BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001N19

Length=554
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004307764.1|  PREDICTED: polyadenylate-binding protein 1         179   1e-52   Fragaria vesca subsp. vesca
gb|KDP22495.1|  hypothetical protein JCGZ_26326                         177   4e-52   Jatropha curcas
ref|XP_008234027.1|  PREDICTED: polyadenylate-binding protein 2         174   1e-50   Prunus mume [ume]
ref|NP_001275811.1|  poly(A)-binding protein 1                          173   2e-50   Citrus sinensis [apfelsine]
ref|XP_010269828.1|  PREDICTED: polyadenylate-binding protein 2-like    172   5e-50   Nelumbo nucifera [Indian lotus]
ref|XP_004235203.1|  PREDICTED: polyadenylate-binding protein 2         172   5e-50   Solanum lycopersicum
ref|XP_006376950.1|  hypothetical protein POPTR_0012s11480g             171   1e-49   Populus trichocarpa [western balsam poplar]
ref|XP_011003544.1|  PREDICTED: polyadenylate-binding protein 1-like    171   1e-49   Populus euphratica
ref|XP_006374587.1|  hypothetical protein POPTR_0015s12230g             171   1e-49   Populus trichocarpa [western balsam poplar]
ref|XP_009631161.1|  PREDICTED: polyadenylate-binding protein 2         171   1e-49   Nicotiana tomentosiformis
ref|XP_006437033.1|  hypothetical protein CICLE_v10032621mg             171   1e-49   
ref|XP_011040327.1|  PREDICTED: polyadenylate-binding protein 1 i...    171   2e-49   Populus euphratica
ref|XP_011040326.1|  PREDICTED: polyadenylate-binding protein 1 i...    171   2e-49   Populus euphratica
ref|XP_006485035.1|  PREDICTED: polyadenylate-binding protein 2 i...    171   2e-49   Citrus sinensis [apfelsine]
ref|XP_006358184.1|  PREDICTED: polyadenylate-binding protein 2-like    171   2e-49   Solanum tuberosum [potatoes]
ref|XP_006437034.1|  hypothetical protein CICLE_v10032621mg             171   3e-49   Citrus clementina [clementine]
gb|KJB19595.1|  hypothetical protein B456_003G110600                    169   5e-49   Gossypium raimondii
ref|XP_009363742.1|  PREDICTED: polyadenylate-binding protein 2         170   5e-49   Pyrus x bretschneideri [bai li]
ref|XP_010274505.1|  PREDICTED: polyadenylate-binding protein 2         170   5e-49   Nelumbo nucifera [Indian lotus]
pdb|2M70|A  Chain A, Structural Determination Of The Citrus Sinen...    167   5e-49   Citrus sinensis [apfelsine]
ref|XP_007218817.1|  hypothetical protein PRUPE_ppa010052mg             171   8e-49   
ref|XP_007038220.1|  RNA-binding family protein                         169   8e-49   
ref|XP_002511041.1|  polyadenylate-binding protein, putative            169   1e-48   
gb|KJB19594.1|  hypothetical protein B456_003G110600                    169   1e-48   Gossypium raimondii
gb|AFK33591.1|  unknown                                                 166   3e-48   Medicago truncatula
ref|XP_003590723.1|  Polyadenylate-binding protein                      166   5e-48   
ref|XP_009362727.1|  PREDICTED: polyadenylate-binding protein 2-like    167   5e-48   Pyrus x bretschneideri [bai li]
gb|KJB51352.1|  hypothetical protein B456_008G213100                    166   5e-48   Gossypium raimondii
ref|XP_007205858.1|  hypothetical protein PRUPE_ppa011157mg             166   1e-47   Prunus persica
ref|XP_011076455.1|  PREDICTED: polyadenylate-binding protein 1 i...    166   1e-47   Sesamum indicum [beniseed]
ref|XP_004166616.1|  PREDICTED: polyadenylate-binding protein 2-like    166   1e-47   
gb|ACJ85460.1|  unknown                                                 166   1e-47   Medicago truncatula
emb|CDP01496.1|  unnamed protein product                                166   1e-47   Coffea canephora [robusta coffee]
ref|XP_008453840.1|  PREDICTED: polyadenylate-binding protein 2-l...    166   2e-47   Cucumis melo [Oriental melon]
gb|KJB07918.1|  hypothetical protein B456_001G052500                    165   2e-47   Gossypium raimondii
ref|XP_002279148.1|  PREDICTED: polyadenylate-binding protein 2         166   2e-47   Vitis vinifera
ref|XP_008364853.1|  PREDICTED: polyadenylate-binding protein 2-like    165   2e-47   
ref|XP_008804766.1|  PREDICTED: polyadenylate-binding protein 2-l...    165   2e-47   Phoenix dactylifera
ref|XP_004146890.1|  PREDICTED: LOW QUALITY PROTEIN: polyadenylat...    165   3e-47   
gb|KJB07914.1|  hypothetical protein B456_001G052500                    165   3e-47   Gossypium raimondii
gb|KJB51353.1|  hypothetical protein B456_008G213100                    164   4e-47   Gossypium raimondii
ref|XP_002321779.2|  hypothetical protein POPTR_0015s12230g             165   4e-47   
ref|XP_006374586.1|  hypothetical protein POPTR_0015s12230g             165   4e-47   
gb|ACU17272.1|  unknown                                                 163   5e-47   Glycine max [soybeans]
gb|KJB51351.1|  hypothetical protein B456_008G213100                    164   6e-47   Gossypium raimondii
ref|XP_008353926.1|  PREDICTED: polyadenylate-binding protein 2-l...    164   8e-47   
gb|KHG11684.1|  Polyadenylate-binding 2                                 164   9e-47   Gossypium arboreum [tree cotton]
ref|XP_008353925.1|  PREDICTED: polyadenylate-binding protein 2-l...    164   9e-47   
gb|KJB51354.1|  hypothetical protein B456_008G213100                    164   9e-47   Gossypium raimondii
ref|XP_009344452.1|  PREDICTED: polyadenylate-binding protein 2 i...    164   1e-46   
ref|XP_009344451.1|  PREDICTED: polyadenylate-binding protein 2 i...    164   1e-46   Pyrus x bretschneideri [bai li]
gb|KHG12327.1|  Polyadenylate-binding 2                                 164   1e-46   Gossypium arboreum [tree cotton]
ref|XP_010917314.1|  PREDICTED: polyadenylate-binding protein 2-like    163   1e-46   Elaeis guineensis
ref|XP_004495250.1|  PREDICTED: polyadenylate-binding protein 2-l...    162   2e-46   
gb|KHN30707.1|  Polyadenylate-binding protein 2                         162   2e-46   Glycine soja [wild soybean]
ref|XP_004495249.1|  PREDICTED: polyadenylate-binding protein 2-l...    162   3e-46   
ref|XP_007144150.1|  hypothetical protein PHAVU_007G133000g             162   3e-46   Phaseolus vulgaris [French bean]
emb|CAN77560.1|  hypothetical protein VITISV_031100                     161   3e-46   Vitis vinifera
ref|XP_008804765.1|  PREDICTED: polyadenylate-binding protein 2-l...    162   6e-46   Phoenix dactylifera
ref|XP_008381986.1|  PREDICTED: polyadenylate-binding protein 2 i...    162   6e-46   Malus domestica [apple tree]
ref|XP_008453839.1|  PREDICTED: polyadenylate-binding protein 2-l...    161   1e-45   Cucumis melo [Oriental melon]
ref|XP_010933557.1|  PREDICTED: polyadenylate-binding protein 2-like    161   1e-45   Elaeis guineensis
ref|NP_001235474.1|  uncharacterized protein LOC100527139               160   2e-45   
gb|ACN41220.1|  unknown                                                 159   2e-45   Picea sitchensis
gb|KJB17317.1|  hypothetical protein B456_003G040800                    159   3e-45   Gossypium raimondii
ref|XP_008786202.1|  PREDICTED: polyadenylate-binding protein 2-like    160   3e-45   Phoenix dactylifera
ref|XP_003635560.2|  PREDICTED: polyadenylate-binding protein 2         159   4e-45   Vitis vinifera
gb|ABK21856.1|  unknown                                                 159   4e-45   Picea sitchensis
gb|KHG00394.1|  Polyadenylate-binding 2                                 159   5e-45   Gossypium arboreum [tree cotton]
gb|ACU24426.1|  unknown                                                 159   5e-45   Glycine max [soybeans]
gb|KJB17319.1|  hypothetical protein B456_003G040800                    159   5e-45   Gossypium raimondii
ref|XP_010267253.1|  PREDICTED: polyadenylate-binding protein 2         159   5e-45   Nelumbo nucifera [Indian lotus]
ref|NP_001237617.1|  uncharacterized protein LOC100527545               159   6e-45   
ref|XP_004146877.1|  PREDICTED: polyadenylate-binding protein 2-like    159   7e-45   Cucumis sativus [cucumbers]
ref|XP_010062822.1|  PREDICTED: polyadenylate-binding protein 2 i...    159   8e-45   Eucalyptus grandis [rose gum]
ref|XP_010536563.1|  PREDICTED: polyadenylate-binding protein 2         159   1e-44   Tarenaya hassleriana [spider flower]
ref|XP_006585263.1|  PREDICTED: polyadenylate-binding protein 2-A       158   1e-44   Glycine max [soybeans]
gb|KCW90905.1|  hypothetical protein EUGRSUZ_A02940                     159   1e-44   Eucalyptus grandis [rose gum]
ref|XP_010062812.1|  PREDICTED: polyadenylate-binding protein 2 i...    159   1e-44   Eucalyptus grandis [rose gum]
ref|XP_007047888.1|  RNA-binding (RRM/RBD/RNP motifs) family prot...    158   1e-44   
ref|XP_010937392.1|  PREDICTED: polyadenylate-binding protein 2 i...    158   1e-44   Elaeis guineensis
ref|XP_011084771.1|  PREDICTED: polyadenylate-binding protein 1-like    158   1e-44   Sesamum indicum [beniseed]
ref|XP_009404041.1|  PREDICTED: polyadenylate-binding protein 2-l...    158   1e-44   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010523297.1|  PREDICTED: polyadenylate-binding protein 2-like    157   2e-44   Tarenaya hassleriana [spider flower]
ref|XP_004504101.1|  PREDICTED: polyadenylate-binding protein 2-A...    158   2e-44   Cicer arietinum [garbanzo]
ref|XP_002306300.1|  hypothetical protein POPTR_0005s07440g             158   2e-44   Populus trichocarpa [western balsam poplar]
ref|XP_011031058.1|  PREDICTED: polyadenylate-binding protein 3-l...    157   2e-44   Populus euphratica
ref|XP_006366227.1|  PREDICTED: polyadenylate-binding protein 2-A...    157   2e-44   Solanum tuberosum [potatoes]
ref|XP_007148398.1|  hypothetical protein PHAVU_006G205100g             157   3e-44   Phaseolus vulgaris [French bean]
ref|XP_010519384.1|  PREDICTED: polyadenylate-binding protein 2-l...    157   3e-44   Tarenaya hassleriana [spider flower]
ref|XP_008453809.1|  PREDICTED: polyadenylate-binding protein 2 i...    157   3e-44   
ref|XP_009140879.1|  PREDICTED: polyadenylate-binding protein 2-like    157   3e-44   Brassica rapa
ref|XP_009404040.1|  PREDICTED: polyadenylate-binding protein 2-l...    157   3e-44   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006838494.1|  hypothetical protein AMTR_s00002p00165660          157   3e-44   
gb|AFK45716.1|  unknown                                                 157   4e-44   Lotus japonicus
ref|XP_002309968.1|  hypothetical protein POPTR_0007s05140g             157   4e-44   Populus trichocarpa [western balsam poplar]
ref|XP_011022817.1|  PREDICTED: polyadenylate-binding protein 2-l...    157   4e-44   Populus euphratica
gb|AFK37159.1|  unknown                                                 157   4e-44   Lotus japonicus
gb|KJB19596.1|  hypothetical protein B456_003G110600                    157   4e-44   Gossypium raimondii
ref|XP_002511038.1|  polyadenylate-binding protein, putative            157   5e-44   
emb|CDX71690.1|  BnaC09g27310D                                          157   6e-44   
ref|XP_008777640.1|  PREDICTED: polyadenylate-binding protein 2-like    157   6e-44   Phoenix dactylifera
gb|AFK33976.1|  unknown                                                 155   6e-44   Medicago truncatula
ref|XP_004164242.1|  PREDICTED: polyadenylate-binding protein 2-like    156   7e-44   
ref|XP_002531675.1|  poly-A binding protein, putative                   156   1e-43   Ricinus communis
gb|EYU20156.1|  hypothetical protein MIMGU_mgv1a008942mg                159   1e-43   Erythranthe guttata [common monkey flower]
gb|KGN53209.1|  hypothetical protein Csa_4G026860                       156   1e-43   Cucumis sativus [cucumbers]
ref|XP_009132625.1|  PREDICTED: polyadenylate-binding protein 2-like    156   1e-43   Brassica rapa
ref|XP_010937393.1|  PREDICTED: polyadenylate-binding protein 2 i...    155   1e-43   Elaeis guineensis
ref|XP_006353217.1|  PREDICTED: polyadenylate-binding protein 2-A...    155   2e-43   Solanum tuberosum [potatoes]
ref|XP_007042909.1|  RNA-binding family protein isoform 1               154   2e-43   Theobroma cacao [chocolate]
ref|XP_004143458.1|  PREDICTED: polyadenylate-binding protein 2-like    155   2e-43   Cucumis sativus [cucumbers]
gb|AFJ66183.1|  hypothetical protein 11M19.19                           155   2e-43   Arabidopsis halleri
ref|XP_002864097.1|  hypothetical protein ARALYDRAFT_918145             155   3e-43   Arabidopsis lyrata subsp. lyrata
ref|XP_003608452.1|  Polyadenylate-binding protein                      154   3e-43   Medicago truncatula
ref|NP_001240115.1|  uncharacterized protein LOC100784473               154   3e-43   Glycine max [soybeans]
gb|KHN29042.1|  Polyadenylate-binding protein 2                         154   3e-43   Glycine soja [wild soybean]
ref|XP_010027916.1|  PREDICTED: polyadenylate-binding protein 2 i...    155   3e-43   Eucalyptus grandis [rose gum]
ref|XP_006466250.1|  PREDICTED: polyadenylate-binding protein 2-like    154   3e-43   Citrus sinensis [apfelsine]
gb|AFK38116.1|  unknown                                                 154   3e-43   Medicago truncatula
ref|XP_004168611.1|  PREDICTED: polyadenylate-binding protein 2-like    154   4e-43   
ref|XP_004137160.1|  PREDICTED: polyadenylate-binding protein 2-like    154   4e-43   Cucumis sativus [cucumbers]
ref|XP_009127326.1|  PREDICTED: polyadenylate-binding protein 2-like    154   5e-43   Brassica rapa
gb|KGN53719.1|  hypothetical protein Csa_4G110060                       154   5e-43   Cucumis sativus [cucumbers]
ref|XP_007042910.1|  RNA-binding family protein isoform 2               153   5e-43   
ref|XP_008462875.1|  PREDICTED: polyadenylate-binding protein 2-l...    153   5e-43   Cucumis melo [Oriental melon]
ref|NP_568751.1|  polyadenylate-binding protein 1                       154   5e-43   Arabidopsis thaliana [mouse-ear cress]
gb|AAM61036.1|  contains similarity to poly(A)-binding protein II       154   5e-43   Arabidopsis thaliana [mouse-ear cress]
gb|KDO60716.1|  hypothetical protein CISIN_1g041633mg                   154   5e-43   Citrus sinensis [apfelsine]
emb|CDY16338.1|  BnaA02g11420D                                          154   6e-43   Brassica napus [oilseed rape]
ref|XP_010442595.1|  PREDICTED: polyadenylate-binding protein 2-like    154   6e-43   Camelina sativa [gold-of-pleasure]
ref|XP_006281051.1|  hypothetical protein CARUB_v10027069mg             154   6e-43   Capsella rubella
gb|KHG15936.1|  Polyadenylate-binding 2                                 153   7e-43   Gossypium arboreum [tree cotton]
ref|XP_008462873.1|  PREDICTED: polyadenylate-binding protein 2-l...    153   8e-43   Cucumis melo [Oriental melon]
gb|AGV54499.1|  RNA binding/nucleic acid binding                        154   8e-43   Phaseolus vulgaris [French bean]
gb|KJB47020.1|  hypothetical protein B456_008G016100                    153   8e-43   Gossypium raimondii
ref|NP_001239931.1|  uncharacterized protein LOC100791351               153   9e-43   Glycine max [soybeans]
ref|XP_006402013.1|  hypothetical protein EUTSA_v10014588mg             154   9e-43   Eutrema salsugineum [saltwater cress]
emb|CDY55162.1|  BnaCnng28280D                                          153   1e-42   Brassica napus [oilseed rape]
gb|KFK26726.1|  hypothetical protein AALP_AA8G284900                    153   1e-42   Arabis alpina [alpine rockcress]
ref|NP_001288928.1|  polyadenylate-binding protein 2                    153   1e-42   Brassica rapa
ref|XP_007159717.1|  hypothetical protein PHAVU_002G261500g             153   1e-42   Phaseolus vulgaris [French bean]
ref|XP_004504812.1|  PREDICTED: polyadenylate-binding protein 2-A...    154   1e-42   
dbj|BAA97374.1|  unnamed protein product                                154   1e-42   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006828070.1|  hypothetical protein AMTR_s00008p00267630          153   1e-42   Amborella trichopoda
gb|KFK25338.1|  hypothetical protein AALP_AA8G099700                    153   1e-42   Arabis alpina [alpine rockcress]
gb|AFK45960.1|  unknown                                                 151   1e-42   Lotus japonicus
ref|XP_004504815.1|  PREDICTED: polyadenylate-binding protein 2-A...    152   2e-42   Cicer arietinum [garbanzo]
ref|XP_010690525.1|  PREDICTED: polyadenylate-binding protein 3-l...    152   2e-42   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006394055.1|  hypothetical protein EUTSA_v10004890mg             152   2e-42   
ref|XP_010690526.1|  PREDICTED: polyadenylate-binding protein 2-l...    152   2e-42   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB17316.1|  hypothetical protein B456_003G040800                    151   2e-42   Gossypium raimondii
ref|XP_010030027.1|  PREDICTED: polyadenylate-binding protein 2-like    151   3e-42   Eucalyptus grandis [rose gum]
ref|XP_006394056.1|  hypothetical protein EUTSA_v10004890mg             152   3e-42   Eutrema salsugineum [saltwater cress]
ref|XP_009130503.1|  PREDICTED: polyadenylate-binding protein 2-like    152   3e-42   Brassica rapa
ref|XP_010680512.1|  PREDICTED: polyadenylate-binding protein 2         152   4e-42   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004504816.1|  PREDICTED: polyadenylate-binding protein 2-A...    151   4e-42   Cicer arietinum [garbanzo]
gb|ACU19123.1|  unknown                                                 151   4e-42   Glycine max [soybeans]
ref|NP_201329.1|  RNA recognition motif-containing protein              152   4e-42   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002866661.1|  polyadenylate-binding protein family protein       152   5e-42   Arabidopsis lyrata subsp. lyrata
gb|KFK28208.1|  hypothetical protein AALP_AA8G486500                    151   5e-42   Arabis alpina [alpine rockcress]
ref|XP_003525045.1|  PREDICTED: polyadenylate-binding protein 2 i...    151   6e-42   Glycine max [soybeans]
ref|XP_009390281.1|  PREDICTED: polyadenylate-binding protein 2-l...    151   6e-42   Musa acuminata subsp. malaccensis [pisang utan]
gb|ACJ84516.1|  unknown                                                 151   6e-42   Medicago truncatula
emb|CDY33952.1|  BnaC02g43850D                                          150   8e-42   Brassica napus [oilseed rape]
ref|XP_010463257.1|  PREDICTED: polyadenylate-binding protein 2-like    151   8e-42   Camelina sativa [gold-of-pleasure]
ref|XP_010484391.1|  PREDICTED: polyadenylate-binding protein 2-l...    151   8e-42   Camelina sativa [gold-of-pleasure]
ref|XP_010444551.1|  PREDICTED: polyadenylate-binding protein 2-l...    151   8e-42   Camelina sativa [gold-of-pleasure]
gb|KCW56970.1|  hypothetical protein EUGRSUZ_I02641                     150   9e-42   Eucalyptus grandis [rose gum]
gb|EYU35168.1|  hypothetical protein MIMGU_mgv1a013256mg                151   9e-42   Erythranthe guttata [common monkey flower]
ref|XP_010555595.1|  PREDICTED: polyadenylate-binding protein 2-like    151   1e-41   Tarenaya hassleriana [spider flower]
gb|KCW56969.1|  hypothetical protein EUGRSUZ_I02641                     151   1e-41   Eucalyptus grandis [rose gum]
ref|XP_009404039.1|  PREDICTED: polyadenylate-binding protein 2-l...    150   1e-41   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002323754.1|  hypothetical protein POPTR_0017s07850g             150   1e-41   Populus trichocarpa [western balsam poplar]
gb|EYU35167.1|  hypothetical protein MIMGU_mgv1a013256mg                150   1e-41   Erythranthe guttata [common monkey flower]
ref|XP_006279497.1|  hypothetical protein CARUB_v10027046mg             151   1e-41   
emb|CDX91567.1|  BnaC02g15930D                                          150   1e-41   
ref|XP_010094140.1|  Polyadenylate-binding protein 2                    149   2e-41   Morus notabilis
ref|XP_010676727.1|  PREDICTED: polyadenylate-binding protein 1-like    150   2e-41   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009390280.1|  PREDICTED: polyadenylate-binding protein 2-l...    150   2e-41   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009404038.1|  PREDICTED: polyadenylate-binding protein 2-l...    150   2e-41   Musa acuminata subsp. malaccensis [pisang utan]
gb|KCW56971.1|  hypothetical protein EUGRSUZ_I02641                     150   2e-41   Eucalyptus grandis [rose gum]
gb|AFK37484.1|  unknown                                                 149   3e-41   Lotus japonicus
emb|CDY33970.1|  BnaC02g43670D                                          149   3e-41   Brassica napus [oilseed rape]
ref|XP_004250109.1|  PREDICTED: polyadenylate-binding protein 2 i...    149   3e-41   
gb|EYU23964.1|  hypothetical protein MIMGU_mgv1a013628mg                149   5e-41   Erythranthe guttata [common monkey flower]
ref|XP_002983261.1|  hypothetical protein SELMODRAFT_117870             149   5e-41   
ref|XP_002873452.1|  polyadenylate-binding protein family protein       148   5e-41   
ref|NP_850803.1|  RNA recognition motif-containing protein              148   5e-41   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007047889.1|  RNA-binding (RRM/RBD/RNP motifs) family prot...    149   6e-41   
ref|NP_196597.1|  RNA recognition motif-containing protein              148   8e-41   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010937390.1|  PREDICTED: polyadenylate-binding protein 2 i...    149   9e-41   
ref|XP_011097543.1|  PREDICTED: polyadenylate-binding protein 2 i...    148   1e-40   Sesamum indicum [beniseed]
ref|XP_010444550.1|  PREDICTED: polyadenylate-binding protein 2-l...    148   1e-40   Camelina sativa [gold-of-pleasure]
ref|XP_009611267.1|  PREDICTED: polyadenylate-binding protein 2         148   1e-40   Nicotiana tomentosiformis
ref|XP_010484390.1|  PREDICTED: polyadenylate-binding protein 2-l...    148   1e-40   Camelina sativa [gold-of-pleasure]
ref|XP_002961293.1|  hypothetical protein SELMODRAFT_74095              148   1e-40   
ref|XP_009624759.1|  PREDICTED: polyadenylate-binding protein 2-like    147   2e-40   Nicotiana tomentosiformis
ref|XP_007159120.1|  hypothetical protein PHAVU_002G210300g             147   2e-40   Phaseolus vulgaris [French bean]
ref|XP_001752237.1|  predicted protein                                  145   3e-40   
ref|XP_002525843.1|  poly-A binding protein, putative                   146   3e-40   Ricinus communis
ref|XP_009776052.1|  PREDICTED: polyadenylate-binding protein 2-like    146   3e-40   Nicotiana sylvestris
gb|KJB79638.1|  hypothetical protein B456_013G060100                    146   4e-40   Gossypium raimondii
emb|CDP20626.1|  unnamed protein product                                146   4e-40   Coffea canephora [robusta coffee]
gb|KHG28448.1|  Polyadenylate-binding 2                                 145   5e-40   Gossypium arboreum [tree cotton]
gb|KJB79637.1|  hypothetical protein B456_013G060100                    145   5e-40   Gossypium raimondii
gb|KJB79639.1|  hypothetical protein B456_013G060100                    145   6e-40   Gossypium raimondii
ref|XP_010027917.1|  PREDICTED: polyadenylate-binding protein 2 i...    146   7e-40   Eucalyptus grandis [rose gum]
ref|XP_010937391.1|  PREDICTED: polyadenylate-binding protein 2 i...    145   1e-39   
gb|AHA84276.1|  polyadenylate-binding protein 2                         145   2e-39   Phaseolus vulgaris [French bean]
ref|XP_001784768.1|  predicted protein                                  145   2e-39   
gb|KDP40916.1|  hypothetical protein JCGZ_24915                         144   2e-39   Jatropha curcas
ref|XP_006399527.1|  hypothetical protein EUTSA_v10014635mg             143   6e-39   
ref|XP_004288178.1|  PREDICTED: polyadenylate-binding protein 2-like    143   8e-39   Fragaria vesca subsp. vesca
ref|XP_006399528.1|  hypothetical protein EUTSA_v10014635mg             143   9e-39   Eutrema salsugineum [saltwater cress]
ref|XP_009393548.1|  PREDICTED: polyadenylate-binding protein 2-like    143   9e-39   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_001784990.1|  predicted protein                                  142   2e-38   
ref|XP_006492630.1|  PREDICTED: polyadenylate-binding protein 2-l...    142   2e-38   Citrus sinensis [apfelsine]
ref|XP_011092431.1|  PREDICTED: polyadenylate-binding protein 2-l...    141   3e-38   Sesamum indicum [beniseed]
ref|XP_006359788.1|  PREDICTED: polyadenylate-binding protein 2-like    141   4e-38   Solanum tuberosum [potatoes]
ref|XP_004964966.1|  PREDICTED: polyadenylate-binding protein 2-l...    141   4e-38   Setaria italica
ref|NP_001057163.1|  Os06g0219600                                       141   4e-38   
ref|XP_004964965.1|  PREDICTED: polyadenylate-binding protein 2-l...    141   5e-38   Setaria italica
gb|ACF87534.1|  unknown                                                 140   8e-38   Zea mays [maize]
ref|XP_006655919.1|  PREDICTED: polyadenylate-binding protein 2-like    140   8e-38   Oryza brachyantha
ref|XP_002436725.1|  hypothetical protein SORBIDRAFT_10g007620          140   1e-37   Sorghum bicolor [broomcorn]
dbj|BAD17091.1|  putative poly(A) binding protein                       140   1e-37   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011092432.1|  PREDICTED: polyadenylate-binding protein 2-l...    139   1e-37   
ref|XP_002975089.1|  hypothetical protein SELMODRAFT_102545             140   2e-37   
ref|XP_001766601.1|  predicted protein                                  140   2e-37   
ref|NP_001048174.1|  Os02g0757900                                       139   2e-37   
ref|XP_004248796.1|  PREDICTED: polyadenylate-binding protein 2-like    139   2e-37   Solanum lycopersicum
ref|XP_009385628.1|  PREDICTED: polyadenylate-binding protein 2-l...    139   2e-37   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004953974.1|  PREDICTED: polyadenylate-binding protein 2-A...    139   2e-37   Setaria italica
ref|XP_009760239.1|  PREDICTED: polyadenylate-binding protein 2-like    139   2e-37   Nicotiana sylvestris
ref|XP_006288515.1|  hypothetical protein CARUB_v10001786mg             140   2e-37   
ref|NP_001132591.1|  uncharacterized protein LOC100194063               139   2e-37   Zea mays [maize]
ref|XP_006647930.1|  PREDICTED: polyadenylate-binding protein 2-A...    139   3e-37   Oryza brachyantha
ref|XP_006288516.1|  hypothetical protein CARUB_v10001786mg             140   3e-37   
ref|XP_004964967.1|  PREDICTED: polyadenylate-binding protein 2-l...    138   3e-37   Setaria italica
gb|KDO50216.1|  hypothetical protein CISIN_1g029268mg                   138   4e-37   Citrus sinensis [apfelsine]
ref|XP_009385630.1|  PREDICTED: polyadenylate-binding protein 2-l...    138   6e-37   
gb|EMT14995.1|  Polyadenylate-binding protein 2                         137   8e-37   
ref|XP_003570602.1|  PREDICTED: polyadenylate-binding protein 2-like    137   1e-36   Brachypodium distachyon [annual false brome]
ref|XP_002988978.1|  hypothetical protein SELMODRAFT_159820             136   1e-36   
ref|XP_009385631.1|  PREDICTED: polyadenylate-binding protein 2-l...    137   1e-36   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008658656.1|  PREDICTED: polyadenylate-binding protein 2 i...    137   2e-36   Zea mays [maize]
gb|ACR34224.1|  unknown                                                 136   2e-36   Zea mays [maize]
ref|NP_001149957.1|  polyadenylate-binding protein 2                    136   2e-36   
ref|XP_010491699.1|  PREDICTED: polyadenylate-binding protein 2-l...    136   3e-36   Camelina sativa [gold-of-pleasure]
gb|EMS52889.1|  Polyadenylate-binding protein 2                         135   3e-36   Triticum urartu
dbj|BAK03017.1|  predicted protein                                      136   4e-36   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010453061.1|  PREDICTED: polyadenylate-binding protein 2-like    136   5e-36   Camelina sativa [gold-of-pleasure]
ref|NP_001148500.1|  polyadenylate-binding protein 2                    135   6e-36   Zea mays [maize]
ref|XP_003564078.1|  PREDICTED: polyadenylate-binding protein 2-like    135   6e-36   Brachypodium distachyon [annual false brome]
gb|KDO50217.1|  hypothetical protein CISIN_1g029268mg                   134   6e-36   Citrus sinensis [apfelsine]
ref|XP_011043113.1|  PREDICTED: polyadenylate-binding protein 2-like    134   1e-35   Populus euphratica
ref|NP_001152340.1|  polyadenylate-binding protein 2                    134   1e-35   Zea mays [maize]
gb|EYU39126.1|  hypothetical protein MIMGU_mgv1a012968mg                135   1e-35   Erythranthe guttata [common monkey flower]
ref|XP_006492629.1|  PREDICTED: polyadenylate-binding protein 2-l...    134   1e-35   Citrus sinensis [apfelsine]
gb|AFW64407.1|  hypothetical protein ZEAMMB73_935050                    133   2e-35   
ref|XP_010491700.1|  PREDICTED: polyadenylate-binding protein 2-l...    134   3e-35   Camelina sativa [gold-of-pleasure]
ref|NP_001190511.1|  polyadenylate-binding protein 1                    134   7e-35   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011003864.1|  PREDICTED: polyadenylate-binding protein 2-l...    130   7e-34   Populus euphratica
ref|XP_011003863.1|  PREDICTED: polyadenylate-binding protein 2-l...    130   8e-34   Populus euphratica
ref|XP_002300187.2|  hypothetical protein POPTR_0001s31900g             130   2e-33   
gb|EPS71398.1|  hypothetical protein M569_03365                         128   4e-33   Genlisea aurea
ref|XP_011087906.1|  PREDICTED: polyadenylate-binding protein 2-like    125   6e-32   
gb|EMS59552.1|  Polyadenylate-binding protein 2                         125   2e-31   Triticum urartu
emb|CDY37814.1|  BnaAnng04750D                                          118   8e-30   Brassica napus [oilseed rape]
ref|XP_006681215.1|  hypothetical protein BATDEDRAFT_91010              119   8e-30   Batrachochytrium dendrobatidis JAM81
ref|XP_005848131.1|  hypothetical protein CHLNCDRAFT_13079              116   2e-29   Chlorella variabilis
gb|EXX59092.1|  Sgn1p                                                   117   4e-29   Rhizophagus irregularis DAOM 197198w
gb|ERZ96470.1|  hypothetical protein GLOINDRAFT_340629                  115   2e-28   
gb|KHG13063.1|  Polyadenylate-binding 2                                 114   7e-28   Gossypium arboreum [tree cotton]
ref|XP_010422853.1|  PREDICTED: polyadenylate-binding protein 2-like    114   9e-28   Camelina sativa [gold-of-pleasure]
ref|XP_001732185.1|  hypothetical protein MGL_0778                      113   2e-27   Malassezia globosa CBS 7966
ref|XP_008392810.1|  PREDICTED: polyadenylate-binding protein 2-like    111   3e-27   
emb|CDH52264.1|  polyadenylate-binding protein 2                        112   7e-27   Lichtheimia corymbifera JMRC:FSU:9682
emb|CDS05392.1|  Putative Apoptosis regulator BCL-W                     112   8e-27   
gb|EMT22397.1|  Polyadenylate-binding protein 2                         113   1e-26   
ref|XP_005642733.1|  RNA-binding domain-containing protein              110   3e-26   
ref|XP_004348410.1|  RNP domain-containing protein                      110   3e-26   
ref|XP_011076456.1|  PREDICTED: polyadenylate-binding protein 1 i...    108   4e-26   
gb|KDN47980.1|  RNA-binding domain-containing protein                   108   4e-26   
ref|XP_010109150.1|  Polyadenylate-binding protein 2                    112   5e-26   
emb|CEG73057.1|  Putative Apoptosis regulator BCL-W                     109   6e-26   
ref|XP_011397261.1|  Polyadenylate-binding protein 2                    108   7e-26   
emb|CDP19849.1|  unnamed protein product                                108   2e-25   
ref|XP_003320388.1|  apoptosis regulator BCL-W                          107   2e-25   
gb|EIE85121.1|  hypothetical protein RO3G_09831                         108   2e-25   
ref|XP_007406870.1|  hypothetical protein MELLADRAFT_29239              106   2e-25   
gb|KDO50215.1|  hypothetical protein CISIN_1g029268mg                   107   3e-25   
gb|EWC45754.1|  hypothetical protein DRE_05091                          105   3e-25   
ref|XP_011465382.1|  PREDICTED: polyadenylate-binding protein 2-like    107   4e-25   
ref|XP_003059453.1|  predicted protein                                  106   5e-25   
gb|KFY71846.1|  hypothetical protein V499_07986                         106   5e-25   
gb|ELR06322.1|  hypothetical protein GMDG_07913                         107   6e-25   
gb|KFH72006.1|  apoptosis regulator BCL-W                               107   6e-25   
ref|XP_011114836.1|  hypothetical protein H072_9232                     106   7e-25   
ref|XP_007877442.1|  hypothetical protein PFL1_01741                    106   7e-25   
gb|EHK41278.1|  hypothetical protein TRIATDRAFT_169914                  105   7e-25   
emb|CEG73059.1|  Putative Apoptosis regulator BCL-W                     105   7e-25   
ref|XP_006963218.1|  predicted protein                                  105   7e-25   
emb|CEP08917.1|  hypothetical protein                                   106   8e-25   
gb|EHK16606.1|  hypothetical protein TRIVIDRAFT_19040                   105   8e-25   
dbj|GAN11379.1|  RNA-binding domain-containing protein                  106   9e-25   
gb|KFY49971.1|  hypothetical protein V496_09680                         107   1e-24   
gb|ETS05648.1|  RNA-binding domain-containing protein                   105   1e-24   
emb|CEG73058.1|  Putative Apoptosis regulator BCL-W                     105   1e-24   
gb|EPB82254.1|  apoptosis regulator BCL-W                               105   1e-24   
dbj|GAC72494.1|  splicing factor RNPS1                                  104   1e-24   
ref|XP_008595140.1|  RNA recognition domain-containing protein          105   1e-24   
emb|CEI97024.1|  Putative Apoptosis regulator BCL-W                     105   2e-24   
ref|XP_011126610.1|  hypothetical protein AOL_s00188g59                 105   2e-24   
emb|CDI56456.1|  related to poly(a) binding protein II                  105   2e-24   
gb|EPZ34386.1|  RNA recognition motif domain-containing protein         104   2e-24   
gb|KDB12677.1|  putative rrm-type rna binding protein                   105   2e-24   
ref|NP_001190512.1|  polyadenylate-binding protein 1                    103   3e-24   
ref|XP_011388696.1|  hypothetical protein UMAG_02401                    105   3e-24   
gb|KID72233.1|  Nucleotide-binding, alpha-beta plait                    104   3e-24   
ref|XP_001696457.1|  poly(A) binding protein                            103   3e-24   
ref|XP_007816217.1|  RNA recognition motif domain protein               104   3e-24   
gb|KID85880.1|  Nucleotide-binding, alpha-beta plait                    105   3e-24   
gb|KDQ10044.1|  hypothetical protein BOTBODRAFT_504849                  105   3e-24   
ref|XP_007814073.1|  putative rrm-type rna binding protein              104   3e-24   
gb|ETS60884.1|  hypothetical protein PaG_04803                          105   3e-24   
gb|KDD72350.1|  hypothetical protein H632_c3475p0                       103   3e-24   
gb|KFY15058.1|  hypothetical protein V492_02252                         104   3e-24   
gb|EQL03995.1|  Nucleotide-binding, alpha-beta plait                    104   3e-24   
ref|XP_003050726.1|  hypothetical protein NECHADRAFT_40692              103   3e-24   
emb|CBQ71145.1|  related to poly(a) binding protein II                  105   3e-24   
gb|EPQ65817.1|  Cytoplasmic RNA-binding protein                         103   4e-24   
gb|KFH40681.1|  Polyadenylate-binding protein-like protein              104   4e-24   
gb|EST05917.1|  hypothetical protein PSEUBRA_SCAF4g05044                104   4e-24   
ref|XP_001595617.1|  hypothetical protein SS1G_03706                    104   4e-24   
gb|KID97040.1|  Nucleotide-binding, alpha-beta plait                    104   4e-24   
emb|CCU78358.1|  RNP domain-containing protein                          103   4e-24   
gb|KGQ04114.1|  Polyadenylate-binding protein 2                         106   4e-24   
gb|KFY15668.1|  hypothetical protein V491_05603                         103   4e-24   
dbj|GAK64008.1|  RNP domain protein                                     105   5e-24   
ref|XP_001554468.1|  hypothetical protein BC1G_07056                    103   5e-24   
gb|KDQ64824.1|  hypothetical protein JAAARDRAFT_238798                  103   6e-24   
gb|EWG40618.1|  hypothetical protein FVEG_02944                         103   6e-24   
ref|XP_002585092.1|  polyadenylate-binding protein 2                    103   6e-24   
ref|XP_003070263.1|  RNA recognition motif containing protein           103   6e-24   
gb|EWY90483.1|  hypothetical protein FOYG_07986                         102   7e-24   
ref|XP_008357091.1|  PREDICTED: polyadenylate-binding protein 2-like    101   7e-24   
gb|KHN96368.1|  Nucleotide-binding, alpha-beta plait                    103   7e-24   
ref|XP_008368037.1|  PREDICTED: polyadenylate-binding protein 2-like    101   7e-24   
emb|CCE29353.1|  probable RRM-type RNA binding protein                  103   8e-24   
gb|KFX86176.1|  hypothetical protein V490_09189                         103   8e-24   
gb|KFY82085.1|  hypothetical protein V500_10835                         103   9e-24   
gb|EXL56557.1|  hypothetical protein FOCG_04128                         102   9e-24   
emb|CDM30120.1|  Nucleotide-binding, alpha-beta plait                   103   9e-24   
gb|KGO35980.1|  Nucleotide-binding, alpha-beta plait                    103   9e-24   
gb|KFY23862.1|  hypothetical protein V493_05584                         103   9e-24   
emb|CCF54292.1|  related to poly(a) binding protein II                  103   9e-24   
gb|KFA62833.1|  hypothetical protein S40285_03795                       103   1e-23   
ref|XP_001243223.1|  hypothetical protein CIMG_07119                    103   1e-23   
gb|KEY69986.1|  hypothetical protein S7711_04004                        103   1e-23   
gb|KGO68009.1|  Nucleotide-binding, alpha-beta plait                    103   1e-23   
gb|KIN06582.1|  hypothetical protein OIDMADRAFT_17387                   103   1e-23   
ref|XP_002560647.1|  Pc16g02770                                         103   1e-23   
gb|EKV12642.1|  hypothetical protein PDIG_42430                         102   1e-23   
ref|XP_003008784.1|  polyadenylate-binding protein                      103   1e-23   
gb|EEH41573.2|  hypothetical protein PAAG_03136                         103   1e-23   
gb|KFZ16430.1|  hypothetical protein V502_05098                         103   2e-23   
ref|XP_010273013.1|  PREDICTED: polyadenylate-binding protein 2 i...    101   2e-23   
ref|XP_010273012.1|  PREDICTED: polyadenylate-binding protein 2 i...    101   2e-23   
ref|XP_006666314.1|  RNP domain-containing protein                      102   2e-23   
ref|XP_002842152.1|  hypothetical protein                               102   2e-23   
ref|XP_007364279.1|  RNA-binding domain-containing protein              102   2e-23   
ref|XP_009649746.1|  polyadenylate-binding protein                      102   2e-23   
gb|ELQ32355.1|  polyadenylate-binding protein 2                         102   2e-23   
emb|CCT68449.1|  probable RRM-type RNA binding protein                  102   2e-23   
gb|EWG40616.1|  hypothetical protein FVEG_02944                         102   2e-23   
gb|ACG38228.1|  polyadenylate-binding protein 2                         102   2e-23   
emb|CCU99426.1|  unnamed protein product                                102   2e-23   
dbj|GAA87517.1|  RNP domain protein                                     102   2e-23   
gb|EGU87076.1|  hypothetical protein FOXB_02470                         102   2e-23   
ref|XP_007295841.1|  polyadenylate-binding protein 2                    102   2e-23   
ref|XP_001269310.1|  RNP domain protein                                 102   3e-23   
ref|XP_004504814.1|  PREDICTED: polyadenylate-binding protein 2-A...    102   3e-23   
gb|AFW64403.1|  polyadenylate-binding protein 2                         102   3e-23   
ref|XP_007914907.1|  putative polyadenylate-binding protein 2 pro...    102   3e-23   
gb|EMR89231.1|  putative polyadenylate-binding protein 2 protein        103   3e-23   
ref|XP_007382197.1|  RNA-binding domain-containing protein              102   3e-23   
gb|EXL56554.1|  hypothetical protein FOCG_04128                         102   3e-23   
ref|XP_008034922.1|  polyadenylate-binding protein 2                    102   3e-23   
ref|XP_001217158.1|  polyadenylate-binding protein 2                    101   3e-23   
ref|XP_002341352.1|  RNP domain protein                                 101   4e-23   
gb|EHA17785.1|  hypothetical protein ASPNIDRAFT_55885                   101   4e-23   
gb|EEH07148.1|  RNP domain-containing protein                           100   4e-23   
ref|XP_001264816.1|  RNP domain protein                                 101   4e-23   
ref|XP_007874495.1|  hypothetical protein PNEG_02486                    101   4e-23   
ref|XP_002144201.1|  RNP domain protein                                 101   4e-23   
gb|EPS32063.1|  hypothetical protein PDE_07022                          101   4e-23   
ref|XP_001392222.1|  polyadenylate-binding protein 2                    101   5e-23   
ref|XP_002794591.1|  hypothetical protein PAAG_03136                    101   5e-23   
ref|XP_003715472.1|  polyadenylate-binding protein 2                    101   5e-23   
ref|XP_752316.1|  RNP domain protein                                    102   5e-23   
gb|EFW99173.1|  rnp domain containing protein                           101   5e-23   
emb|CEJ88515.1|  Putative Polyadenylate-binding protein 2               102   6e-23   
ref|XP_001727864.1|  polyadenylate-binding protein 2                    101   6e-23   
dbj|GAC98641.1|  hypothetical protein PHSY_006235                       106   6e-23   
emb|CCG84821.1|  protein of unknown function                            100   6e-23   
gb|EQB57479.1|  RNA recognition domain-containing protein               101   7e-23   
gb|EYE92492.1|  RNA-binding domain-containing protein                   100   7e-23   
emb|CCX34955.1|  Similar to Polyadenylate-binding protein 2; acc....    101   7e-23   
ref|XP_007581018.1|  putative rnp domain protein                        100   7e-23   
gb|ESZ97421.1|  RNP domain-containing protein                           101   7e-23   
emb|CBI26591.3|  unnamed protein product                              99.8    7e-23   
gb|KEZ45213.1|  hypothetical protein SAPIO_CDS2677                      100   8e-23   
gb|EGC41240.1|  RNP domain-containing protein                           100   8e-23   
gb|EYB28785.1|  hypothetical protein FG05_10271                         101   8e-23   
ref|XP_007778127.1|  hypothetical protein W97_02035                     100   8e-23   
ref|XP_006694990.1|  putative poly(A) binding protein                   101   8e-23   
ref|XP_009254994.1|  hypothetical protein FPSE_03600                    101   8e-23   
ref|XP_011319224.1|  polyadenylate-binding protein 2                    101   8e-23   
gb|EJW84124.1|  hypothetical protein WUBG_04965                         101   8e-23   
gb|KIL96308.1|  hypothetical protein FAVG1_01052                        101   9e-23   
gb|KIY49578.1|  hypothetical protein FISHEDRAFT_41201                   102   9e-23   
ref|XP_002627705.1|  RNP domain-containing protein                      100   9e-23   
ref|XP_003139219.1|  pabpn1-prov protein                                101   9e-23   
ref|XP_002464918.1|  hypothetical protein SORBIDRAFT_01g028780          101   9e-23   
ref|XP_007275489.1|  rnp domain protein                                 101   1e-22   
ref|XP_001901242.1|  pabpn1-prov protein                                101   1e-22   
ref|XP_007392270.1|  hypothetical protein PHACADRAFT_250387             100   1e-22   
gb|EER45291.1|  RNP domain-containing protein                           100   1e-22   
ref|XP_658944.1|  hypothetical protein AN1340.2                         100   1e-22   
ref|XP_007925064.1|  hypothetical protein MYCFIDRAFT_122613             100   1e-22   
gb|EKG21444.1|  hypothetical protein MPH_01242                          100   1e-22   
ref|XP_003304145.1|  hypothetical protein PTT_16602                     100   1e-22   
ref|XP_009216294.1|  polyadenylate-binding protein 2                    100   1e-22   
ref|XP_008370300.1|  PREDICTED: uncharacterized protein LOC103433759    100   1e-22   
ref|XP_006423797.1|  hypothetical protein CICLE_v100293173mg          97.4    2e-22   
emb|CCJ30944.1|  unnamed protein product                              99.4    2e-22   
ref|XP_001903913.1|  hypothetical protein                               100   2e-22   
gb|EGE06758.1|  RNP domain-containing protein                         97.8    2e-22   
emb|CDH52263.1|  polyadenylate-binding protein 2                        100   2e-22   
emb|CCF35443.1|  RNA recognition domain-containing protein              100   2e-22   
gb|EEC80241.1|  hypothetical protein OsI_22184                          100   2e-22   
ref|XP_001934161.1|  polyadenylate-binding protein 2 (Poly(A)-bin...    100   2e-22   
ref|XP_007595402.1|  RNA recognition domain-containing protein        99.8    2e-22   
ref|XP_009854497.1|  hypothetical protein NEUTE1DRAFT_69316             100   2e-22   
gb|KHE86315.1|  RNA-binding domain-containing protein                   100   2e-22   
ref|XP_007675424.1|  hypothetical protein BAUCODRAFT_68306              100   2e-22   
ref|XP_799120.2|  PREDICTED: polyadenylate-binding protein 2-like       100   3e-22   
ref|XP_003021492.1|  small subunit of nuclear cap-binding protein...  97.8    3e-22   
emb|CDQ02436.1|  Protein Bm2265, isoform f                              100   3e-22   
ref|XP_001795538.1|  hypothetical protein SNOG_05129                  99.8    3e-22   
gb|ENH81968.1|  polyadenylate-binding protein 2                       99.4    3e-22   
gb|EFQ35020.1|  RNA recognition domain-containing protein             99.4    3e-22   
ref|XP_007861628.1|  RNA-binding domain-containing protein            98.2    3e-22   
ref|XP_006818400.1|  PREDICTED: polyadenylate-binding protein 2-B...    100   3e-22   
gb|KHJ35028.1|  putative rnp domain-containing protein                99.4    3e-22   
ref|XP_002736265.1|  PREDICTED: polyadenylate-binding protein 2-B...    100   3e-22   
gb|KDN61321.1|  putative RNA recognition domain-containing protein    99.4    3e-22   
ref|XP_011394887.1|  polyadenylate-binding protein 2                  99.8    4e-22   
gb|EGZ67999.1|  RNA-binding domain-containing protein                 99.8    4e-22   
ref|XP_003835384.1|  hypothetical protein LEMA_P047250.1              99.0    4e-22   
ref|XP_007839899.1|  hypothetical protein PFICI_13127                 99.0    4e-22   
ref|XP_009066493.1|  hypothetical protein LOTGIDRAFT_96385            97.8    5e-22   
ref|XP_003344835.1|  hypothetical protein SMAC_06118                  99.4    5e-22   
gb|EZF30937.1|  hypothetical protein H101_05428                       98.6    5e-22   
ref|XP_003169098.1|  polyadenylate-binding protein 2                  98.6    5e-22   
ref|XP_003235832.1|  hypothetical protein TERG_02884                  98.6    5e-22   
ref|XP_003848243.1|  hypothetical protein MYCGRDRAFT_77177            99.0    5e-22   
gb|EGD94005.1|  hypothetical protein TESG_01534                       98.6    6e-22   
ref|XP_006358185.1|  PREDICTED: polyadenylate-binding protein 2-l...  97.8    6e-22   
gb|KIM45824.1|  hypothetical protein M413DRAFT_440868                 98.6    6e-22   
dbj|GAM82894.1|  hypothetical protein ANO11243_008800                 98.6    6e-22   
ref|XP_010318203.1|  PREDICTED: polyadenylate-binding protein 2-like  97.4    6e-22   
ref|XP_007787071.1|  hypothetical protein EPUS_04605                  98.6    6e-22   
gb|KEQ73418.1|  RNA-binding domain-containing protein                 98.6    6e-22   
ref|XP_003650887.1|  hypothetical protein THITE_2110808               98.6    6e-22   
gb|KIY67350.1|  hypothetical protein CYLTODRAFT_437062                  100   6e-22   
gb|KEQ87750.1|  RNA-binding domain-containing protein                 98.6    7e-22   
gb|KEQ62759.1|  RNA-binding domain-containing protein                 98.6    7e-22   
ref|XP_002842664.1|  RNP domain-containing protein                    98.2    7e-22   
gb|KJA24508.1|  hypothetical protein HYPSUDRAFT_38545                 98.6    7e-22   
ref|XP_008078466.1|  RNA-binding, RBD                                 98.2    7e-22   
ref|XP_002267022.2|  PREDICTED: polyadenylate-binding protein 2       96.3    8e-22   
emb|CDH52265.1|  polyadenylate-binding protein 2                      98.2    1e-21   
gb|EME44671.1|  hypothetical protein DOTSEDRAFT_72205                 98.6    1e-21   
ref|XP_007692380.1|  hypothetical protein COCMIDRAFT_107059           98.2    1e-21   
ref|XP_011436331.1|  PREDICTED: polyadenylate-binding protein 2-B...  98.2    1e-21   
emb|CCM02820.1|  predicted protein                                    99.0    1e-21   
ref|XP_008021062.1|  hypothetical protein SETTUDRAFT_162632           97.8    1e-21   
ref|XP_009016949.1|  hypothetical protein HELRODRAFT_156918           98.2    1e-21   
ref|XP_007337763.1|  RNA-binding domain-containing protein            96.7    2e-21   
gb|ERT01824.1|  hypothetical protein HMPREF1624_00118                 97.4    2e-21   
gb|AFW71284.1|  hypothetical protein ZEAMMB73_459562                  98.2    2e-21   
ref|XP_006459888.1|  hypothetical protein AGABI2DRAFT_68353           99.4    2e-21   
gb|KFZ01785.1|  hypothetical protein V501_09799                         102   2e-21   
ref|XP_002273141.1|  PREDICTED: polyadenylate-binding protein 2-l...  97.1    2e-21   
gb|EKC42587.1|  Polyadenylate-binding protein 2                       98.2    2e-21   
ref|XP_007329630.1|  hypothetical protein AGABI1DRAFT_100088          99.4    2e-21   
ref|XP_003013913.1|  small subunit of nuclear cap-binding protein...  99.0    2e-21   



