSLQALKSAGVEGIMVD  543
            KAM  SLQALKSAGVEGIM+D
Sbjct  116  KAMRASLQALKSAGVEGIMID  136



>ref|NP_189034.1| beta-amylase 1 [Arabidopsis thaliana]
 sp|Q9LIR6.1|BAM1_ARATH RecName: Full=Beta-amylase 1, chloroplastic; AltName: Full=1,4-alpha-D-glucan 
maltohydrolase; AltName: Full=Beta-amylase 
7; AltName: Full=Thioredoxin-regulated beta-amylase; Short=TR-BAMY; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAK56281.1|AF367293_1 AT3g23920/F14O13_11 [Arabidopsis thaliana]
 dbj|BAB03009.1| beta-amylase [Arabidopsis thaliana]
 gb|AAL67089.1| putative beta-amylase [Arabidopsis thaliana]
 gb|AAL77747.1| AT3g23920/F14O13_11 [Arabidopsis thaliana]
 gb|AAM20167.1| putative beta-amylase [Arabidopsis thaliana]
 gb|AEE76832.1| beta-amylase 1 [Arabidopsis thaliana]
Length=575

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 56/147 (38%), Positives = 82/147 (56%), Gaps = 21/147 (14%)
 Frame = +1

Query  166  LPMSLAHQIGFISRTPVEV--RTESVTREAPAKTAVSISP-LWRRNLRISVKNLAAK-AV  333
            + ++L+HQ+G ++ TP++    T+S        +A  ++P    RN +    + +   + 
Sbjct  1    MALNLSHQLGVLAGTPIKSGEMTDSSLLSISPPSARMMTPKAMNRNYKAHGTDPSPPMSP  60

Query  334  LRGGMEADLSAAVE-----------------REHKMGSDRGGSRGVPVFVMMPLDTVKMD  462
            + G   ADLS A +                 RE  +G  + G  GVPVFVMMPLD+V M 
Sbjct  61   ILGATRADLSVACKAFAVENGIGTIEEQRTYREGGIGGKKEGGGGVPVFVMMPLDSVTMG  120

Query  463  HTMNRKKAMNVSLQALKSAGVEGIMVD  543
            +T+NR+KAM  SLQALKSAGVEGIM+D
Sbjct  121  NTVNRRKAMKASLQALKSAGVEGIMID  147



>ref|XP_001756520.1| predicted protein [Physcomitrella patens]
 gb|EDQ78474.1| predicted protein [Physcomitrella patens]
Length=483

 Score = 73.9 bits (180),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +1

Query  382  HKMGSDRGGSRGVPVFVMMPLDTVKMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            H+  + RG   GVPVFVM+PLDTV M++T+NR++A++ SL ALKSAGVEG+M+D
Sbjct  2    HETATSRGVRGGVPVFVMLPLDTVSMNNTLNRRRALDASLLALKSAGVEGVMMD  55



>ref|XP_009102529.1| PREDICTED: beta-amylase 1, chloroplastic [Brassica rapa]
Length=570

 Score = 73.9 bits (180),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 59/144 (41%), Positives = 82/144 (57%), Gaps = 24/144 (17%)
 Frame = +1

Query  172  MSLAHQIGFISRTPVEVRTESVTREAP-AKTAVSISPLWRR-----NLRI-SVKNLAAK-  327
             +L HQ+G ++ TP++    S    AP A++++S+SP   R     N+   S +N++   
Sbjct  3    FNLTHQLGALAGTPIK----SGEMTAPSAESSLSVSPPSARMPISMNMNYTSNRNVSPPM  58

Query  328  AVLRGGMEADLSAA--------VEREHKMGSDRGGSRG----VPVFVMMPLDTVKMDHTM  471
            + + G   ADLS A        VE +        G       VPVFVMMPLD+V M +T+
Sbjct  59   SPVLGSRRADLSVACKAFAVETVEEQRTYKEGGIGGEKEKGGVPVFVMMPLDSVTMGNTV  118

Query  472  NRKKAMNVSLQALKSAGVEGIMVD  543
            NR+KAM  SLQALKSAGVEGIM+D
Sbjct  119  NRRKAMRASLQALKSAGVEGIMID  142



>emb|CDX77441.1| BnaA07g05790D [Brassica napus]
Length=570

 Score = 73.9 bits (180),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 59/144 (41%), Positives = 82/144 (57%), Gaps = 24/144 (17%)
 Frame = +1

Query  172  MSLAHQIGFISRTPVEVRTESVTREAP-AKTAVSISPLWRR-----NLRI-SVKNLAAK-  327
             +L HQ+G ++ TP++    S    AP A++++S+SP   R     N+   S +N++   
Sbjct  3    FNLTHQLGALAGTPIK----SGEMTAPSAESSLSVSPPSARMPISMNMNYTSNRNVSPPM  58

Query  328  AVLRGGMEADLSAA--------VEREHKMGSDRGGSRG----VPVFVMMPLDTVKMDHTM  471
            + + G   ADLS A        VE +        G       VPVFVMMPLD+V M +T+
Sbjct  59   SPVLGSRRADLSVACKAFAVETVEEQRTYKEGGIGGEKGKGGVPVFVMMPLDSVTMGNTV  118

Query  472  NRKKAMNVSLQALKSAGVEGIMVD  543
            NR+KAM  SLQALKSAGVEGIM+D
Sbjct  119  NRRKAMRASLQALKSAGVEGIMID  142



>gb|KJB68813.1| hypothetical protein B456_011G1809002, partial [Gossypium raimondii]
Length=208

 Score = 70.5 bits (171),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +1

Query  418  VPVFVMMPLDTVKMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            VPV+VMMPLD+V   +T+NRKKAMN SL ALKSAGVEGIM+D
Sbjct  116  VPVYVMMPLDSVTNGNTVNRKKAMNASLHALKSAGVEGIMID  157



>ref|XP_001768786.1| predicted protein [Physcomitrella patens]
 gb|EDQ66339.1| predicted protein [Physcomitrella patens]
Length=505

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = +1

Query  382  HKMGSDRGGSRGVPVFVMMPLDTVKMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            H+  + RG    VPVFVM+PLD+V M++T+NR++A+N SL ALKSAG+EGIM+D
Sbjct  24   HETATSRGVHGRVPVFVMLPLDSVNMNNTLNRRRALNASLMALKSAGIEGIMMD  77



>ref|XP_004511752.1| PREDICTED: beta-amylase 3, chloroplastic-like [Cicer arietinum]
Length=545

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 36/61 (59%), Positives = 44/61 (72%), Gaps = 5/61 (8%)
 Frame = +1

Query  361  SAAVEREHKMGSDRGGSRGVPVFVMMPLDTVKMDHTMNRKKAMNVSLQALKSAGVEGIMV  540
            + +V   H   S+R     VPVFVM+PLDTV M   +N++KAMNVSL ALKSAGVEG+MV
Sbjct  74   APSVTHNHDDDSNR-----VPVFVMLPLDTVSMGGNLNKQKAMNVSLMALKSAGVEGVMV  128

Query  541  D  543
            D
Sbjct  129  D  129



>ref|XP_010111574.1| Beta-amylase 1 [Morus notabilis]
 gb|EXC31281.1| Beta-amylase 1 [Morus notabilis]
Length=604

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 53/84 (63%), Gaps = 16/84 (19%)
 Frame = +1

Query  340  GGMEADLSAAV----------------EREHKMGSDRGGSRGVPVFVMMPLDTVKMDHTM  471
            GG+  DLSAA                   EH+    R    GVPV+VMMPL++V M+HT+
Sbjct  93   GGIRPDLSAACLAFGTELEAPTEELASASEHREVRARVKGSGVPVYVMMPLNSVMMNHTV  152

Query  472  NRKKAMNVSLQALKSAGVEGIMVD  543
            +++KAM +SL+ALKSAGVEGIM+D
Sbjct  153  HKRKAMEMSLRALKSAGVEGIMLD  176



>gb|AAL37169.1|AF319168_1 putative chloroplast-targeted beta-amylase [Brassica napus]
Length=569

 Score = 70.5 bits (171),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 57/144 (40%), Positives = 82/144 (57%), Gaps = 24/144 (17%)
 Frame = +1

Query  172  MSLAHQIGFISRTPVEVRTESVTREAP-AKTAVSISPLWRR-----NLRI-SVKNLAAK-  327
             +L HQ+G ++ TP++    S    AP A++++S+SP   R     N+   S +N++   
Sbjct  3    FNLTHQLGALAGTPIK----SGEMTAPSAESSLSVSPPSARMPISMNMNYTSNRNVSPPM  58

Query  328  AVLRGGMEADLSAA--------VEREHKMGSDRGGSRG----VPVFVMMPLDTVKMDHTM  471
            + + G   ADLS A        VE +        G       VPVFVM+PLD+V + +T+
Sbjct  59   SPVLGSRRADLSVACKAFAVETVEEQRTYKEGGIGGEKGKGGVPVFVMIPLDSVTIGNTV  118

Query  472  NRKKAMNVSLQALKSAGVEGIMVD  543
            NR+KAM  SLQALKSAGVEGIM+D
Sbjct  119  NRRKAMRASLQALKSAGVEGIMID  142



>ref|XP_003558837.1| PREDICTED: beta-amylase 1, chloroplastic-like [Brachypodium distachyon]
Length=573

 Score = 70.5 bits (171),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 49/124 (40%), Positives = 67/124 (54%), Gaps = 13/124 (10%)
 Frame = +1

Query  208  TPVEVRTESVTREAPAKTAVSISPLWRRNLRISVKNLAAKAVLRGGMEADLSAAVEREHK  387
            TP   RT  ++  A + TAV  +P   + L++  + +   A     ++    A V+    
Sbjct  29   TPGSSRTALLSAGASSSTAVP-APNAAQLLKMQAQTMEPAAPQAADIDKACQALVDGAAA  87

Query  388  MGSDRGGSR-----------GVPVFVMMPLDTVKMDHT-MNRKKAMNVSLQALKSAGVEG  531
             G+D+G              GVPVFVMMPLDTV+ D + +NR+KAM  SL ALKSAG EG
Sbjct  88   PGADQGAEHADVAGVEARKVGVPVFVMMPLDTVRKDGSALNRRKAMQASLAALKSAGAEG  147

Query  532  IMVD  543
            IMVD
Sbjct  148  IMVD  151



>ref|XP_008460711.1| PREDICTED: beta-amylase 1, chloroplastic [Cucumis melo]
Length=545

 Score = 70.5 bits (171),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 36/61 (59%), Positives = 43/61 (70%), Gaps = 4/61 (7%)
 Frame = +1

Query  361  SAAVEREHKMGSDRGGSRGVPVFVMMPLDTVKMDHTMNRKKAMNVSLQALKSAGVEGIMV  540
            +AAVE E K     G   GV VFVMM LD+V M + +NR+KAM VS QA+K AGVEG+MV
Sbjct  75   TAAVEEEEK----EGNRSGVGVFVMMALDSVTMGNKVNRRKAMEVSFQAMKGAGVEGVMV  130

Query  541  D  543
            D
Sbjct  131  D  131



>gb|KHG16283.1| Beta-amylase 1, chloroplastic -like protein [Gossypium arboreum]
Length=587

 Score = 70.5 bits (171),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 53/163 (33%), Positives = 76/163 (47%), Gaps = 39/163 (24%)
 Frame = +1

Query  166  LPMSLAHQIGFISRTPVEVRTESVTREAPAKTAVSISPLWR---RNLRISVKNLA-----  321
            + ++LAHQIG ++ T  ++  E  T E  +    ++S + +    NLR +    A     
Sbjct  1    MALNLAHQIGSLAGT--QIAAEVTTGEQSSSATANVSGVRKVPLANLRCNAPGEALSPPM  58

Query  322  ------------AKAVLRGGMEADLSAAVEREHKMGSDRGGSRG----------------  417
                          A++   +  DLSAA +    +                         
Sbjct  59   LTPPLTPRSAANRSAMMSPSLRPDLSAACQAYGTLSPLETAEESSASVAWKEGGKKEEKK  118

Query  418  -VPVFVMMPLDTVKMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
             VPV+VMMPLD+V   +T+NRKKAMN SL ALKSAGVEGIM+D
Sbjct  119  GVPVYVMMPLDSVTNGNTVNRKKAMNASLHALKSAGVEGIMID  161



>ref|XP_001778149.1| predicted protein [Physcomitrella patens]
 gb|EDQ57039.1| predicted protein [Physcomitrella patens]
Length=507

 Score = 70.1 bits (170),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = +1

Query  382  HKMGSDRGGSRGVPVFVMMPLDTVKMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            H+  + RG   GVPVFVM+PLD+V +++T+ R++A+N SL ALKSAGVEG+M+D
Sbjct  27   HETPTSRGVHGGVPVFVMLPLDSVNINNTLKRRRALNASLLALKSAGVEGVMMD  80



>ref|XP_002517513.1| Beta-amylase, putative [Ricinus communis]
 gb|EEF45055.1| Beta-amylase, putative [Ricinus communis]
Length=547

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 41/87 (47%), Positives = 50/87 (57%), Gaps = 5/87 (6%)
 Frame = +1

Query  298  RISVKNLAAKAVLRGG----MEADLSAAVEREHKMG-SDRGGSRGVPVFVMMPLDTVKMD  462
            R+  KN   +A L       ME   S   E+ H M  S       VPVFVM+PLDTV + 
Sbjct  40   RLGAKNSMQEAQLSQDNIFTMEGRRSDNREKLHAMSNSQSSNDSKVPVFVMLPLDTVTLG  99

Query  463  HTMNRKKAMNVSLQALKSAGVEGIMVD  543
              +N+ +AMN SL ALKSAGVEG+MVD
Sbjct  100  GNLNKPRAMNASLMALKSAGVEGVMVD  126



>ref|XP_004147196.1| PREDICTED: beta-amylase 1, chloroplastic-like [Cucumis sativus]
 gb|KGN61543.1| hypothetical protein Csa_2G167190 [Cucumis sativus]
Length=545

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 38/62 (61%), Positives = 45/62 (73%), Gaps = 6/62 (10%)
 Frame = +1

Query  361  SAAVEREHKMGSDRGGSR-GVPVFVMMPLDTVKMDHTMNRKKAMNVSLQALKSAGVEGIM  537
            +AAVE E K     GG R GV VFVMM LD+V M + +NR+KAM VS QA+K AGVEG+M
Sbjct  75   TAAVEEEEK-----GGYRSGVGVFVMMALDSVTMGNKVNRRKAMEVSFQAMKGAGVEGVM  129

Query  538  VD  543
            VD
Sbjct  130  VD  131



>gb|ACG29617.1| beta-amylase [Zea mays]
Length=572

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 42/77 (55%), Positives = 53/77 (69%), Gaps = 2/77 (3%)
 Frame = +1

Query  319  AAKAVLRGGMEADLSAAVEREH-KMGSDRGGSRGVPVFVMMPLDTVKMD-HTMNRKKAMN  492
            A K  L    +A + AA E EH  + ++     GVPVFVMMPLDTV+ D +++NR+KA+ 
Sbjct  74   AVKPDLAMACQALVEAAPEAEHADVAAELRSRAGVPVFVMMPLDTVRKDGNSLNRRKAVE  133

Query  493  VSLQALKSAGVEGIMVD  543
             SL ALKSAGVEGIMVD
Sbjct  134  ASLAALKSAGVEGIMVD  150



>tpg|DAA43306.1| TPA: beta-amylase [Zea mays]
Length=573

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 42/77 (55%), Positives = 53/77 (69%), Gaps = 2/77 (3%)
 Frame = +1