>ref|XP_004307764.1| PREDICTED: polyadenylate-binding protein 1 [Fragaria vesca subsp. 
vesca]
Length=219

 Score =   179 bits (454),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 96/128 (75%), Positives = 107/128 (84%), Gaps = 1/128 (1%)
 Frame = +1

Query  169  EQEEDVYGGEFPeegdmdadvdmaalaeaeaqedPNAKQDLENMKKRLKEIEEEAGALRE  348
            + E +VYGGE P +   D D+   A  + +  +DPN+K+ LE+MKKRLKEIEEEAGALR+
Sbjct  4    QSEHEVYGGEIPADDGEDVDMASRADDDQDYTDDPNSKE-LEDMKKRLKEIEEEAGALRD  62

Query  349  MQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRV  528
            MQAKVEKEM  VQDPN  SASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRV
Sbjct  63   MQAKVEKEMGAVQDPNGGSASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRV  122

Query  529  TILTDKFG  552
            TILTDKFG
Sbjct  123  TILTDKFG  130



>gb|KDP22495.1| hypothetical protein JCGZ_26326 [Jatropha curcas]
Length=223

 Score =   177 bits (450),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 102/128 (80%), Positives = 115/128 (90%), Gaps = 1/128 (1%)
 Frame = +1

Query  169  EQEEDVYGGEFPeegdmdadvdmaalaeaeaqedPNAKQDLENMKKRLKEIEEEAGALRE  348
            EQE +VYG E P+EG+MDAD+DM++  E +  + PN+K DLE+MKKRLKEIEEEAGALRE
Sbjct  6    EQEHEVYGSEIPDEGEMDADIDMSSRLEEDEDQGPNSK-DLEDMKKRLKEIEEEAGALRE  64

Query  349  MQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRV  528
            MQAKVEKEM  VQD ++ASA+QAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRV
Sbjct  65   MQAKVEKEMGAVQDSSSASATQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRV  124

Query  529  TILTDKFG  552
            TILTDKFG
Sbjct  125  TILTDKFG  132



>ref|XP_008234027.1| PREDICTED: polyadenylate-binding protein 2 [Prunus mume]
Length=219

 Score =   174 bits (441),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 93/128 (73%), Positives = 108/128 (84%), Gaps = 1/128 (1%)
 Frame = +1

Query  169  EQEEDVYGGEFPeegdmdadvdmaalaeaeaqedPNAKQDLENMKKRLKEIEEEAGALRE  348
            +QE +VYGGE P +   D D+   A  + +  +DPN+K +LE+MKKRLKEIEEEAGALR+
Sbjct  4    QQEHEVYGGEIPADDGEDVDMSSRADDDQDYNDDPNSK-ELEDMKKRLKEIEEEAGALRD  62

Query  349  MQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRV  528
            MQAKVEKEM  VQD ++ SA+QAEKEEVD+RSIYVGNVDYACTPEEVQQHFQSCGTVNRV
Sbjct  63   MQAKVEKEMGAVQDSSSGSATQAEKEEVDSRSIYVGNVDYACTPEEVQQHFQSCGTVNRV  122

Query  529  TILTDKFG  552
            TILTDKFG
Sbjct  123  TILTDKFG  130



>ref|NP_001275811.1| poly(A)-binding protein 1 [Citrus sinensis]
 gb|AEN74948.1| poly(A)-binding protein 1 [Citrus sinensis]
Length=234

 Score =   173 bits (439),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 100/140 (71%), Positives = 110/140 (79%), Gaps = 12/140 (9%)
 Frame = +1

Query  169  EQEEDVYGGEFP-----------eegdmdadvdmaalaeaeaqedPNAK-QDLENMKKRL  312
            EQE DVYGGE P            E + D D +    A+ E +EDPNA  +DLE+MKKRL
Sbjct  6    EQEHDVYGGEIPDEMDADIDVDEHEHEHDQDHEHEHDADNENEEDPNANSKDLEDMKKRL  65

Query  313  KEIEEEAGALREMQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQ  492
            KEIEEEAGALREMQAKVEKEM  VQD ++ SA+QAEKEEVD+RSIYVGNVDYACTPEEVQ
Sbjct  66   KEIEEEAGALREMQAKVEKEMGAVQDSSSTSATQAEKEEVDSRSIYVGNVDYACTPEEVQ  125

Query  493  QHFQSCGTVNRVTILTDKFG  552
            QHFQSCGTVNRVTILTDKFG
Sbjct  126  QHFQSCGTVNRVTILTDKFG  145



>ref|XP_010269828.1| PREDICTED: polyadenylate-binding protein 2-like [Nelumbo nucifera]
Length=231

 Score =   172 bits (437),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 99/128 (77%), Positives = 112/128 (88%), Gaps = 5/128 (4%)
 Frame = +1

Query  169  EQEEDVYGGEFPeegdmdadvdmaalaeaeaqedPNAKQDLENMKKRLKEIEEEAGALRE  348
            EQE +VYGGE P+ G+MDADV+     E +    PN+K +LE+MKKRLKEIEEEAGALRE
Sbjct  18   EQEHEVYGGEIPDYGEMDADVEFPGDEEVD----PNSK-NLEDMKKRLKEIEEEAGALRE  72

Query  349  MQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRV  528
            MQAKVEKEM  VQDP++A+A+QAEKEEVD+RSIYVGNVDYACTPEEVQQHFQSCGTVNRV
Sbjct  73   MQAKVEKEMGIVQDPSSAAATQAEKEEVDSRSIYVGNVDYACTPEEVQQHFQSCGTVNRV  132

Query  529  TILTDKFG  552
            TILTDKFG
Sbjct  133  TILTDKFG  140



>ref|XP_004235203.1| PREDICTED: polyadenylate-binding protein 2 [Solanum lycopersicum]
Length=224

 Score =   172 bits (436),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 96/128 (75%), Positives = 102/128 (80%), Gaps = 3/128 (2%)
 Frame = +1

Query  169  EQEEDVYGGEFPeegdmdadvdmaalaeaeaqedPNAKQDLENMKKRLKEIEEEAGALRE  348
            E E +VYGGE P+E          + A     + PNAK+ LENMKKRLKEIE+EAGALRE
Sbjct  11   EHEHEVYGGEIPDEEGEMDAEYDTSAAAESEDD-PNAKE-LENMKKRLKEIEDEAGALRE  68

Query  349  MQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRV  528
            MQAKVEKEM   QDP A SASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRV
Sbjct  69   MQAKVEKEMGSAQDPTA-SASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRV  127

Query  529  TILTDKFG  552
            TILTDKFG
Sbjct  128  TILTDKFG  135



>ref|XP_006376950.1| hypothetical protein POPTR_0012s11480g [Populus trichocarpa]
 gb|ERP54747.1| hypothetical protein POPTR_0012s11480g [Populus trichocarpa]
Length=226

 Score =   171 bits (434),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 101/123 (82%), Positives = 112/123 (91%), Gaps = 1/123 (1%)
 Frame = +1

Query  184  VYGGEFPeegdmdadvdmaalaeaeaqedPNAKQDLENMKKRLKEIEEEAGALREMQAKV  363
            VYGGE P+EG+MDADVDM++ AE +  +DPN+K DLE+MKKRLKEIEEEAGALREMQAKV
Sbjct  16   VYGGEIPDEGEMDADVDMSSRAEEDEYQDPNSK-DLEDMKKRLKEIEEEAGALREMQAKV  74

Query  364  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  543
            EKEM  VQD   ASA+QAEKEEVD+RSIYVGNVDY+CTPEEVQQHFQSCGTVNRVTILTD
Sbjct  75   EKEMGAVQDSPGASATQAEKEEVDSRSIYVGNVDYSCTPEEVQQHFQSCGTVNRVTILTD  134

Query  544  KFG  552
            KFG
Sbjct  135  KFG  137



>ref|XP_011003544.1| PREDICTED: polyadenylate-binding protein 1-like [Populus euphratica]
Length=226

 Score =   171 bits (434),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 101/123 (82%), Positives = 112/123 (91%), Gaps = 1/123 (1%)
 Frame = +1

Query  184  VYGGEFPeegdmdadvdmaalaeaeaqedPNAKQDLENMKKRLKEIEEEAGALREMQAKV  363
            VYGGE P+EG+MDADVDM++ AE +  +DPN+K DLE+MKKRLKEIEEEAGALREMQAKV
Sbjct  16   VYGGEIPDEGEMDADVDMSSRAEEDEYQDPNSK-DLEDMKKRLKEIEEEAGALREMQAKV  74

Query  364  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  543
            EKEM  VQD   ASA+QAEKEEVD+RSIYVGNVDY+CTPEEVQQHFQSCGTVNRVTILTD
Sbjct  75   EKEMGAVQDSPGASATQAEKEEVDSRSIYVGNVDYSCTPEEVQQHFQSCGTVNRVTILTD  134

Query  544  KFG  552
            KFG
Sbjct  135  KFG  137



>ref|XP_006374587.1| hypothetical protein POPTR_0015s12230g [Populus trichocarpa]
 gb|ERP52384.1| hypothetical protein POPTR_0015s12230g [Populus trichocarpa]
Length=226

 Score =   171 bits (434),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 99/123 (80%), Positives = 111/123 (90%), Gaps = 1/123 (1%)
 Frame = +1

Query  184  VYGGEFPeegdmdadvdmaalaeaeaqedPNAKQDLENMKKRLKEIEEEAGALREMQAKV  363
            VYGGE P+EG+MDAD DM++ AE +  +DPN+K DLE+MK+RLKEIEEEAGALREMQAKV
Sbjct  16   VYGGEIPDEGEMDADADMSSRAEEDEYQDPNSK-DLEDMKRRLKEIEEEAGALREMQAKV  74

Query  364  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  543
            EKEM  VQD   ASA+QAEKEEVD+RSIYVGNVDY+CTPEEVQQHFQSCGTVNRVTILTD
Sbjct  75   EKEMGAVQDSPGASATQAEKEEVDSRSIYVGNVDYSCTPEEVQQHFQSCGTVNRVTILTD  134

Query  544  KFG  552
            KFG
Sbjct  135  KFG  137



>ref|XP_009631161.1| PREDICTED: polyadenylate-binding protein 2 [Nicotiana tomentosiformis]
 ref|XP_009764085.1| PREDICTED: polyadenylate-binding protein 2-like [Nicotiana sylvestris]
Length=224

 Score =   171 bits (434),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 96/123 (78%), Positives = 103/123 (84%), Gaps = 2/123 (2%)
 Frame = +1

Query  184  VYGGEFPeegdmdadvdmaalaeaeaqedPNAKQDLENMKKRLKEIEEEAGALREMQAKV  363
            VYGG+ P+E            A AE+++DPNAK+ LENMKKRLKEIE+EAGALREMQAKV
Sbjct  15   VYGGDIPDEEGEMDAEYDETSAAAESEDDPNAKE-LENMKKRLKEIEDEAGALREMQAKV  73

Query  364  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  543
            EKEM   QDP A SASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD
Sbjct  74   EKEMGSAQDPTA-SASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  132

Query  544  KFG  552
            KFG
Sbjct  133  KFG  135



>ref|XP_006437033.1| hypothetical protein CICLE_v10032621mg [Citrus clementina]
 gb|ESR50273.1| hypothetical protein CICLE_v10032621mg [Citrus clementina]
 gb|KDO57709.1| hypothetical protein CISIN_1g027515mg [Citrus sinensis]
Length=222

 Score =   171 bits (433),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 101/142 (71%), Positives = 111/142 (78%), Gaps = 14/142 (10%)
 Frame = +1

Query  169  EQEEDVYGGEFPeegdm-------------dadvdmaalaeaeaqedPNA-KQDLENMKK  306
            EQE DVYGGE P+E D              D D +    A+ E +EDPNA  +DLE+MKK
Sbjct  6    EQEHDVYGGEIPDEMDADIDVDEHEHEHDHDHDHEHEHDADNENEEDPNANSKDLEDMKK  65

Query  307  RLKEIEEEAGALREMQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEE  486
            RLKEIEEEAGALREMQAKVEKEM  VQD ++ SA+QAEKEEVD+RSIYVGNVDYACTPEE
Sbjct  66   RLKEIEEEAGALREMQAKVEKEMGAVQDSSSTSATQAEKEEVDSRSIYVGNVDYACTPEE  125

Query  487  VQQHFQSCGTVNRVTILTDKFG  552
            VQQHFQSCGTVNRVTILTDKFG
Sbjct  126  VQQHFQSCGTVNRVTILTDKFG  147



>ref|XP_011040327.1| PREDICTED: polyadenylate-binding protein 1 isoform X2 [Populus 
euphratica]
Length=225

 Score =   171 bits (433),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 99/123 (80%), Positives = 111/123 (90%), Gaps = 1/123 (1%)
 Frame = +1

Query  184  VYGGEFPeegdmdadvdmaalaeaeaqedPNAKQDLENMKKRLKEIEEEAGALREMQAKV  363
            VYGGE P+EG+MDAD DM++ AE +  +DPN+K DLE+MK+RLKEIEEEAGALREMQAKV
Sbjct  16   VYGGEIPDEGEMDADADMSSRAEEDEYQDPNSK-DLEDMKRRLKEIEEEAGALREMQAKV  74

Query  364  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  543
            EKEM  VQD   ASA+QAEKEEVD+RSIYVGNVDY+CTPEEVQQHFQSCGTVNRVTILTD
Sbjct  75   EKEMGAVQDSPGASATQAEKEEVDSRSIYVGNVDYSCTPEEVQQHFQSCGTVNRVTILTD  134

Query  544  KFG  552
            KFG
Sbjct  135  KFG  137



>ref|XP_011040326.1| PREDICTED: polyadenylate-binding protein 1 isoform X1 [Populus 
euphratica]
Length=226

 Score =   171 bits (433),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 99/123 (80%), Positives = 111/123 (90%), Gaps = 1/123 (1%)
 Frame = +1

Query  184  VYGGEFPeegdmdadvdmaalaeaeaqedPNAKQDLENMKKRLKEIEEEAGALREMQAKV  363
            VYGGE P+EG+MDAD DM++ AE +  +DPN+K DLE+MK+RLKEIEEEAGALREMQAKV
Sbjct  16   VYGGEIPDEGEMDADADMSSRAEEDEYQDPNSK-DLEDMKRRLKEIEEEAGALREMQAKV  74

Query  364  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  543
            EKEM  VQD   ASA+QAEKEEVD+RSIYVGNVDY+CTPEEVQQHFQSCGTVNRVTILTD
Sbjct  75   EKEMGAVQDSPGASATQAEKEEVDSRSIYVGNVDYSCTPEEVQQHFQSCGTVNRVTILTD  134

Query  544  KFG  552
            KFG
Sbjct  135  KFG  137



>ref|XP_006485035.1| PREDICTED: polyadenylate-binding protein 2 isoform X2 [Citrus 
sinensis]
Length=234

 Score =   171 bits (433),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 101/142 (71%), Positives = 111/142 (78%), Gaps = 14/142 (10%)
 Frame = +1

Query  169  EQEEDVYGGEFPeegdm-------------dadvdmaalaeaeaqedPNA-KQDLENMKK  306
            EQE DVYGGE P+E D              D D +    A+ E +EDPNA  +DLE+MKK
Sbjct  6    EQEHDVYGGEIPDEMDADIDVDEHEHEHDHDHDHEHEHDADNENEEDPNANSKDLEDMKK  65

Query  307  RLKEIEEEAGALREMQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEE  486
            RLKEIEEEAGALREMQAKVEKEM  VQD ++ SA+QAEKEEVD+RSIYVGNVDYACTPEE
Sbjct  66   RLKEIEEEAGALREMQAKVEKEMGAVQDSSSTSATQAEKEEVDSRSIYVGNVDYACTPEE  125

Query  487  VQQHFQSCGTVNRVTILTDKFG  552
            VQQHFQSCGTVNRVTILTDKFG
Sbjct  126  VQQHFQSCGTVNRVTILTDKFG  147



>ref|XP_006358184.1| PREDICTED: polyadenylate-binding protein 2-like [Solanum tuberosum]
Length=224

 Score =   171 bits (432),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 95/128 (74%), Positives = 101/128 (79%), Gaps = 3/128 (2%)
 Frame = +1

Query  169  EQEEDVYGGEFPeegdmdadvdmaalaeaeaqedPNAKQDLENMKKRLKEIEEEAGALRE  348
            E E +VYGGE P+E          + A     + PNAK+ LENMKKRLKEIE+EAGALRE
Sbjct  11   EHEHEVYGGEIPDEEGEMDAEYDTSAAAESEDD-PNAKE-LENMKKRLKEIEDEAGALRE  68

Query  349  MQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRV  528
            MQAKVEKEM   QDP A SASQAEKEEVD RSIYVGNVDYACTPEEVQQHFQSCGTVNRV
Sbjct  69   MQAKVEKEMGSAQDPTA-SASQAEKEEVDGRSIYVGNVDYACTPEEVQQHFQSCGTVNRV  127

Query  529  TILTDKFG  552
            TILTDKFG
Sbjct  128  TILTDKFG  135



>ref|XP_006437034.1| hypothetical protein CICLE_v10032621mg [Citrus clementina]
 gb|ESR50274.1| hypothetical protein CICLE_v10032621mg [Citrus clementina]
Length=236

 Score =   171 bits (432),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 101/142 (71%), Positives = 111/142 (78%), Gaps = 14/142 (10%)
 Frame = +1

Query  169  EQEEDVYGGEFPeegdm-------------dadvdmaalaeaeaqedPNA-KQDLENMKK  306
            EQE DVYGGE P+E D              D D +    A+ E +EDPNA  +DLE+MKK
Sbjct  6    EQEHDVYGGEIPDEMDADIDVDEHEHEHDHDHDHEHEHDADNENEEDPNANSKDLEDMKK  65

Query  307  RLKEIEEEAGALREMQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEE  486
            RLKEIEEEAGALREMQAKVEKEM  VQD ++ SA+QAEKEEVD+RSIYVGNVDYACTPEE
Sbjct  66   RLKEIEEEAGALREMQAKVEKEMGAVQDSSSTSATQAEKEEVDSRSIYVGNVDYACTPEE  125

Query  487  VQQHFQSCGTVNRVTILTDKFG  552
            VQQHFQSCGTVNRVTILTDKFG
Sbjct  126  VQQHFQSCGTVNRVTILTDKFG  147



>gb|KJB19595.1| hypothetical protein B456_003G110600 [Gossypium raimondii]
Length=216

 Score =   169 bits (429),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 94/135 (70%), Positives = 104/135 (77%), Gaps = 8/135 (6%)
 Frame = +1

Query  172  QEEDVYGGEFPeegdm-------dadvdmaalaeaeaqedPNA-KQDLENMKKRLKEIEE  327
            QE +VYGGE P+E              +     + E + DPN+  +DLE+MKKRLKEIEE
Sbjct  7    QEHEVYGGEIPDEEGEMDADIDISGAAEDYEGNDQELEHDPNSNSKDLEDMKKRLKEIEE  66

Query  328  EAGALREMQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQS  507
            EAGALREMQAKVEKEM  VQD   ASA+QAEKEEVD+RSIYVGNVDYACTPEEVQQHFQS
Sbjct  67   EAGALREMQAKVEKEMGAVQDSPGASATQAEKEEVDSRSIYVGNVDYACTPEEVQQHFQS  126

Query  508  CGTVNRVTILTDKFG  552
            CGTVNRVTILTDKFG
Sbjct  127  CGTVNRVTILTDKFG  141



>ref|XP_009363742.1| PREDICTED: polyadenylate-binding protein 2 [Pyrus x bretschneideri]
Length=221

 Score =   170 bits (430),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 83/94 (88%), Positives = 90/94 (96%), Gaps = 1/94 (1%)
 Frame = +1

Query  271  PNAKQDLENMKKRLKEIEEEAGALREMQAKVEKEMTGVQDPNAASASQAEKEEVDARSIY  450
            PN+K+ LE+MKKRLKEIEEEAGALR+MQAKVEKEM  VQDP++ SASQAEKEEVD+RSIY
Sbjct  40   PNSKE-LEDMKKRLKEIEEEAGALRDMQAKVEKEMGAVQDPSSGSASQAEKEEVDSRSIY  98

Query  451  VGNVDYACTPEEVQQHFQSCGTVNRVTILTDKFG  552
            VGNVDYACTPEEVQQHFQSCGTVNRVTILTDKFG
Sbjct  99   VGNVDYACTPEEVQQHFQSCGTVNRVTILTDKFG  132



>ref|XP_010274505.1| PREDICTED: polyadenylate-binding protein 2 [Nelumbo nucifera]
Length=231

 Score =   170 bits (430),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 95/123 (77%), Positives = 110/123 (89%), Gaps = 4/123 (3%)
 Frame = +1

Query  184  VYGGEFPeegdmdadvdmaalaeaeaqedPNAKQDLENMKKRLKEIEEEAGALREMQAKV  363
            VYGGE P++GDMDADV+M+   + +    PN++++LE MKKRLKEIEEEAGALREMQAKV
Sbjct  21   VYGGEIPDDGDMDADVEMSRAEDED----PNSRENLEAMKKRLKEIEEEAGALREMQAKV  76

Query  364  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  543
            EKEM  VQDP++A+A QAEKEEVD+RSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD
Sbjct  77   EKEMGAVQDPSSAAAIQAEKEEVDSRSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  136

Query  544  KFG  552
            K+G
Sbjct  137  KYG  139



>pdb|2M70|A Chain A, Structural Determination Of The Citrus Sinensis Poly(a)-binding 
Protein Cspabp1
Length=155

 Score =   167 bits (424),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 80/89 (90%), Positives = 85/89 (96%), Gaps = 0/89 (0%)
 Frame = +1

Query  286  DLENMKKRLKEIEEEAGALREMQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNVD  465
            DLE+MKKRLKEIEEEAGALREMQAKVEKEM  VQD ++ SA+QAEKEEVD+RSIYVGNVD
Sbjct  24   DLEDMKKRLKEIEEEAGALREMQAKVEKEMGAVQDSSSTSATQAEKEEVDSRSIYVGNVD  83

Query  466  YACTPEEVQQHFQSCGTVNRVTILTDKFG  552
            YACTPEEVQQHFQSCGTVNRVTILTDKFG
Sbjct  84   YACTPEEVQQHFQSCGTVNRVTILTDKFG  112



>ref|XP_007218817.1| hypothetical protein PRUPE_ppa010052mg [Prunus persica]
 gb|EMJ20016.1| hypothetical protein PRUPE_ppa010052mg [Prunus persica]
Length=266

 Score =   171 bits (432),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 91/123 (74%), Positives = 104/123 (85%), Gaps = 1/123 (1%)
 Frame = +1

Query  184  VYGGEFPeegdmdadvdmaalaeaeaqedPNAKQDLENMKKRLKEIEEEAGALREMQAKV  363
            VYGGE P +   D D+   A  + +  +DPN+K+ LE+MKKRLKEIEEEAGALR+MQAKV
Sbjct  56   VYGGEIPADDGEDVDMSSRADDDQDYNDDPNSKE-LEDMKKRLKEIEEEAGALRDMQAKV  114

Query  364  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  543
            EKEM  VQD ++ SA+QAEKEEVD+RSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD
Sbjct  115  EKEMGAVQDSSSGSATQAEKEEVDSRSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  174

Query  544  KFG  552
            KFG
Sbjct  175  KFG  177



>ref|XP_007038220.1| RNA-binding family protein [Theobroma cacao]
 gb|EOY22721.1| RNA-binding family protein [Theobroma cacao]
Length=230

 Score =   169 bits (429),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 96/136 (71%), Positives = 109/136 (80%), Gaps = 8/136 (6%)
 Frame = +1

Query  169  EQEEDVYGGEFPeeg-------dmdadvdmaalaeaeaqedPNA-KQDLENMKKRLKEIE  324
            E E +VYGGE P+E        DM    +     E + ++DPN+  +DLE+MKKRLKEIE
Sbjct  6    EPEHEVYGGEIPDEEGEMDADVDMSGGAEDYEGNEQDLEQDPNSNSKDLEDMKKRLKEIE  65

Query  325  EEAGALREMQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQ  504
            EEAGALREMQAKVEKEM  VQD ++ASA+QAEKEEVD+RSIYVGNVDYACTPEEVQQHFQ
Sbjct  66   EEAGALREMQAKVEKEMGAVQDSSSASATQAEKEEVDSRSIYVGNVDYACTPEEVQQHFQ  125

Query  505  SCGTVNRVTILTDKFG  552
            SCGTVNRVTILTDKFG
Sbjct  126  SCGTVNRVTILTDKFG  141



>ref|XP_002511041.1| polyadenylate-binding protein, putative [Ricinus communis]
 gb|EEF51643.1| polyadenylate-binding protein, putative [Ricinus communis]
Length=231

 Score =   169 bits (428),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 82/94 (87%), Positives = 89/94 (95%), Gaps = 1/94 (1%)
 Frame = +1

Query  271  PNAKQDLENMKKRLKEIEEEAGALREMQAKVEKEMTGVQDPNAASASQAEKEEVDARSIY  450
            PN+K DLE+MKKRLKEIEEEAGALREMQAKVEKEM  VQD ++ SA+QAEKEEVD+RS+Y
Sbjct  50   PNSK-DLEDMKKRLKEIEEEAGALREMQAKVEKEMGAVQDSSSGSATQAEKEEVDSRSVY  108

Query  451  VGNVDYACTPEEVQQHFQSCGTVNRVTILTDKFG  552
            VGNVDYACTPEEVQQHFQSCGTVNRVTILTDKFG
Sbjct  109  VGNVDYACTPEEVQQHFQSCGTVNRVTILTDKFG  142



>gb|KJB19594.1| hypothetical protein B456_003G110600 [Gossypium raimondii]
Length=230

 Score =   169 bits (428),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 94/135 (70%), Positives = 104/135 (77%), Gaps = 8/135 (6%)
 Frame = +1

Query  172  QEEDVYGGEFPeegdm-------dadvdmaalaeaeaqedPNA-KQDLENMKKRLKEIEE  327
            QE +VYGGE P+E              +     + E + DPN+  +DLE+MKKRLKEIEE
Sbjct  7    QEHEVYGGEIPDEEGEMDADIDISGAAEDYEGNDQELEHDPNSNSKDLEDMKKRLKEIEE  66

Query  328  EAGALREMQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQS  507
            EAGALREMQAKVEKEM  VQD   ASA+QAEKEEVD+RSIYVGNVDYACTPEEVQQHFQS
Sbjct  67   EAGALREMQAKVEKEMGAVQDSPGASATQAEKEEVDSRSIYVGNVDYACTPEEVQQHFQS  126

Query  508  CGTVNRVTILTDKFG  552
            CGTVNRVTILTDKFG
Sbjct  127  CGTVNRVTILTDKFG  141



>gb|AFK33591.1| unknown [Medicago truncatula]
Length=179

 Score =   166 bits (420),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 82/95 (86%), Positives = 86/95 (91%), Gaps = 1/95 (1%)
 Frame = +1

Query  271  PN-AKQDLENMKKRLKEIEEEAGALREMQAKVEKEMTGVQDPNAASASQAEKEEVDARSI  447
            PN   ++LE+MKKRLKEIEEEA ALREMQAKVEKEM  VQDP  +S SQAEKEEVDARSI
Sbjct  13   PNHTTKELEDMKKRLKEIEEEASALREMQAKVEKEMGAVQDPAGSSVSQAEKEEVDARSI  72

Query  448  YVGNVDYACTPEEVQQHFQSCGTVNRVTILTDKFG  552
            YVGNVDYACTPEEVQQHFQSCGTVNRVTILTDKFG
Sbjct  73   YVGNVDYACTPEEVQQHFQSCGTVNRVTILTDKFG  107



>ref|XP_003590723.1| Polyadenylate-binding protein [Medicago truncatula]
 gb|ACJ84474.1| unknown [Medicago truncatula]
 gb|AES60974.1| polyadenylate-binding protein II [Medicago truncatula]
Length=187

 Score =   166 bits (420),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 89/129 (69%), Positives = 100/129 (78%), Gaps = 1/129 (1%)
 Frame = +1

Query  169  EQEEDVYGGEFPeegdmdadvdmaalaeaeaqedPN-AKQDLENMKKRLKEIEEEAGALR  345
            ++E +VYG + P+E         A   E + +   N   ++LE+MKKRLKEIEEEA ALR
Sbjct  3    QEEHEVYGADIPDEEVDMDADIDAEHQEGDEELASNHTTKELEDMKKRLKEIEEEASALR  62

Query  346  EMQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNR  525
            EMQAKVEKEM  VQDP  +S SQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNR
Sbjct  63   EMQAKVEKEMGAVQDPAGSSVSQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNR  122

Query  526  VTILTDKFG  552
            VTILTDKFG
Sbjct  123  VTILTDKFG  131



>ref|XP_009362727.1| PREDICTED: polyadenylate-binding protein 2-like [Pyrus x bretschneideri]
Length=222

 Score =   167 bits (423),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 91/131 (69%), Positives = 104/131 (79%), Gaps = 4/131 (3%)
 Frame = +1

Query  169  EQEEDVYGGEFPe---egdmdadvdmaalaeaeaqedPNAKQDLENMKKRLKEIEEEAGA  339
            +QE +VYG E P    E    +        + +  +DPN+K +LE+MKKRLKEIEEEAGA
Sbjct  4    QQEHEVYGAEIPNDDGEDVDMSSRADGVDDDQDYNDDPNSK-ELEDMKKRLKEIEEEAGA  62

Query  340  LREMQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTV  519
            LR+MQAKVEKEM  VQD ++ SASQAEKEEVD+RSIYVGNVDYACTPEEVQQHFQSCGTV
Sbjct  63   LRDMQAKVEKEMGAVQDSSSGSASQAEKEEVDSRSIYVGNVDYACTPEEVQQHFQSCGTV  122

Query  520  NRVTILTDKFG  552
            NRVTILTDKFG
Sbjct  123  NRVTILTDKFG  133



>gb|KJB51352.1| hypothetical protein B456_008G213100 [Gossypium raimondii]
Length=180

 Score =   166 bits (420),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 94/135 (70%), Positives = 106/135 (79%), Gaps = 7/135 (5%)
 Frame = +1

Query  169  EQEEDVYGGEFPeegdmdadvdmaalaeae-------aqedPNAKQDLENMKKRLKEIEE  327
            EQE +VYGGE P+E               +        Q+DP++ +DLE+MKKRL+EIEE
Sbjct  6    EQEHEVYGGEIPDEEGEMDAEFDMTAGAEDYQGNDQGLQQDPSSSKDLEDMKKRLREIEE  65

Query  328  EAGALREMQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQS  507
            EAGALREMQAKVEKEM  VQD ++ASASQAEKEEVD+RSIYVGNVDYACTPEEVQQHFQS
Sbjct  66   EAGALREMQAKVEKEMGAVQDSSSASASQAEKEEVDSRSIYVGNVDYACTPEEVQQHFQS  125

Query  508  CGTVNRVTILTDKFG  552
            CGTVNRVTILTDKFG
Sbjct  126  CGTVNRVTILTDKFG  140



>ref|XP_007205858.1| hypothetical protein PRUPE_ppa011157mg [Prunus persica]
 ref|XP_008234985.1| PREDICTED: polyadenylate-binding protein 2 isoform X1 [Prunus 
mume]
 gb|EMJ07057.1| hypothetical protein PRUPE_ppa011157mg [Prunus persica]
Length=221