Query  319  AAKAVLRGGMEADLSAAVEREH-KMGSDRGGSRGVPVFVMMPLDTVKMD-HTMNRKKAMN  492
            A K  L    +A + AA E EH  + ++     GVPVFVMMPLDTV+ D +++NR+KA+ 
Sbjct  75   AVKPDLAMACQALVEAAPEAEHADVAAELRSRAGVPVFVMMPLDTVRKDGNSLNRRKAVE  134

Query  493  VSLQALKSAGVEGIMVD  543
             SL ALKSAGVEGIMVD
Sbjct  135  ASLAALKSAGVEGIMVD  151



>ref|NP_001148159.1| beta-amylase [Zea mays]
 gb|ACG29973.1| beta-amylase [Zea mays]
Length=573

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 42/77 (55%), Positives = 53/77 (69%), Gaps = 2/77 (3%)
 Frame = +1

Query  319  AAKAVLRGGMEADLSAAVEREH-KMGSDRGGSRGVPVFVMMPLDTVKMD-HTMNRKKAMN  492
            A K  L    +A + AA E EH  + ++     GVPVFVMMPLDTV+ D +++NR+KA+ 
Sbjct  75   AVKPDLAMACQALVEAAPEAEHADVAAELRSRAGVPVFVMMPLDTVRKDGNSLNRRKAVE  134

Query  493  VSLQALKSAGVEGIMVD  543
             SL ALKSAGVEGIMVD
Sbjct  135  ASLAALKSAGVEGIMVD  151



>gb|KJB72487.1| hypothetical protein B456_011G1810002, partial [Gossypium raimondii]
 gb|KJB72488.1| hypothetical protein B456_011G1810002, partial [Gossypium raimondii]
Length=212

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 57/165 (35%), Positives = 78/165 (47%), Gaps = 43/165 (26%)
 Frame = +1

Query  166  LPMSLAHQIGFISRTPVEVRTESVTREAPAKTAVSIS-----PLWRRNLRISVKNLAA--  324
            + ++LAHQIG ++ T  ++  E  T E  +     +S     PL   NLR +    A   
Sbjct  1    MALNLAHQIGSLAGT--QIAAEVTTGEQSSSATADVSGFRKVPL--ANLRCNAPGEALSP  56

Query  325  ---------------KAVLRGGMEADLSAAVE----------REHKMGS-------DRGG  408
                            A++   +  DLSA  +           E    S        +  
Sbjct  57   PMLTPPLTPRSAANRSAMMSLSLRPDLSAVCQAFGTLSPLETAEESSASVAWKEGGKKEE  116

Query  409  SRGVPVFVMMPLDTVKMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
             +GVPV+VMMPLD+V   +T+NRKKAMN SL ALKSAGVEGIM+D
Sbjct  117  KKGVPVYVMMPLDSVTNGNTVNRKKAMNASLHALKSAGVEGIMID  161



>ref|XP_004985749.1| PREDICTED: beta-amylase 1, chloroplastic-like isoform X1 [Setaria 
italica]
Length=603

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 40/75 (53%), Positives = 53/75 (71%), Gaps = 2/75 (3%)
 Frame = +1

Query  325  KAVLRGGMEADLSAAVEREH-KMGSDRGGSRGVPVFVMMPLDTVKMD-HTMNRKKAMNVS  498
            K+ L    +A + AA E EH  + ++     GVPVFVMMPLDTV+ D +++NR++A+  S
Sbjct  67   KSDLAMACQALVEAAPEAEHADVAAELKSKAGVPVFVMMPLDTVRKDGNSLNRRRAVEAS  126

Query  499  LQALKSAGVEGIMVD  543
            L ALKSAGVEGIMVD
Sbjct  127  LAALKSAGVEGIMVD  141



>ref|XP_007155732.1| hypothetical protein PHAVU_003G226900g [Phaseolus vulgaris]
 gb|ESW27726.1| hypothetical protein PHAVU_003G226900g [Phaseolus vulgaris]
Length=548

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 49/132 (37%), Positives = 75/132 (57%), Gaps = 11/132 (8%)
 Frame = +1

Query  166  LPMSLAHQIGFISRTPVEVRTESVTREAPAKTAVSISPLWRRNLRISVKNLAAKAVL---  336
            + ++L   I FI++   E +    + + PA   +S + L + + R+ VKN   +A     
Sbjct  1    MALTLRSSISFINQK--ETKILKTSDDVPA--ILSFAKL-KPSFRLRVKNSMQEAHHARD  55

Query  337  -RGGMEADLSAAVEREH--KMGSDRGGSRGVPVFVMMPLDTVKMDHTMNRKKAMNVSLQA  507
                 EA  +   E+ H   +   + GS+ VPV+VM+PLDTV M  ++N+ +AMN SL A
Sbjct  56   NSFNSEARRNEKWEKVHAPSVAHSQSGSKRVPVYVMLPLDTVTMGGSLNKPRAMNASLMA  115

Query  508  LKSAGVEGIMVD  543
            LKSAGVEG+MVD
Sbjct  116  LKSAGVEGVMVD  127



>ref|XP_004985750.1| PREDICTED: beta-amylase 1, chloroplastic-like isoform X2 [Setaria 
italica]
Length=563

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 40/75 (53%), Positives = 53/75 (71%), Gaps = 2/75 (3%)
 Frame = +1

Query  325  KAVLRGGMEADLSAAVEREH-KMGSDRGGSRGVPVFVMMPLDTVKMD-HTMNRKKAMNVS  498
            K+ L    +A + AA E EH  + ++     GVPVFVMMPLDTV+ D +++NR++A+  S
Sbjct  67   KSDLAMACQALVEAAPEAEHADVAAELKSKAGVPVFVMMPLDTVRKDGNSLNRRRAVEAS  126

Query  499  LQALKSAGVEGIMVD  543
            L ALKSAGVEGIMVD
Sbjct  127  LAALKSAGVEGIMVD  141



>ref|XP_004508980.1| PREDICTED: beta-amylase 3, chloroplastic-like [Cicer arietinum]
Length=545

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = +1

Query  394  SDRGGSRGVPVFVMMPLDTVKMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            S+  GS+ VPVFVM+PLDTV M   +N+ +AM+ SL ALKSAGVEG+MVD
Sbjct  74   SNHDGSKKVPVFVMLPLDTVTMGGNLNKPRAMSASLMALKSAGVEGVMVD  123



>gb|AFI56496.1| beta-amylase [Vaccinium corymbosum]
Length=533

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 37/45 (82%), Gaps = 0/45 (0%)
 Frame = +1

Query  409  SRGVPVFVMMPLDTVKMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            SR VPVFVM+PLDTV +   +N+ KAMN SL ALKSAG+EG+MVD
Sbjct  83   SRNVPVFVMLPLDTVSLGGHLNKPKAMNASLMALKSAGIEGVMVD  127



>gb|KEH31589.1| beta-amylase [Medicago truncatula]
Length=541

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = +1

Query  394  SDRGGSRGVPVFVMMPLDTVKMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            S+   S+ VPVFVM+PLDTV M   +N+ +AMN SL ALKSAGVEG+MVD
Sbjct  70   SNHDNSKKVPVFVMLPLDTVTMGGNLNKPRAMNASLMALKSAGVEGVMVD  119



>ref|XP_006573703.1| PREDICTED: beta-amylase 3, chloroplastic-like [Glycine max]
Length=548

 Score = 67.8 bits (164),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 32/45 (71%), Positives = 37/45 (82%), Gaps = 0/45 (0%)
 Frame = +1

Query  409  SRGVPVFVMMPLDTVKMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            S  VPVFVM+PLDTV M  T+N+ +AMN SL ALKSAGVEG+MVD
Sbjct  85   SMRVPVFVMLPLDTVTMGGTLNKPRAMNASLMALKSAGVEGVMVD  129



>gb|KHN42645.1| Beta-amylase 3, chloroplastic [Glycine soja]
Length=548

 Score = 67.8 bits (164),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +1

Query  418  VPVFVMMPLDTVKMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            VPVFVM+PLDTV M  T+N+ +AMN SL ALKSAGVEG+MVD
Sbjct  88   VPVFVMLPLDTVTMGGTLNKPRAMNASLMALKSAGVEGVMVD  129



>ref|XP_003539125.1| PREDICTED: beta-amylase 3, chloroplastic-like isoform 1 [Glycine 
max]
 gb|KHN34883.1| Beta-amylase 3, chloroplastic [Glycine soja]
Length=554

 Score = 67.8 bits (164),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +1

Query  418  VPVFVMMPLDTVKMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            VPVFVM+PLDTV M  T+N+ +AMN SL ALKSAGVEG+MVD
Sbjct  94   VPVFVMLPLDTVTMGGTLNKPRAMNASLMALKSAGVEGVMVD  135



>gb|AGT17079.1| beta-amylase [Saccharum hybrid cultivar R570]
Length=560

 Score = 67.4 bits (163),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 39/44 (89%), Gaps = 1/44 (2%)
 Frame = +1

Query  415  GVPVFVMMPLDTVKMD-HTMNRKKAMNVSLQALKSAGVEGIMVD  543
            GVPVFVMMPLDTV+ D +++NR+KA+  SL ALKSAGVEGIMVD
Sbjct  95   GVPVFVMMPLDTVRKDGNSLNRRKAVEASLAALKSAGVEGIMVD  138



>gb|EMT02663.1| hypothetical protein F775_42276 [Aegilops tauschii]
Length=153

 Score = 64.3 bits (155),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 32/46 (70%), Positives = 38/46 (83%), Gaps = 1/46 (2%)
 Frame = +1

Query  409  SRGVPVFVMMPLDTVKMDHT-MNRKKAMNVSLQALKSAGVEGIMVD  543
            +RGVPVFVMMPLDTV+ D + +NR+KA+  SL ALKSAG  GIMVD
Sbjct  16   ARGVPVFVMMPLDTVRKDGSALNRRKAVQASLAALKSAGTAGIMVD  61



>emb|CDP13430.1| unnamed protein product [Coffea canephora]
Length=547

 Score = 67.4 bits (163),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 41/93 (44%), Positives = 54/93 (58%), Gaps = 3/93 (3%)
 Frame = +1

Query  271  ISPLWRRNLRISVKNLAAKAVLRGGMEADLSAAVEREHKMGSDRG--GSRGVPVFVMMPL  444
            I P  R   R S++           +E   +   E+ H + + R   GSR VPVFVM+PL
Sbjct  35   IRPTCRLRARNSMQEAPISRERPSQLEGRKNEQGEKLHGLPAPRSQNGSR-VPVFVMLPL  93

Query  445  DTVKMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            DTV +   +N+ +AMN SL ALKSAGVEG+MVD
Sbjct  94   DTVSVGGNLNKPRAMNASLMALKSAGVEGVMVD  126



>ref|XP_002468533.1| hypothetical protein SORBIDRAFT_01g047500 [Sorghum bicolor]
 gb|EER95531.1| hypothetical protein SORBIDRAFT_01g047500 [Sorghum bicolor]
Length=564

 Score = 67.4 bits (163),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 39/44 (89%), Gaps = 1/44 (2%)
 Frame = +1

Query  415  GVPVFVMMPLDTVKMD-HTMNRKKAMNVSLQALKSAGVEGIMVD  543
            GVPVFVMMPLDTV+ D +++NR+KA+  SL ALKSAGVEGIMVD
Sbjct  99   GVPVFVMMPLDTVRKDGNSLNRRKAVEASLAALKSAGVEGIMVD  142



>ref|XP_003611408.1| Beta-amylase [Medicago truncatula]
 gb|AES94366.1| beta-amylase [Medicago truncatula]
Length=543

 Score = 67.0 bits (162),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 34/61 (56%), Positives = 43/61 (70%), Gaps = 5/61 (8%)
 Frame = +1

Query  361  SAAVEREHKMGSDRGGSRGVPVFVMMPLDTVKMDHTMNRKKAMNVSLQALKSAGVEGIMV  540
            +++V   H   S+R     VPVFVM+PLDTV M   +N+ +AMN SL ALKSAGVEG+MV
Sbjct  75   TSSVTHNHDGDSNR-----VPVFVMLPLDTVTMGGKLNKARAMNASLMALKSAGVEGVMV  129

Query  541  D  543
            D
Sbjct  130  D  130



>ref|XP_009135884.1| PREDICTED: beta-amylase 1, chloroplastic-like [Brassica rapa]
Length=564

 Score = 67.0 bits (162),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 57/139 (41%), Positives = 81/139 (58%), Gaps = 16/139 (12%)
 Frame = +1

Query  166  LPMSLAHQIGFISRTPVEVRTESVTREAPAKTAVSISPLWRR---NLRISVKNLAAKAVL  336
            + + L HQ+G ++  P++ R   +T  +P  +++S+SP   R    + ++ K      VL
Sbjct  1    MALRLPHQLGALAGAPIKSR--EITTASPVNSSLSVSPPLARMHKAMDLNHKPRRMNPVL  58

Query  337  RGGMEADLSAAVE----------REHKMGSDRGGSRGVPVFVMMPLDTVKMDHTMNRKKA  486
                +ADLS A +          R HK G   GG  GVPVFVMMPLD+V M + +NR+KA
Sbjct  59   -ATAQADLSVACKAFAVETTEERRTHKEGRVGGGGGGVPVFVMMPLDSVTMGNAVNRRKA  117

Query  487  MNVSLQALKSAGVEGIMVD  543
            M  SLQAL+S GVEGIM+D
Sbjct  118  MRASLQALRSGGVEGIMID  136



>ref|XP_007152599.1| hypothetical protein PHAVU_004G143600g [Phaseolus vulgaris]
 gb|ESW24593.1| hypothetical protein PHAVU_004G143600g [Phaseolus vulgaris]
Length=568

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = +1

Query  346  MEADLSAAVEREHKMGSDRGGSRGVPVFVMMPLDTVKMDHTMNRKKAMNVSLQALKSAGV  525
            +  ++  A E+EH  G  +G   GVPVFVMMPLD+V   +T+NR+KA+N ++ ALKSAGV
Sbjct  78   LATEVEVAEEKEHAEGGKKGEGSGVPVFVMMPLDSVTAGNTVNRRKAVNAAMAALKSAGV  137

Query  526  EGIMVD  543
            EG+M+D
Sbjct  138  EGVMMD  143



>ref|XP_003611409.1| Beta-amylase [Medicago truncatula]
 gb|AES94367.1| beta-amylase [Medicago truncatula]
Length=543

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 43/65 (66%), Gaps = 5/65 (8%)
 Frame = +1

Query  349  EADLSAAVEREHKMGSDRGGSRGVPVFVMMPLDTVKMDHTMNRKKAMNVSLQALKSAGVE  528
            E  L+ ++   H   S R     VPVFVM+PLDTV M   +N+ +AMN SL ALKSAGVE
Sbjct  69   EKVLAPSIAHNHDADSTR-----VPVFVMLPLDTVTMGGKLNKARAMNASLMALKSAGVE  123

Query  529  GIMVD  543
            G+MVD
Sbjct  124  GVMVD  128



>gb|ABK24605.1| unknown [Picea sitchensis]
Length=492

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +1

Query  415  GVPVFVMMPLDTVKMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            GVPVFV +PLD+V   HT+NR+KAM+ SL ALKSAGVEG+MV+
Sbjct  32   GVPVFVKLPLDSVTSKHTVNRRKAMDASLMALKSAGVEGVMVN  74