 Score =   166 bits (421),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 90/128 (70%), Positives = 106/128 (83%), Gaps = 0/128 (0%)
 Frame = +1

Query  169  EQEEDVYGGEFPeegdmdadvdmaalaeaeaqedPNAKQDLENMKKRLKEIEEEAGALRE  348
            E+E +VYGGE P+EG+M+ D++        +  D +A ++L+ MKKRLKE+EEEA ALRE
Sbjct  3    EEEHEVYGGEIPDEGEMEGDIEAHHADVDMSTADDDAVKELDEMKKRLKEMEEEAAALRE  62

Query  349  MQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRV  528
            MQAKVEKEM  VQDP A +ASQA KEEVDARS++VGNVDYACTPEEVQQHFQSCGTVNRV
Sbjct  63   MQAKVEKEMGAVQDPAAVAASQANKEEVDARSVFVGNVDYACTPEEVQQHFQSCGTVNRV  122

Query  529  TILTDKFG  552
            TILTDKFG
Sbjct  123  TILTDKFG  130



>ref|XP_011076455.1| PREDICTED: polyadenylate-binding protein 1 isoform X1 [Sesamum 
indicum]
Length=221

 Score =   166 bits (420),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 95/128 (74%), Positives = 109/128 (85%), Gaps = 3/128 (2%)
 Frame = +1

Query  169  EQEEDVYGGEFPeegdmdadvdmaalaeaeaqedPNAKQDLENMKKRLKEIEEEAGALRE  348
            EQ++DVYGG+ PEE  M++D+D +A  EA A    +  ++LE+MKKRL+EIEEEAGALRE
Sbjct  8    EQDDDVYGGDVPEEAYMESDIDPSADPEAAAD---SKAKELESMKKRLQEIEEEAGALRE  64

Query  349  MQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRV  528
            MQAKVEKEM   QD   ASASQAEKEEVD+RSIYVGNVDYACTPEEVQQHFQSCGTVNRV
Sbjct  65   MQAKVEKEMGATQDSTGASASQAEKEEVDSRSIYVGNVDYACTPEEVQQHFQSCGTVNRV  124

Query  529  TILTDKFG  552
            TILTDK+G
Sbjct  125  TILTDKYG  132



>ref|XP_004166616.1| PREDICTED: polyadenylate-binding protein 2-like [Cucumis sativus]
 gb|KGN53187.1| hypothetical protein Csa_4G025170 [Cucumis sativus]
Length=229

 Score =   166 bits (420),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 93/132 (70%), Positives = 110/132 (83%), Gaps = 4/132 (3%)
 Frame = +1

Query  169  EQEEDVYGGEFPeegdmdadvdmaalae---aeaqedPNA-KQDLENMKKRLKEIEEEAG  336
            E E +VYGG+ P++ ++DAD+DM++          E  NA  +DLE+MK+RLKEIEEEAG
Sbjct  9    EHEHEVYGGDIPDDAELDADLDMSSGRADEEGYDAEPSNANSKDLEDMKRRLKEIEEEAG  68

Query  337  ALREMQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGT  516
            ALREMQAKVEKEM  VQD ++ SA+QAEKEEVD+RS+YVGNVDYACTPEEVQQHFQSCGT
Sbjct  69   ALREMQAKVEKEMGAVQDSSSTSATQAEKEEVDSRSVYVGNVDYACTPEEVQQHFQSCGT  128

Query  517  VNRVTILTDKFG  552
            VNRVTILTDKFG
Sbjct  129  VNRVTILTDKFG  140



>gb|ACJ85460.1| unknown [Medicago truncatula]
 gb|AFK49250.1| unknown [Medicago truncatula]
Length=217

 Score =   166 bits (419),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 89/129 (69%), Positives = 100/129 (78%), Gaps = 1/129 (1%)
 Frame = +1

Query  169  EQEEDVYGGEFPeegdmdadvdmaalaeaeaqedPN-AKQDLENMKKRLKEIEEEAGALR  345
            ++E +VYG + P+E         A   E + +   N   ++LE+MKKRLKEIEEEA ALR
Sbjct  3    QEEHEVYGADIPDEEVDMDADIDAEHQEGDEELASNHTTKELEDMKKRLKEIEEEASALR  62

Query  346  EMQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNR  525
            EMQAKVEKEM  VQDP  +S SQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNR
Sbjct  63   EMQAKVEKEMGAVQDPAGSSVSQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNR  122

Query  526  VTILTDKFG  552
            VTILTDKFG
Sbjct  123  VTILTDKFG  131



>emb|CDP01496.1| unnamed protein product [Coffea canephora]
Length=221

 Score =   166 bits (420),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 91/128 (71%), Positives = 108/128 (84%), Gaps = 0/128 (0%)
 Frame = +1

Query  169  EQEEDVYGGEFPeegdmdadvdmaalaeaeaqedPNAKQDLENMKKRLKEIEEEAGALRE  348
            E+E +VYGGE P+EG+M+ D+D  +     +  D +A ++L+ MKKRLKE+EEEA ALRE
Sbjct  3    EEEHEVYGGEIPDEGEMEGDLDPNSGDVDMSTADDDAVKELDEMKKRLKEMEEEAAALRE  62

Query  349  MQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRV  528
            MQAKVEKEM  VQDP +A+ASQA KEEVD+RSI+VGNVDYACTPEEVQQHFQSCGTVNRV
Sbjct  63   MQAKVEKEMGAVQDPASAAASQANKEEVDSRSIFVGNVDYACTPEEVQQHFQSCGTVNRV  122

Query  529  TILTDKFG  552
            TILTDKFG
Sbjct  123  TILTDKFG  130



>ref|XP_008453840.1| PREDICTED: polyadenylate-binding protein 2-like isoform X2 [Cucumis 
melo]
Length=229

 Score =   166 bits (420),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 93/132 (70%), Positives = 106/132 (80%), Gaps = 4/132 (3%)
 Frame = +1

Query  169  EQEEDVYGGEFPeegdmda---dvdmaalaeaeaqedPNA-KQDLENMKKRLKEIEEEAG  336
            E E +VYGG+ P++ +MDA        A  E    E  NA  +DLE+MK+RLKEIEEEAG
Sbjct  9    EHEHEVYGGDIPDDAEMDADLDMSSGRADEEGYDAEPSNANSKDLEDMKRRLKEIEEEAG  68

Query  337  ALREMQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGT  516
            ALREMQAKVEKEM  VQD ++ SA+QAEKEEVD+RS+YVGNVDYACTPEEVQQHFQSCGT
Sbjct  69   ALREMQAKVEKEMGAVQDSSSTSATQAEKEEVDSRSVYVGNVDYACTPEEVQQHFQSCGT  128

Query  517  VNRVTILTDKFG  552
            VNRVTILTDKFG
Sbjct  129  VNRVTILTDKFG  140



>gb|KJB07918.1| hypothetical protein B456_001G052500 [Gossypium raimondii]
Length=214

 Score =   165 bits (418),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 81/95 (85%), Positives = 89/95 (94%), Gaps = 1/95 (1%)
 Frame = +1

Query  271  PNA-KQDLENMKKRLKEIEEEAGALREMQAKVEKEMTGVQDPNAASASQAEKEEVDARSI  447
            PN+  +DLE+MKKRLKEIE+EAGALREMQAKVEKEM  VQD + ASA+QAEKEEVD+RSI
Sbjct  45   PNSNSKDLEDMKKRLKEIEDEAGALREMQAKVEKEMGAVQDSSGASATQAEKEEVDSRSI  104

Query  448  YVGNVDYACTPEEVQQHFQSCGTVNRVTILTDKFG  552
            YVGNVDY+CTPEEVQQHFQSCGTVNRVTILTDKFG
Sbjct  105  YVGNVDYSCTPEEVQQHFQSCGTVNRVTILTDKFG  139



>ref|XP_002279148.1| PREDICTED: polyadenylate-binding protein 2 [Vitis vinifera]
Length=226

 Score =   166 bits (419),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 81/94 (86%), Positives = 90/94 (96%), Gaps = 1/94 (1%)
 Frame = +1

Query  271  PNAKQDLENMKKRLKEIEEEAGALREMQAKVEKEMTGVQDPNAASASQAEKEEVDARSIY  450
            PN+K ++E+M+KRLKEIEEEAGALREMQAKVEKEM  VQD ++ASA+QAEKEEVD+RSIY
Sbjct  44   PNSK-NIEDMRKRLKEIEEEAGALREMQAKVEKEMGAVQDSSSASATQAEKEEVDSRSIY  102

Query  451  VGNVDYACTPEEVQQHFQSCGTVNRVTILTDKFG  552
            VGNVDYACTPEEVQQHFQSCGTVNRVTILTDKFG
Sbjct  103  VGNVDYACTPEEVQQHFQSCGTVNRVTILTDKFG  136



>ref|XP_008364853.1| PREDICTED: polyadenylate-binding protein 2-like [Malus domestica]
Length=221

 Score =   165 bits (418),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 82/94 (87%), Positives = 88/94 (94%), Gaps = 1/94 (1%)
 Frame = +1

Query  271  PNAKQDLENMKKRLKEIEEEAGALREMQAKVEKEMTGVQDPNAASASQAEKEEVDARSIY  450
            PN+K+ LE+MKKRLKEIEEEAGALR+MQAKVEKEM  VQD +  SASQAEKEEVD+RSIY
Sbjct  40   PNSKE-LEDMKKRLKEIEEEAGALRDMQAKVEKEMGAVQDTSXGSASQAEKEEVDSRSIY  98

Query  451  VGNVDYACTPEEVQQHFQSCGTVNRVTILTDKFG  552
            VGNVDYACTPEEVQQHFQSCGTVNRVTILTDKFG
Sbjct  99   VGNVDYACTPEEVQQHFQSCGTVNRVTILTDKFG  132



>ref|XP_008804766.1| PREDICTED: polyadenylate-binding protein 2-like isoform X2 [Phoenix 
dactylifera]
Length=221

 Score =   165 bits (418),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 87/128 (68%), Positives = 110/128 (86%), Gaps = 0/128 (0%)
 Frame = +1

Query  169  EQEEDVYGGEFPeegdmdadvdmaalaeaeaqedPNAKQDLENMKKRLKEIEEEAGALRE  348
            E+E +VYGGE P+EG+M+ ++D A      ++ D +A ++L+ MKKRLKE+EEEA ALRE
Sbjct  3    EEEHEVYGGEIPDEGEMEGEMDAANADVDMSRADEDASKELDEMKKRLKEMEEEAAALRE  62

Query  349  MQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRV  528
            MQAKVEKEM+ VQDP +A+A+QA +EEVD+RS++VGNVDY+CTPEEVQQHFQSCGTVNRV
Sbjct  63   MQAKVEKEMSAVQDPASAAATQASREEVDSRSVFVGNVDYSCTPEEVQQHFQSCGTVNRV  122

Query  529  TILTDKFG  552
            TILTDKFG
Sbjct  123  TILTDKFG  130



>ref|XP_004146890.1| PREDICTED: LOW QUALITY PROTEIN: polyadenylate-binding protein 
2-like [Cucumis sativus]
Length=237

 Score =   165 bits (418),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 78/90 (87%), Positives = 86/90 (96%), Gaps = 0/90 (0%)
 Frame = +1

Query  283  QDLENMKKRLKEIEEEAGALREMQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNV  462
            +DLE+MK+RLKEIEEEAGALREMQAKVEKEM  VQD ++ SA+QAEKEEVD+RS+YVGNV
Sbjct  59   KDLEDMKRRLKEIEEEAGALREMQAKVEKEMGAVQDSSSTSATQAEKEEVDSRSVYVGNV  118

Query  463  DYACTPEEVQQHFQSCGTVNRVTILTDKFG  552
            DYACTPEEVQQHFQSCGTVNRVTILTDKFG
Sbjct  119  DYACTPEEVQQHFQSCGTVNRVTILTDKFG  148



>gb|KJB07914.1| hypothetical protein B456_001G052500 [Gossypium raimondii]
 gb|KJB07915.1| hypothetical protein B456_001G052500 [Gossypium raimondii]
Length=228

 Score =   165 bits (418),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 81/95 (85%), Positives = 89/95 (94%), Gaps = 1/95 (1%)
 Frame = +1

Query  271  PNA-KQDLENMKKRLKEIEEEAGALREMQAKVEKEMTGVQDPNAASASQAEKEEVDARSI  447
            PN+  +DLE+MKKRLKEIE+EAGALREMQAKVEKEM  VQD + ASA+QAEKEEVD+RSI
Sbjct  45   PNSNSKDLEDMKKRLKEIEDEAGALREMQAKVEKEMGAVQDSSGASATQAEKEEVDSRSI  104

Query  448  YVGNVDYACTPEEVQQHFQSCGTVNRVTILTDKFG  552
            YVGNVDY+CTPEEVQQHFQSCGTVNRVTILTDKFG
Sbjct  105  YVGNVDYSCTPEEVQQHFQSCGTVNRVTILTDKFG  139



>gb|KJB51353.1| hypothetical protein B456_008G213100 [Gossypium raimondii]
Length=213

 Score =   164 bits (416),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 97/135 (72%), Positives = 109/135 (81%), Gaps = 7/135 (5%)
 Frame = +1

Query  169  EQEEDVYGGEFP-------eegdmdadvdmaalaeaeaqedPNAKQDLENMKKRLKEIEE  327
            EQE +VYGGE P        E DM A  +     +   Q+DP++ +DLE+MKKRL+EIEE
Sbjct  6    EQEHEVYGGEIPDEEGEMDAEFDMTAGAEDYQGNDQGLQQDPSSSKDLEDMKKRLREIEE  65

Query  328  EAGALREMQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQS  507
            EAGALREMQAKVEKEM  VQD ++ASASQAEKEEVD+RSIYVGNVDYACTPEEVQQHFQS
Sbjct  66   EAGALREMQAKVEKEMGAVQDSSSASASQAEKEEVDSRSIYVGNVDYACTPEEVQQHFQS  125

Query  508  CGTVNRVTILTDKFG  552
            CGTVNRVTILTDKFG
Sbjct  126  CGTVNRVTILTDKFG  140



>ref|XP_002321779.2| hypothetical protein POPTR_0015s12230g [Populus trichocarpa]
 gb|EEF05906.2| hypothetical protein POPTR_0015s12230g [Populus trichocarpa]
Length=222

 Score =   165 bits (417),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 98/123 (80%), Positives = 110/123 (89%), Gaps = 4/123 (3%)
 Frame = +1

Query  184  VYGGEFPeegdmdadvdmaalaeaeaqedPNAKQDLENMKKRLKEIEEEAGALREMQAKV  363
            VYGGE P+EG+MDAD DM++ AE +  +DPN+K DLE+MK+RLKEIEEEAGALREMQAKV
Sbjct  16   VYGGEIPDEGEMDADADMSSRAEEDEYQDPNSK-DLEDMKRRLKEIEEEAGALREMQAKV  74

Query  364  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  543
            EKEM  VQ    ASA+QAEKEEVD+RSIYVGNVDY+CTPEEVQQHFQSCGTVNRVTILTD
Sbjct  75   EKEMGAVQ---GASATQAEKEEVDSRSIYVGNVDYSCTPEEVQQHFQSCGTVNRVTILTD  131

Query  544  KFG  552
            KFG
Sbjct  132  KFG  134



>ref|XP_006374586.1| hypothetical protein POPTR_0015s12230g [Populus trichocarpa]
 gb|ERP52383.1| hypothetical protein POPTR_0015s12230g [Populus trichocarpa]
Length=223

 Score =   165 bits (417),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 98/123 (80%), Positives = 110/123 (89%), Gaps = 4/123 (3%)
 Frame = +1

Query  184  VYGGEFPeegdmdadvdmaalaeaeaqedPNAKQDLENMKKRLKEIEEEAGALREMQAKV  363
            VYGGE P+EG+MDAD DM++ AE +  +DPN+K DLE+MK+RLKEIEEEAGALREMQAKV
Sbjct  16   VYGGEIPDEGEMDADADMSSRAEEDEYQDPNSK-DLEDMKRRLKEIEEEAGALREMQAKV  74

Query  364  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  543
            EKEM  VQ    ASA+QAEKEEVD+RSIYVGNVDY+CTPEEVQQHFQSCGTVNRVTILTD
Sbjct  75   EKEMGAVQ---GASATQAEKEEVDSRSIYVGNVDYSCTPEEVQQHFQSCGTVNRVTILTD  131

Query  544  KFG  552
            KFG
Sbjct  132  KFG  134



>gb|ACU17272.1| unknown [Glycine max]
Length=183

 Score =   163 bits (413),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 87/129 (67%), Positives = 98/129 (76%), Gaps = 5/129 (4%)
 Frame = +1

Query  169  EQEEDVYGGEFPeegdmdadvdmaalaeaeaqedPN-AKQDLENMKKRLKEIEEEAGALR  345
            ++E +VYG + P+E             +      PN   ++LE+MKKRLKEIEEEA ALR
Sbjct  3    QEEHEVYGADIPDEEIDMDADAEQQDEQLA----PNHTNKELEDMKKRLKEIEEEASALR  58

Query  346  EMQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNR  525
            EMQAKVEKEM  VQD +  SA+QAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNR
Sbjct  59   EMQAKVEKEMGAVQDSSGTSATQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNR  118

Query  526  VTILTDKFG  552
            VTILTDKFG
Sbjct  119  VTILTDKFG  127



>gb|KJB51351.1| hypothetical protein B456_008G213100 [Gossypium raimondii]
Length=217

 Score =   164 bits (415),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 97/135 (72%), Positives = 109/135 (81%), Gaps = 7/135 (5%)
 Frame = +1

Query  169  EQEEDVYGGEFP-------eegdmdadvdmaalaeaeaqedPNAKQDLENMKKRLKEIEE  327
            EQE +VYGGE P        E DM A  +     +   Q+DP++ +DLE+MKKRL+EIEE
Sbjct  6    EQEHEVYGGEIPDEEGEMDAEFDMTAGAEDYQGNDQGLQQDPSSSKDLEDMKKRLREIEE  65

Query  328  EAGALREMQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQS  507
            EAGALREMQAKVEKEM  VQD ++ASASQAEKEEVD+RSIYVGNVDYACTPEEVQQHFQS
Sbjct  66   EAGALREMQAKVEKEMGAVQDSSSASASQAEKEEVDSRSIYVGNVDYACTPEEVQQHFQS  125

Query  508  CGTVNRVTILTDKFG  552
            CGTVNRVTILTDKFG
Sbjct  126  CGTVNRVTILTDKFG  140



>ref|XP_008353926.1| PREDICTED: polyadenylate-binding protein 2-like isoform X2 [Malus 
domestica]
Length=219

 Score =   164 bits (415),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 91/128 (71%), Positives = 105/128 (82%), Gaps = 0/128 (0%)
 Frame = +1

Query  169  EQEEDVYGGEFPeegdmdadvdmaalaeaeaqedPNAKQDLENMKKRLKEIEEEAGALRE  348
            E+E +VYG E P+EG+MD D+D        +  D +A ++L+ MKKRLKE+EEEA ALRE
Sbjct  3    EEEHEVYGAEIPDEGEMDGDMDALHADVDMSTADDDAVKELDEMKKRLKEMEEEAAALRE  62

Query  349  MQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRV  528
            MQAKVEKEM  VQDP  A+ASQA KEEVDARS++VGNVDYACTPEEVQQHFQSCGTVNRV
Sbjct  63   MQAKVEKEMGAVQDPAIAAASQANKEEVDARSVFVGNVDYACTPEEVQQHFQSCGTVNRV  122

Query  529  TILTDKFG  552
            TILTDKFG
Sbjct  123  TILTDKFG  130



>gb|KHG11684.1| Polyadenylate-binding 2 [Gossypium arboreum]
Length=227

 Score =   164 bits (415),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 97/135 (72%), Positives = 109/135 (81%), Gaps = 7/135 (5%)
 Frame = +1

Query  169  EQEEDVYGGEFP-------eegdmdadvdmaalaeaeaqedPNAKQDLENMKKRLKEIEE  327
            EQE +VYGGE P        E DM A  +     +   Q+DP++ +DLE+MKKRL+EIEE
Sbjct  6    EQEHEVYGGEIPDEEGEMDAEFDMTAGAEDYQGNDQGLQQDPSSSKDLEDMKKRLREIEE  65

Query  328  EAGALREMQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQS  507
            EAGALREMQAKVEKEM  VQD ++ASASQAEKEEVD+RSIYVGNVDYACTPEEVQQHFQS
Sbjct  66   EAGALREMQAKVEKEMGAVQDSSSASASQAEKEEVDSRSIYVGNVDYACTPEEVQQHFQS  125

Query  508  CGTVNRVTILTDKFG  552
            CGTVNRVTILTDKFG
Sbjct  126  CGTVNRVTILTDKFG  140



>ref|XP_008353925.1| PREDICTED: polyadenylate-binding protein 2-like isoform X1 [Malus 
domestica]
Length=221

 Score =   164 bits (415),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 91/128 (71%), Positives = 105/128 (82%), Gaps = 0/128 (0%)
 Frame = +1

Query  169  EQEEDVYGGEFPeegdmdadvdmaalaeaeaqedPNAKQDLENMKKRLKEIEEEAGALRE  348
            E+E +VYG E P+EG+MD D+D        +  D +A ++L+ MKKRLKE+EEEA ALRE
Sbjct  3    EEEHEVYGAEIPDEGEMDGDMDALHADVDMSTADDDAVKELDEMKKRLKEMEEEAAALRE  62

Query  349  MQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRV  528
            MQAKVEKEM  VQDP  A+ASQA KEEVDARS++VGNVDYACTPEEVQQHFQSCGTVNRV
Sbjct  63   MQAKVEKEMGAVQDPAIAAASQANKEEVDARSVFVGNVDYACTPEEVQQHFQSCGTVNRV  122

Query  529  TILTDKFG  552
            TILTDKFG
Sbjct  123  TILTDKFG  130



>gb|KJB51354.1| hypothetical protein B456_008G213100 [Gossypium raimondii]
Length=227

 Score =   164 bits (415),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 97/135 (72%), Positives = 109/135 (81%), Gaps = 7/135 (5%)
 Frame = +1

Query  169  EQEEDVYGGEFP-------eegdmdadvdmaalaeaeaqedPNAKQDLENMKKRLKEIEE  327
            EQE +VYGGE P        E DM A  +     +   Q+DP++ +DLE+MKKRL+EIEE
Sbjct  6    EQEHEVYGGEIPDEEGEMDAEFDMTAGAEDYQGNDQGLQQDPSSSKDLEDMKKRLREIEE  65

Query  328  EAGALREMQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQS  507
            EAGALREMQAKVEKEM  VQD ++ASASQAEKEEVD+RSIYVGNVDYACTPEEVQQHFQS
Sbjct  66   EAGALREMQAKVEKEMGAVQDSSSASASQAEKEEVDSRSIYVGNVDYACTPEEVQQHFQS  125

Query  508  CGTVNRVTILTDKFG  552
            CGTVNRVTILTDKFG
Sbjct  126  CGTVNRVTILTDKFG  140



>ref|XP_009344452.1| PREDICTED: polyadenylate-binding protein 2 isoform X2 [Pyrus 
x bretschneideri]
Length=219

 Score =   164 bits (414),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 91/128 (71%), Positives = 105/128 (82%), Gaps = 0/128 (0%)
 Frame = +1

Query  169  EQEEDVYGGEFPeegdmdadvdmaalaeaeaqedPNAKQDLENMKKRLKEIEEEAGALRE  348
            E+E +VYG E P+EG+MD D+D        +  D +A ++L+ MKKRLKE+EEEA ALRE
Sbjct  3    EEEHEVYGAEIPDEGEMDGDLDALHADVDMSTADDDAVKELDEMKKRLKEMEEEAAALRE  62

Query  349  MQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRV  528
            MQAKVEKEM  VQDP  A+ASQA KEEVDARS++VGNVDYACTPEEVQQHFQSCGTVNRV
Sbjct  63   MQAKVEKEMGAVQDPAIAAASQANKEEVDARSVFVGNVDYACTPEEVQQHFQSCGTVNRV  122

Query  529  TILTDKFG  552
            TILTDKFG
Sbjct  123  TILTDKFG  130



>ref|XP_009344451.1| PREDICTED: polyadenylate-binding protein 2 isoform X1 [Pyrus 
x bretschneideri]
Length=221

 Score =   164 bits (414),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 91/128 (71%), Positives = 105/128 (82%), Gaps = 0/128 (0%)
 Frame = +1

Query  169  EQEEDVYGGEFPeegdmdadvdmaalaeaeaqedPNAKQDLENMKKRLKEIEEEAGALRE  348
            E+E +VYG E P+EG+MD D+D        +  D +A ++L+ MKKRLKE+EEEA ALRE
Sbjct  3    EEEHEVYGAEIPDEGEMDGDLDALHADVDMSTADDDAVKELDEMKKRLKEMEEEAAALRE  62

Query  349  MQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRV  528
            MQAKVEKEM  VQDP  A+ASQA KEEVDARS++VGNVDYACTPEEVQQHFQSCGTVNRV
Sbjct  63   MQAKVEKEMGAVQDPAIAAASQANKEEVDARSVFVGNVDYACTPEEVQQHFQSCGTVNRV  122

Query  529  TILTDKFG  552
            TILTDKFG
Sbjct  123  TILTDKFG  130



>gb|KHG12327.1| Polyadenylate-binding 2 [Gossypium arboreum]
Length=228

 Score =   164 bits (414),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 80/95 (84%), Positives = 88/95 (93%), Gaps = 1/95 (1%)
 Frame = +1

Query  271  PNA-KQDLENMKKRLKEIEEEAGALREMQAKVEKEMTGVQDPNAASASQAEKEEVDARSI  447
            PN+  +DLE+MKKRLKEIE+EAGALREMQAKVEKEM  VQD +  SA+QAEKEEVD+RSI
Sbjct  45   PNSNSKDLEDMKKRLKEIEDEAGALREMQAKVEKEMGAVQDSSGTSATQAEKEEVDSRSI  104

Query  448  YVGNVDYACTPEEVQQHFQSCGTVNRVTILTDKFG  552
            YVGNVDY+CTPEEVQQHFQSCGTVNRVTILTDKFG
Sbjct  105  YVGNVDYSCTPEEVQQHFQSCGTVNRVTILTDKFG  139



>ref|XP_010917314.1| PREDICTED: polyadenylate-binding protein 2-like [Elaeis guineensis]
Length=223

 Score =   163 bits (413),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 89/130 (68%), Positives = 109/130 (84%), Gaps = 2/130 (2%)
 Frame = +1

Query  169  EQEEDVYGGEFPeegdmdadvdmaalaeaeaqedPNAK--QDLENMKKRLKEIEEEAGAL  342
            E+E +VYGGE P+E +M+ ++D A      A+ D +A   Q+L+ MKKRLKE+EEEA AL
Sbjct  3    EEEHEVYGGEIPDEAEMEGEMDAANADIDMARADEDASKLQELDEMKKRLKEMEEEAAAL  62

Query  343  REMQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVN  522
            REMQAKVEKEM+ VQDP +A+A+QA +EEVD+RS++VGNVDYACTPEEVQQHFQSCGTVN
Sbjct  63   REMQAKVEKEMSAVQDPASAAATQASREEVDSRSVFVGNVDYACTPEEVQQHFQSCGTVN  122

Query  523  RVTILTDKFG  552
            RVTILTDKFG
Sbjct  123  RVTILTDKFG  132



>ref|XP_004495250.1| PREDICTED: polyadenylate-binding protein 2-like isoform X2 [Cicer 
arietinum]
Length=216

 Score =   162 bits (411),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 79/93 (85%), Positives = 86/93 (92%), Gaps = 0/93 (0%)
 Frame = +1

Query  274  NAKQDLENMKKRLKEIEEEAGALREMQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYV  453
            +  ++LE+MKKRLKEIEEEA ALREMQAKVEKEM  VQD + +SA+QAEKEEVDARSIYV
Sbjct  39   HTTKELEDMKKRLKEIEEEASALREMQAKVEKEMGAVQDSSGSSATQAEKEEVDARSIYV  98

Query  454  GNVDYACTPEEVQQHFQSCGTVNRVTILTDKFG  552
            GNVDYACTPEEVQQHFQSCGTVNRVTILTDKFG
Sbjct  99   GNVDYACTPEEVQQHFQSCGTVNRVTILTDKFG  131



>gb|KHN30707.1| Polyadenylate-binding protein 2 [Glycine soja]
Length=214

 Score =   162 bits (411),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 81/95 (85%), Positives = 86/95 (91%), Gaps = 1/95 (1%)
 Frame = +1

Query  271  PN-AKQDLENMKKRLKEIEEEAGALREMQAKVEKEMTGVQDPNAASASQAEKEEVDARSI  447
            PN   ++LE+MKKRLKEIEEEA ALREMQAKVEKEM  VQD +  SA+QAEKEEVDARSI
Sbjct  33   PNHTNKELEDMKKRLKEIEEEASALREMQAKVEKEMGAVQDSSGTSATQAEKEEVDARSI  92

Query  448  YVGNVDYACTPEEVQQHFQSCGTVNRVTILTDKFG  552
            YVGNVDYACTPEEVQQHFQSCGTVNRVTILTDKFG
Sbjct  93   YVGNVDYACTPEEVQQHFQSCGTVNRVTILTDKFG  127



>ref|XP_004495249.1| PREDICTED: polyadenylate-binding protein 2-like isoform X1 [Cicer 
arietinum]
Length=218

 Score =   162 bits (411),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 79/93 (85%), Positives = 86/93 (92%), Gaps = 0/93 (0%)
 Frame = +1

Query  274  NAKQDLENMKKRLKEIEEEAGALREMQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYV  453
            +  ++LE+MKKRLKEIEEEA ALREMQAKVEKEM  VQD + +SA+QAEKEEVDARSIYV
Sbjct  39   HTTKELEDMKKRLKEIEEEASALREMQAKVEKEMGAVQDSSGSSATQAEKEEVDARSIYV  98

Query  454  GNVDYACTPEEVQQHFQSCGTVNRVTILTDKFG  552
            GNVDYACTPEEVQQHFQSCGTVNRVTILTDKFG
Sbjct  99   GNVDYACTPEEVQQHFQSCGTVNRVTILTDKFG  131



>ref|XP_007144150.1| hypothetical protein PHAVU_007G133000g [Phaseolus vulgaris]
 gb|ESW16144.1| hypothetical protein PHAVU_007G133000g [Phaseolus vulgaris]
Length=214

 Score =   162 bits (411),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 79/93 (85%), Positives = 85/93 (91%), Gaps = 0/93 (0%)
 Frame = +1

Query  274  NAKQDLENMKKRLKEIEEEAGALREMQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYV  453
            +  ++LE+MKKRLKEIEEEA ALREMQAKVEKEM  VQD +  SA+QAEKEEVDARSIYV
Sbjct  35   HTTKELEDMKKRLKEIEEEASALREMQAKVEKEMGAVQDSSGPSATQAEKEEVDARSIYV  94

Query  454  GNVDYACTPEEVQQHFQSCGTVNRVTILTDKFG  552
            GNVDYACTPEEVQQHFQSCGTVNRVTILTDKFG
Sbjct  95   GNVDYACTPEEVQQHFQSCGTVNRVTILTDKFG  127



>emb|CAN77560.1| hypothetical protein VITISV_031100 [Vitis vinifera]
Length=175

 Score =   161 bits (407),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 77/85 (91%), Positives = 82/85 (96%), Gaps = 0/85 (0%)
 Frame = +1

Query  298  MKKRLKEIEEEAGALREMQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACT  477
            M+KRLKEIEEEAGALREMQAKVEKEM  VQD ++ASA+QAEKEEVD+RSIYVGNVDYACT
Sbjct  1    MRKRLKEIEEEAGALREMQAKVEKEMGAVQDSSSASATQAEKEEVDSRSIYVGNVDYACT  60

Query  478  PEEVQQHFQSCGTVNRVTILTDKFG  552
            PEEVQQHFQSCGTVNRVTILTDKFG
Sbjct  61   PEEVQQHFQSCGTVNRVTILTDKFG  85



>ref|XP_008804765.1| PREDICTED: polyadenylate-binding protein 2-like isoform X1 [Phoenix 
dactylifera]
Length=223

 Score =   162 bits (409),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 88/130 (68%), Positives = 110/130 (85%), Gaps = 2/130 (2%)
 Frame = +1

Query  169  EQEEDVYGGEFPeegdmdadvdmaalaeaeaqedPNAK--QDLENMKKRLKEIEEEAGAL  342
            E+E +VYGGE P+EG+M+ ++D A      ++ D +A   Q+L+ MKKRLKE+EEEA AL
Sbjct  3    EEEHEVYGGEIPDEGEMEGEMDAANADVDMSRADEDASKLQELDEMKKRLKEMEEEAAAL  62

Query  343  REMQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVN  522
            REMQAKVEKEM+ VQDP +A+A+QA +EEVD+RS++VGNVDY+CTPEEVQQHFQSCGTVN
Sbjct  63   REMQAKVEKEMSAVQDPASAAATQASREEVDSRSVFVGNVDYSCTPEEVQQHFQSCGTVN  122

Query  523  RVTILTDKFG  552
            RVTILTDKFG
Sbjct  123  RVTILTDKFG  132



>ref|XP_008381986.1| PREDICTED: polyadenylate-binding protein 2 isoform X1 [Malus 
domestica]
Length=220

 Score =   162 bits (409),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 89/128 (70%), Positives = 104/128 (81%), Gaps = 0/128 (0%)
 Frame = +1

Query  169  EQEEDVYGGEFPeegdmdadvdmaalaeaeaqedPNAKQDLENMKKRLKEIEEEAGALRE  348
            E+E +VYG E P+EG++D D+D        +  D  A ++L+ MKKRLKE+EEEA ALRE
Sbjct  3    EEEHEVYGAEIPDEGELDGDMDAHHADVDMSTADVAAVKELDEMKKRLKEMEEEAAALRE  62

Query  349  MQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRV  528
            MQAKVEKEM  VQDP  A+ASQA +EEVDARS++VGNVDYACTPEEVQQHFQSCGTVNRV
Sbjct  63   MQAKVEKEMGAVQDPAIAAASQANREEVDARSVFVGNVDYACTPEEVQQHFQSCGTVNRV  122

Query  529  TILTDKFG  552
            TILTDKFG
Sbjct  123  TILTDKFG  130



>ref|XP_008453839.1| PREDICTED: polyadenylate-binding protein 2-like isoform X1 [Cucumis 
melo]
Length=230

 Score =   161 bits (407),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 93/133 (70%), Positives = 106/133 (80%), Gaps = 5/133 (4%)
 Frame = +1

Query  169  EQEEDVYGGEFPeegdmda---dvdmaalaeaeaqedPNA-KQDLENMKKRLKEIEEEAG  336
            E E +VYGG+ P++ +MDA        A  E    E  NA  +DLE+MK+RLKEIEEEAG
Sbjct  9    EHEHEVYGGDIPDDAEMDADLDMSSGRADEEGYDAEPSNANSKDLEDMKRRLKEIEEEAG  68

Query  337  ALREMQAKVEKEMTGVQ-DPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCG  513
            ALREMQAKVEKEM  VQ D ++ SA+QAEKEEVD+RS+YVGNVDYACTPEEVQQHFQSCG
Sbjct  69   ALREMQAKVEKEMGAVQEDSSSTSATQAEKEEVDSRSVYVGNVDYACTPEEVQQHFQSCG  128

Query  514  TVNRVTILTDKFG  552
            TVNRVTILTDKFG
Sbjct  129  TVNRVTILTDKFG  141



>ref|XP_010933557.1| PREDICTED: polyadenylate-binding protein 2-like [Elaeis guineensis]
Length=222

 Score =   161 bits (407),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 86/128 (67%), Positives = 103/128 (80%), Gaps = 1/128 (1%)
 Frame = +1

Query  172  QEEDVYGGEFPeegdmdadvdmaalaeaeaqedPNAKQ-DLENMKKRLKEIEEEAGALRE  348
             E DVYG + PEE       +    + A A+++  +K+ ++E MKKR+KEIE+E GALRE
Sbjct  4    HEHDVYGDDIPEEEGEMETDEQEMASAATAEDESTSKEENIEEMKKRMKEIEDETGALRE  63

Query  349  MQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRV  528
            MQAKVEKEM  VQD ++A+A+QAEKEEVD+RSIYVGNVDYACTPEEVQQHFQSCGTVNRV
Sbjct  64   MQAKVEKEMGAVQDSSSAAATQAEKEEVDSRSIYVGNVDYACTPEEVQQHFQSCGTVNRV  123

Query  529  TILTDKFG  552
            TILTDKFG
Sbjct  124  TILTDKFG  131



>ref|NP_001235474.1| uncharacterized protein LOC100527139 [Glycine max]
 gb|ACU16186.1| unknown [Glycine max]
Length=214

 Score =   160 bits (405),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 80/95 (84%), Positives = 85/95 (89%), Gaps = 1/95 (1%)
 Frame = +1

Query  271  PN-AKQDLENMKKRLKEIEEEAGALREMQAKVEKEMTGVQDPNAASASQAEKEEVDARSI  447
            PN   ++LE+MKKRLKEIEEEA ALREMQAKVEKEM  VQD +  SA+QAEKEEVDAR I
Sbjct  33   PNHTNKELEDMKKRLKEIEEEASALREMQAKVEKEMGAVQDSSGTSATQAEKEEVDARPI  92

Query  448  YVGNVDYACTPEEVQQHFQSCGTVNRVTILTDKFG  552
            YVGNVDYACTPEEVQQHFQSCGTVNRVTILTDKFG
Sbjct  93   YVGNVDYACTPEEVQQHFQSCGTVNRVTILTDKFG  127



>gb|ACN41220.1| unknown [Picea sitchensis]
Length=201

 Score =   159 bits (403),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 77/92 (84%), Positives = 83/92 (90%), Gaps = 0/92 (0%)
 Frame = +1

Query  277  AKQDLENMKKRLKEIEEEAGALREMQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVG  456
            A ++LE MKKRLKE+EEEA ALR+MQAKVEKEM  VQDP A++ASQA KEE D RSIYVG
Sbjct  21   AVKELEEMKKRLKEMEEEAAALRDMQAKVEKEMGAVQDPAASAASQATKEEADTRSIYVG  80

Query  457  NVDYACTPEEVQQHFQSCGTVNRVTILTDKFG  552
            NVDYACTPEEVQQHFQSCGTVNRVTILTDKFG
Sbjct  81   NVDYACTPEEVQQHFQSCGTVNRVTILTDKFG  112



>gb|KJB17317.1| hypothetical protein B456_003G040800 [Gossypium raimondii]
Length=206

 Score =   159 bits (403),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 85/128 (66%), Positives = 105/128 (82%), Gaps = 0/128 (0%)
 Frame = +1

Query  169  EQEEDVYGGEFPeegdmdadvdmaalaeaeaqedPNAKQDLENMKKRLKEIEEEAGALRE  348
            E+E +VYGGE P+EG+M+ ++D        +  D +A ++L+ MKKRLKE+E+EA ALRE
Sbjct  3    EEEHEVYGGEIPDEGEMEGELDPQNADVDMSAADEDAVKELDEMKKRLKEMEDEAAALRE  62

Query  349  MQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRV  528
            MQAKVEKEM  VQDP  A+A+QA KEE D+RS++VGNVDYACTPEEVQQHFQSCGTVNRV
Sbjct  63   MQAKVEKEMGAVQDPAGATANQASKEEADSRSVFVGNVDYACTPEEVQQHFQSCGTVNRV  122

Query  529  TILTDKFG  552
            TILTDK+G
Sbjct  123  TILTDKYG  130



>ref|XP_008786202.1| PREDICTED: polyadenylate-binding protein 2-like [Phoenix dactylifera]
Length=222

 Score =   160 bits (404),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 87/128 (68%), Positives = 103/128 (80%), Gaps = 1/128 (1%)
 Frame = +1

Query  172  QEEDVYGGEFPeegdmdadvdmaalaeaeaqedPNAKQ-DLENMKKRLKEIEEEAGALRE  348
             E +VYGG+ PEE       D+   + A A+++  +K+ ++E MKKR+KEIEEE GALRE
Sbjct  4    HEHEVYGGDIPEEEGEMEADDLEMASGATAEDESASKEENIEEMKKRMKEIEEETGALRE  63

Query  349  MQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRV  528
            MQAKVEKEM  VQD + A+A+Q EKEEVD+RSIYVGNVDYACTPEEVQQHFQSCGTVNRV
Sbjct  64   MQAKVEKEMGAVQDSSGAAATQVEKEEVDSRSIYVGNVDYACTPEEVQQHFQSCGTVNRV  123

Query  529  TILTDKFG  552
            TILTDKFG
Sbjct  124  TILTDKFG  131



>ref|XP_003635560.2| PREDICTED: polyadenylate-binding protein 2 [Vitis vinifera]
Length=221

 Score =   159 bits (403),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 87/128 (68%), Positives = 105/128 (82%), Gaps = 0/128 (0%)
 Frame = +1

Query  169  EQEEDVYGGEFPeegdmdadvdmaalaeaeaqedPNAKQDLENMKKRLKEIEEEAGALRE  348
            E+E +VYGGE P+EG+M+ D+D        A  D +A ++L+ MKKRLKE+EEEA ALRE
Sbjct  3    EEEHEVYGGEIPDEGEMEGDMDAHNADVDMATNDDDAVKELDEMKKRLKEMEEEAAALRE  62

Query  349  MQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRV  528
            MQAKVEKEM  VQDP +A+ +QA KEE D+RS++VGNVDYACTPEEVQQHFQSCGTVNRV
Sbjct  63   MQAKVEKEMGAVQDPASAAVTQANKEEADSRSVFVGNVDYACTPEEVQQHFQSCGTVNRV  122

Query  529  TILTDKFG  552
            TILTDK+G
Sbjct  123  TILTDKYG  130



>gb|ABK21856.1| unknown [Picea sitchensis]
Length=215

 Score =   159 bits (403),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 77/92 (84%), Positives = 83/92 (90%), Gaps = 0/92 (0%)
 Frame = +1

Query  277  AKQDLENMKKRLKEIEEEAGALREMQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVG  456
            A ++LE MKKRLKE+EEEA ALR+MQAKVEKEM  VQDP A++ASQA KEE D RSIYVG
Sbjct  35   AVKELEEMKKRLKEMEEEAAALRDMQAKVEKEMGAVQDPAASAASQATKEEADTRSIYVG  94

Query  457  NVDYACTPEEVQQHFQSCGTVNRVTILTDKFG  552
            NVDYACTPEEVQQHFQSCGTVNRVTILTDKFG
Sbjct  95   NVDYACTPEEVQQHFQSCGTVNRVTILTDKFG  126



>gb|KHG00394.1| Polyadenylate-binding 2 [Gossypium arboreum]
Length=221

 Score =   159 bits (403),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 85/128 (66%), Positives = 105/128 (82%), Gaps = 0/128 (0%)
 Frame = +1

Query  169  EQEEDVYGGEFPeegdmdadvdmaalaeaeaqedPNAKQDLENMKKRLKEIEEEAGALRE  348
            E+E +VYGGE P+EG+M+ ++D        +  D +A ++L+ MKKRLKE+E+EA ALRE
Sbjct  3    EEEHEVYGGEIPDEGEMEGELDPQNADVDMSAADEDAVKELDEMKKRLKEMEDEAAALRE  62

Query  349  MQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRV  528
            MQAKVEKEM  VQDP  A+A+QA KEE D+RS++VGNVDYACTPEEVQQHFQSCGTVNRV
Sbjct  63   MQAKVEKEMGAVQDPAGATANQASKEEADSRSVFVGNVDYACTPEEVQQHFQSCGTVNRV  122

Query  529  TILTDKFG  552
            TILTDK+G
Sbjct  123  TILTDKYG  130



>gb|ACU24426.1| unknown [Glycine max]
Length=218

 Score =   159 bits (402),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 91/128 (71%), Positives = 109/128 (85%), Gaps = 0/128 (0%)
 Frame = +1

Query  169  EQEEDVYGGEFPeegdmdadvdmaalaeaeaqedPNAKQDLENMKKRLKEIEEEAGALRE  348
            E+E +VYGGE P+EG+M+ D+DM+A  +  A +D  A ++L+ MK+RLKE+EEEA ALRE
Sbjct  3    EEEHEVYGGEIPDEGEMEGDIDMSAADDEAAVDDDAAVKELDEMKRRLKEMEEEAAALRE  62

Query  349  MQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRV  528
            MQAKVEKE+  VQDP  A+ASQA KEE DARS++VGNVDYACTPEEVQQHFQSCGTVNRV
Sbjct  63   MQAKVEKEIGSVQDPANAAASQANKEEADARSVFVGNVDYACTPEEVQQHFQSCGTVNRV  122

Query  529  TILTDKFG  552
            TILTDKFG
Sbjct  123  TILTDKFG  130



>gb|KJB17319.1| hypothetical protein B456_003G040800 [Gossypium raimondii]
Length=221

 Score =   159 bits (403),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 85/128 (66%), Positives = 105/128 (82%), Gaps = 0/128 (0%)
 Frame = +1

Query  169  EQEEDVYGGEFPeegdmdadvdmaalaeaeaqedPNAKQDLENMKKRLKEIEEEAGALRE  348
            E+E +VYGGE P+EG+M+ ++D        +  D +A ++L+ MKKRLKE+E+EA ALRE
Sbjct  3    EEEHEVYGGEIPDEGEMEGELDPQNADVDMSAADEDAVKELDEMKKRLKEMEDEAAALRE  62

Query  349  MQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRV  528
            MQAKVEKEM  VQDP  A+A+QA KEE D+RS++VGNVDYACTPEEVQQHFQSCGTVNRV
Sbjct  63   MQAKVEKEMGAVQDPAGATANQASKEEADSRSVFVGNVDYACTPEEVQQHFQSCGTVNRV  122

Query  529  TILTDKFG  552
            TILTDK+G
Sbjct  123  TILTDKYG  130



>ref|XP_010267253.1| PREDICTED: polyadenylate-binding protein 2 [Nelumbo nucifera]
Length=221

 Score =   159 bits (403),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 85/128 (66%), Positives = 106/128 (83%), Gaps = 0/128 (0%)
 Frame = +1

Query  169  EQEEDVYGGEFPeegdmdadvdmaalaeaeaqedPNAKQDLENMKKRLKEIEEEAGALRE  348
            E+E +VYGG+ P+EG+M+ D+D         + D +A ++L+ MKKRLKE+EEEA ALRE
Sbjct  3    EEEHEVYGGDIPDEGEMEGDMDGNTADVEMTRADEDAVKELDEMKKRLKEMEEEAAALRE  62

Query  349  MQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRV  528
            MQAKVEKEM  VQDP +A+A+QA +EE D+RS++VGNVDY+CTPEEVQQHFQSCGTVNRV
Sbjct  63   MQAKVEKEMGAVQDPASAAATQASREEADSRSVFVGNVDYSCTPEEVQQHFQSCGTVNRV  122

Query  529  TILTDKFG  552
            TILTDKFG
Sbjct  123  TILTDKFG  130



>ref|NP_001237617.1| uncharacterized protein LOC100527545 [Glycine max]
 gb|ACU16641.1| unknown [Glycine max]
Length=214

 Score =   159 bits (402),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 78/95 (82%), Positives = 85/95 (89%), Gaps = 1/95 (1%)
 Frame = +1

Query  271  PN-AKQDLENMKKRLKEIEEEAGALREMQAKVEKEMTGVQDPNAASASQAEKEEVDARSI  447
            PN   ++LE+MKKRLKEIEEEA ALREMQAKVEKEM  V+D +  SA+Q E+EEVDARSI
Sbjct  33   PNHTNKELEDMKKRLKEIEEEASALREMQAKVEKEMGAVRDSSGTSATQVEREEVDARSI  92

Query  448  YVGNVDYACTPEEVQQHFQSCGTVNRVTILTDKFG  552
            YVGNVDYACTPEEVQQHFQSCGTVNRVTILTDKFG
Sbjct  93   YVGNVDYACTPEEVQQHFQSCGTVNRVTILTDKFG  127



>ref|XP_004146877.1| PREDICTED: polyadenylate-binding protein 2-like [Cucumis sativus]
Length=212

 Score =   159 bits (401),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 91/128 (71%), Positives = 105/128 (82%), Gaps = 7/128 (5%)
 Frame = +1

Query  169  EQEEDVYGGEFPeegdmdadvdmaalaeaeaqedPNAKQDLENMKKRLKEIEEEAGALRE  348
            E+E +VYGGE P EG+M+ DVDM+A  +       +A ++L+ MKKRLKE+EEEA ALRE
Sbjct  3    EEEHEVYGGEIPVEGEMEGDVDMSAGDD-------DAVKELDEMKKRLKEMEEEAAALRE  55

Query  349  MQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRV  528
            MQAKVEKEM  VQDP   SASQA KEE D+RS++VGNVDYACTPEEVQQHFQSCGTVNRV
Sbjct  56   MQAKVEKEMGAVQDPAGTSASQAGKEETDSRSVFVGNVDYACTPEEVQQHFQSCGTVNRV  115

Query  529  TILTDKFG  552
            TILTDKFG
Sbjct  116  TILTDKFG  123



>ref|XP_010062822.1| PREDICTED: polyadenylate-binding protein 2 isoform X2 [Eucalyptus 
grandis]
 gb|KCW90904.1| hypothetical protein EUGRSUZ_A02940 [Eucalyptus grandis]
Length=229

 Score =   159 bits (402),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 78/95 (82%), Positives = 87/95 (92%), Gaps = 1/95 (1%)
 Frame = +1

Query  271  PNAK-QDLENMKKRLKEIEEEAGALREMQAKVEKEMTGVQDPNAASASQAEKEEVDARSI  447
            PN+  ++LE+MKKRLKEI+EEAGALRE+QAKVEKEM  V D ++ SA+ AEKEEVDARSI
Sbjct  49   PNSSSKELEDMKKRLKEIDEEAGALRELQAKVEKEMGAVPDSSSTSATMAEKEEVDARSI  108

Query  448  YVGNVDYACTPEEVQQHFQSCGTVNRVTILTDKFG  552
            YVGNVDYACTPEEVQQHFQSCGTVNRVTILTDKFG
Sbjct  109  YVGNVDYACTPEEVQQHFQSCGTVNRVTILTDKFG  143



>ref|XP_010536563.1| PREDICTED: polyadenylate-binding protein 2 [Tarenaya hassleriana]
Length=227

 Score =   159 bits (401),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 77/93 (83%), Positives = 84/93 (90%), Gaps = 0/93 (0%)
 Frame = +1

Query  274  NAKQDLENMKKRLKEIEEEAGALREMQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYV  453
            +  +DLE MKKRL+EIEEEAGALREMQAKVEKEM   QD ++AS S AEKEEVD+RSIYV
Sbjct  49   SGSKDLEEMKKRLQEIEEEAGALREMQAKVEKEMGSGQDSSSASPSLAEKEEVDSRSIYV  108

Query  454  GNVDYACTPEEVQQHFQSCGTVNRVTILTDKFG  552
            GNVDYACTPEEVQ+HFQSCGTVNRVTILTDKFG
Sbjct  109  GNVDYACTPEEVQEHFQSCGTVNRVTILTDKFG  141



>ref|XP_006585263.1| PREDICTED: polyadenylate-binding protein 2-A [Glycine max]
Length=218

 Score =   158 bits (400),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 91/128 (71%), Positives = 109/128 (85%), Gaps = 0/128 (0%)
 Frame = +1

Query  169  EQEEDVYGGEFPeegdmdadvdmaalaeaeaqedPNAKQDLENMKKRLKEIEEEAGALRE  348
            E+E +VYGGE P+EG+M+ D+DM+A  +  A +D  A ++L+ MK+RLKE+EEEA ALRE
Sbjct  3    EEEHEVYGGEIPDEGEMEGDIDMSAADDEAAVDDDAAVKELDEMKRRLKEMEEEAAALRE  62

Query  349  MQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRV  528
            MQAKVEKE+  VQDP  A+ASQA KEE DARS++VGNVDYACTPEEVQQHFQSCGTVNRV
Sbjct  63   MQAKVEKEIGSVQDPANAAASQANKEEADARSVFVGNVDYACTPEEVQQHFQSCGTVNRV  122

Query  529  TILTDKFG  552
            TILTDKFG
Sbjct  123  TILTDKFG  130



>gb|KCW90905.1| hypothetical protein EUGRSUZ_A02940 [Eucalyptus grandis]
Length=232

 Score =   159 bits (401),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 78/95 (82%), Positives = 87/95 (92%), Gaps = 1/95 (1%)
 Frame = +1

Query  271  PNAK-QDLENMKKRLKEIEEEAGALREMQAKVEKEMTGVQDPNAASASQAEKEEVDARSI  447
            PN+  ++LE+MKKRLKEI+EEAGALRE+QAKVEKEM  V D ++ SA+ AEKEEVDARSI
Sbjct  49   PNSSSKELEDMKKRLKEIDEEAGALRELQAKVEKEMGAVPDSSSTSATMAEKEEVDARSI  108

Query  448  YVGNVDYACTPEEVQQHFQSCGTVNRVTILTDKFG  552
            YVGNVDYACTPEEVQQHFQSCGTVNRVTILTDKFG
Sbjct  109  YVGNVDYACTPEEVQQHFQSCGTVNRVTILTDKFG  143



>ref|XP_010062812.1| PREDICTED: polyadenylate-binding protein 2 isoform X1 [Eucalyptus 
grandis]
 gb|KCW90906.1| hypothetical protein EUGRSUZ_A02940 [Eucalyptus grandis]
Length=233

 Score =   159 bits (401),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 78/95 (82%), Positives = 87/95 (92%), Gaps = 1/95 (1%)
 Frame = +1

Query  271  PNAK-QDLENMKKRLKEIEEEAGALREMQAKVEKEMTGVQDPNAASASQAEKEEVDARSI  447
            PN+  ++LE+MKKRLKEI+EEAGALRE+QAKVEKEM  V D ++ SA+ AEKEEVDARSI
Sbjct  49   PNSSSKELEDMKKRLKEIDEEAGALRELQAKVEKEMGAVPDSSSTSATMAEKEEVDARSI  108

Query  448  YVGNVDYACTPEEVQQHFQSCGTVNRVTILTDKFG  552
            YVGNVDYACTPEEVQQHFQSCGTVNRVTILTDKFG
Sbjct  109  YVGNVDYACTPEEVQQHFQSCGTVNRVTILTDKFG  143



>ref|XP_007047888.1| RNA-binding (RRM/RBD/RNP motifs) family protein isoform 1 [Theobroma 
cacao]
 gb|EOX92045.1| RNA-binding (RRM/RBD/RNP motifs) family protein isoform 1 [Theobroma 
cacao]
Length=221

 Score =   158 bits (400),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 85/128 (66%), Positives = 105/128 (82%), Gaps = 0/128 (0%)
 Frame = +1

Query  169  EQEEDVYGGEFPeegdmdadvdmaalaeaeaqedPNAKQDLENMKKRLKEIEEEAGALRE  348
            E+E +VYGGE P+EG+M+ D+D        +  D +A ++L+ MKKRLKE+E+EA ALRE
Sbjct  3    EEEHEVYGGEIPDEGEMEGDLDPHNADVDMSAADDDAVKELDEMKKRLKEMEDEAAALRE  62

Query  349  MQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRV  528
            MQAKVEKEM  VQDP  A+A+QA +EE D+RS++VGNVDYACTPEEVQQHFQSCGTVNRV
Sbjct  63   MQAKVEKEMGAVQDPAGAAANQASREEADSRSVFVGNVDYACTPEEVQQHFQSCGTVNRV  122