>ref|XP_009413253.1| PREDICTED: beta-amylase 3, chloroplastic [Musa acuminata subsp. 
malaccensis]
Length=549

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 44/117 (38%), Positives = 64/117 (55%), Gaps = 10/117 (9%)
 Frame = +1

Query  211  PVEVRTESVTREAPAKTAVSI-SPLWR-RNLRISVKNLAAKAVLRGGMEADLSAAVEREH  384
            PV+ +T   + E P + A  +  P  R R L+ S +++    + RG +      A E  H
Sbjct  14   PVDSKTHRASDELPGRLAFDVRKPAGRLRTLKASRQDV----IERGTLLQHTEQAAELLH  69

Query  385  ----KMGSDRGGSRGVPVFVMMPLDTVKMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
                  G    G+  VPV+VM+PLDTV +   + R +A+N SL AL+SAGVEG+MVD
Sbjct  70   GPPTAHGDPGAGTSRVPVYVMLPLDTVSLAGGLTRARALNASLMALRSAGVEGVMVD  126



>ref|XP_009612895.1| PREDICTED: beta-amylase 3, chloroplastic [Nicotiana tomentosiformis]
Length=546

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 31/50 (62%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = +1

Query  394  SDRGGSRGVPVFVMMPLDTVKMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            S+   S  VPVFVM+PLDT+ M   +N+ +AM+VSL ALKSAGVEG+MVD
Sbjct  75   SNINSSTKVPVFVMLPLDTITMGGNLNKPRAMHVSLMALKSAGVEGVMVD  124



>emb|CAN62440.1| hypothetical protein VITISV_032500 [Vitis vinifera]
Length=543

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 39/49 (80%), Gaps = 1/49 (2%)
 Frame = +1

Query  397  DRGGSRGVPVFVMMPLDTVKMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            ++ GSR VPVFVM+PLDTV     +N+ +AMN SL ALKSAGVEG+MVD
Sbjct  75   NKNGSR-VPVFVMLPLDTVSFGGNLNKPRAMNASLMALKSAGVEGVMVD  122



>ref|XP_002467119.1| hypothetical protein SORBIDRAFT_01g019850 [Sorghum bicolor]
 gb|EER94117.1| hypothetical protein SORBIDRAFT_01g019850 [Sorghum bicolor]
Length=547

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 39/79 (49%), Positives = 49/79 (62%), Gaps = 11/79 (14%)
 Frame = +1

Query  310  KNLAAKAVLRGGMEADLSAAVEREHKMGSDRGGSRGVPVFVMMPLDTVK-MDHTMNRKKA  486
            +++  +A + G   AD +A+  R            GVPVFVMMPLDTVK     +NR+KA
Sbjct  59   RSVFCRAAVSGKSAADRAASTRRR----------SGVPVFVMMPLDTVKKCGSALNRRKA  108

Query  487  MNVSLQALKSAGVEGIMVD  543
            +  SL ALKSAGVEGIMVD
Sbjct  109  VQASLSALKSAGVEGIMVD  127



>ref|XP_004147264.1| PREDICTED: beta-amylase 3, chloroplastic-like [Cucumis sativus]
 gb|KGN55808.1| hypothetical protein Csa_3G017020 [Cucumis sativus]
Length=538

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 40/89 (45%), Positives = 53/89 (60%), Gaps = 8/89 (9%)
 Frame = +1

Query  277  PLWRRNLRISVKNLAAKAVLRGGMEADLSAAVEREHKMGSDRGGSRGVPVFVMMPLDTVK  456
            PL R  +R S   L    + RGG + +   ++   H     R     VPVFVM+PLDTV 
Sbjct  39   PLSRLRIRSS---LQETRIERGGEKLEKLHSLSSNHHTNDLR-----VPVFVMLPLDTVT  90

Query  457  MDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            +  ++N+ +AMN SL ALKSAGVEG+MVD
Sbjct  91   LGGSLNKPRAMNASLMALKSAGVEGVMVD  119



>ref|XP_009601320.1| PREDICTED: beta-amylase 3, chloroplastic-like [Nicotiana tomentosiformis]
Length=546

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 31/50 (62%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = +1

Query  394  SDRGGSRGVPVFVMMPLDTVKMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            S+   S  VPVFVM+PLDT+ M   +N+ +AM+VSL ALKSAGVEG+MVD
Sbjct  76   SNINSSTKVPVFVMLPLDTMTMGGNLNKPRAMHVSLMALKSAGVEGVMVD  125



>gb|AFK46577.1| unknown [Lotus japonicus]
Length=320

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/45 (67%), Positives = 37/45 (82%), Gaps = 0/45 (0%)
 Frame = +1

Query  409  SRGVPVFVMMPLDTVKMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            S+ VP FVM+PLDTV +  T+N+ + MNVSL ALKSAGVEG+MVD
Sbjct  71   SKSVPSFVMLPLDTVTVGGTLNKPRVMNVSLMALKSAGVEGVMVD  115



>ref|XP_003524296.1| PREDICTED: beta-amylase 3, chloroplastic-like [Glycine max]
 gb|KHN08412.1| Beta-amylase 3, chloroplastic [Glycine soja]
Length=547

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/45 (67%), Positives = 38/45 (84%), Gaps = 0/45 (0%)
 Frame = +1

Query  409  SRGVPVFVMMPLDTVKMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            S+ VPV+VM+PLDTV M+  +N+ +AMN SL ALKSAGVEG+MVD
Sbjct  82   SKRVPVYVMLPLDTVTMEGRLNKPRAMNASLMALKSAGVEGVMVD  126



>gb|AFO84076.1| beta-amylase [Actinidia chinensis]
Length=547

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 32/58 (55%), Positives = 41/58 (71%), Gaps = 1/58 (2%)
 Frame = +1

Query  373  EREHKMGSDRGGSRG-VPVFVMMPLDTVKMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            E+ HK+    G +   VPVFVM+PLDT+     +N+ +AMN SL ALKSAGVEG+MVD
Sbjct  69   EKLHKLSDTHGENDSRVPVFVMLPLDTISYGGNLNKPRAMNASLMALKSAGVEGVMVD  126



>ref|NP_001236350.1| beta-amylase [Glycine max]
 emb|CAI39244.1| beta-amylase [Glycine max]
 gb|KHN01649.1| Beta-amylase 3, chloroplastic [Glycine soja]
Length=540

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/45 (67%), Positives = 38/45 (84%), Gaps = 0/45 (0%)
 Frame = +1

Query  409  SRGVPVFVMMPLDTVKMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            S+ VPV+VM+PLDTV M  ++N+ +AMN SL ALKSAGVEG+MVD
Sbjct  75   SKRVPVYVMLPLDTVTMGGSLNKPRAMNASLMALKSAGVEGVMVD  119



>ref|XP_007039632.1| Chloroplast beta-amylase isoform 4, partial [Theobroma cacao]
 gb|EOY24133.1| Chloroplast beta-amylase isoform 4, partial [Theobroma cacao]
Length=433

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +1

Query  418  VPVFVMMPLDTVKMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            VPVFVM+PLDT+ +   +N+++AMN SL ALKSAGVEG+MVD
Sbjct  115  VPVFVMLPLDTITLGGNLNKQRAMNASLMALKSAGVEGVMVD  156



>ref|XP_009597851.1| PREDICTED: beta-amylase 3, chloroplastic-like [Nicotiana tomentosiformis]
Length=548

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 29/50 (58%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = +1

Query  394  SDRGGSRGVPVFVMMPLDTVKMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            S+   +  VPVFVM+PLDT+ +   +N+ +AMN SL ALKSAGVEG+MVD
Sbjct  79   SNNSSTTKVPVFVMLPLDTINIGGKLNKPRAMNASLMALKSAGVEGVMVD  128



>ref|XP_007039631.1| Chloroplast beta-amylase isoform 3 [Theobroma cacao]
 gb|EOY24132.1| Chloroplast beta-amylase isoform 3 [Theobroma cacao]
Length=535

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +1

Query  418  VPVFVMMPLDTVKMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            VPVFVM+PLDT+ +   +N+++AMN SL ALKSAGVEG+MVD
Sbjct  115  VPVFVMLPLDTITLGGNLNKQRAMNASLMALKSAGVEGVMVD  156



>emb|CBI33977.3| unnamed protein product [Vitis vinifera]
Length=465

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 39/49 (80%), Gaps = 1/49 (2%)
 Frame = +1

Query  397  DRGGSRGVPVFVMMPLDTVKMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            ++ GSR VPVFVM+PLDTV     +N+ +AMN SL ALKS+GVEG+MVD
Sbjct  48   NKNGSR-VPVFVMLPLDTVSFGGNLNKPRAMNASLMALKSSGVEGVMVD  95



>gb|ABR18773.1| beta-amylase [Boehmeria nivea]
Length=266

 Score = 63.9 bits (154),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +1

Query  418  VPVFVMMPLDTVKMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            VPVFVM+PLDTV +   +N+ +AMN SL ALKSAGVEG+MVD
Sbjct  1    VPVFVMLPLDTVGLGGGLNKPRAMNASLMALKSAGVEGVMVD  42



>ref|XP_002282871.1| PREDICTED: beta-amylase 3, chloroplastic [Vitis vinifera]
Length=543

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 39/49 (80%), Gaps = 1/49 (2%)
 Frame = +1

Query  397  DRGGSRGVPVFVMMPLDTVKMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            ++ GSR VPVFVM+PLDTV     +N+ +AMN SL ALKS+GVEG+MVD
Sbjct  75   NKNGSR-VPVFVMLPLDTVSFGGNLNKPRAMNASLMALKSSGVEGVMVD  122



>ref|XP_008448759.1| PREDICTED: beta-amylase 3, chloroplastic [Cucumis melo]
Length=537

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 38/83 (46%), Positives = 51/83 (61%), Gaps = 6/83 (7%)
 Frame = +1

Query  295  LRISVKNLAAKAVLRGGMEADLSAAVEREHKMGSDRGGSRGVPVFVMMPLDTVKMDHTMN  474
            LRI   +L    + RGG + +   ++   H     R     VPVFVM+PLDTV +  ++N
Sbjct  43   LRIR-SSLQETKIERGGEKLEKLHSLSSNHHTDDLR-----VPVFVMLPLDTVTLGGSLN  96

Query  475  RKKAMNVSLQALKSAGVEGIMVD  543
            + +AMN SL ALKSAGVEG+MVD
Sbjct  97   KPRAMNASLMALKSAGVEGVMVD  119



>gb|EMS61458.1| Beta-amylase 1, chloroplastic [Triticum urartu]
Length=393

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 39/54 (72%), Gaps = 5/54 (9%)
 Frame = +1

Query  397  DRGGSR----GVPVFVMMPLDTVKMDHT-MNRKKAMNVSLQALKSAGVEGIMVD  543
            D GG      GVPVFVMMPLDTV+ D + +NR+KAM  SL ALKSAG  GIMVD
Sbjct  27   DAGGEEARKVGVPVFVMMPLDTVRKDGSALNRRKAMQASLAALKSAGAAGIMVD  80



>ref|XP_009792527.1| PREDICTED: beta-amylase 3, chloroplastic-like [Nicotiana sylvestris]
Length=548

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 29/50 (58%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = +1

Query  394  SDRGGSRGVPVFVMMPLDTVKMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            S+   +  VPVFVM+PLDT+ +   +N+ +AMN SL ALKSAGVEG+MVD
Sbjct  79   SNNSRTTKVPVFVMLPLDTINIGGNLNKPRAMNASLMALKSAGVEGVMVD  128



>ref|XP_006362484.1| PREDICTED: beta-amylase 3, chloroplastic-like [Solanum tuberosum]
Length=541

 Score = 65.1 bits (157),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +1

Query  418  VPVFVMMPLDTVKMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            VPVFVM+PLDT+ +   MN+ +AMN SL ALKSAGVEG+MVD
Sbjct  80   VPVFVMLPLDTISIGGNMNKPRAMNASLMALKSAGVEGVMVD  121



>ref|XP_009400488.1| PREDICTED: beta-amylase 1, chloroplastic [Musa acuminata subsp. 
malaccensis]
Length=590

 Score = 65.1 bits (157),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 30/42 (71%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +1

Query  418  VPVFVMMPLDTVKMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            VPV+VM+PLDTV+    +NR+KAMN SL ALKSAGVEG+MVD
Sbjct  125  VPVYVMLPLDTVRPGGGLNRRKAMNASLMALKSAGVEGVMVD  166



>ref|XP_009136825.1| PREDICTED: beta-amylase 3, chloroplastic [Brassica rapa]
Length=548

 Score = 65.1 bits (157),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 29/42 (69%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +1

Query  418  VPVFVMMPLDTVKMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            VPVFVM+PLDTV M   +N+++AMN SL ALK AGVEG+MVD
Sbjct  85   VPVFVMLPLDTVTMSGHLNKQRAMNASLMALKGAGVEGVMVD  126



>ref|XP_004982940.1| PREDICTED: beta-amylase 1, chloroplastic-like [Setaria italica]
Length=543

 Score = 65.1 bits (157),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 37/44 (84%), Gaps = 1/44 (2%)
 Frame = +1

Query  415  GVPVFVMMPLDTVKMDHT-MNRKKAMNVSLQALKSAGVEGIMVD  543
            GVPVFVMMPLDTVK   T +NR+KA+  SL ALKSAGVEG+MVD
Sbjct  81   GVPVFVMMPLDTVKKCGTALNRRKAVQASLAALKSAGVEGVMVD  124



>ref|XP_006838474.1| hypothetical protein AMTR_s00002p00150440 [Amborella trichopoda]
 gb|ERN01043.1| hypothetical protein AMTR_s00002p00150440 [Amborella trichopoda]
Length=585

 Score = 65.1 bits (157),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 31/56 (55%), Positives = 41/56 (73%), Gaps = 1/56 (2%)
 Frame = +1

Query  379  EHKM-GSDRGGSRGVPVFVMMPLDTVKMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            EHK+ G      +GVPVFVM+PLDTV  +  ++R +A+N SL ALK+AGV G+MVD
Sbjct  109  EHKLHGLQSSRVKGVPVFVMLPLDTVNFEGALSRPRALNASLMALKAAGVAGVMVD  164



>ref|XP_004245844.1| PREDICTED: beta-amylase 3, chloroplastic [Solanum lycopersicum]
Length=546

 Score = 65.1 bits (157),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 31/58 (53%), Positives = 42/58 (72%), Gaps = 1/58 (2%)
 Frame = +1

Query  373  EREHKMGSDRGGSRG-VPVFVMMPLDTVKMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            E+ H++ ++   S   VPVFVM+PLDT+ M   +NR +AMN SL ALKS+G EG+MVD
Sbjct  68   EKLHELTANHSNSSTRVPVFVMLPLDTMTMGGNLNRPRAMNASLMALKSSGAEGVMVD  125



>gb|ACY25894.1| beta-amylase 1 [Euphorbia esula]
Length=311

 Score = 63.9 bits (154),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +1

Query  418  VPVFVMMPLDTVKMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            VPVFVM+PLDT+ +   +NR +A+N SL ALKSAGVEG+MVD
Sbjct  85   VPVFVMLPLDTITLGGKLNRPRALNASLMALKSAGVEGVMVD  126