Query  529  TILTDKFG  552
            TILTDK+G
Sbjct  123  TILTDKYG  130



>ref|XP_010937392.1| PREDICTED: polyadenylate-binding protein 2 isoform X3 [Elaeis 
guineensis]
Length=221

 Score =   158 bits (400),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 86/128 (67%), Positives = 106/128 (83%), Gaps = 0/128 (0%)
 Frame = +1

Query  169  EQEEDVYGGEFPeegdmdadvdmaalaeaeaqedPNAKQDLENMKKRLKEIEEEAGALRE  348
            E+E +VYG + P+EG+M+ D+D         + D +A ++L+ MKKRLKE+EEEA ALRE
Sbjct  3    EEEHEVYGQDIPDEGEMEGDIDPHGADVDMTRADDDAVKELDEMKKRLKEMEEEAAALRE  62

Query  349  MQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRV  528
            MQAKVEKEM  VQDP +A+A+QA +EEVD+RS++VGNVDYACTPEEVQQHFQSCGTVNRV
Sbjct  63   MQAKVEKEMGAVQDPASAAATQASREEVDSRSVFVGNVDYACTPEEVQQHFQSCGTVNRV  122

Query  529  TILTDKFG  552
            TILTDKFG
Sbjct  123  TILTDKFG  130



>ref|XP_011084771.1| PREDICTED: polyadenylate-binding protein 1-like [Sesamum indicum]
Length=228

 Score =   158 bits (400),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 93/132 (70%), Positives = 107/132 (81%), Gaps = 4/132 (3%)
 Frame = +1

Query  169  EQEEDVYGGEFPeegdmda--dvdmaalaeaeaqedPNAKQDLENMKKRLKEIEEEAGAL  342
            EQE+DVYGG+ PEE  M++  D    A A A A    +  ++LENMKKRL+EIEE+AGAL
Sbjct  8    EQEDDVYGGDLPEEAYMESDFDSSADADAAAAAAAADDKAKELENMKKRLQEIEEQAGAL  67

Query  343  REMQAKVEKEMTGV--QDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGT  516
            REMQAKVEKE+ G   +D   ASA+QAEKEEVD+RSIYVGNVDYACTPEEVQQHFQSCGT
Sbjct  68   REMQAKVEKEIGGAAPEDSTGASAAQAEKEEVDSRSIYVGNVDYACTPEEVQQHFQSCGT  127

Query  517  VNRVTILTDKFG  552
            VNRVTILTDK+G
Sbjct  128  VNRVTILTDKYG  139



>ref|XP_009404041.1| PREDICTED: polyadenylate-binding protein 2-like isoform X4 [Musa 
acuminata subsp. malaccensis]
Length=214

 Score =   158 bits (399),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 90/128 (70%), Positives = 105/128 (82%), Gaps = 7/128 (5%)
 Frame = +1

Query  169  EQEEDVYGGEFPeegdmdadvdmaalaeaeaqedPNAKQDLENMKKRLKEIEEEAGALRE  348
            E+E +VYGGE P+E DMDADVD+    E       +A ++L+ MKKRLKE+EEEA ALRE
Sbjct  3    EEEHEVYGGEIPDEADMDADVDIGRSDE-------DAAKELDEMKKRLKEMEEEAAALRE  55

Query  349  MQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRV  528
            +QAKVEKEM   QDP  ++A+QA KEEVDARS++VGNVDYACTPEEVQQHFQSCGTVNRV
Sbjct  56   IQAKVEKEMGAAQDPAGSAATQASKEEVDARSVFVGNVDYACTPEEVQQHFQSCGTVNRV  115

Query  529  TILTDKFG  552
            TILTDKFG
Sbjct  116  TILTDKFG  123



>ref|XP_010523297.1| PREDICTED: polyadenylate-binding protein 2-like [Tarenaya hassleriana]
Length=199

 Score =   157 bits (397),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 74/93 (80%), Positives = 85/93 (91%), Gaps = 0/93 (0%)
 Frame = +1

Query  274  NAKQDLENMKKRLKEIEEEAGALREMQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYV  453
            +A ++L+ MKKRLKE+EEEA ALREMQAKVEKEM  VQDP + +A+QA KEEVD+RS++V
Sbjct  16   DAVKELDEMKKRLKEMEEEAAALREMQAKVEKEMGAVQDPASMAANQASKEEVDSRSVFV  75

Query  454  GNVDYACTPEEVQQHFQSCGTVNRVTILTDKFG  552
            GNVDYACTPEEVQQHFQSCGTVNRVTILTDKFG
Sbjct  76   GNVDYACTPEEVQQHFQSCGTVNRVTILTDKFG  108



>ref|XP_004504101.1| PREDICTED: polyadenylate-binding protein 2-A-like [Cicer arietinum]
Length=221

 Score =   158 bits (399),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 85/128 (66%), Positives = 102/128 (80%), Gaps = 0/128 (0%)
 Frame = +1

Query  169  EQEEDVYGGEFPeegdmdadvdmaalaeaeaqedPNAKQDLENMKKRLKEIEEEAGALRE  348
            E+E +VYGGE P+ G+M+ D+DM+   +  A        DL+ M++RLKE+E+EA ALRE
Sbjct  3    EEEHEVYGGEIPDVGEMEGDIDMSTADDEAAGVKQLGDMDLDEMRRRLKEMEDEAAALRE  62

Query  349  MQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRV  528
            M AKVEKE+  VQDP A +ASQA KEE DARS++VGNVDYACTPEEVQQHFQSCGTVNRV
Sbjct  63   MHAKVEKEIGSVQDPAAVAASQANKEETDARSVFVGNVDYACTPEEVQQHFQSCGTVNRV  122

Query  529  TILTDKFG  552
            TILTDKFG
Sbjct  123  TILTDKFG  130



>ref|XP_002306300.1| hypothetical protein POPTR_0005s07440g [Populus trichocarpa]
 gb|EEE93296.1| hypothetical protein POPTR_0005s07440g [Populus trichocarpa]
Length=218

 Score =   158 bits (399),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 82/128 (64%), Positives = 97/128 (76%), Gaps = 3/128 (2%)
 Frame = +1

Query  169  EQEEDVYGGEFPeegdmdadvdmaalaeaeaqedPNAKQDLENMKKRLKEIEEEAGALRE  348
            E+E +VYGGE P+        +      A      +A ++L+ MKKRLKE+EEEA ALRE
Sbjct  3    EEEHEVYGGEIPDVEGDMDPHNADVDMSAADD---DAVKELDEMKKRLKEMEEEAAALRE  59

Query  349  MQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRV  528
            MQAKVEKEM  VQDP  A+A+QA +EE D+RS++VGNVDYACTPEEVQQHFQSCGTVNRV
Sbjct  60   MQAKVEKEMGAVQDPATAAANQANREEADSRSVFVGNVDYACTPEEVQQHFQSCGTVNRV  119

Query  529  TILTDKFG  552
            TILTDKFG
Sbjct  120  TILTDKFG  127



>ref|XP_011031058.1| PREDICTED: polyadenylate-binding protein 3-like isoform X1 [Populus 
euphratica]
Length=218

 Score =   157 bits (398),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 82/128 (64%), Positives = 97/128 (76%), Gaps = 3/128 (2%)
 Frame = +1

Query  169  EQEEDVYGGEFPeegdmdadvdmaalaeaeaqedPNAKQDLENMKKRLKEIEEEAGALRE  348
            E+E +VYGGE P+        +      A      +A ++L+ MKKRLKE+EEEA ALRE
Sbjct  3    EEEHEVYGGEIPDVEGDMDPHNADVDMSAADD---DAVKELDEMKKRLKEMEEEAAALRE  59

Query  349  MQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRV  528
            MQAKVEKEM  VQDP  A+A+QA +EE D+RS++VGNVDYACTPEEVQQHFQSCGTVNRV
Sbjct  60   MQAKVEKEMGAVQDPATAAANQANREEADSRSVFVGNVDYACTPEEVQQHFQSCGTVNRV  119

Query  529  TILTDKFG  552
            TILTDKFG
Sbjct  120  TILTDKFG  127



>ref|XP_006366227.1| PREDICTED: polyadenylate-binding protein 2-A-like [Solanum tuberosum]
Length=216

 Score =   157 bits (398),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 87/128 (68%), Positives = 104/128 (81%), Gaps = 6/128 (5%)
 Frame = +1

Query  169  EQEEDVYGGEFPeegdmdadvdmaalaeaeaqedPNAKQDLENMKKRLKEIEEEAGALRE  348
            E+E +VYGGE P E +M+AD+D    A+       +A ++L+ MKKRLKE+E+EA ALRE
Sbjct  3    EEEHEVYGGEIPMEAEMEADMDNHPAADE------DAVKELDEMKKRLKEMEDEAAALRE  56

Query  349  MQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRV  528
            MQAKVEKEM  VQDP  A ASQA +EE+D+RSI+VGNVDYACTPEEVQQHFQ+CGTVNRV
Sbjct  57   MQAKVEKEMGSVQDPANADASQANREELDSRSIFVGNVDYACTPEEVQQHFQACGTVNRV  116

Query  529  TILTDKFG  552
            TILTDKFG
Sbjct  117  TILTDKFG  124



>ref|XP_007148398.1| hypothetical protein PHAVU_006G205100g [Phaseolus vulgaris]
 gb|ESW20392.1| hypothetical protein PHAVU_006G205100g [Phaseolus vulgaris]
Length=195

 Score =   157 bits (396),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 73/93 (78%), Positives = 85/93 (91%), Gaps = 0/93 (0%)
 Frame = +1

Query  274  NAKQDLENMKKRLKEIEEEAGALREMQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYV  453
            +A ++L++MKKRLKE+E+EA ALREMQAKVEKEM  VQDP  ASASQA +EEVD+RS++V
Sbjct  11   DANEELDDMKKRLKEMEDEAAALREMQAKVEKEMGSVQDPATASASQANREEVDSRSVFV  70

Query  454  GNVDYACTPEEVQQHFQSCGTVNRVTILTDKFG  552
            GNVDY+CTPEEVQQHFQSCGTVNRVTI TDKFG
Sbjct  71   GNVDYSCTPEEVQQHFQSCGTVNRVTIRTDKFG  103



>ref|XP_010519384.1| PREDICTED: polyadenylate-binding protein 2-like isoform X1 [Tarenaya 
hassleriana]
Length=221

 Score =   157 bits (398),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 85/128 (66%), Positives = 103/128 (80%), Gaps = 0/128 (0%)
 Frame = +1

Query  169  EQEEDVYGGEFPeegdmdadvdmaalaeaeaqedPNAKQDLENMKKRLKEIEEEAGALRE  348
            E+E +VYGGE P+ G+M+ +VD        +  D +A ++L+ MKKRLKE+EEEA ALRE
Sbjct  3    EEEHEVYGGEIPDVGEMEGEVDAPNPDIDMSAADEDAVKELDEMKKRLKEMEEEAAALRE  62

Query  349  MQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRV  528
            MQAKVEKEM  V DP   +A+QA KEEVD+RS++VGNVDYACTPEEVQQHFQ+CGTVNRV
Sbjct  63   MQAKVEKEMGAVPDPAGMAANQASKEEVDSRSVFVGNVDYACTPEEVQQHFQACGTVNRV  122

Query  529  TILTDKFG  552
            TILTDKFG
Sbjct  123  TILTDKFG  130



>ref|XP_008453809.1| PREDICTED: polyadenylate-binding protein 2 isoform X1 [Cucumis 
melo]
Length=212

 Score =   157 bits (397),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 90/128 (70%), Positives = 104/128 (81%), Gaps = 7/128 (5%)
 Frame = +1

Query  169  EQEEDVYGGEFPeegdmdadvdmaalaeaeaqedPNAKQDLENMKKRLKEIEEEAGALRE  348
            E+E +VYGGE P EG+M+ DVDM+A  +       +A ++L+ MKKRLKE+EEEA ALRE
Sbjct  3    EEEHEVYGGEIPVEGEMEGDVDMSAGDD-------DAVKELDEMKKRLKEMEEEAAALRE  55

Query  349  MQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRV  528
            MQAKVEKEM  VQDP   SA QA KEE D+RS++VGNVDYACTPEEVQQHFQSCGTVNRV
Sbjct  56   MQAKVEKEMGAVQDPAGTSAGQAGKEETDSRSVFVGNVDYACTPEEVQQHFQSCGTVNRV  115

Query  529  TILTDKFG  552
            TILTDKFG
Sbjct  116  TILTDKFG  123



>ref|XP_009140879.1| PREDICTED: polyadenylate-binding protein 2-like [Brassica rapa]
 emb|CDY05837.1| BnaA10g05830D [Brassica napus]
Length=227

 Score =   157 bits (398),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 89/137 (65%), Positives = 102/137 (74%), Gaps = 10/137 (7%)
 Frame = +1

Query  169  EQEEDVYGGEFPeegdmdadvdmaalaeaeaqedP---------NAKQDLENMKKRLKEI  321
            EQE +VYGG+ PEE + + + D       E              +A +DLE+MKKR+KEI
Sbjct  6    EQEHEVYGGDIPEEEEGEMETDEYEEYVGEEGAAAGGDEELEPGSASRDLEDMKKRIKEI  65

Query  322  EEEAGALREMQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHF  501
            EEEAGALREMQAK EK+M   QDP+ A +S AEKEEVD+RSIYVGNVDYACTPEEVQQHF
Sbjct  66   EEEAGALREMQAKAEKDMGAGQDPSNAISS-AEKEEVDSRSIYVGNVDYACTPEEVQQHF  124

Query  502  QSCGTVNRVTILTDKFG  552
            QSCGTVNRVTILTDKFG
Sbjct  125  QSCGTVNRVTILTDKFG  141



>ref|XP_009404040.1| PREDICTED: polyadenylate-binding protein 2-like isoform X3 [Musa 
acuminata subsp. malaccensis]
Length=216

 Score =   157 bits (397),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 91/128 (71%), Positives = 105/128 (82%), Gaps = 5/128 (4%)
 Frame = +1

Query  169  EQEEDVYGGEFPeegdmdadvdmaalaeaeaqedPNAKQDLENMKKRLKEIEEEAGALRE  348
            E+E +VYGGE P+E DMDADVD+    E  A+      Q+L+ MKKRLKE+EEEA ALRE
Sbjct  3    EEEHEVYGGEIPDEADMDADVDIGRSDEDAAKL-----QELDEMKKRLKEMEEEAAALRE  57

Query  349  MQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRV  528
            +QAKVEKEM   QDP  ++A+QA KEEVDARS++VGNVDYACTPEEVQQHFQSCGTVNRV
Sbjct  58   IQAKVEKEMGAAQDPAGSAATQASKEEVDARSVFVGNVDYACTPEEVQQHFQSCGTVNRV  117

Query  529  TILTDKFG  552
            TILTDKFG
Sbjct  118  TILTDKFG  125



>ref|XP_006838494.1| hypothetical protein AMTR_s00002p00165660 [Amborella trichopoda]
 gb|ERN01063.1| hypothetical protein AMTR_s00002p00165660 [Amborella trichopoda]
Length=205

 Score =   157 bits (396),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 92/123 (75%), Positives = 103/123 (84%), Gaps = 8/123 (7%)
 Frame = +1

Query  184  VYGGEFPeegdmdadvdmaalaeaeaqedPNAKQDLENMKKRLKEIEEEAGALREMQAKV  363
            VYGGE PE+G+MD D  MAA  E        + ++LE+MKKRLKEIEEEAGALREMQAKV
Sbjct  16   VYGGEIPEDGEMDGDTVMAATEEDA------SAKELEDMKKRLKEIEEEAGALREMQAKV  69

Query  364  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  543
            EKEM  VQDP  ++A+QA KEEVD+RS+YVGNVDYACTPEEVQQHFQSCGTVNRVTILTD
Sbjct  70   EKEMGVVQDP--SNATQASKEEVDSRSVYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  127

Query  544  KFG  552
            KFG
Sbjct  128  KFG  130



>gb|AFK45716.1| unknown [Lotus japonicus]
Length=218

 Score =   157 bits (397),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 80/94 (85%), Positives = 85/94 (90%), Gaps = 3/94 (3%)
 Frame = +1

Query  271  PNAKQDLENMKKRLKEIEEEAGALREMQAKVEKEMTGVQDPNAASASQAEKEEVDARSIY  450
            PN  +DLE+MKKRLKEIEEEA ALREMQAKVEK+M  VQD   +SA+QAEKEEVD RSIY
Sbjct  40   PN--KDLEDMKKRLKEIEEEASALREMQAKVEKDMGAVQD-AGSSATQAEKEEVDGRSIY  96

Query  451  VGNVDYACTPEEVQQHFQSCGTVNRVTILTDKFG  552
            VGNVDYACTPEEVQQHFQSCGTVNRVTILTDKFG
Sbjct  97   VGNVDYACTPEEVQQHFQSCGTVNRVTILTDKFG  130



>ref|XP_002309968.1| hypothetical protein POPTR_0007s05140g [Populus trichocarpa]
 gb|EEE90418.1| hypothetical protein POPTR_0007s05140g [Populus trichocarpa]
Length=218

 Score =   157 bits (397),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 82/128 (64%), Positives = 97/128 (76%), Gaps = 3/128 (2%)
 Frame = +1

Query  169  EQEEDVYGGEFPeegdmdadvdmaalaeaeaqedPNAKQDLENMKKRLKEIEEEAGALRE  348
            E+E +VYGGE P+        +      A      +A ++L+ MKKRLKE+EEEA ALRE
Sbjct  3    EEEHEVYGGEIPDVEGDMDPHNADVDMSAAED---DAVKELDEMKKRLKEMEEEAAALRE  59

Query  349  MQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRV  528
            MQAKVEKEM  V DP +A+A+QA KEE D+RS++VGNVDYACTPEEVQQHFQSCGTVNRV
Sbjct  60   MQAKVEKEMGAVPDPASAAANQANKEEADSRSVFVGNVDYACTPEEVQQHFQSCGTVNRV  119

Query  529  TILTDKFG  552
            TILTDKFG
Sbjct  120  TILTDKFG  127



>ref|XP_011022817.1| PREDICTED: polyadenylate-binding protein 2-like isoform X1 [Populus 
euphratica]
Length=218

 Score =   157 bits (396),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 82/128 (64%), Positives = 97/128 (76%), Gaps = 3/128 (2%)
 Frame = +1

Query  169  EQEEDVYGGEFPeegdmdadvdmaalaeaeaqedPNAKQDLENMKKRLKEIEEEAGALRE  348
            E+E +VYGGE P+        +      A      +A ++L+ MKKRLKE+EEEA ALRE
Sbjct  3    EEEHEVYGGEIPDVEGDMDPHNADVDMSAAED---DAVKELDEMKKRLKEMEEEAAALRE  59

Query  349  MQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRV  528
            MQAKVEKEM  V DP +A+A+QA KEE D+RS++VGNVDYACTPEEVQQHFQSCGTVNRV
Sbjct  60   MQAKVEKEMGAVPDPASAAANQANKEEADSRSVFVGNVDYACTPEEVQQHFQSCGTVNRV  119

Query  529  TILTDKFG  552
            TILTDKFG
Sbjct  120  TILTDKFG  127



>gb|AFK37159.1| unknown [Lotus japonicus]
Length=217

 Score =   157 bits (396),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 80/94 (85%), Positives = 85/94 (90%), Gaps = 3/94 (3%)
 Frame = +1

Query  271  PNAKQDLENMKKRLKEIEEEAGALREMQAKVEKEMTGVQDPNAASASQAEKEEVDARSIY  450
            PN  +DLE+MKKRLKEIEEEA ALREMQAKVEK+M  VQD   +SA+QAEKEEVD RSIY
Sbjct  40   PN--KDLEDMKKRLKEIEEEASALREMQAKVEKDMGAVQD-AGSSATQAEKEEVDGRSIY  96

Query  451  VGNVDYACTPEEVQQHFQSCGTVNRVTILTDKFG  552
            VGNVDYACTPEEVQQHFQSCGTVNRVTILTDKFG
Sbjct  97   VGNVDYACTPEEVQQHFQSCGTVNRVTILTDKFG  130



>gb|KJB19596.1| hypothetical protein B456_003G110600 [Gossypium raimondii]
Length=227

 Score =   157 bits (397),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 91/135 (67%), Positives = 101/135 (75%), Gaps = 11/135 (8%)
 Frame = +1

Query  172  QEEDVYGGEFPeegdm-------dadvdmaalaeaeaqedPNA-KQDLENMKKRLKEIEE  327
            QE +VYGGE P+E              +     + E + DPN+  +DLE+MKKRLKEIEE
Sbjct  7    QEHEVYGGEIPDEEGEMDADIDISGAAEDYEGNDQELEHDPNSNSKDLEDMKKRLKEIEE  66

Query  328  EAGALREMQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQS  507
            EAGALREMQAKVEKEM  VQD   ASA+QAEKEEVD+RSIY   VDYACTPEEVQQHFQS
Sbjct  67   EAGALREMQAKVEKEMGAVQDSPGASATQAEKEEVDSRSIY---VDYACTPEEVQQHFQS  123

Query  508  CGTVNRVTILTDKFG  552
            CGTVNRVTILTDKFG
Sbjct  124  CGTVNRVTILTDKFG  138



>ref|XP_002511038.1| polyadenylate-binding protein, putative [Ricinus communis]
 gb|EEF51640.1| polyadenylate-binding protein, putative [Ricinus communis]
Length=234

 Score =   157 bits (397),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 82/110 (75%), Positives = 88/110 (80%), Gaps = 17/110 (15%)
 Frame = +1

Query  271  PNAKQDLENMKKRLKEIEEEAGALREMQAKVEKEMTGVQD----------------PNAA  402
            PN+K DLE+MKKRLKEIEEEAGALREMQAKVEKEM  VQ                  ++ 
Sbjct  50   PNSK-DLEDMKKRLKEIEEEAGALREMQAKVEKEMGAVQGISHSLPLSIYIVLWSYSSSG  108

Query  403  SASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTDKFG  552
            SA+QAEKEEVD+RSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTDKFG
Sbjct  109  SATQAEKEEVDSRSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTDKFG  158



>emb|CDX71690.1| BnaC09g27310D [Brassica napus]
Length=227

 Score =   157 bits (396),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 89/139 (64%), Positives = 104/139 (75%), Gaps = 10/139 (7%)
 Frame = +1

Query  163  NPEQEEDVYGGEFPeegdmdadvdmaalaeaeaqedP---------NAKQDLENMKKRLK  315
            N EQE +VYGG+ PEE + + + D       E              +A +DLE+MKKR+K
Sbjct  4    NDEQEHEVYGGDIPEEEEGEMETDEYEEYVGEEGAAAGGDEKLKPGSASRDLEDMKKRIK  63

Query  316  EIEEEAGALREMQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQ  495
            EIEEEAGALREMQAK EK+M   QDP++A +S AEKEEVD+RSI+VGNVDYACTPEEVQQ
Sbjct  64   EIEEEAGALREMQAKAEKDMGAGQDPSSAISS-AEKEEVDSRSIHVGNVDYACTPEEVQQ  122

Query  496  HFQSCGTVNRVTILTDKFG  552
            HFQSCGTVNRVTILTDKFG
Sbjct  123  HFQSCGTVNRVTILTDKFG  141



>ref|XP_008777640.1| PREDICTED: polyadenylate-binding protein 2-like [Phoenix dactylifera]
Length=221

 Score =   157 bits (396),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 85/128 (66%), Positives = 106/128 (83%), Gaps = 0/128 (0%)
 Frame = +1

Query  169  EQEEDVYGGEFPeegdmdadvdmaalaeaeaqedPNAKQDLENMKKRLKEIEEEAGALRE  348
            E+E +VYG + P+EG+M+ D+D         + D +A ++L+ MKKRLK++EEEA ALRE
Sbjct  3    EEEHEVYGQDIPDEGEMEGDIDPHGADVDMTRADDDAVKELDEMKKRLKDMEEEATALRE  62

Query  349  MQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRV  528
            MQAKVEKEM  VQDP +A+A+QA +EEVD+RS++VGNVDYACTPEEVQQHFQSCGTVNRV
Sbjct  63   MQAKVEKEMGAVQDPASAAATQASREEVDSRSVFVGNVDYACTPEEVQQHFQSCGTVNRV  122

Query  529  TILTDKFG  552
            TILTDKFG
Sbjct  123  TILTDKFG  130



>gb|AFK33976.1| unknown [Medicago truncatula]
Length=170

 Score =   155 bits (391),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 74/93 (80%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = +1

Query  274  NAKQDLENMKKRLKEIEEEAGALREMQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYV  453
            N + DL++MKKRLKE+E+EA AL+EMQAKVEKEM  VQDP  ASASQ  +EEVDARSI+V
Sbjct  13   NNEADLDDMKKRLKEMEDEAAALKEMQAKVEKEMGSVQDPANASASQINREEVDARSIFV  72

Query  454  GNVDYACTPEEVQQHFQSCGTVNRVTILTDKFG  552
            GNVDYACTPE+VQQHFQSCGTVNRVTI TDKFG
Sbjct  73   GNVDYACTPEDVQQHFQSCGTVNRVTIRTDKFG  105



>ref|XP_004164242.1| PREDICTED: polyadenylate-binding protein 2-like [Cucumis sativus]
Length=212

 Score =   156 bits (394),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 90/128 (70%), Positives = 104/128 (81%), Gaps = 7/128 (5%)
 Frame = +1

Query  169  EQEEDVYGGEFPeegdmdadvdmaalaeaeaqedPNAKQDLENMKKRLKEIEEEAGALRE  348
            E+E +VYGGE P EG+M+ DVDM+A  +       +A ++L+ MKKRLKE+EEEA ALRE
Sbjct  3    EEEHEVYGGEIPVEGEMEGDVDMSAGDD-------DAVKELDEMKKRLKEMEEEAAALRE  55

Query  349  MQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRV  528
            MQAKV KEM  VQDP   SASQA KEE D+RS++VGNVDYACTPEEVQQHFQSCGTVNRV
Sbjct  56   MQAKVGKEMGAVQDPAGTSASQAGKEETDSRSVFVGNVDYACTPEEVQQHFQSCGTVNRV  115

Query  529  TILTDKFG  552
            TILTDKFG
Sbjct  116  TILTDKFG  123



>ref|XP_002531675.1| poly-A binding protein, putative [Ricinus communis]
 gb|EEF30719.1| poly-A binding protein, putative [Ricinus communis]
Length=218

 Score =   156 bits (394),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 83/128 (65%), Positives = 99/128 (77%), Gaps = 3/128 (2%)
 Frame = +1

Query  169  EQEEDVYGGEFPeegdmdadvdmaalaeaeaqedPNAKQDLENMKKRLKEIEEEAGALRE  348
            E+E +VYGGE P+        ++     A      +A ++L+ MKKRLKE+EEEA ALRE
Sbjct  3    EEEHEVYGGEIPDMEGDIDPHNVDMDMSAADD---DAVKELDEMKKRLKEMEEEAAALRE  59

Query  349  MQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRV  528
            MQAKVEKEM  VQDP +A+A+QA KEE D+RS++VGNVDYACTPEEVQQHFQSCGTVNRV
Sbjct  60   MQAKVEKEMGAVQDPASAAANQANKEETDSRSVFVGNVDYACTPEEVQQHFQSCGTVNRV  119

Query  529  TILTDKFG  552
            TILTDKFG
Sbjct  120  TILTDKFG  127



>gb|EYU20156.1| hypothetical protein MIMGU_mgv1a008942mg [Erythranthe guttata]
Length=357

 Score =   159 bits (403),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 94/129 (73%), Positives = 106/129 (82%), Gaps = 4/129 (3%)
 Frame = +1

Query  169  EQEEDVYGGEFPeegdmdadvdmaalaeaeaqedPNAKQDLENMKKRLKEIEEEAGALRE  348
            EQ++DVYGG+ PE+  M++D D +A AEA      +  ++LE MKKRL+EIEEEAGALRE
Sbjct  143  EQDDDVYGGDVPEDAYMESDFDPSADAEAAED---SKSKELEGMKKRLQEIEEEAGALRE  199

Query  349  MQAKVEKEMTGVQ-DPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNR  525
            MQAKVEKEM   Q D    SA+QAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNR
Sbjct  200  MQAKVEKEMVSNQEDSTGGSANQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNR  259

Query  526  VTILTDKFG  552
            VTILTDKFG
Sbjct  260  VTILTDKFG  268



>gb|KGN53209.1| hypothetical protein Csa_4G026860 [Cucumis sativus]
Length=234

 Score =   156 bits (394),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 75/93 (81%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = +1

Query  274  NAKQDLENMKKRLKEIEEEAGALREMQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYV  453
            +A ++L+ MKKRLKE+EEEA ALREMQAKVEKEM  VQDP   SASQA KEE D+RS++V
Sbjct  53   DAVKELDEMKKRLKEMEEEAAALREMQAKVEKEMGAVQDPAGTSASQAGKEETDSRSVFV  112

Query  454  GNVDYACTPEEVQQHFQSCGTVNRVTILTDKFG  552
            GNVDYACTPEEVQQHFQSCGTVNRVTILTDKFG
Sbjct  113  GNVDYACTPEEVQQHFQSCGTVNRVTILTDKFG  145



>ref|XP_009132625.1| PREDICTED: polyadenylate-binding protein 2-like [Brassica rapa]
 emb|CDY38851.1| BnaA03g13280D [Brassica napus]
 emb|CDY32641.1| BnaC03g16090D [Brassica napus]
Length=225

 Score =   156 bits (394),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 77/93 (83%), Positives = 85/93 (91%), Gaps = 1/93 (1%)
 Frame = +1

Query  274  NAKQDLENMKKRLKEIEEEAGALREMQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYV  453
            ++ +DLE+MKKR+KEIEEEAGALREMQAK EKEM   QDP+ A +S AEKEEVD+RSIYV
Sbjct  48   SSAKDLEDMKKRIKEIEEEAGALREMQAKAEKEMGADQDPSGAISS-AEKEEVDSRSIYV  106

Query  454  GNVDYACTPEEVQQHFQSCGTVNRVTILTDKFG  552
            GNVDYACTPEEVQQHFQSCGTVNRVTILTDKFG
Sbjct  107  GNVDYACTPEEVQQHFQSCGTVNRVTILTDKFG  139



>ref|XP_010937393.1| PREDICTED: polyadenylate-binding protein 2 isoform X4 [Elaeis 
guineensis]
Length=219

 Score =   155 bits (393),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 73/89 (82%), Positives = 83/89 (93%), Gaps = 0/89 (0%)
 Frame = +1

Query  286  DLENMKKRLKEIEEEAGALREMQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNVD  465
            +L+ MKKRLKE+EEEA ALREMQAKVEKEM  VQDP +A+A+QA +EEVD+RS++VGNVD
Sbjct  40   ELDEMKKRLKEMEEEAAALREMQAKVEKEMGAVQDPASAAATQASREEVDSRSVFVGNVD  99

Query  466  YACTPEEVQQHFQSCGTVNRVTILTDKFG  552
            YACTPEEVQQHFQSCGTVNRVTILTDKFG
Sbjct  100  YACTPEEVQQHFQSCGTVNRVTILTDKFG  128



>ref|XP_006353217.1| PREDICTED: polyadenylate-binding protein 2-A-like isoform X1 
[Solanum tuberosum]
Length=218

 Score =   155 bits (392),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 86/128 (67%), Positives = 103/128 (80%), Gaps = 4/128 (3%)
 Frame = +1

Query  169  EQEEDVYGGEFPeegdmdadvdmaalaeaeaqedPNAKQDLENMKKRLKEIEEEAGALRE  348
            E+E +VYGGE P EGDM+       +A A+     +A ++L+ MKKRLKE+E+EA ALRE
Sbjct  3    EEEHEVYGGEIPIEGDMEPHGADVDMATADD----DAVKELDEMKKRLKEMEDEAAALRE  58

Query  349  MQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRV  528
            MQAKVEKEM  VQDP + +ASQ  +EEVD+RSI+VGNVDYACTPEEVQQHFQ+CGTVNRV
Sbjct  59   MQAKVEKEMGSVQDPASTAASQENREEVDSRSIFVGNVDYACTPEEVQQHFQACGTVNRV  118

Query  529  TILTDKFG  552
            TILTDKFG
Sbjct  119  TILTDKFG  126



>ref|XP_007042909.1| RNA-binding family protein isoform 1 [Theobroma cacao]
 gb|EOX98740.1| RNA-binding family protein isoform 1 [Theobroma cacao]
Length=194

 Score =   154 bits (390),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 71/89 (80%), Positives = 82/89 (92%), Gaps = 0/89 (0%)
 Frame = +1

Query  286  DLENMKKRLKEIEEEAGALREMQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNVD  465
            DL++MK+RLKE+EEEA ALREMQAKVEKEM  VQDP AA+ SQA +EEVD+RS++VGNVD
Sbjct  17   DLDDMKRRLKEMEEEAAALREMQAKVEKEMGSVQDPAAAATSQANREEVDSRSVFVGNVD  76

Query  466  YACTPEEVQQHFQSCGTVNRVTILTDKFG  552
            Y+CTPEEVQQHFQSCGTVNRVTI TDK+G
Sbjct  77   YSCTPEEVQQHFQSCGTVNRVTIRTDKYG  105



>ref|XP_004143458.1| PREDICTED: polyadenylate-binding protein 2-like [Cucumis sativus]
 ref|XP_004160130.1| PREDICTED: polyadenylate-binding protein 2-like [Cucumis sativus]
 gb|KGN48735.1| hypothetical protein Csa_6G499790 [Cucumis sativus]
Length=212

 Score =   155 bits (392),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 81/128 (63%), Positives = 93/128 (73%), Gaps = 10/128 (8%)
 Frame = +1

Query  169  EQEEDVYGGEFPeegdmdadvdmaalaeaeaqedPNAKQDLENMKKRLKEIEEEAGALRE  348
            E+E +VYGGE P E                     +A ++L+ MKKRLKE+EEEA ALRE
Sbjct  3    EEEHEVYGGEIPVEEGDIDMSATDD----------DAIKELDEMKKRLKEMEEEAAALRE  52

Query  349  MQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRV  528
            MQAKVEKEM  VQDP  ++ SQ  KEE D+RS++VGNVDYACTPEEVQQHFQSCGTVNRV
Sbjct  53   MQAKVEKEMGAVQDPAGSAVSQESKEEADSRSVFVGNVDYACTPEEVQQHFQSCGTVNRV  112

Query  529  TILTDKFG  552
            TILTDKFG
Sbjct  113  TILTDKFG  120



>gb|AFJ66183.1| hypothetical protein 11M19.19 [Arabidopsis halleri]
Length=228

 Score =   155 bits (392),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 75/93 (81%), Positives = 83/93 (89%), Gaps = 1/93 (1%)
 Frame = +1

Query  274  NAKQDLENMKKRLKEIEEEAGALREMQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYV  453
            ++ +DLE+MKKR+KEIEEEAGALREMQAK EK+M   QDP+    S AEKEEVD+RSIYV
Sbjct  51   SSSKDLEDMKKRIKEIEEEAGALREMQAKAEKDMGAGQDPSGG-VSAAEKEEVDSRSIYV  109

Query  454  GNVDYACTPEEVQQHFQSCGTVNRVTILTDKFG  552
            GNVDYACTPEEVQQHFQSCGTVNRVTILTDKFG
Sbjct  110  GNVDYACTPEEVQQHFQSCGTVNRVTILTDKFG  142



>ref|XP_002864097.1| hypothetical protein ARALYDRAFT_918145 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40356.1| hypothetical protein ARALYDRAFT_918145 [Arabidopsis lyrata subsp. 
lyrata]
Length=228

 Score =   155 bits (392),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 75/93 (81%), Positives = 83/93 (89%), Gaps = 1/93 (1%)
 Frame = +1

Query  274  NAKQDLENMKKRLKEIEEEAGALREMQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYV  453
            ++ +DLE+MKKR+KEIEEEAGALREMQAK EK+M   QDP+    S AEKEEVD+RSIYV
Sbjct  51   SSSKDLEDMKKRIKEIEEEAGALREMQAKAEKDMGAGQDPSGG-VSAAEKEEVDSRSIYV  109

Query  454  GNVDYACTPEEVQQHFQSCGTVNRVTILTDKFG  552
            GNVDYACTPEEVQQHFQSCGTVNRVTILTDKFG
Sbjct  110  GNVDYACTPEEVQQHFQSCGTVNRVTILTDKFG  142



>ref|XP_003608452.1| Polyadenylate-binding protein [Medicago truncatula]
 gb|AES90649.1| polyadenylate-binding protein II [Medicago truncatula]
Length=199

 Score =   154 bits (389),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 74/93 (80%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = +1

Query  274  NAKQDLENMKKRLKEIEEEAGALREMQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYV  453
            N + DL++MKKRLKE+E+EA AL+EMQAKVEKEM  VQDP  ASASQ  +EEVDARSI+V
Sbjct  13   NNEADLDDMKKRLKEMEDEAAALKEMQAKVEKEMGSVQDPANASASQINREEVDARSIFV  72

Query  454  GNVDYACTPEEVQQHFQSCGTVNRVTILTDKFG  552
            GNVDYACTPE+VQQHFQSCGTVNRVTI TDKFG
Sbjct  73   GNVDYACTPEDVQQHFQSCGTVNRVTIRTDKFG  105



>ref|NP_001240115.1| uncharacterized protein LOC100784473 [Glycine max]
 gb|ACU18324.1| unknown [Glycine max]
 gb|KHN26757.1| Polyadenylate-binding protein 2 [Glycine soja]
Length=197

 Score =   154 bits (389),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 71/93 (76%), Positives = 84/93 (90%), Gaps = 0/93 (0%)
 Frame = +1

Query  274  NAKQDLENMKKRLKEIEEEAGALREMQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYV  453
            +  ++L++MKKRLKE+E+EA ALREMQAKVEKEM  VQDP  ASASQA KEE+D+RS++V
Sbjct  12   DTNEELDDMKKRLKEMEDEAAALREMQAKVEKEMGSVQDPANASASQANKEEIDSRSVFV  71

Query  454  GNVDYACTPEEVQQHFQSCGTVNRVTILTDKFG  552
            GNVDY+CTPEEVQQHFQSCGTVNR+TI TDKFG
Sbjct  72   GNVDYSCTPEEVQQHFQSCGTVNRITIRTDKFG  104



>gb|KHN29042.1| Polyadenylate-binding protein 2 [Glycine soja]
Length=212

 Score =   154 bits (390),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 89/128 (70%), Positives = 106/128 (83%), Gaps = 6/128 (5%)
 Frame = +1

Query  169  EQEEDVYGGEFPeegdmdadvdmaalaeaeaqedPNAKQDLENMKKRLKEIEEEAGALRE  348
            E+E +VYGGE P+EG+M+ D+DM+A  +  A       ++L+ MK+RLKE+EEEA ALRE
Sbjct  3    EEEHEVYGGEIPDEGEMEGDIDMSAADDDAAV------KELDEMKRRLKEMEEEAAALRE  56

Query  349  MQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRV  528
            MQAKVEKE+  VQDP  A+ASQA KEE DARS++VGNVDYACTPEEVQQHFQSCGTVNRV
Sbjct  57   MQAKVEKEIGSVQDPANAAASQANKEEADARSVFVGNVDYACTPEEVQQHFQSCGTVNRV  116

Query  529  TILTDKFG  552
            TILTDKFG
Sbjct  117  TILTDKFG  124



>ref|XP_010027916.1| PREDICTED: polyadenylate-binding protein 2 isoform X1 [Eucalyptus 
grandis]
 gb|KCW54560.1| hypothetical protein EUGRSUZ_I00520 [Eucalyptus grandis]
Length=221

 Score =   155 bits (391),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 89/128 (70%), Positives = 105/128 (82%), Gaps = 0/128 (0%)
 Frame = +1

Query  169  EQEEDVYGGEFPeegdmdadvdmaalaeaeaqedPNAKQDLENMKKRLKEIEEEAGALRE  348
            E+E +VYGGE P EG+++ D+D        +  D +A ++L+ MKKRLKE+EEEA ALRE
Sbjct  3    EEEHEVYGGEIPVEGELEGDMDTHHADVDMSTADDDAVKELDEMKKRLKEMEEEAAALRE  62

Query  349  MQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRV  528
            MQAKVEKEM  VQDP +A+ASQA KEEVD RS++VGNVDYACTPEEVQQHFQSCGTVNRV
Sbjct  63   MQAKVEKEMGAVQDPASAAASQASKEEVDTRSVFVGNVDYACTPEEVQQHFQSCGTVNRV  122

Query  529  TILTDKFG  552
            TILTDKFG
Sbjct  123  TILTDKFG  130



>ref|XP_006466250.1| PREDICTED: polyadenylate-binding protein 2-like [Citrus sinensis]
Length=218

 Score =   154 bits (390),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 81/128 (63%), Positives = 95/128 (74%), Gaps = 3/128 (2%)
 Frame = +1

Query  169  EQEEDVYGGEFPeegdmdadvdmaalaeaeaqedPNAKQDLENMKKRLKEIEEEAGALRE  348
            E+E +VYGGE P+        +      A      +A ++L+ MKKRLKE+EEEA ALRE
Sbjct  3    EEEHEVYGGEIPDVEGDMDAHNTDVDMSAADD---DAVKELDEMKKRLKEMEEEAAALRE  59

Query  349  MQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRV  528
            MQAKVEKEM   QDP   +A+QA KEE D+RS++VGNVDYACTPEEVQQHFQSCGTVNRV
Sbjct  60   MQAKVEKEMGAAQDPANVAANQANKEEADSRSVFVGNVDYACTPEEVQQHFQSCGTVNRV  119

Query  529  TILTDKFG  552
            TILTDKFG
Sbjct  120  TILTDKFG  127



>gb|AFK38116.1| unknown [Medicago truncatula]
Length=199

 Score =   154 bits (389),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 73/93 (78%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = +1

Query  274  NAKQDLENMKKRLKEIEEEAGALREMQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYV  453
            N + DL++MKKRLKE+E+EA AL+EMQAKVEKEM  +QDP  ASASQ  +EEVDARSI+V
Sbjct  13   NNEADLDDMKKRLKEMEDEAAALKEMQAKVEKEMGSIQDPANASASQINREEVDARSIFV  72

Query  454  GNVDYACTPEEVQQHFQSCGTVNRVTILTDKFG  552
            GNVDYACTPE+VQQHFQSCGTVNRVTI TDKFG
Sbjct  73   GNVDYACTPEDVQQHFQSCGTVNRVTIRTDKFG  105



>ref|XP_004168611.1| PREDICTED: polyadenylate-binding protein 2-like [Cucumis sativus]
Length=196

 Score =   154 bits (388),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 69/89 (78%), Positives = 84/89 (94%), Gaps = 0/89 (0%)
 Frame = +1

Query  286  DLENMKKRLKEIEEEAGALREMQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNVD  465
            +L++MKKRLK++E+EA ALREMQAKVEKEM+ VQDP +A+ASQA +EEVD+RS++VGNVD
Sbjct  17   ELDDMKKRLKDMEDEAAALREMQAKVEKEMSSVQDPASAAASQANREEVDSRSVFVGNVD  76

Query  466  YACTPEEVQQHFQSCGTVNRVTILTDKFG  552
            Y+CTPEEVQQHFQSCGTVNR+TI TDKFG
Sbjct  77   YSCTPEEVQQHFQSCGTVNRITIRTDKFG  105



>ref|XP_004137160.1| PREDICTED: polyadenylate-binding protein 2-like [Cucumis sativus]
Length=196

 Score =   154 bits (388),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 69/89 (78%), Positives = 84/89 (94%), Gaps = 0/89 (0%)
 Frame = +1

Query  286  DLENMKKRLKEIEEEAGALREMQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNVD  465
            +L++MKKRLK++E+EA ALREMQAKVEKEM+ VQDP +A+ASQA +EEVD+RS++VGNVD
Sbjct  17   ELDDMKKRLKDMEDEAAALREMQAKVEKEMSSVQDPASAAASQANREEVDSRSVFVGNVD  76

Query  466  YACTPEEVQQHFQSCGTVNRVTILTDKFG  552
            Y+CTPEEVQQHFQSCGTVNR+TI TDKFG
Sbjct  77   YSCTPEEVQQHFQSCGTVNRITIRTDKFG  105



>ref|XP_009127326.1| PREDICTED: polyadenylate-binding protein 2-like [Brassica rapa]
Length=231

 Score =   154 bits (390),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 82/93 (88%), Gaps = 1/93 (1%)
 Frame = +1

Query  274  NAKQDLENMKKRLKEIEEEAGALREMQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYV  453
            +A +DLE+MKKRLKEIEEEA ALREMQAK E +M   QDP++A  S AEKEEVD RSIYV
Sbjct  54   SASRDLEDMKKRLKEIEEEASALREMQAKAENDMAAAQDPSSA-ISAAEKEEVDLRSIYV  112

Query  454  GNVDYACTPEEVQQHFQSCGTVNRVTILTDKFG  552
            GNVDYACTPEEVQQHFQSCGTVNRVTILTDKFG
Sbjct  113  GNVDYACTPEEVQQHFQSCGTVNRVTILTDKFG  145



>gb|KGN53719.1| hypothetical protein Csa_4G110060 [Cucumis sativus]
Length=197

 Score =   154 bits (388),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 69/89 (78%), Positives = 84/89 (94%), Gaps = 0/89 (0%)
 Frame = +1

Query  286  DLENMKKRLKEIEEEAGALREMQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNVD  465
            +L++MKKRLK++E+EA ALREMQAKVEKEM+ VQDP +A+ASQA +EEVD+RS++VGNVD
Sbjct  18   ELDDMKKRLKDMEDEAAALREMQAKVEKEMSSVQDPASAAASQANREEVDSRSVFVGNVD  77

Query  466  YACTPEEVQQHFQSCGTVNRVTILTDKFG  552
            Y+CTPEEVQQHFQSCGTVNR+TI TDKFG
Sbjct  78   YSCTPEEVQQHFQSCGTVNRITIRTDKFG  106



>ref|XP_007042910.1| RNA-binding family protein isoform 2 [Theobroma cacao]
 gb|EOX98741.1| RNA-binding family protein isoform 2 [Theobroma cacao]
Length=189

 Score =   153 bits (387),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 71/89 (80%), Positives = 82/89 (92%), Gaps = 0/89 (0%)
 Frame = +1

Query  286  DLENMKKRLKEIEEEAGALREMQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNVD  465
            DL++MK+RLKE+EEEA ALREMQAKVEKEM  VQDP AA+ SQA +EEVD+RS++VGNVD
Sbjct  17   DLDDMKRRLKEMEEEAAALREMQAKVEKEMGSVQDPAAAATSQANREEVDSRSVFVGNVD  76

Query  466  YACTPEEVQQHFQSCGTVNRVTILTDKFG  552
            Y+CTPEEVQQHFQSCGTVNRVTI TDK+G
Sbjct  77   YSCTPEEVQQHFQSCGTVNRVTIRTDKYG  105



>ref|XP_008462875.1| PREDICTED: polyadenylate-binding protein 2-like isoform X2 [Cucumis 
melo]
Length=197

 Score =   153 bits (387),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 70/93 (75%), Positives = 85/93 (91%), Gaps = 0/93 (0%)
 Frame = +1

Query  274  NAKQDLENMKKRLKEIEEEAGALREMQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYV  453
            N   +L++MKKRLK++E+EA ALREMQAKVEKEM+ VQDP +A+ASQA +EEVD+RS++V
Sbjct  14   NDAVELDDMKKRLKDMEDEAAALREMQAKVEKEMSSVQDPASAAASQANREEVDSRSVFV  73

Query  454  GNVDYACTPEEVQQHFQSCGTVNRVTILTDKFG  552
            GNVDY+CTPEEVQQHFQSCGTVNR+TI TDKFG
Sbjct  74   GNVDYSCTPEEVQQHFQSCGTVNRITIRTDKFG  106



>ref|NP_568751.1| polyadenylate-binding protein 1 [Arabidopsis thaliana]
 sp|Q93VI4.1|PABN1_ARATH RecName: Full=Polyadenylate-binding protein 1; Short=AtPabN1; 
Short=Poly(A)-binding protein 1; AltName: Full=Nuclear poly(A)-binding 
protein 1; AltName: Full=Poly(A)-binding protein 
I; Short=PABI [Arabidopsis thaliana]
 gb|AAL06847.1| AT5g51120/MWD22_6 [Arabidopsis thaliana]
 gb|AAL09819.1| unknown protein [Arabidopsis thaliana]
 gb|AAL85123.1| unknown protein [Arabidopsis thaliana]
 gb|AAM47151.1| unknown protein [Arabidopsis thaliana]
 gb|AED96038.1| polyadenylate-binding protein 1 [Arabidopsis thaliana]
Length=227

 Score =   154 bits (390),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 75/93 (81%), Positives = 83/93 (89%), Gaps = 1/93 (1%)
 Frame = +1

Query  274  NAKQDLENMKKRLKEIEEEAGALREMQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYV  453
            ++ +DLE+MKKR+KEIEEEAGALREMQAK EK+M   QDP+    S AEKEEVD+RSIYV
Sbjct  49   SSSRDLEDMKKRIKEIEEEAGALREMQAKAEKDMGASQDPSGG-VSAAEKEEVDSRSIYV  107

Query  454  GNVDYACTPEEVQQHFQSCGTVNRVTILTDKFG  552
            GNVDYACTPEEVQQHFQSCGTVNRVTILTDKFG
Sbjct  108  GNVDYACTPEEVQQHFQSCGTVNRVTILTDKFG  140



>gb|AAM61036.1| contains similarity to poly(A)-binding protein II [Arabidopsis 
thaliana]
Length=227

 Score =   154 bits (390),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 75/93 (81%), Positives = 83/93 (89%), Gaps = 1/93 (1%)
 Frame = +1

Query  274  NAKQDLENMKKRLKEIEEEAGALREMQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYV  453
            ++ +DLE+MKKR+KEIEEEAGALREMQAK EK+M   QDP+    S AEKEEVD+RSIYV
Sbjct  49   SSSRDLEDMKKRIKEIEEEAGALREMQAKAEKDMGASQDPSGG-VSAAEKEEVDSRSIYV  107

Query  454  GNVDYACTPEEVQQHFQSCGTVNRVTILTDKFG  552
            GNVDYACTPEEVQQHFQSCGTVNRVTILTDKFG
Sbjct  108  GNVDYACTPEEVQQHFQSCGTVNRVTILTDKFG  140



>gb|KDO60716.1| hypothetical protein CISIN_1g041633mg [Citrus sinensis]
Length=237

 Score =   154 bits (390),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 81/128 (63%), Positives = 95/128 (74%), Gaps = 3/128 (2%)
 Frame = +1

Query  169  EQEEDVYGGEFPeegdmdadvdmaalaeaeaqedPNAKQDLENMKKRLKEIEEEAGALRE  348
            E+E +VYGGE P+        +      A      +A ++L+ MKKRLKE+EEEA ALRE
Sbjct  3    EEEHEVYGGEIPDVEGDMDAHNTDVDMSAADD---DAVKELDEMKKRLKEMEEEAAALRE  59

Query  349  MQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRV  528
            MQAKVEKEM   QDP   +A+QA KEE D+RS++VGNVDYACTPEEVQQHFQSCGTVNRV
Sbjct  60   MQAKVEKEMGAAQDPANVAANQASKEEADSRSVFVGNVDYACTPEEVQQHFQSCGTVNRV  119

Query  529  TILTDKFG  552
            TILTDKFG
Sbjct  120  TILTDKFG  127



>emb|CDY16338.1| BnaA02g11420D [Brassica napus]
Length=231

 Score =   154 bits (390),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 82/93 (88%), Gaps = 1/93 (1%)
 Frame = +1

Query  274  NAKQDLENMKKRLKEIEEEAGALREMQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYV  453
            +A +DLE+MKKRLKEIEEEA ALREMQAK E +M   QDP++A  S AEKEEVD RSIYV
Sbjct  54   SASRDLEDMKKRLKEIEEEASALREMQAKAENDMAAAQDPSSA-ISAAEKEEVDLRSIYV  112

Query  454  GNVDYACTPEEVQQHFQSCGTVNRVTILTDKFG  552
            GNVDYACTPEEVQQHFQSCGTVNRVTILTDKFG
Sbjct  113  GNVDYACTPEEVQQHFQSCGTVNRVTILTDKFG  145



>ref|XP_010442595.1| PREDICTED: polyadenylate-binding protein 2-like [Camelina sativa]
 ref|XP_010482442.1| PREDICTED: polyadenylate-binding protein 2-like [Camelina sativa]
Length=226

 Score =   154 bits (389),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 75/93 (81%), Positives = 84/93 (90%), Gaps = 1/93 (1%)
 Frame = +1

Query  274  NAKQDLENMKKRLKEIEEEAGALREMQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYV  453
            ++ +DLE+MKKR+KEIEEEAGALREMQAK EK+M   QDP+   +S AEKEEVD+RSIYV
Sbjct  49   SSSRDLEDMKKRIKEIEEEAGALREMQAKAEKDMGAGQDPSGGVSS-AEKEEVDSRSIYV  107

Query  454  GNVDYACTPEEVQQHFQSCGTVNRVTILTDKFG  552
            GNVDYACTPEEVQQHFQSCGTVNRVTILTDKFG
Sbjct  108  GNVDYACTPEEVQQHFQSCGTVNRVTILTDKFG  140



>ref|XP_006281051.1| hypothetical protein CARUB_v10027069mg [Capsella rubella]
 ref|XP_010426305.1| PREDICTED: polyadenylate-binding protein 2-like [Camelina sativa]
 gb|EOA13949.1| hypothetical protein CARUB_v10027069mg [Capsella rubella]
Length=226

 Score =   154 bits (389),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 75/93 (81%), Positives = 84/93 (90%), Gaps = 1/93 (1%)
 Frame = +1

Query  274  NAKQDLENMKKRLKEIEEEAGALREMQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYV  453
            ++ +DLE+MKKR+KEIEEEAGALREMQAK EK+M   QDP+   +S AEKEEVD+RSIYV
Sbjct  49   SSSRDLEDMKKRIKEIEEEAGALREMQAKAEKDMGAGQDPSGGVSS-AEKEEVDSRSIYV  107

Query  454  GNVDYACTPEEVQQHFQSCGTVNRVTILTDKFG  552
            GNVDYACTPEEVQQHFQSCGTVNRVTILTDKFG
Sbjct  108  GNVDYACTPEEVQQHFQSCGTVNRVTILTDKFG  140



>gb|KHG15936.1| Polyadenylate-binding 2 [Gossypium arboreum]
Length=194

 Score =   153 bits (386),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 70/89 (79%), Positives = 82/89 (92%), Gaps = 0/89 (0%)
 Frame = +1

Query  286  DLENMKKRLKEIEEEAGALREMQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNVD  465
            DL++MK+RLKE+E+EA ALREMQAKVEKEM  VQDP +A+ SQA +EEVD+RSI+VGNVD
Sbjct  17   DLDDMKRRLKEMEDEAAALREMQAKVEKEMGSVQDPASAATSQANREEVDSRSIFVGNVD  76

Query  466  YACTPEEVQQHFQSCGTVNRVTILTDKFG  552
            Y+CTPEEVQQHFQSCGTVNRVTI TDK+G
Sbjct  77   YSCTPEEVQQHFQSCGTVNRVTIRTDKYG  105



>ref|XP_008462873.1| PREDICTED: polyadenylate-binding protein 2-like isoform X1 [Cucumis 
melo]
Length=202

 Score =   153 bits (387),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 70/93 (75%), Positives = 85/93 (91%), Gaps = 0/93 (0%)
 Frame = +1

Query  274  NAKQDLENMKKRLKEIEEEAGALREMQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYV  453
            N   +L++MKKRLK++E+EA ALREMQAKVEKEM+ VQDP +A+ASQA +EEVD+RS++V
Sbjct  14   NDAVELDDMKKRLKDMEDEAAALREMQAKVEKEMSSVQDPASAAASQANREEVDSRSVFV  73