>ref|XP_007039629.1| Chloroplast beta-amylase isoform 1 [Theobroma cacao]
 ref|XP_007039630.1| Chloroplast beta-amylase isoform 1 [Theobroma cacao]
 ref|XP_007039633.1| Chloroplast beta-amylase isoform 1 [Theobroma cacao]
 gb|EOY24130.1| Chloroplast beta-amylase isoform 1 [Theobroma cacao]
 gb|EOY24131.1| Chloroplast beta-amylase isoform 1 [Theobroma cacao]
 gb|EOY24134.1| Chloroplast beta-amylase isoform 1 [Theobroma cacao]
Length=575

 Score = 64.7 bits (156),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 28/42 (67%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +1

Query  418  VPVFVMMPLDTVKMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            VPVFVM+PLDT+ +   +N+++AMN SL ALKSAGVEG+MVD
Sbjct  115  VPVFVMLPLDTITLGGNLNKQRAMNASLMALKSAGVEGVMVD  156



>gb|AHJ09602.1| chloroplast beta-amylase 3 [Camellia sinensis]
Length=548

 Score = 64.7 bits (156),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 31/58 (53%), Positives = 40/58 (69%), Gaps = 1/58 (2%)
 Frame = +1

Query  373  EREHKMGSDRGGSRG-VPVFVMMPLDTVKMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            E+ H +    G +   VPVFVM+PLDT+     +N+ +AMN SL ALKSAGVEG+MVD
Sbjct  70   EKLHMLSDTHGKNDSRVPVFVMLPLDTISFGGNLNKPRAMNASLMALKSAGVEGVMVD  127



>ref|XP_004244551.1| PREDICTED: beta-amylase 3, chloroplastic-like [Solanum lycopersicum]
Length=542

 Score = 64.7 bits (156),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +1

Query  394  SDRGGSRGVPVFVMMPLDTVKMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            S+   S  VPVFVM+PLDT+ +   MN+ +AMN SL ALK AGVEG+MVD
Sbjct  73   SNNSSSTKVPVFVMLPLDTISIGGNMNKPRAMNASLMALKGAGVEGVMVD  122



>ref|XP_004300297.1| PREDICTED: beta-amylase 3, chloroplastic [Fragaria vesca subsp. 
vesca]
Length=553

 Score = 64.7 bits (156),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 30/50 (60%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = +1

Query  394  SDRGGSRGVPVFVMMPLDTVKMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            S+   S+ VPV+VM+PLDTV     +N+ +AMNVSL ALK+AGVEG+MVD
Sbjct  83   SNNNDSKKVPVYVMLPLDTVTHGGHLNKPRAMNVSLMALKNAGVEGVMVD  132



>ref|XP_006385589.1| beta-amylase family protein [Populus trichocarpa]
 gb|ABK95564.1| unknown [Populus trichocarpa]
 gb|ERP63386.1| beta-amylase family protein [Populus trichocarpa]
Length=548

 Score = 64.7 bits (156),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 40/88 (45%), Positives = 51/88 (58%), Gaps = 6/88 (7%)
 Frame = +1

Query  298  RISVKNLAAKAVLRGG----MEADLSAAVEREHKM-GSDRGGSRG-VPVFVMMPLDTVKM  459
            R+  KN   +A L        E   S   E+ H + G D   S   VPVFVM+PLDTV +
Sbjct  40   RLQAKNSKQEAQLSQDDILVTEGRKSKNWEKLHAISGPDHSSSNSRVPVFVMLPLDTVTI  99

Query  460  DHTMNRKKAMNVSLQALKSAGVEGIMVD  543
               +N+ +AMN SL AL+SAGVEG+MVD
Sbjct  100  GGNLNKPRAMNASLMALRSAGVEGVMVD  127



>ref|NP_001275172.1| beta-amylase PCT-BMYI [Solanum tuberosum]
 gb|AAK84008.1|AF393847_1 beta-amylase PCT-BMYI [Solanum tuberosum]
Length=545

 Score = 64.7 bits (156),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 33/67 (49%), Positives = 44/67 (66%), Gaps = 1/67 (1%)
 Frame = +1

Query  346  MEADLSAAVEREHKMGSDRGG-SRGVPVFVMMPLDTVKMDHTMNRKKAMNVSLQALKSAG  522
            ME       E+ H++ ++    S  VPVFVM+PLDT+ M   +NR +AMN SL ALKS+G
Sbjct  58   MEVKKIEKREKLHELPANHSNRSTRVPVFVMLPLDTMTMGGNLNRPRAMNASLMALKSSG  117

Query  523  VEGIMVD  543
             EG+MVD
Sbjct  118  AEGVMVD  124



>gb|KDP45986.1| hypothetical protein JCGZ_11889 [Jatropha curcas]
Length=547

 Score = 64.3 bits (155),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 38/87 (44%), Positives = 49/87 (56%), Gaps = 5/87 (6%)
 Frame = +1

Query  298  RISVKNLAAKAVLRGG----MEADLSAAVEREHKM-GSDRGGSRGVPVFVMMPLDTVKMD  462
            R+  KN   +A L       ME   S   E+ H + G        VPVFVM+PLDT+ + 
Sbjct  40   RLQAKNSVQEAQLSHDNIFMMEGMESEKREKVHAISGPHSSNDTKVPVFVMLPLDTITIR  99

Query  463  HTMNRKKAMNVSLQALKSAGVEGIMVD  543
              +N+ +AMN SL ALKSAGV G+MVD
Sbjct  100  GNLNKPRAMNASLMALKSAGVAGVMVD  126



>ref|XP_003574353.1| PREDICTED: beta-amylase 3, chloroplastic [Brachypodium distachyon]
Length=548

 Score = 64.3 bits (155),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 48/130 (37%), Positives = 65/130 (50%), Gaps = 13/130 (10%)
 Frame = +1

Query  166  LPMSLAHQIGFISRTPVEVRTESVTREAPAKTAVSISPLWRRNLRISVKNLAAKAVLRGG  345
            + ++L     F+S      +        P+  AV  +P   R LR      AA+A L   
Sbjct  1    MALTLRSSTSFLSPLEPSSKLHKAEDAPPSCVAVPAAPSRLRVLRA-----AAQAPL-SP  54

Query  346  MEAD----LSAAVEREHKMGSDRGGSRGVPVFVMMPLDTVKMDHTMNRKKAMNVSLQALK  513
            MEA     L    ++ H  G  RGG   VPV+VM+PLDTV     + R +A+  SL AL+
Sbjct  55   MEAPAPELLHGQAQQAHSGGQKRGG---VPVYVMLPLDTVGPGGQLLRARALAASLMALR  111

Query  514  SAGVEGIMVD  543
            SAGVEG+MVD
Sbjct  112  SAGVEGVMVD  121



>ref|XP_003632025.2| PREDICTED: beta-amylase 1, chloroplastic [Vitis vinifera]
Length=459

 Score = 64.3 bits (155),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 46/66 (70%), Gaps = 1/66 (2%)
 Frame = +1

Query  346  MEADLSAAVEREHKMGSDRGGSRGVPVFVMMPLDTVKMDHTMNRKKAMNVSLQALKSAGV  525
            ME + + A ERE+K G  +   +GVPV+VM+PLD+V M + +N  + M   +Q LKSAGV
Sbjct  1    METEATPA-EREYKEGGAKATGKGVPVYVMIPLDSVTMGNGVNTWEKMKERMQKLKSAGV  59

Query  526  EGIMVD  543
            EG+M+D
Sbjct  60   EGVMMD  65



>gb|AAK96508.1| AT4g17090/dl4575c [Arabidopsis thaliana]
 gb|AAL31225.1| AT4g17090/dl4575c [Arabidopsis thaliana]
Length=376

 Score = 63.9 bits (154),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +1

Query  418  VPVFVMMPLDTVKMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            VPVFVM+PLDTV M   +N+ +AMN SL ALK AGVEG+MVD
Sbjct  86   VPVFVMLPLDTVTMSGHLNKPRAMNASLMALKGAGVEGVMVD  127



>gb|EAY88485.1| hypothetical protein OsI_09956 [Oryza sativa Indica Group]
 gb|EAZ25531.1| hypothetical protein OsJ_09355 [Oryza sativa Japonica Group]
Length=556

 Score = 64.3 bits (155),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 38/44 (86%), Gaps = 1/44 (2%)
 Frame = +1

Query  415  GVPVFVMMPLDTVKMD-HTMNRKKAMNVSLQALKSAGVEGIMVD  543
            GVPV+VMMPLDTV+ D + +NR+KA+  SL+ALKSAG EGIMVD
Sbjct  91   GVPVYVMMPLDTVRKDGNGLNRRKAVEASLKALKSAGAEGIMVD  134



>ref|NP_001048926.1| Os03g0141200 [Oryza sativa Japonica Group]
 gb|ABF93905.1| Beta-amylase, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF10840.1| Os03g0141200 [Oryza sativa Japonica Group]
 dbj|BAG91188.1| unnamed protein product [Oryza sativa Japonica Group]
Length=557

 Score = 64.3 bits (155),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 38/44 (86%), Gaps = 1/44 (2%)
 Frame = +1

Query  415  GVPVFVMMPLDTVKMD-HTMNRKKAMNVSLQALKSAGVEGIMVD  543
            GVPV+VMMPLDTV+ D + +NR+KA+  SL+ALKSAG EGIMVD
Sbjct  92   GVPVYVMMPLDTVRKDGNGLNRRKAVEASLKALKSAGAEGIMVD  135



>ref|NP_567523.1| beta-amylase [Arabidopsis thaliana]
 sp|O23553.3|BAM3_ARATH RecName: Full=Beta-amylase 3, chloroplastic; AltName: Full=1,4-alpha-D-glucan 
maltohydrolase; AltName: Full=Beta-amylase 
8; AltName: Full=Chloroplast beta-amylase; Short=CT-BMY; Flags: 
Precursor [Arabidopsis thaliana]
 emb|CAB58423.1| beta-amylase enzyme [Arabidopsis thaliana]
 gb|AAM65134.1| putative beta-amylase [Arabidopsis thaliana]
 gb|AEE83848.1| beta-amylase [Arabidopsis thaliana]
Length=548

 Score = 64.3 bits (155),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 29/42 (69%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +1

Query  418  VPVFVMMPLDTVKMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            VPVFVM+PLDTV M   +N+ +AMN SL ALK AGVEG+MVD
Sbjct  86   VPVFVMLPLDTVTMSGHLNKPRAMNASLMALKGAGVEGVMVD  127



>ref|XP_006285145.1| hypothetical protein CARUB_v10006488mg [Capsella rubella]
 gb|EOA18043.1| hypothetical protein CARUB_v10006488mg [Capsella rubella]
Length=548

 Score = 64.3 bits (155),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 29/42 (69%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +1

Query  418  VPVFVMMPLDTVKMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            VPVFVM+PLDTV M   +N+ +AMN SL ALK AGVEG+MVD
Sbjct  86   VPVFVMLPLDTVTMSGHLNKPRAMNASLMALKGAGVEGVMVD  127



>ref|XP_010440058.1| PREDICTED: beta-amylase 3, chloroplastic [Camelina sativa]
Length=548

 Score = 64.3 bits (155),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 29/42 (69%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +1

Query  418  VPVFVMMPLDTVKMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            VPVFVM+PLDTV M   +N+ +AMN SL ALK AGVEG+MVD
Sbjct  86   VPVFVMLPLDTVTMSGHLNKPRAMNASLMALKGAGVEGVMVD  127



>ref|XP_002868085.1| beta-amylase 8 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH44344.1| beta-amylase 8 [Arabidopsis lyrata subsp. lyrata]
Length=548

 Score = 64.3 bits (155),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 29/42 (69%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +1

Query  418  VPVFVMMPLDTVKMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            VPVFVM+PLDTV M   +N+ +AMN SL ALK AGVEG+MVD
Sbjct  86   VPVFVMLPLDTVTMSGHLNKPRAMNASLMALKGAGVEGVMVD  127



>ref|XP_010449668.1| PREDICTED: beta-amylase 3, chloroplastic-like [Camelina sativa]
Length=548

 Score = 64.3 bits (155),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 29/42 (69%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +1

Query  418  VPVFVMMPLDTVKMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            VPVFVM+PLDTV M   +N+ +AMN SL ALK AGVEG+MVD
Sbjct  86   VPVFVMLPLDTVTMSGHLNKPRAMNASLMALKGAGVEGVMVD  127



>ref|XP_010434720.1| PREDICTED: beta-amylase 3, chloroplastic-like [Camelina sativa]
Length=548

 Score = 64.3 bits (155),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 29/42 (69%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +1

Query  418  VPVFVMMPLDTVKMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            VPVFVM+PLDTV M   +N+ +AMN SL ALK AGVEG+MVD
Sbjct  86   VPVFVMLPLDTVTMSGHLNKPRAMNASLMALKGAGVEGVMVD  127



>emb|CDY09643.1| BnaC07g34180D [Brassica napus]
Length=548

 Score = 64.3 bits (155),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 29/42 (69%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +1

Query  418  VPVFVMMPLDTVKMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            VPVFVM+PLDTV M   +N+ +AMN SL ALK AGVEG+MVD
Sbjct  85   VPVFVMLPLDTVTMSGHLNKPRAMNASLMALKGAGVEGVMVD  126



>ref|XP_006414272.1| hypothetical protein EUTSA_v10024842mg [Eutrema salsugineum]
 dbj|BAJ34236.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ55725.1| hypothetical protein EUTSA_v10024842mg [Eutrema salsugineum]
Length=548

 Score = 64.3 bits (155),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 29/42 (69%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +1

Query  418  VPVFVMMPLDTVKMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            VPVFVM+PLDTV M   +N+ +AMN SL ALK AGVEG+MVD
Sbjct  85   VPVFVMLPLDTVTMSGHLNKPRAMNASLMALKGAGVEGVMVD  126



>emb|CAB46051.1| putative beta-amylase [Arabidopsis thaliana]
 emb|CAB80980.1| putative beta-amylase [Arabidopsis thaliana]
Length=498

 Score = 63.9 bits (154),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +1

Query  418  VPVFVMMPLDTVKMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            VPVFVM+PLDTV M   +N+ +AMN SL ALK AGVEG+MVD
Sbjct  36   VPVFVMLPLDTVTMSGHLNKPRAMNASLMALKGAGVEGVMVD  77



>ref|XP_009397011.1| PREDICTED: beta-amylase 3, chloroplastic-like [Musa acuminata 
subsp. malaccensis]
Length=547

 Score = 63.9 bits (154),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 42/129 (33%), Positives = 71/129 (55%), Gaps = 6/129 (5%)
 Frame = +1

Query  166  LPMSLAHQIGFISRTPVEVRTESVTREAPAKTAVSI-SPLWR-RNLRISVKNLAAKA-VL  336
            + ++L     F++      ++   + E+P+   +S   P  R R  + S   +  +A  +
Sbjct  1    MALTLRSSTSFMTNPIDPSKSHKASDESPSLLPLSPRKPACRLRAAKASNHGMIERAPAV  60

Query  337  RGGMEADLSAAVEREHKMGSDRGGSRGVPVFVMMPLDTVKMDHTMNRKKAMNVSLQALKS  516
             GG +A+    +   H++    GG+  VPV+VM+PLDTV  +  + R +A+N SL AL+S
Sbjct  61   HGGWKAEQLHGLSGVHRV---PGGTARVPVYVMLPLDTVSPEGRLQRARALNASLMALRS  117

Query  517  AGVEGIMVD  543
            AGVEG+MVD
Sbjct  118  AGVEGVMVD  126



>gb|KFK45005.1| hypothetical protein AALP_AA1G332100 [Arabis alpina]
Length=548

 Score = 63.9 bits (154),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 29/42 (69%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +1

Query  418  VPVFVMMPLDTVKMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            VPVFVM+PLDTV M   +N+ +AMN SL ALK AGVEG+MVD
Sbjct  85   VPVFVMLPLDTVTMSGHLNKPRAMNASLMALKGAGVEGVMVD  126



>emb|CDX90487.1| BnaA03g42940D [Brassica napus]
Length=541

 Score = 63.9 bits (154),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +1

Query  418  VPVFVMMPLDTVKMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            VPVFVM+PLDTV M   +N+ +AMN SL ALK AGVEG+MVD
Sbjct  85   VPVFVMLPLDTVTMSGHLNKPRAMNASLMALKGAGVEGVMVD  126



>ref|XP_009772032.1| PREDICTED: beta-amylase 3, chloroplastic-like [Nicotiana sylvestris]
Length=542

 Score = 63.9 bits (154),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 30/45 (67%), Positives = 37/45 (82%), Gaps = 0/45 (0%)
 Frame = +1

Query  409  SRGVPVFVMMPLDTVKMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            S  VPVFVM+PLDT+ M   +N+ +AM+VSL ALKSAGVEG+MVD
Sbjct  77   STKVPVFVMLPLDTMTMGGNLNKPRAMHVSLMALKSAGVEGVMVD  121



>emb|CDY35597.1| BnaC01g21190D [Brassica napus]
Length=548

 Score = 63.9 bits (154),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 29/42 (69%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +1

Query  418  VPVFVMMPLDTVKMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            VPVFVM+PLDTV M   +N+ +AMN SL ALK AGVEG+MVD
Sbjct  85   VPVFVMLPLDTVTMSGHLNKPRAMNASLMALKGAGVEGVMVD  126



>ref|XP_009144721.1| PREDICTED: beta-amylase 3, chloroplastic-like [Brassica rapa]
Length=549

 Score = 63.9 bits (154),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 29/42 (69%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +1

Query  418  VPVFVMMPLDTVKMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            VPVFVM+PLDTV M   +N+ +AMN SL ALK AGVEG+MVD
Sbjct  86   VPVFVMLPLDTVTMSGHLNKPRAMNASLMALKGAGVEGVMVD  127



>emb|CDY42960.1| BnaA01g17940D [Brassica napus]
Length=549

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 29/42 (69%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +1

Query  418  VPVFVMMPLDTVKMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            VPVFVM+PLDTV M   +N+ +AMN SL ALK AGVEG+MVD
Sbjct  86   VPVFVMLPLDTVTMSGHLNKPRAMNASLMALKGAGVEGVMVD  127



>ref|XP_009802914.1| PREDICTED: beta-amylase 3, chloroplastic-like [Nicotiana sylvestris]
Length=549

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 34/78 (44%), Positives = 49/78 (63%), Gaps = 1/78 (1%)
 Frame = +1

Query  313  NLAAKAVLRGGMEADLSAAVEREHKMGSDRGG-SRGVPVFVMMPLDTVKMDHTMNRKKAM  489
            +L+ + V+   +E   +   E+ H + +     S  VPVFVM+PLDTV M   +N+ + M
Sbjct  51   HLSHERVIGNPIEGRKNEKREKLHVLTTTHSNNSTAVPVFVMLPLDTVTMGGKLNKPRLM  110

Query  490  NVSLQALKSAGVEGIMVD  543
            N SL AL+SAGVEG+MVD
Sbjct  111  NASLIALRSAGVEGVMVD  128



>gb|KJB51734.1| hypothetical protein B456_008G230100 [Gossypium raimondii]
Length=540

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +1

Query  418  VPVFVMMPLDTVKMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            VPV+VM+PLDT+ +  ++N+ +AMN SL ALKSAGVEG+MVD
Sbjct  81   VPVYVMLPLDTITLGGSLNKPRAMNASLMALKSAGVEGVMVD  122



>gb|KHG28698.1| Beta-amylase 3, chloroplastic -like protein [Gossypium arboreum]
Length=540

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +1

Query  418  VPVFVMMPLDTVKMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            VPV+VM+PLDT+ +  ++N+ +AMN SL ALKSAGVEG+MVD
Sbjct  81   VPVYVMLPLDTITLGGSLNKPRAMNASLMALKSAGVEGVMVD  122



>gb|KJB39785.1| hypothetical protein B456_007G030600 [Gossypium raimondii]
Length=539

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +1

Query  418  VPVFVMMPLDTVKMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            VPV+VM+PLDTV     +N+ KAMN SL ALKSAGVEG+MVD
Sbjct  79   VPVYVMLPLDTVTHGGNLNKPKAMNASLMALKSAGVEGVMVD  120



>ref|XP_007223114.1| hypothetical protein PRUPE_ppa005431mg [Prunus persica]
 gb|EMJ24313.1| hypothetical protein PRUPE_ppa005431mg [Prunus persica]
Length=461

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/37 (76%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = +1

Query  433  MMPLDTVKMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            MMPLD+V M++++NRKKAMN SLQALKSAGVEG+M+D
Sbjct  1    MMPLDSVTMNNSVNRKKAMNASLQALKSAGVEGVMMD  37



>ref|XP_011032002.1| PREDICTED: beta-amylase 3, chloroplastic-like [Populus euphratica]
Length=547

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 32/66 (48%), Positives = 43/66 (65%), Gaps = 1/66 (2%)
 Frame = +1

Query  349  EADLSAAVEREHKM-GSDRGGSRGVPVFVMMPLDTVKMDHTMNRKKAMNVSLQALKSAGV  525
            E   S + E+ H + G     +  VPVFVM+PLDTV +   +N+ +AMN SL AL+SAG 
Sbjct  61   EGRKSKSWEKLHAISGPHSSNNSRVPVFVMLPLDTVTIGGNLNKPRAMNASLMALRSAGA  120

Query  526  EGIMVD  543
            EG+MVD
Sbjct  121  EGVMVD  126



>ref|NP_001147532.1| beta-amylase [Zea mays]
 gb|ACF86357.1| unknown [Zea mays]
 gb|ACG27842.1| beta-amylase [Zea mays]
 gb|AFW68644.1| beta-amylase [Zea mays]
Length=544

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 38/68 (56%), Positives = 45/68 (66%), Gaps = 11/68 (16%)
 Frame = +1

Query  343  GMEADLSAAVEREHKMGSDRGGSRGVPVFVMMPLDTVKMDHT-MNRKKAMNVSLQALKSA  519
            G  ADL++   R          S GVPVFVMMPLDTVK   T ++R+KA+  SL ALKSA
Sbjct  68   GSAADLASGGRR----------SSGVPVFVMMPLDTVKECGTALHRRKAVQASLSALKSA  117

Query  520  GVEGIMVD  543
            GVEG+MVD
Sbjct  118  GVEGVMVD  125



>ref|XP_006385389.1| beta-amylase family protein [Populus trichocarpa]
 gb|ERP63186.1| beta-amylase family protein [Populus trichocarpa]
Length=547

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 27/42 (64%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +1

Query  418  VPVFVMMPLDTVKMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            VPVFVM+PLDT+ +   +N+ +AMN SL AL+SAGVEG+MVD
Sbjct  85   VPVFVMLPLDTITIGGNLNKPRAMNASLMALRSAGVEGVMVD  126



>ref|XP_010695452.1| PREDICTED: beta-amylase 3, chloroplastic [Beta vulgaris subsp. 
vulgaris]
Length=546

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 32/67 (48%), Positives = 44/67 (66%), Gaps = 1/67 (1%)
 Frame = +1

Query  346  MEADLSAAVEREHKM-GSDRGGSRGVPVFVMMPLDTVKMDHTMNRKKAMNVSLQALKSAG  522
            +E      +ER H++ G     +  VPV+VM+PLDTV     +N+ +AMN SL ALK+AG
Sbjct  57   LEGKSHEKLERLHELKGHHHTNNTRVPVYVMLPLDTVCNGGKLNKPRAMNASLMALKTAG  116

Query  523  VEGIMVD  543
            VEG+MVD
Sbjct  117  VEGVMVD  123



>ref|XP_010110537.1| hypothetical protein L484_023371 [Morus notabilis]
 gb|EXC26755.1| hypothetical protein L484_023371 [Morus notabilis]
Length=544

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 30/50 (60%), Positives = 39/50 (78%), Gaps = 1/50 (2%)
 Frame = +1

Query  394  SDRGGSRGVPVFVMMPLDTVKMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            S +  SR VPVFVM+PLDT+ +   +N+ +AMN SL ALK+AGVEG+MVD
Sbjct  77   SPKNDSR-VPVFVMLPLDTLTLGGNLNKPRAMNASLMALKAAGVEGVMVD  125



>ref|XP_011018667.1| PREDICTED: beta-amylase 3, chloroplastic-like [Populus euphratica]
Length=547

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 27/42 (64%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +1

Query  418  VPVFVMMPLDTVKMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            VPVFVM+PLDT+ +   +N+ +AMN SL AL+SAGVEG+MVD
Sbjct  85   VPVFVMLPLDTITIGGNLNKPRAMNASLMALRSAGVEGVMVD  126



>ref|XP_010055392.1| PREDICTED: beta-amylase 3, chloroplastic [Eucalyptus grandis]
 gb|KCW71851.1| hypothetical protein EUGRSUZ_E00330 [Eucalyptus grandis]
Length=543

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 37/85 (44%), Positives = 52/85 (61%), Gaps = 4/85 (5%)
 Frame = +1

Query  298  RISVKNLAAKAVLRG-GMEADLSAAVEREHKMGSDRG--GSRGVPVFVMMPLDTVKMDHT  468
            R+  KN   + + RG   E      +E+ H +    G  G++ VPV++M+PLDTV     
Sbjct  40   RLRAKNSMHEILERGISTEVTRKDILEKLHALTVSHGQQGTK-VPVYIMLPLDTVTHGGN  98

Query  469  MNRKKAMNVSLQALKSAGVEGIMVD  543
            +N+ +AMN SL ALKSAGVEG+MVD
Sbjct  99   LNKPRAMNASLMALKSAGVEGVMVD  123



>gb|AFO84077.1| beta-amylase [Actinidia chinensis]
Length=520

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 40/58 (69%), Gaps = 1/58 (2%)
 Frame = +1

Query  373  EREHKMGSDRGGSRG-VPVFVMMPLDTVKMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            E+ HK+    G +   VPVFVM+PLDT+     +N+ +AMN SL ALKSAG+EG+ VD
Sbjct  69   EKLHKLSDTHGKNDSQVPVFVMLPLDTISNGGNLNKPRAMNASLMALKSAGIEGVTVD  126



>gb|EPS63004.1| hypothetical protein M569_11781, partial [Genlisea aurea]
Length=455

 Score = 62.0 bits (149),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/45 (67%), Positives = 37/45 (82%), Gaps = 1/45 (2%)
 Frame = +1

Query  412  RGVPVFVMMPLDTVKMDH-TMNRKKAMNVSLQALKSAGVEGIMVD  543
            +GVPVFVM+PLDTV M   ++NR +AM  SL ALK+AGVEG+MVD
Sbjct  2    KGVPVFVMLPLDTVSMGGGSLNRPRAMAASLAALKTAGVEGVMVD  46



>ref|XP_006844925.1| hypothetical protein AMTR_s00058p00155330 [Amborella trichopoda]
 gb|ERN06600.1| hypothetical protein AMTR_s00058p00155330 [Amborella trichopoda]
Length=559

 Score = 62.0 bits (149),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 32/56 (57%), Positives = 39/56 (70%), Gaps = 3/56 (5%)
 Frame = +1

Query  382  HKMG--SDRGGSRGVPVFVMMPLDTVKMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            H +G    RGG RG PVFV +PLD+V  D  M R+KAM VS +ALK AGVEG+ +D
Sbjct  92   HYLGPAQSRGG-RGFPVFVALPLDSVSSDGKMMRRKAMEVSFRALKLAGVEGVAMD  146



>ref|XP_006477060.1| PREDICTED: beta-amylase 3, chloroplastic isoform X2 [Citrus sinensis]
 gb|KDO57012.1| hypothetical protein CISIN_1g047891mg [Citrus sinensis]
Length=551

 Score = 62.0 bits (149),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +1

Query  418  VPVFVMMPLDTVKMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            VPVFVM+PLDT+     +N+ +AMN SL ALKSAGVEG+MVD
Sbjct  89   VPVFVMLPLDTLSNSGHLNKPRAMNASLMALKSAGVEGVMVD  130



>ref|XP_006477059.1| PREDICTED: beta-amylase 3, chloroplastic isoform X1 [Citrus sinensis]
Length=554

 Score = 61.6 bits (148),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +1

Query  418  VPVFVMMPLDTVKMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            VPVFVM+PLDT+     +N+ +AMN SL ALKSAGVEG+MVD
Sbjct  89   VPVFVMLPLDTLSNSGHLNKPRAMNASLMALKSAGVEGVMVD  130



>ref|XP_009794895.1| PREDICTED: beta-amylase 3, chloroplastic-like, partial [Nicotiana 
sylvestris]
Length=442

 Score = 61.6 bits (148),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 29/45 (64%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = +1

Query  409  SRGVPVFVMMPLDTVKMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            S  VPVFVM+PLDTV M   +N+ + MN SL AL+SAGVEG+MVD
Sbjct  84   STAVPVFVMLPLDTVTMGGKLNKPRLMNASLIALRSAGVEGVMVD  128



>gb|ACY25895.1| beta-amylase 2 [Euphorbia esula]
Length=270

 Score = 60.5 bits (145),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +1

Query  418  VPVFVMMPLDTVKMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            VPVFVM+PLDT+ +   +NR +A+N SL ALKSAGV G+MVD
Sbjct  85   VPVFVMLPLDTITLGGKLNRPRALNASLMALKSAGVVGVMVD  126



>emb|CDX93004.1| BnaA03g37260D [Brassica napus]
Length=555

 Score = 61.6 bits (148),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 51/132 (39%), Positives = 74/132 (56%), Gaps = 11/132 (8%)
 Frame = +1

Query  166  LPMSLAHQIGFISRTPVEVRTESVTREAPAKTAVSISPLWRRNLRISVKNLAAKAVLRGG  345
            + + L HQ+G ++  P++ R  + +    + +         + + ++  +     V+   
Sbjct  1    MALRLPHQLGSLAGAPIKSRETTASSPNSSLSVSPPLARVHKAMNLNHNSRGMNPVV---  57

Query  346  MEADLSA-----AVERE-HKMGSDRGGSRGVPVFVMMPLDTVKMDHTMNRKKAMNVSLQA  507
              ADLS      AVER  HK G   GG  GVPVFVMMPLD+V M + +NR+KAM  SLQA
Sbjct  58   --ADLSVRCKAFAVERRTHKEGRVGGGGGGVPVFVMMPLDSVTMGNAVNRRKAMRASLQA  115

Query  508  LKSAGVEGIMVD  543
            L+S GVEGIM+D
Sbjct  116  LRSGGVEGIMID  127



>gb|AFP89361.1| beta-amylase [Citrus limon]
Length=551

 Score = 61.6 bits (148),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 28/42 (67%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +1

Query  418  VPVFVMMPLDTVKMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            VPVFVM+PLDT+     +N+ +AMN SL ALKSAGVEG+MVD
Sbjct  89   VPVFVMLPLDTLSNSGHLNKPRAMNASLMALKSAGVEGVMVD  130



>gb|AFQ33613.1| beta-amylase 1 [Citrus trifoliata]
Length=551

 Score = 61.6 bits (148),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 28/42 (67%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +1

Query  418  VPVFVMMPLDTVKMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            VPVFVM+PLDT+     +N+ +AMN SL ALKSAGVEG+MVD
Sbjct  89   VPVFVMLPLDTLSNSGHLNKPRAMNASLMALKSAGVEGVMVD  130



>ref|XP_006440139.1| hypothetical protein CICLE_v10019566mg [Citrus clementina]
 gb|ESR53379.1| hypothetical protein CICLE_v10019566mg [Citrus clementina]
Length=551

 Score = 61.2 bits (147),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 28/42 (67%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +1

Query  418  VPVFVMMPLDTVKMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            VPVFVM+PLDT+     +N+ +AMN SL ALKSAGVEG+MVD
Sbjct  89   VPVFVMLPLDTLSNSGHLNKPRAMNASLMALKSAGVEGVMVD  130



>dbj|BAJ96121.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=551

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 30/44 (68%), Positives = 36/44 (82%), Gaps = 1/44 (2%)
 Frame = +1

Query  415  GVPVFVMMPLDTVKMDHT-MNRKKAMNVSLQALKSAGVEGIMVD  543
            GVPVFVMMPLDTV+ D + +NR+KA+  S+ ALKSAG  GIMVD
Sbjct  86   GVPVFVMMPLDTVRKDGSALNRRKAVQASMAALKSAGAAGIMVD  129



>dbj|BAJ90222.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=549

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 31/62 (50%), Positives = 41/62 (66%), Gaps = 1/62 (2%)
 Frame = +1

Query  358  LSAAVEREHKMGSDRGGSRGVPVFVMMPLDTVKMDHTMNRKKAMNVSLQALKSAGVEGIM  537
            L   V++ H  G  R    GVPVFVM+PLDTV     ++R +A+  SL AL++AGVEG+M
Sbjct  68   LHGQVQQAHA-GGGRPSRGGVPVFVMLPLDTVGPGGQLSRARALAASLMALRTAGVEGVM  126

Query  538  VD  543
            VD
Sbjct  127  VD  128



>ref|XP_007209867.1| hypothetical protein PRUPE_ppa003812mg [Prunus persica]
 gb|EMJ11066.1| hypothetical protein PRUPE_ppa003812mg [Prunus persica]
Length=547

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +1

Query  418  VPVFVMMPLDTVKMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            VPV+VM+PLDTV     +N+ +AMN SL ALK+AGVEG+MVD
Sbjct  85   VPVYVMLPLDTVSHGGHLNKPRAMNASLMALKNAGVEGVMVD  126



>gb|EYU24930.1| hypothetical protein MIMGU_mgv1a020099mg [Erythranthe guttata]
Length=542

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 40/60 (67%), Gaps = 3/60 (5%)
 Frame = +1

Query  373  EREHKMGSDRGGSRG---VPVFVMMPLDTVKMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            E+ H M S    S     VPVFVM+PLDTV +  ++N+ +AM  SL ALKS GVEG+MVD
Sbjct  71   EKLHGMASPHSHSSTNVRVPVFVMLPLDTVSIGGSLNKSRAMFASLMALKSGGVEGVMVD  130



>ref|XP_008794866.1| PREDICTED: beta-amylase 3, chloroplastic [Phoenix dactylifera]
Length=547

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 40/61 (66%), Gaps = 4/61 (7%)
 Frame = +1

Query  373  EREHKMGSDRGGSRGV----PVFVMMPLDTVKMDHTMNRKKAMNVSLQALKSAGVEGIMV  540
            ER H +   R G  GV    PV+VM+PLDTV     ++R +A+  SL AL+SAGVEG+MV
Sbjct  65   ERLHGLPGQRSGEGGVSARVPVYVMLPLDTVSASGGLSRARALQASLMALRSAGVEGVMV  124

Query  541  D  543
            D
Sbjct  125  D  125



>gb|EYU17858.1| hypothetical protein MIMGU_mgv1a003946mg [Erythranthe guttata]
Length=553

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 40/60 (67%), Gaps = 3/60 (5%)
 Frame = +1

Query  373  EREHKMGSDRGGSRG---VPVFVMMPLDTVKMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            E+ H M S    S     VPVFVM+PLDTV +  ++N+ +AM  SL ALKS GVEG+MVD
Sbjct  71   EKLHGMASPHSHSSTNVRVPVFVMLPLDTVSIGGSLNKSRAMFASLMALKSGGVEGVMVD  130



>ref|XP_010531694.1| PREDICTED: beta-amylase 3, chloroplastic-like [Tarenaya hassleriana]
Length=549

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 29/49 (59%), Positives = 37/49 (76%), Gaps = 1/49 (2%)
 Frame = +1

Query  397  DRGGSRGVPVFVMMPLDTVKMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            D  GS  V VFVM+PLDT+ +   +N+ +AMN SL ALKSAGV+G+MVD
Sbjct  79   DMNGS-SVSVFVMLPLDTITISGNLNKPRAMNASLMALKSAGVDGVMVD  126



>ref|XP_008229498.1| PREDICTED: beta-amylase 3, chloroplastic [Prunus mume]
Length=547

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 29/46 (63%), Positives = 37/46 (80%), Gaps = 1/46 (2%)
 Frame = +1

Query  406  GSRGVPVFVMMPLDTVKMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            GS+ VPV+VM+PLDTV     +N+ +AMN SL ALK+AGVEG+MVD
Sbjct  82   GSK-VPVYVMLPLDTVSHGGHLNKPRAMNASLMALKNAGVEGVMVD  126



>ref|XP_011070282.1| PREDICTED: beta-amylase 3, chloroplastic [Sesamum indicum]
Length=549

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 27/42 (64%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +1

Query  418  VPVFVMMPLDTVKMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            VPVFVM+PLDT+ +  ++N+ +AM  SL ALKSAGVEG+MVD
Sbjct  87   VPVFVMLPLDTISIGGSLNKPRAMLASLVALKSAGVEGVMVD  128



>ref|XP_009371857.1| PREDICTED: beta-amylase 3, chloroplastic [Pyrus x bretschneideri]
Length=545

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 27/42 (64%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +1

Query  418  VPVFVMMPLDTVKMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            VPV+VM+PLDTV     +N+ +AMN SL ALK AGVEG+MVD
Sbjct  83   VPVYVMLPLDTVSHGGHLNKPRAMNASLMALKQAGVEGVMVD  124



>ref|XP_008373719.1| PREDICTED: beta-amylase 3, chloroplastic [Malus domestica]
Length=546

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +1

Query  418  VPVFVMMPLDTVKMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            VPV+VM+PLDTV     +N+ +AMN SL ALK AGVEG+MVD
Sbjct  84   VPVYVMLPLDTVXHXGHLNKPRAMNASLMALKQAGVEGVMVD  125



>ref|XP_001782016.1| predicted protein [Physcomitrella patens]
 gb|EDQ53159.1| predicted protein [Physcomitrella patens]
Length=465

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  433  MMPLDTVKMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            M+PLD+V M++T+NR++AMN SL ALKSAGVEGIM+D
Sbjct  1    MLPLDSVNMNNTLNRRRAMNASLLALKSAGVEGIMMD  37



>ref|XP_008361217.1| PREDICTED: beta-amylase 3, chloroplastic-like [Malus domestica]
Length=653

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +1

Query  418  VPVFVMMPLDTVKMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            VPV+VM+PLDTV     +N+ +AMN SL ALK AGVEG+MVD
Sbjct  84   VPVYVMLPLDTVSHGGHLNKPRAMNASLMALKQAGVEGVMVD  125



>ref|XP_010919816.1| PREDICTED: beta-amylase 3, chloroplastic isoform X2 [Elaeis guineensis]
Length=509

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 39/60 (65%), Gaps = 4/60 (7%)
 Frame = +1

Query  376  REHKMGSDRGGSRG----VPVFVMMPLDTVKMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            R H +   R G  G    VPV+VM+PLDTV     ++R +A+N SL AL+SAGVEG+M D
Sbjct  65   RLHGLPGQRSGQGGTSARVPVYVMLPLDTVSASGGLSRARALNASLMALRSAGVEGVMAD  124



>ref|XP_010919815.1| PREDICTED: beta-amylase 3, chloroplastic isoform X1 [Elaeis guineensis]
Length=546

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 39/60 (65%), Gaps = 4/60 (7%)
 Frame = +1

Query  376  REHKMGSDRGGSRG----VPVFVMMPLDTVKMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            R H +   R G  G    VPV+VM+PLDTV     ++R +A+N SL AL+SAGVEG+M D
Sbjct  65   RLHGLPGQRSGQGGTSARVPVYVMLPLDTVSASGGLSRARALNASLMALRSAGVEGVMAD  124



>ref|XP_010274550.1| PREDICTED: beta-amylase 3, chloroplastic [Nelumbo nucifera]
Length=547

 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 39/58 (67%), Gaps = 1/58 (2%)
 Frame = +1

Query  373  EREHKM-GSDRGGSRGVPVFVMMPLDTVKMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            ER H + G     S  V VFVM+PLD V    ++NR +A+N SL ALKSAGVEG+MVD
Sbjct  70   ERLHALVGGHSKKSNRVAVFVMLPLDAVSPGGSLNRPRALNASLMALKSAGVEGVMVD  127



>ref|XP_004983616.1| PREDICTED: beta-amylase 3, chloroplastic-like isoform X1 [Setaria 
italica]
Length=557

 Score = 58.2 bits (139),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 29/52 (56%), Positives = 38/52 (73%), Gaps = 1/52 (2%)
 Frame = +1

Query  391  GSDRGGSRG-VPVFVMMPLDTVKMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            G D G  RG VPV+VM+PLDTV     ++R++A+  SL AL+ AGVEG+MVD
Sbjct  82   GQDHGRPRGGVPVYVMLPLDTVGPGGQLSRQRAVAASLMALRGAGVEGVMVD  133



>ref|XP_004983617.1| PREDICTED: beta-amylase 3, chloroplastic-like isoform X2 [Setaria 
italica]
Length=558

 Score = 58.2 bits (139),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 29/52 (56%), Positives = 38/52 (73%), Gaps = 1/52 (2%)
 Frame = +1

Query  391  GSDRGGSRG-VPVFVMMPLDTVKMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            G D G  RG VPV+VM+PLDTV     ++R++A+  SL AL+ AGVEG+MVD
Sbjct  82   GQDHGRPRGGVPVYVMLPLDTVGPGGQLSRQRAVAASLMALRGAGVEGVMVD  133



>ref|XP_006662612.1| PREDICTED: beta-amylase 3, chloroplastic-like [Oryza brachyantha]
Length=305

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 36/54 (67%), Gaps = 0/54 (0%)
 Frame = +1

Query  382  HKMGSDRGGSRGVPVFVMMPLDTVKMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            HK  +      G PV+VM+PLDTV     ++R +A+  SL AL+SAGVEG+MVD
Sbjct  22   HKAAAGEDAPPGTPVYVMLPLDTVGPGGQLSRARALAASLMALQSAGVEGVMVD  75



>tpg|DAA46353.1| TPA: hypothetical protein ZEAMMB73_080734 [Zea mays]
Length=534

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +1

Query  415  GVPVFVMMPLDTVKMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            GVPV+VM+PLDTV     ++R++A+  SL AL+ AGVEG+MVD
Sbjct  85   GVPVYVMLPLDTVGPGGQLSRQRALAASLMALRGAGVEGVMVD  127



>gb|KIZ05231.1| hypothetical protein MNEG_2733 [Monoraphidium neglectum]
Length=509

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 40/67 (60%), Gaps = 7/67 (10%)
 Frame = +1

Query  364  AAVEREHKMGSDRGGSRGVPVFVMMPLDTV-------KMDHTMNRKKAMNVSLQALKSAG  522
            A  E  H+  S  G   G PVFVM+PLDTV       K    + R+KA+ ++L  L+SAG
Sbjct  31   ATAETVHEAPSTSGRDLGCPVFVMLPLDTVWVVERDGKRVAILKREKALEIALHTLRSAG  90

Query  523  VEGIMVD  543
            VEG+MVD
Sbjct  91   VEGVMVD  97



>gb|EMS55384.1| Beta-amylase 1, chloroplastic [Triticum urartu]
Length=283

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/45 (64%), Positives = 33/45 (73%), Gaps = 2/45 (4%)
 Frame = +1

Query  415  GVPVFVMMPLDTVK--MDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            GVP+FVMMPLDTVK      +N +K M   L ALKS+GVEGIMVD
Sbjct  18   GVPLFVMMPLDTVKTCCGSGLNHRKTMARDLAALKSSGVEGIMVD  62



>gb|AFW87826.1| hypothetical protein ZEAMMB73_675891 [Zea mays]
Length=300

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +1

Query  415  GVPVFVMMPLDTVKMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            GVPV+VM+PLDTV     ++R++A+  SL AL+ AGVEG+MVD
Sbjct  87   GVPVYVMLPLDTVGPGGQLSRQRAVAASLMALRGAGVEGVMVD  129



>ref|XP_008658465.1| PREDICTED: beta-amylase 3, chloroplastic-like [Zea mays]
 tpg|DAA46352.1| TPA: hypothetical protein ZEAMMB73_080734 [Zea mays]
Length=551

 Score = 55.8 bits (133),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 32/64 (50%), Positives = 44/64 (69%), Gaps = 3/64 (5%)
 Frame = +1

Query  361  SAAVEREHKMGSDR--GGSRG-VPVFVMMPLDTVKMDHTMNRKKAMNVSLQALKSAGVEG  531
            + A E  H  G+D+  G  RG VPV+VM+PLDTV     ++R++A+  SL AL+ AGVEG
Sbjct  64   AEAGELLHGGGADQHHGLPRGGVPVYVMLPLDTVGPGGQLSRQRALAASLMALRGAGVEG  123

Query  532  IMVD  543
            +MVD
Sbjct  124  VMVD  127



>ref|XP_002975660.1| hypothetical protein SELMODRAFT_232533 [Selaginella moellendorffii]
 gb|EFJ23289.1| hypothetical protein SELMODRAFT_232533 [Selaginella moellendorffii]
Length=472

 Score = 55.5 bits (132),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = +1

Query  433  MMPLDTVKMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            M+PLD+V +++T+NR++A+N  L ALKSAGVEG+MVD
Sbjct  1    MLPLDSVNVNNTLNRRRALNAGLIALKSAGVEGVMVD  37



>dbj|BAJ95735.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=467

 Score = 55.5 bits (132),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 28/45 (62%), Positives = 33/45 (73%), Gaps = 2/45 (4%)
 Frame = +1

Query  415  GVPVFVMMPLDTVK--MDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            GVPVFVMMPLDTVK      +N ++ M   L ALKS+GVEG+MVD
Sbjct  37   GVPVFVMMPLDTVKTCCGSGLNHRRTMARDLAALKSSGVEGVMVD  81



>ref|XP_002978844.1| hypothetical protein SELMODRAFT_233213 [Selaginella moellendorffii]
 gb|EFJ20291.1| hypothetical protein SELMODRAFT_233213 [Selaginella moellendorffii]
Length=472

 Score = 55.5 bits (132),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = +1

Query  433  MMPLDTVKMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            M+PLD+V +++T+NR++A+N  L ALKSAGVEG+MVD
Sbjct  1    MLPLDSVNVNNTLNRRRALNAGLIALKSAGVEGVMVD  37



>emb|CAX51379.1| beta-amylase [Hordeum vulgare subsp. vulgare]
Length=448

 Score = 55.5 bits (132),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 28/45 (62%), Positives = 33/45 (73%), Gaps = 2/45 (4%)
 Frame = +1

Query  415  GVPVFVMMPLDTVK--MDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            GVPVFVMMPLDTVK      +N ++ M   L ALKS+GVEG+MVD
Sbjct  18   GVPVFVMMPLDTVKTCCGSGLNHRRTMARDLAALKSSGVEGVMVD  62



>ref|XP_002464915.1| hypothetical protein SORBIDRAFT_01g028700 [Sorghum bicolor]
 gb|EER91913.1| hypothetical protein SORBIDRAFT_01g028700 [Sorghum bicolor]
Length=557

 Score = 55.1 bits (131),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 25/43 (58%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +1

Query  415  GVPVFVMMPLDTVKMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            GVPV+VM+PLDTV     ++R++A+  SL AL+ AGVEG+MVD
Sbjct  91   GVPVYVMLPLDTVGPGGQLSRQRAVAASLMALRGAGVEGVMVD  133



>gb|EMT09794.1| Beta-amylase [Aegilops tauschii]
Length=721

 Score = 55.1 bits (131),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 32/44 (73%), Gaps = 2/44 (5%)
 Frame = +1

Query  415  GVPVFVMMPLDTVK--MDHTMNRKKAMNVSLQALKSAGVEGIMV  540
            GVPVFVMMPLDTVK      +N +K M   L ALKS+GVEGIMV
Sbjct  18   GVPVFVMMPLDTVKTCCGSGLNHRKTMARDLAALKSSGVEGIMV  61



>ref|XP_008658990.1| PREDICTED: uncharacterized protein LOC100502394 isoform X1 [Zea 
mays]
 gb|AFW87825.1| hypothetical protein ZEAMMB73_675891 [Zea mays]
Length=553

 Score = 55.1 bits (131),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 25/43 (58%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +1

Query  415  GVPVFVMMPLDTVKMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            GVPV+VM+PLDTV     ++R++A+  SL AL+ AGVEG+MVD
Sbjct  87   GVPVYVMLPLDTVGPGGQLSRQRAVAASLMALRGAGVEGVMVD  129



>ref|XP_008364514.1| PREDICTED: LOW QUALITY PROTEIN: beta-amylase 3, chloroplastic-like, 
partial [Malus domestica]
Length=391

 Score = 54.7 bits (130),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 31/42 (74%), Gaps = 2/42 (5%)
 Frame = +1

Query  418  VPVFVMMPLDTVKMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            VPV+VM+PLDTV   H  +  K MN SL ALK AGVEG+MVD
Sbjct  84   VPVYVMLPLDTVX--HXGHLNKXMNASLMALKQAGVEGVMVD  123



>ref|XP_003548316.1| PREDICTED: beta-amylase 1, chloroplastic-like [Glycine max]
Length=570

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 54/151 (36%), Positives = 77/151 (51%), Gaps = 31/151 (21%)
 Frame = +1

Query  166  LPMSLAHQIGFISRTPVEVRTESVTREAPAKTAVSISPLWRRNLRISVKNLAAKAVLRGG  345
            + +++ HQIG ++   V V   S      +  A+S + LW+    +S+K    +    GG
Sbjct  1    MALNMTHQIGTLAAATVPVPNSSA---GESTAAMSAATLWKPP-AVSLKCKVTRT--EGG  54

Query  346  ME---------------ADLSAA-------VEREHKMGSDRGGSRG---VPVFVMMPLDT  450
             E               ADLSAA       V  E  +   +    G   VP+FVMMPLD+
Sbjct  55   AEGLSPPLSPCRSPVLRADLSAACQAFTAEVAAEEYIAGGKEKGEGKEGVPLFVMMPLDS  114

Query  451  VKMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            VK  + +NRKKAMN ++ ALKSAGVEG+M+D
Sbjct  115  VKTGNAVNRKKAMNAAMAALKSAGVEGVMMD  145



>ref|XP_009802726.1| PREDICTED: beta-amylase 1, chloroplastic-like [Nicotiana sylvestris]
Length=548

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 40/112 (36%), Positives = 60/112 (54%), Gaps = 10/112 (9%)
 Frame = +1

Query  223  RTESVTREAPAKTAVSISPLW----RRNLRISVKNLAAKAVLRGGMEADLSAAVEREHKM  390
            RT+S     PA++  S SP+      R   +S +  ++ +V   G + DL    E +H  
Sbjct  19   RTDSAA--VPARSLKS-SPIQTRFQNRRFTLSCRLDSSSSVPSNGFDGDLQ--YELQHGS  73

Query  391  GSDRGGSRGVPVFVMMPLDTVKMDH-TMNRKKAMNVSLQALKSAGVEGIMVD  543
             S     RG PVFV +P+D V +    M RKKAM  S +AL +AGVEG++++
Sbjct  74   VSTHYRRRGSPVFVTLPVDAVSLPAGIMKRKKAMAQSFRALAAAGVEGVVME  125



>ref|XP_009627593.1| PREDICTED: beta-amylase 1, chloroplastic-like [Nicotiana tomentosiformis]
Length=548

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 40/112 (36%), Positives = 60/112 (54%), Gaps = 10/112 (9%)
 Frame = +1

Query  223  RTESVTREAPAKTAVSISPLW----RRNLRISVKNLAAKAVLRGGMEADLSAAVEREHKM  390
            RT+S     PA++  S SP+      R   +S +  ++ +V   G + DL    E +H  
Sbjct  19   RTDSAA--VPARSLKS-SPIQTRFQNRRFTLSCRLDSSSSVPSNGFDGDLQ--YELQHGS  73

Query  391  GSDRGGSRGVPVFVMMPLDTVKMDH-TMNRKKAMNVSLQALKSAGVEGIMVD  543
             S     RG PVFV +P+D V +    M RKKAM  S +AL +AGVEG++++
Sbjct  74   VSTHYRRRGSPVFVTLPVDAVSLPAGIMKRKKAMAQSFRALAAAGVEGVVME  125



>ref|XP_003062547.1| glycoside hydrolase family 14 protein [Micromonas pusilla CCMP1545]
 gb|EEH53366.1| glycoside hydrolase family 14 protein [Micromonas pusilla CCMP1545]
Length=546

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 23/41 (56%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +1

Query  421  PVFVMMPLDTVKMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            PVFVM+PLD V  D  +   KA+ VSL+ LK  GVEG+M+D
Sbjct  26   PVFVMLPLDVVTRDGVLQHGKALEVSLKTLKKIGVEGVMID  66



>ref|XP_005846867.1| hypothetical protein CHLNCDRAFT_134682 [Chlorella variabilis]
 gb|EFN54765.1| hypothetical protein CHLNCDRAFT_134682 [Chlorella variabilis]
Length=147

 Score = 50.4 bits (119),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 33/51 (65%), Gaps = 7/51 (14%)
 Frame = +1

Query  412  RGVPVFVMMPLDTVKM-------DHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            RGVPV+VM+PLDTV +            R+KAM V L+ L  AGV+G+M+D
Sbjct  74   RGVPVYVMLPLDTVWLLERGGTTQPLFIREKAMEVGLEMLSRAGVDGVMID  124



>ref|XP_002505301.1| glycoside hydrolase family 14 protein [Micromonas sp. RCC299]
 gb|ACO66559.1| glycoside hydrolase family 14 protein [Micromonas sp. RCC299]
Length=465

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 28/52 (54%), Positives = 34/52 (65%), Gaps = 1/52 (2%)
 Frame = +1

Query  388  MGSDRGGSRGVPVFVMMPLDTVKMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            MGS R  S GVPV+VM+PLDTV  D  + R   +   +  LK AGVEG+MVD
Sbjct  1    MGSPRS-SGGVPVYVMLPLDTVSRDGQLQRPDELAERMSRLKRAGVEGVMVD  51



>ref|XP_002681212.1| beta-amylase [Naegleria gruberi]
 gb|EFC48468.1| beta-amylase [Naegleria gruberi]
Length=500

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 24/56 (43%), Positives = 34/56 (61%), Gaps = 0/56 (0%)
 Frame = +1

Query  376  REHKMGSDRGGSRGVPVFVMMPLDTVKMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            +E K  S   G   VPV++MMPLDTV  D T+N    +  +L+ +K  G +GIM+D
Sbjct  47   KEAKSTSTTTGGSYVPVYIMMPLDTVNNDGTLNNPTKIYNNLKQVKQVGTDGIMID  102



>gb|KIZ05250.1| hypothetical protein MNEG_2716 [Monoraphidium neglectum]
Length=313

 Score = 51.2 bits (121),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 33/50 (66%), Gaps = 7/50 (14%)
 Frame = +1

Query  415  GVPVFVMMPLDTV-------KMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            G PVFVM+PLDTV       K    + R+KA+ ++L  L+ AGVEG+MVD
Sbjct  225  GCPVFVMLPLDTVWVVERDGKRVAVLKREKALEIALHTLRGAGVEGVMVD  274



>ref|XP_002968794.1| hypothetical protein SELMODRAFT_145994 [Selaginella moellendorffii]
 gb|EFJ29910.1| hypothetical protein SELMODRAFT_145994 [Selaginella moellendorffii]
Length=464

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 31/38 (82%), Gaps = 1/38 (3%)
 Frame = +1

Query  433  MMPLDTVKM-DHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            M+PLD++   ++ +NR +AMN S QALKSAGVEG+MVD
Sbjct  1    MLPLDSINSGNNQVNRARAMNASFQALKSAGVEGVMVD  38



>gb|EAZ16360.1| hypothetical protein OsJ_31822 [Oryza sativa Japonica Group]
Length=535

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 36/44 (82%), Gaps = 1/44 (2%)
 Frame = +1

Query  415  GVPVFVMMPLDTV-KMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            GVPVFVMMPLDTV K    +NR+KA+  SL ALKSAGVEGIMVD
Sbjct  72   GVPVFVMMPLDTVSKCGSALNRRKAVAASLAALKSAGVEGIMVD  115



>gb|EAY78842.1| hypothetical protein OsI_33946 [Oryza sativa Indica Group]
Length=536

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 36/44 (82%), Gaps = 1/44 (2%)
 Frame = +1

Query  415  GVPVFVMMPLDTV-KMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            GVPVFVMMPLDTV K    +NR+KA+  SL ALKSAGVEGIMVD
Sbjct  72   GVPVFVMMPLDTVSKCGSALNRRKAVAASLAALKSAGVEGIMVD  115



>gb|AFI71858.1| amylase [Oryza sativa]
Length=535

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 36/44 (82%), Gaps = 1/44 (2%)
 Frame = +1

Query  415  GVPVFVMMPLDTV-KMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            GVPVFVMMPLDTV K    +NR+KA+  SL ALKSAGVEGIMVD
Sbjct  72   GVPVFVMMPLDTVSKCGSALNRRKAVAASLAALKSAGVEGIMVD  115



>ref|NP_001064798.1| Os10g0465700 [Oryza sativa Japonica Group]
 gb|AAK27799.1|AC022457_2 putative amylase [Oryza sativa Japonica Group]
 gb|AAP54185.1| Glycosyl hydrolase family 14 protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF26712.1| Os10g0465700 [Oryza sativa Japonica Group]
 dbj|BAG90332.1| unnamed protein product [Oryza sativa Japonica Group]
Length=535

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 36/44 (82%), Gaps = 1/44 (2%)
 Frame = +1

Query  415  GVPVFVMMPLDTV-KMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            GVPVFVMMPLDTV K    +NR+KA+  SL ALKSAGVEGIMVD
Sbjct  72   GVPVFVMMPLDTVSKCGSALNRRKAVAASLAALKSAGVEGIMVD  115



>ref|XP_002974185.1| hypothetical protein SELMODRAFT_149606, partial [Selaginella 
moellendorffii]
 gb|EFJ25140.1| hypothetical protein SELMODRAFT_149606, partial [Selaginella 
moellendorffii]
Length=432

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 31/38 (82%), Gaps = 1/38 (3%)
 Frame = +1

Query  433  MMPLDTVKM-DHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            M+PLD++   ++ +NR +AMN S QALKSAGVEG+MVD
Sbjct  1    MLPLDSINSGNNQVNRARAMNASFQALKSAGVEGVMVD  38



>ref|XP_002265698.1| PREDICTED: inactive beta-amylase 4, chloroplastic [Vitis vinifera]
 emb|CBI39736.3| unnamed protein product [Vitis vinifera]
Length=522

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/97 (35%), Positives = 54/97 (56%), Gaps = 10/97 (10%)
 Frame = +1

Query  265  VSISPLWRRNLRISVKNLAAKAVLRGGMEADLSAAVEREHKMGSDRGGSRGVPVFVMMPL  444
            VS+ PL++ N     +++AA   +      D   A E+      +  G + VP+FVMMP+
Sbjct  37   VSMIPLFKHNGLFIWRSIAANNCI---FSMD---AREKSRSTTLETPGHKRVPIFVMMPV  90

Query  445  DTVKMDHT----MNRKKAMNVSLQALKSAGVEGIMVD  543
            D+  +D +    + R KA+ +SL+ALK AGV GI V+
Sbjct  91   DSFGIDTSGAPRIRRIKALTISLKALKLAGVHGIAVE  127



>ref|XP_003534086.1| PREDICTED: beta-amylase 1, chloroplastic [Glycine max]
Length=569

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 29/42 (69%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +1

Query  418  VPVFVMMPLDTVKMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            VPVFVMMPLD+V   + +NRKKAMN ++ ALKSAGVEG+M+D
Sbjct  103  VPVFVMMPLDSVTAGNAVNRKKAMNAAMAALKSAGVEGVMMD  144



>ref|XP_009403535.1| PREDICTED: beta-amylase 3, chloroplastic-like [Musa acuminata 
subsp. malaccensis]
Length=542

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/44 (55%), Positives = 28/44 (64%), Gaps = 0/44 (0%)
 Frame = +1

Query  412  RGVPVFVMMPLDTVKMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            RGVPVFV +P D V     M R+K M  S  AL +AGVEGI V+
Sbjct  85   RGVPVFVTLPADAVTPSGRMTRRKTMGASFMALATAGVEGITVE  128



>ref|XP_003532447.1| PREDICTED: beta-amylase 1, chloroplastic-like isoform X1 [Glycine 
max]
Length=553

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 39/115 (34%), Positives = 57/115 (50%), Gaps = 6/115 (5%)
 Frame = +1

Query  214  VEVRTES--VTREAPAKTAVSISPLWRRNLRISVKNLAAKAVLRGGMEADLSA---AVER  378
            V  RT+S  +TR     T  + SP  R  L  S  N +      G +  D      A + 
Sbjct  14   VSTRTDSTHLTRFPCRVTFRARSPPLRPALVSSRLNSSRSPDAGGSLSPDNGGGDVAYQL  73

Query  379  EHKMGSDRGGSRGVPVFVMMPLDTVKMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
             H     R   RG PVFV +P++++  D  + R KAM  SL+AL +AGVEG++++
Sbjct  74   HHDFSPQRR-RRGSPVFVTLPVNSIGRDGRVARPKAMMFSLKALATAGVEGVVIE  127



>ref|XP_006662424.1| PREDICTED: beta-amylase 1, chloroplastic-like, partial [Oryza 
brachyantha]
Length=453

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 32/46 (70%), Positives = 37/46 (80%), Gaps = 1/46 (2%)
 Frame = +1

Query  409  SRGVPVFVMMPLDTVK-MDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            + GVPVFVMMPLDTVK     +NR+KA+  SL ALKSAGVEG+MVD
Sbjct  68   TNGVPVFVMMPLDTVKKCGSALNRRKAVAASLAALKSAGVEGVMVD  113



>ref|XP_010450097.1| PREDICTED: inactive beta-amylase 4, chloroplastic-like isoform 
X2 [Camelina sativa]
Length=489

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/46 (57%), Positives = 33/46 (72%), Gaps = 4/46 (9%)
 Frame = +1

Query  418  VPVFVMMPLDTVKMDHT----MNRKKAMNVSLQALKSAGVEGIMVD  543
            VPVFVMMP+DT  +D +    + R KA+ VSL+ALK AGV GI V+
Sbjct  92   VPVFVMMPIDTFGIDDSGCPKIKRLKALTVSLKALKLAGVHGIAVE  137



>ref|XP_010450090.1| PREDICTED: inactive beta-amylase 4, chloroplastic-like isoform 
X1 [Camelina sativa]
Length=531

 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/46 (57%), Positives = 33/46 (72%), Gaps = 4/46 (9%)
 Frame = +1

Query  418  VPVFVMMPLDTVKMDHT----MNRKKAMNVSLQALKSAGVEGIMVD  543
            VPVFVMMP+DT  +D +    + R KA+ VSL+ALK AGV GI V+
Sbjct  92   VPVFVMMPIDTFGIDDSGCPKIKRLKALTVSLKALKLAGVHGIAVE  137



>ref|XP_005642810.1| glycoside hydrolase [Coccomyxa subellipsoidea C-169]
 gb|EIE18266.1| glycoside hydrolase [Coccomyxa subellipsoidea C-169]
Length=473

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 34/52 (65%), Gaps = 7/52 (13%)
 Frame = +1

Query  409  SRGVPVFVMMPLDTV-------KMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            S  +PV+VM+PLDT+       K    + R+KA+ V LQ L+ AGVEG+MVD
Sbjct  3    STSLPVYVMLPLDTIWLLERDGKSIPVIKREKALEVGLQTLRQAGVEGVMVD  54



>ref|XP_002864407.1| beta-amylase 6 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH40666.1| beta-amylase 6 [Arabidopsis lyrata subsp. lyrata]
Length=531

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/46 (57%), Positives = 32/46 (70%), Gaps = 4/46 (9%)
 Frame = +1

Query  418  VPVFVMMPLDTVKMDHT----MNRKKAMNVSLQALKSAGVEGIMVD  543
            VPVFVMMP DT  +D +    + R KA+ VSL+ALK AGV GI V+
Sbjct  92   VPVFVMMPFDTFGIDASGCPKIKRLKALTVSLKALKLAGVHGIAVE  137



>ref|XP_010483034.1| PREDICTED: inactive beta-amylase 4, chloroplastic isoform X3 
[Camelina sativa]
Length=515

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/46 (57%), Positives = 33/46 (72%), Gaps = 4/46 (9%)
 Frame = +1

Query  418  VPVFVMMPLDTVKMDHT----MNRKKAMNVSLQALKSAGVEGIMVD  543
            VPVFVMMP+DT  +D +    + R KA+ VSL+ALK AGV GI V+
Sbjct  76   VPVFVMMPIDTFGIDASGCPKIKRLKALTVSLKALKLAGVHGIAVE  121



>ref|NP_568829.2| inactive beta-amylase 4 [Arabidopsis thaliana]
 sp|Q9FM68.1|BAM4_ARATH RecName: Full=Inactive beta-amylase 4, chloroplastic; AltName: 
Full=Inactive beta-amylase 6; Flags: Precursor [Arabidopsis 
thaliana]
 dbj|BAB09237.1| beta-amylase [Arabidopsis thaliana]
 gb|AED96669.1| inactive beta-amylase 4 [Arabidopsis thaliana]
Length=531

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/46 (57%), Positives = 33/46 (72%), Gaps = 4/46 (9%)
 Frame = +1

Query  418  VPVFVMMPLDTVKMDHT----MNRKKAMNVSLQALKSAGVEGIMVD  543
            VPVFVMMP+DT  +D +    + R KA+ VSL+ALK AGV GI V+
Sbjct  92   VPVFVMMPIDTFGIDASGCPKIKRLKALTVSLKALKLAGVHGIAVE  137



>ref|NP_001190549.1| inactive beta-amylase 4 [Arabidopsis thaliana]
 gb|AED96670.1| inactive beta-amylase 4 [Arabidopsis thaliana]
Length=489

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/46 (57%), Positives = 33/46 (72%), Gaps = 4/46 (9%)
 Frame = +1

Query  418  VPVFVMMPLDTVKMDHT----MNRKKAMNVSLQALKSAGVEGIMVD  543
            VPVFVMMP+DT  +D +    + R KA+ VSL+ALK AGV GI V+
Sbjct  92   VPVFVMMPIDTFGIDASGCPKIKRLKALTVSLKALKLAGVHGIAVE  137



>ref|XP_010483031.1| PREDICTED: inactive beta-amylase 4, chloroplastic isoform X1 
[Camelina sativa]
 ref|XP_010483032.1| PREDICTED: inactive beta-amylase 4, chloroplastic isoform X2 
[Camelina sativa]
Length=531

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/46 (57%), Positives = 33/46 (72%), Gaps = 4/46 (9%)
 Frame = +1

Query  418  VPVFVMMPLDTVKMDHT----MNRKKAMNVSLQALKSAGVEGIMVD  543
            VPVFVMMP+DT  +D +    + R KA+ VSL+ALK AGV GI V+
Sbjct  92   VPVFVMMPIDTFGIDASGCPKIKRLKALTVSLKALKLAGVHGIAVE  137



>ref|XP_006280293.1| hypothetical protein CARUB_v10026217mg [Capsella rubella]
 gb|EOA13191.1| hypothetical protein CARUB_v10026217mg [Capsella rubella]
Length=531

 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 26/46 (57%), Positives = 33/46 (72%), Gaps = 4/46 (9%)
 Frame = +1

Query  418  VPVFVMMPLDTVKMDHT----MNRKKAMNVSLQALKSAGVEGIMVD  543
            VPVFVMMP+DT  +D +    + R KA+ VSL+ALK AGV GI V+
Sbjct  92   VPVFVMMPIDTFGIDASGCPKIKRLKALTVSLKALKLAGVHGIAVE  137



>ref|XP_010483036.1| PREDICTED: inactive beta-amylase 4, chloroplastic isoform X5 
[Camelina sativa]
Length=489

 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 26/46 (57%), Positives = 33/46 (72%), Gaps = 4/46 (9%)
 Frame = +1

Query  418  VPVFVMMPLDTVKMDHT----MNRKKAMNVSLQALKSAGVEGIMVD  543
            VPVFVMMP+DT  +D +    + R KA+ VSL+ALK AGV GI V+
Sbjct  92   VPVFVMMPIDTFGIDASGCPKIKRLKALTVSLKALKLAGVHGIAVE  137



>gb|AAK76508.1| putative beta-amylase [Arabidopsis thaliana]
 gb|AAN71908.1| putative beta-amylase [Arabidopsis thaliana]
Length=484

 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 26/46 (57%), Positives = 33/46 (72%), Gaps = 4/46 (9%)
 Frame = +1

Query  418  VPVFVMMPLDTVKMDHT----MNRKKAMNVSLQALKSAGVEGIMVD  543
            VPVFVMMP+DT  +D +    + R KA+ VSL+ALK AGV GI V+
Sbjct  45   VPVFVMMPIDTFGIDASGCPKIKRLKALTVSLKALKLAGVHGIAVE  90



>ref|XP_010483035.1| PREDICTED: inactive beta-amylase 4, chloroplastic isoform X4 
[Camelina sativa]
Length=459

 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 26/46 (57%), Positives = 33/46 (72%), Gaps = 4/46 (9%)
 Frame = +1

Query  418  VPVFVMMPLDTVKMDHT----MNRKKAMNVSLQALKSAGVEGIMVD  543
            VPVFVMMP+DT  +D +    + R KA+ VSL+ALK AGV GI V+
Sbjct  20   VPVFVMMPIDTFGIDASGCPKIKRLKALTVSLKALKLAGVHGIAVE  65



>dbj|BAH20280.1| AT5G55700 [Arabidopsis thaliana]
Length=498

 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 26/46 (57%), Positives = 33/46 (72%), Gaps = 4/46 (9%)
 Frame = +1

Query  418  VPVFVMMPLDTVKMDHT----MNRKKAMNVSLQALKSAGVEGIMVD  543
            VPVFVMMP+DT  +D +    + R KA+ VSL+ALK AGV GI V+
Sbjct  59   VPVFVMMPIDTFGIDASGCPKIKRLKALTVSLKALKLAGVHGIAVE  104



>ref|XP_009132359.1| PREDICTED: inactive beta-amylase 4, chloroplastic-like isoform 
X3 [Brassica rapa]
Length=470

 Score = 49.3 bits (116),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 34/48 (71%), Gaps = 4/48 (8%)
 Frame = +1

Query  412  RGVPVFVMMPLDTVKMDHT----MNRKKAMNVSLQALKSAGVEGIMVD  543
            R VPV+VMMP+DT  +D +    + R KA+ VSL+ALK AGV G+ V+
Sbjct  91   RKVPVYVMMPIDTFGIDSSGCPIIKRLKALTVSLKALKLAGVHGVAVE  138



>ref|XP_003571854.1| PREDICTED: beta-amylase 1, chloroplastic-like [Brachypodium distachyon]
Length=534

 Score = 49.3 bits (116),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 32/46 (70%), Positives = 37/46 (80%), Gaps = 1/46 (2%)
 Frame = +1

Query  409  SRGVPVFVMMPLDTVKMDHT-MNRKKAMNVSLQALKSAGVEGIMVD  543
            S GVPVFVM+PLDTVK   + + R+KAM  SL ALKSAGVEG+MVD
Sbjct  64   SSGVPVFVMLPLDTVKQCGSGLKRRKAMAASLAALKSAGVEGVMVD  109



>ref|XP_008460412.1| PREDICTED: beta-amylase 1, chloroplastic-like [Cucumis melo]
Length=546

 Score = 49.3 bits (116),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 22/43 (51%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +1

Query  415  GVPVFVMMPLDTVKMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            G  VFV +PLD V  D  + RKKAM+ S +AL +AGVEG++++
Sbjct  81   GSAVFVTLPLDAVSPDGQLRRKKAMSQSFRALAAAGVEGVVIE  123



>ref|XP_003060314.1| glycoside hydrolase family 14 protein [Micromonas pusilla CCMP1545]
 gb|EEH55083.1| glycoside hydrolase family 14 protein [Micromonas pusilla CCMP1545]
Length=496

 Score = 49.3 bits (116),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 32/51 (63%), Gaps = 4/51 (8%)
 Frame = +1

Query  403  GGSRG----VPVFVMMPLDTVKMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            GG  G    +PV+VM+PLDTV  D  + R  A++  L  L SAGV G+MVD
Sbjct  38   GGGDGRKGAIPVYVMLPLDTVSRDGRLQRVDALSAQLARLASAGVAGVMVD  88



>ref|XP_004144400.1| PREDICTED: beta-amylase 1, chloroplastic-like [Cucumis sativus]
 gb|KGN58391.1| hypothetical protein Csa_3G636400 [Cucumis sativus]
Length=546

 Score = 49.3 bits (116),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 22/43 (51%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +1

Query  415  GVPVFVMMPLDTVKMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            G  VFV +PLD V  D  + RKKAM+ S +AL +AGVEG++++
Sbjct  81   GSAVFVTLPLDAVSPDGQLRRKKAMSQSFRALAAAGVEGVVIE  123



>ref|XP_004289151.1| PREDICTED: beta-amylase-like [Fragaria vesca subsp. vesca]
Length=586

 Score = 49.3 bits (116),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 21/42 (50%), Positives = 29/42 (69%), Gaps = 0/42 (0%)
 Frame = +1

Query  418  VPVFVMMPLDTVKMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            VP+FVM+PL  V +D+ +  K  +   LQ LK AGV+G+MVD
Sbjct  85   VPIFVMLPLGVVTIDNVLEDKDTLVKQLQKLKEAGVDGVMVD  126



>ref|XP_009132358.1| PREDICTED: inactive beta-amylase 4, chloroplastic-like isoform 
X2 [Brassica rapa]
Length=516

 Score = 49.3 bits (116),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 34/48 (71%), Gaps = 4/48 (8%)
 Frame = +1

Query  412  RGVPVFVMMPLDTVKMDHT----MNRKKAMNVSLQALKSAGVEGIMVD  543
            R VPV+VMMP+DT  +D +    + R KA+ VSL+ALK AGV G+ V+
Sbjct  75   RKVPVYVMMPIDTFGIDSSGCPIIKRLKALTVSLKALKLAGVHGVAVE  122



>ref|XP_009132357.1| PREDICTED: inactive beta-amylase 4, chloroplastic-like isoform 
X1 [Brassica rapa]
Length=532

 Score = 49.3 bits (116),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 34/48 (71%), Gaps = 4/48 (8%)
 Frame = +1

Query  412  RGVPVFVMMPLDTVKMDHT----MNRKKAMNVSLQALKSAGVEGIMVD  543
            R VPV+VMMP+DT  +D +    + R KA+ VSL+ALK AGV G+ V+
Sbjct  91   RKVPVYVMMPIDTFGIDSSGCPIIKRLKALTVSLKALKLAGVHGVAVE  138



>ref|XP_004503587.1| PREDICTED: beta-amylase 1, chloroplastic-like [Cicer arietinum]
Length=554

 Score = 49.3 bits (116),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 26/57 (46%), Positives = 37/57 (65%), Gaps = 1/57 (2%)
 Frame = +1

Query  373  EREHKMGSDRGGSRGVPVFVMMPLDTVKMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            E  H +   R   RG PVFV +P+ +V  +  + R KAM +SL+AL SAGVEG++V+
Sbjct  74   ELHHDLSPQRR-RRGSPVFVTLPVKSVGSEGKIWRPKAMMLSLKALASAGVEGVVVE  129



>emb|CDY36760.1| BnaA03g11260D [Brassica napus]
Length=532

 Score = 49.3 bits (116),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 34/48 (71%), Gaps = 4/48 (8%)
 Frame = +1

Query  412  RGVPVFVMMPLDTVKMDHT----MNRKKAMNVSLQALKSAGVEGIMVD  543
            R VPV+VMMP+DT  +D +    + R KA+ VSL+ALK AGV G+ V+
Sbjct  91   RKVPVYVMMPIDTFGIDSSGCPIIKRLKALTVSLKALKLAGVHGVAVE  138



>gb|KCW89435.1| hypothetical protein EUGRSUZ_A01734 [Eucalyptus grandis]
Length=591

 Score = 49.3 bits (116),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 19/42 (45%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +1

Query  418  VPVFVMMPLDTVKMDHTMNRKKAMNVSLQALKSAGVEGIMVD  543
            VP++VM+PLD V +D+T+  +  +   L+ L +AG++GIMVD
Sbjct  90   VPIYVMLPLDVVTVDNTLKDEDGIEQQLKKLSTAGIDGIMVD  131



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 579015689490