Query  454  GNVDYACTPEEVQQHFQSCGTVNRVTILTDKFG  552
            GNVDY+CTPEEVQQHFQSCGTVNR+TI TDKFG
Sbjct  74   GNVDYSCTPEEVQQHFQSCGTVNRITIRTDKFG  106



>gb|AGV54499.1| RNA binding/nucleic acid binding [Phaseolus vulgaris]
Length=215

 Score =   154 bits (388),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 89/128 (70%), Positives = 106/128 (83%), Gaps = 6/128 (5%)
 Frame = +1

Query  169  EQEEDVYGGEFPeegdmdadvdmaalaeaeaqedPNAKQDLENMKKRLKEIEEEAGALRE  348
            E+E +VYGGE P+EG+M+ DVDM+A  +  A       ++L+ MK+RLKE+EEEA ALRE
Sbjct  3    EEEHEVYGGEIPDEGEMEGDVDMSAADDDAAV------KELDEMKRRLKEMEEEAAALRE  56

Query  349  MQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRV  528
            MQAKVEKE+  VQDP  A+ASQA KEE D+RS++VGNVDYACTPEEVQQHFQSCGTVNRV
Sbjct  57   MQAKVEKEIGSVQDPANAAASQANKEEADSRSVFVGNVDYACTPEEVQQHFQSCGTVNRV  116

Query  529  TILTDKFG  552
            TILTDKFG
Sbjct  117  TILTDKFG  124



>gb|KJB47020.1| hypothetical protein B456_008G016100 [Gossypium raimondii]
Length=194

 Score =   153 bits (386),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 70/89 (79%), Positives = 82/89 (92%), Gaps = 0/89 (0%)
 Frame = +1

Query  286  DLENMKKRLKEIEEEAGALREMQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNVD  465
            DL++MK+RLKE+E+EA ALR+MQAKVEKEM  VQDP AA+ SQA +EEVD+RSI+VGNVD
Sbjct  17   DLDDMKRRLKEMEDEAAALRDMQAKVEKEMGSVQDPAAAATSQANREEVDSRSIFVGNVD  76

Query  466  YACTPEEVQQHFQSCGTVNRVTILTDKFG  552
            Y+CTPEEVQQHFQSCGTVNRVTI TDK+G
Sbjct  77   YSCTPEEVQQHFQSCGTVNRVTIRTDKYG  105



>ref|NP_001239931.1| uncharacterized protein LOC100791351 [Glycine max]
 gb|ACU24298.1| unknown [Glycine max]
 gb|KHN33536.1| Polyadenylate-binding protein 2 [Glycine soja]
Length=197

 Score =   153 bits (386),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 71/93 (76%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = +1

Query  274  NAKQDLENMKKRLKEIEEEAGALREMQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYV  453
            +  ++L++MKKRLKE+E+EA ALREMQAKVEKEM   QDP  ASASQA KEE+D+RS++V
Sbjct  12   DTSEELDDMKKRLKEMEDEAAALREMQAKVEKEMGSAQDPANASASQANKEEIDSRSVFV  71

Query  454  GNVDYACTPEEVQQHFQSCGTVNRVTILTDKFG  552
            GNVDY+CTPEEVQQHFQSCGTVNRVTI TDKFG
Sbjct  72   GNVDYSCTPEEVQQHFQSCGTVNRVTIRTDKFG  104



>ref|XP_006402013.1| hypothetical protein EUTSA_v10014588mg [Eutrema salsugineum]
 gb|ESQ43466.1| hypothetical protein EUTSA_v10014588mg [Eutrema salsugineum]
Length=226

 Score =   154 bits (388),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 75/93 (81%), Positives = 84/93 (90%), Gaps = 1/93 (1%)
 Frame = +1

Query  274  NAKQDLENMKKRLKEIEEEAGALREMQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYV  453
            ++ +DLE+MKKR+KEIEEEAGALREMQAK EK+M   QDP++   S AEKEEVD+RSIYV
Sbjct  49   SSSRDLEDMKKRIKEIEEEAGALREMQAKAEKDMGSGQDPSSG-ISAAEKEEVDSRSIYV  107

Query  454  GNVDYACTPEEVQQHFQSCGTVNRVTILTDKFG  552
            GNVDYACTPEEVQQHFQSCGTVNRVTILTDKFG
Sbjct  108  GNVDYACTPEEVQQHFQSCGTVNRVTILTDKFG  140



>emb|CDY55162.1| BnaCnng28280D [Brassica napus]
Length=220

 Score =   153 bits (387),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 87/128 (68%), Positives = 104/128 (81%), Gaps = 1/128 (1%)
 Frame = +1

Query  169  EQEEDVYGGEFPeegdmdadvdmaalaeaeaqedPNAKQDLENMKKRLKEIEEEAGALRE  348
            E+E +VYGGE P+ G+MD D++        A  D +A ++L+ MKKRLKE+E+EA ALRE
Sbjct  3    EEEHEVYGGEIPDVGEMDGDMEAPNPDMEMAAADEDAAKELDEMKKRLKEMEDEAAALRE  62

Query  349  MQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRV  528
            MQAKVEKEM G QDP   +A+QA KEEVDARS++VGNVDYACTPEEVQQHFQSCGTV+RV
Sbjct  63   MQAKVEKEM-GAQDPATLAANQAGKEEVDARSVFVGNVDYACTPEEVQQHFQSCGTVHRV  121

Query  529  TILTDKFG  552
            TILTDKFG
Sbjct  122  TILTDKFG  129



>gb|KFK26726.1| hypothetical protein AALP_AA8G284900 [Arabis alpina]
Length=226

 Score =   153 bits (387),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 75/93 (81%), Positives = 83/93 (89%), Gaps = 1/93 (1%)
 Frame = +1

Query  274  NAKQDLENMKKRLKEIEEEAGALREMQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYV  453
            +  +DLE+MKKR+KEIEEEAGALREMQAK EK+M   QDP++   S AEKEEVD+RSIYV
Sbjct  49   SGSKDLEDMKKRIKEIEEEAGALREMQAKAEKDMGAGQDPSSG-ISAAEKEEVDSRSIYV  107

Query  454  GNVDYACTPEEVQQHFQSCGTVNRVTILTDKFG  552
            GNVDYACTPEEVQQHFQSCGTVNRVTILTDKFG
Sbjct  108  GNVDYACTPEEVQQHFQSCGTVNRVTILTDKFG  140



>ref|NP_001288928.1| polyadenylate-binding protein 2 [Brassica rapa]
 gb|ABL97957.1| poly(A)-binding protein II-like [Brassica rapa]
 emb|CDY08805.1| BnaA06g24190D [Brassica napus]
Length=220

 Score =   153 bits (387),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 87/128 (68%), Positives = 104/128 (81%), Gaps = 1/128 (1%)
 Frame = +1

Query  169  EQEEDVYGGEFPeegdmdadvdmaalaeaeaqedPNAKQDLENMKKRLKEIEEEAGALRE  348
            E+E +VYGGE P+ G+MD D++        A  D +A ++L+ MKKRLKE+E+EA ALRE
Sbjct  3    EEEHEVYGGEIPDVGEMDGDMEAPNPDMEMAAADEDAAKELDEMKKRLKEMEDEAAALRE  62

Query  349  MQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRV  528
            MQAKVEKEM G QDP   +A+QA KEEVDARS++VGNVDYACTPEEVQQHFQSCGTV+RV
Sbjct  63   MQAKVEKEM-GAQDPATLAANQAGKEEVDARSVFVGNVDYACTPEEVQQHFQSCGTVHRV  121

Query  529  TILTDKFG  552
            TILTDKFG
Sbjct  122  TILTDKFG  129



>ref|XP_007159717.1| hypothetical protein PHAVU_002G261500g [Phaseolus vulgaris]
 gb|ESW31711.1| hypothetical protein PHAVU_002G261500g [Phaseolus vulgaris]
Length=215

 Score =   153 bits (386),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 89/128 (70%), Positives = 106/128 (83%), Gaps = 6/128 (5%)
 Frame = +1

Query  169  EQEEDVYGGEFPeegdmdadvdmaalaeaeaqedPNAKQDLENMKKRLKEIEEEAGALRE  348
            E+E +VYGGE P+EG+M+ DVDM+A  +  A       ++L+ MK+RLKE+EEEA ALRE
Sbjct  3    EEEHEVYGGEIPDEGEMEGDVDMSAADDDAAV------KELDEMKRRLKEMEEEAAALRE  56

Query  349  MQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRV  528
            MQAKVEKE+  VQDP  A+ASQA KEE D+RS++VGNVDYACTPEEVQQHFQSCGTVNRV
Sbjct  57   MQAKVEKEIGSVQDPVNAAASQANKEEADSRSVFVGNVDYACTPEEVQQHFQSCGTVNRV  116

Query  529  TILTDKFG  552
            TILTDKFG
Sbjct  117  TILTDKFG  124



>ref|XP_004504812.1| PREDICTED: polyadenylate-binding protein 2-A-like isoform X1 
[Cicer arietinum]
Length=235

 Score =   154 bits (388),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 72/90 (80%), Positives = 82/90 (91%), Gaps = 0/90 (0%)
 Frame = +1

Query  283  QDLENMKKRLKEIEEEAGALREMQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNV  462
            Q+L++MKKRLKE+E+EA ALREMQAKVEKEM  VQDP  A+ASQ  +EEVD+RS++VGNV
Sbjct  52   QELDDMKKRLKEMEDEAAALREMQAKVEKEMGSVQDPANAAASQINREEVDSRSVFVGNV  111

Query  463  DYACTPEEVQQHFQSCGTVNRVTILTDKFG  552
            DYACTPEEVQQHFQSCGTVNRVTI TDKFG
Sbjct  112  DYACTPEEVQQHFQSCGTVNRVTIRTDKFG  141



>dbj|BAA97374.1| unnamed protein product [Arabidopsis thaliana]
Length=267

 Score =   154 bits (390),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 75/93 (81%), Positives = 83/93 (89%), Gaps = 1/93 (1%)
 Frame = +1

Query  274  NAKQDLENMKKRLKEIEEEAGALREMQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYV  453
            ++ +DLE+MKKR+KEIEEEAGALREMQAK EK+M   QDP+    S AEKEEVD+RSIYV
Sbjct  49   SSSRDLEDMKKRIKEIEEEAGALREMQAKAEKDMGASQDPSGG-VSAAEKEEVDSRSIYV  107

Query  454  GNVDYACTPEEVQQHFQSCGTVNRVTILTDKFG  552
            GNVDYACTPEEVQQHFQSCGTVNRVTILTDKFG
Sbjct  108  GNVDYACTPEEVQQHFQSCGTVNRVTILTDKFG  140



>ref|XP_006828070.1| hypothetical protein AMTR_s00008p00267630 [Amborella trichopoda]
 gb|ERM95486.1| hypothetical protein AMTR_s00008p00267630 [Amborella trichopoda]
Length=220

 Score =   153 bits (386),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 81/128 (63%), Positives = 100/128 (78%), Gaps = 1/128 (1%)
 Frame = +1

Query  169  EQEEDVYGGEFPeegdmdadvdmaalaeaeaqedPNAKQDLENMKKRLKEIEEEAGALRE  348
            E+E +VYGG+ P+E DM+   +         ++   A ++L+ MKKRLKE+EEEA ALRE
Sbjct  3    EEEHEVYGGDIPDEVDMEGADNPDVDMARADEDA-AATKELDEMKKRLKEMEEEAAALRE  61

Query  349  MQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRV  528
            MQAKVEKEM  VQDP + +A+QA +EE D RS++VGNVDY+CTPEEVQQHFQSCGTVNRV
Sbjct  62   MQAKVEKEMGAVQDPASVAAAQASREEADNRSVFVGNVDYSCTPEEVQQHFQSCGTVNRV  121

Query  529  TILTDKFG  552
            TILTDKFG
Sbjct  122  TILTDKFG  129



>gb|KFK25338.1| hypothetical protein AALP_AA8G099700 [Arabis alpina]
Length=217

 Score =   153 bits (386),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 81/128 (63%), Positives = 100/128 (78%), Gaps = 4/128 (3%)
 Frame = +1

Query  169  EQEEDVYGGEFPeegdmdadvdmaalaeaeaqedPNAKQDLENMKKRLKEIEEEAGALRE  348
            E+E +VYGGE P+ GD++       ++  +     +A ++L+ MK+RLKE+E+EA ALRE
Sbjct  3    EEEHEVYGGEIPDIGDVEVPDPDIDMSAGDD----DAVKELDEMKRRLKEMEDEAAALRE  58

Query  349  MQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRV  528
            MQAKVEKEM  VQDP +  A+Q EKEEVDARS+YVGNVDYACTPEEVQ HFQ+CGTVNRV
Sbjct  59   MQAKVEKEMGAVQDPASTGANQVEKEEVDARSVYVGNVDYACTPEEVQLHFQTCGTVNRV  118

Query  529  TILTDKFG  552
            TIL DKFG
Sbjct  119  TILMDKFG  126



>gb|AFK45960.1| unknown [Lotus japonicus]
Length=171

 Score =   151 bits (382),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 75/85 (88%), Positives = 78/85 (92%), Gaps = 1/85 (1%)
 Frame = +1

Query  298  MKKRLKEIEEEAGALREMQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACT  477
            MKKRLKEIEEEA ALREMQAKVEK+M  VQD   +SA+QAEKEEVD RSIYVGNVDYACT
Sbjct  1    MKKRLKEIEEEASALREMQAKVEKDMGAVQD-AGSSATQAEKEEVDGRSIYVGNVDYACT  59

Query  478  PEEVQQHFQSCGTVNRVTILTDKFG  552
            PEEVQQHFQSCGTVNRVTILTDKFG
Sbjct  60   PEEVQQHFQSCGTVNRVTILTDKFG  84



>ref|XP_004504815.1| PREDICTED: polyadenylate-binding protein 2-A-like isoform X4 
[Cicer arietinum]
Length=199

 Score =   152 bits (384),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 72/93 (77%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = +1

Query  274  NAKQDLENMKKRLKEIEEEAGALREMQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYV  453
            N + +L++MKKRLKE+E+EA ALREMQAKVEKEM  VQDP  A+ASQ  +EEVD+RS++V
Sbjct  13   NNEAELDDMKKRLKEMEDEAAALREMQAKVEKEMGSVQDPANAAASQINREEVDSRSVFV  72

Query  454  GNVDYACTPEEVQQHFQSCGTVNRVTILTDKFG  552
            GNVDYACTPEEVQQHFQSCGTVNRVTI TDKFG
Sbjct  73   GNVDYACTPEEVQQHFQSCGTVNRVTIRTDKFG  105



>ref|XP_010690525.1| PREDICTED: polyadenylate-binding protein 3-like isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=203

 Score =   152 bits (384),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 71/89 (80%), Positives = 81/89 (91%), Gaps = 0/89 (0%)
 Frame = +1

Query  286  DLENMKKRLKEIEEEAGALREMQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNVD  465
            D+E+M+KRLKE+E+EA ALREMQAKVEKEM  VQDP A +A QA KEEVD+RS++VGNVD
Sbjct  25   DVEDMRKRLKEMEDEAAALREMQAKVEKEMGAVQDPAAVAADQANKEEVDSRSVFVGNVD  84

Query  466  YACTPEEVQQHFQSCGTVNRVTILTDKFG  552
            YACTPEEVQQHFQSCGTVNRVTI T+KFG
Sbjct  85   YACTPEEVQQHFQSCGTVNRVTIRTNKFG  113



>ref|XP_006394055.1| hypothetical protein EUTSA_v10004890mg [Eutrema salsugineum]
 gb|ESQ31341.1| hypothetical protein EUTSA_v10004890mg [Eutrema salsugineum]
Length=207

 Score =   152 bits (384),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 87/128 (68%), Positives = 104/128 (81%), Gaps = 1/128 (1%)
 Frame = +1

Query  169  EQEEDVYGGEFPeegdmdadvdmaalaeaeaqedPNAKQDLENMKKRLKEIEEEAGALRE  348
            E+E +VYGGE P+ G+MD D++        A  D +A ++L+ MKKRLKE+E+EA ALRE
Sbjct  3    EEEHEVYGGEIPDVGEMDGDMEAPNPDMDMASADDDAVKELDEMKKRLKEMEDEAAALRE  62

Query  349  MQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRV  528
            MQAKVEKEM G QDP   +A+QA KEEVDARS++VGNVDYACTPEEVQQHFQSCGTV+RV
Sbjct  63   MQAKVEKEM-GAQDPATIAANQAGKEEVDARSVFVGNVDYACTPEEVQQHFQSCGTVHRV  121

Query  529  TILTDKFG  552
            TILTDKFG
Sbjct  122  TILTDKFG  129



>ref|XP_010690526.1| PREDICTED: polyadenylate-binding protein 2-like isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=201

 Score =   152 bits (384),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 71/89 (80%), Positives = 81/89 (91%), Gaps = 0/89 (0%)
 Frame = +1

Query  286  DLENMKKRLKEIEEEAGALREMQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNVD  465
            D+E+M+KRLKE+E+EA ALREMQAKVEKEM  VQDP A +A QA KEEVD+RS++VGNVD
Sbjct  23   DVEDMRKRLKEMEDEAAALREMQAKVEKEMGAVQDPAAVAADQANKEEVDSRSVFVGNVD  82

Query  466  YACTPEEVQQHFQSCGTVNRVTILTDKFG  552
            YACTPEEVQQHFQSCGTVNRVTI T+KFG
Sbjct  83   YACTPEEVQQHFQSCGTVNRVTIRTNKFG  111



>gb|KJB17316.1| hypothetical protein B456_003G040800 [Gossypium raimondii]
Length=176

 Score =   151 bits (381),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 70/85 (82%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = +1

Query  298  MKKRLKEIEEEAGALREMQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACT  477
            MKKRLKE+E+EA ALREMQAKVEKEM  VQDP  A+A+QA KEE D+RS++VGNVDYACT
Sbjct  1    MKKRLKEMEDEAAALREMQAKVEKEMGAVQDPAGATANQASKEEADSRSVFVGNVDYACT  60

Query  478  PEEVQQHFQSCGTVNRVTILTDKFG  552
            PEEVQQHFQSCGTVNRVTILTDK+G
Sbjct  61   PEEVQQHFQSCGTVNRVTILTDKYG  85



>ref|XP_010030027.1| PREDICTED: polyadenylate-binding protein 2-like [Eucalyptus grandis]
Length=195

 Score =   151 bits (382),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 70/89 (79%), Positives = 82/89 (92%), Gaps = 0/89 (0%)
 Frame = +1

Query  286  DLENMKKRLKEIEEEAGALREMQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNVD  465
            +L++MKKRLKE+E+EA ALREMQAKVE+EM  VQDP  A+ASQA KEE+D+RSI+VGNVD
Sbjct  17   ELDDMKKRLKEMEDEAAALREMQAKVEREMGSVQDPANAAASQANKEEIDSRSIFVGNVD  76

Query  466  YACTPEEVQQHFQSCGTVNRVTILTDKFG  552
            Y+CTPEEVQQHFQSCGTVNRVTI TDK+G
Sbjct  77   YSCTPEEVQQHFQSCGTVNRVTIRTDKYG  105



>ref|XP_006394056.1| hypothetical protein EUTSA_v10004890mg [Eutrema salsugineum]
 gb|ESQ31342.1| hypothetical protein EUTSA_v10004890mg [Eutrema salsugineum]
Length=220

 Score =   152 bits (384),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 87/128 (68%), Positives = 104/128 (81%), Gaps = 1/128 (1%)
 Frame = +1

Query  169  EQEEDVYGGEFPeegdmdadvdmaalaeaeaqedPNAKQDLENMKKRLKEIEEEAGALRE  348
            E+E +VYGGE P+ G+MD D++        A  D +A ++L+ MKKRLKE+E+EA ALRE
Sbjct  3    EEEHEVYGGEIPDVGEMDGDMEAPNPDMDMASADDDAVKELDEMKKRLKEMEDEAAALRE  62

Query  349  MQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRV  528
            MQAKVEKEM G QDP   +A+QA KEEVDARS++VGNVDYACTPEEVQQHFQSCGTV+RV
Sbjct  63   MQAKVEKEM-GAQDPATIAANQAGKEEVDARSVFVGNVDYACTPEEVQQHFQSCGTVHRV  121

Query  529  TILTDKFG  552
            TILTDKFG
Sbjct  122  TILTDKFG  129



>ref|XP_009130503.1| PREDICTED: polyadenylate-binding protein 2-like [Brassica rapa]
Length=212

 Score =   152 bits (383),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 87/128 (68%), Positives = 104/128 (81%), Gaps = 7/128 (5%)
 Frame = +1

Query  169  EQEEDVYGGEFPeegdmdadvdmaalaeaeaqedPNAKQDLENMKKRLKEIEEEAGALRE  348
            E+E +VYGGE P+ G+MD D+D+   A+       +A ++L+ MKKRLKEIE+EA ALRE
Sbjct  3    EEEHEVYGGEIPDVGEMDGDMDIMTAADD------DAAKELDEMKKRLKEIEDEAAALRE  56

Query  349  MQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRV  528
            MQAKVEK+M G QDP   +A QA KEEVDARS++VGNVDYACTPEEVQQHFQSCGTV+RV
Sbjct  57   MQAKVEKDM-GPQDPATMAADQAGKEEVDARSVFVGNVDYACTPEEVQQHFQSCGTVHRV  115

Query  529  TILTDKFG  552
            TILTDKFG
Sbjct  116  TILTDKFG  123



>ref|XP_010680512.1| PREDICTED: polyadenylate-binding protein 2 [Beta vulgaris subsp. 
vulgaris]
Length=220

 Score =   152 bits (383),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 86/128 (67%), Positives = 101/128 (79%), Gaps = 1/128 (1%)
 Frame = +1

Query  169  EQEEDVYGGEFPeegdmdadvdmaalaeaeaqedPNAKQDLENMKKRLKEIEEEAGALRE  348
            E+E +VYGG+ P EGD++ D+D        +  D +A ++L+ MKKRLKE+EEEA ALRE
Sbjct  3    EEEHEVYGGDIPVEGDLEGDLDAHNPDVDMSTADDDAVKELDEMKKRLKEMEEEAAALRE  62

Query  349  MQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRV  528
            MQAKVEKEM  VQDP  A A  A KEEVD+RS++VGNVDYACTPEEVQQHFQ CGTVNRV
Sbjct  63   MQAKVEKEMGAVQDPVTA-AEMANKEEVDSRSVFVGNVDYACTPEEVQQHFQGCGTVNRV  121

Query  529  TILTDKFG  552
            TILTDKFG
Sbjct  122  TILTDKFG  129



>ref|XP_004504816.1| PREDICTED: polyadenylate-binding protein 2-A-like isoform X5 
[Cicer arietinum]
Length=197

 Score =   151 bits (381),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 71/89 (80%), Positives = 81/89 (91%), Gaps = 0/89 (0%)
 Frame = +1

Query  286  DLENMKKRLKEIEEEAGALREMQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNVD  465
            +L++MKKRLKE+E+EA ALREMQAKVEKEM  VQDP  A+ASQ  +EEVD+RS++VGNVD
Sbjct  15   ELDDMKKRLKEMEDEAAALREMQAKVEKEMGSVQDPANAAASQINREEVDSRSVFVGNVD  74

Query  466  YACTPEEVQQHFQSCGTVNRVTILTDKFG  552
            YACTPEEVQQHFQSCGTVNRVTI TDKFG
Sbjct  75   YACTPEEVQQHFQSCGTVNRVTIRTDKFG  103



>gb|ACU19123.1| unknown [Glycine max]
Length=205

 Score =   151 bits (382),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 86/128 (67%), Positives = 106/128 (83%), Gaps = 6/128 (5%)
 Frame = +1

Query  169  EQEEDVYGGEFPeegdmdadvdmaalaeaeaqedPNAKQDLENMKKRLKEIEEEAGALRE  348
            E+E +VYGGE P+EG+M+ D+DM+A  +  A       ++L+ MK+RLKE+EEEA ALRE
Sbjct  3    EEEHEVYGGEIPDEGEMEGDIDMSAADDDAAV------KELDEMKRRLKEMEEEAAALRE  56

Query  349  MQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRV  528
            MQAKV+KE+  VQDP  ++ASQA KEE D+RS++VGNVDYACTPEEVQQHFQSCGTVNRV
Sbjct  57   MQAKVDKEIGSVQDPANSAASQANKEEADSRSVFVGNVDYACTPEEVQQHFQSCGTVNRV  116

Query  529  TILTDKFG  552
            TILTDKFG
Sbjct  117  TILTDKFG  124



>ref|NP_201329.1| RNA recognition motif-containing protein [Arabidopsis thaliana]
 sp|Q9FJN9.1|PABN2_ARATH RecName: Full=Polyadenylate-binding protein 2; Short=AtPabN2; 
Short=AtPabN3; Short=Poly(A)-binding protein 2; AltName: Full=Nuclear 
poly(A)-binding protein 2; AltName: Full=Poly(A)-binding 
protein II; Short=PABII [Arabidopsis thaliana]
 gb|AAK62429.1|AF386984_1 poly(A)-binding protein II-like [Arabidopsis thaliana]
 dbj|BAB11662.1| poly(A)-binding protein II-like [Arabidopsis thaliana]
 gb|AAN15337.1| poly(A)-binding protein II-like [Arabidopsis thaliana]
 gb|AED98030.1| RNA recognition motif-containing protein [Arabidopsis thaliana]
Length=220

 Score =   152 bits (383),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 86/128 (67%), Positives = 105/128 (82%), Gaps = 1/128 (1%)
 Frame = +1

Query  169  EQEEDVYGGEFPeegdmdadvdmaalaeaeaqedPNAKQDLENMKKRLKEIEEEAGALRE  348
            E+E +VYGGE P+ G+MD D++        A  D +A ++L+ MKKRLKE+E+EA ALRE
Sbjct  3    EEEHEVYGGEIPDVGEMDGDMEALNPDLDMAAADDDAVKELDEMKKRLKEMEDEAAALRE  62

Query  349  MQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRV  528
            MQAKVEKEM G QDP + +A+QA KEEVDARS++VGNVDYACTPEEVQQHFQ+CGTV+RV
Sbjct  63   MQAKVEKEM-GAQDPASIAANQAGKEEVDARSVFVGNVDYACTPEEVQQHFQTCGTVHRV  121

Query  529  TILTDKFG  552
            TILTDKFG
Sbjct  122  TILTDKFG  129



>ref|XP_002866661.1| polyadenylate-binding protein family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH42920.1| polyadenylate-binding protein family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=220

 Score =   152 bits (383),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 86/128 (67%), Positives = 105/128 (82%), Gaps = 1/128 (1%)
 Frame = +1

Query  169  EQEEDVYGGEFPeegdmdadvdmaalaeaeaqedPNAKQDLENMKKRLKEIEEEAGALRE  348
            E+E +VYGGE P+ G+MD D++        A  D +A ++L+ MKKRLKE+E+EA ALRE
Sbjct  3    EEEHEVYGGEIPDVGEMDGDMEALNPDLDMAAADDDAVKELDEMKKRLKEMEDEAAALRE  62

Query  349  MQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRV  528
            MQAKVEKEM G QDP + +A+QA KEEVDARS++VGNVDYACTPEEVQQHFQ+CGTV+RV
Sbjct  63   MQAKVEKEM-GAQDPASIAANQAGKEEVDARSVFVGNVDYACTPEEVQQHFQTCGTVHRV  121

Query  529  TILTDKFG  552
            TILTDKFG
Sbjct  122  TILTDKFG  129



>gb|KFK28208.1| hypothetical protein AALP_AA8G486500 [Arabis alpina]
Length=220

 Score =   151 bits (382),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 86/128 (67%), Positives = 104/128 (81%), Gaps = 1/128 (1%)
 Frame = +1

Query  169  EQEEDVYGGEFPeegdmdadvdmaalaeaeaqedPNAKQDLENMKKRLKEIEEEAGALRE  348
            E+E +VYGGE P+ G+MD D++        A  D +A ++L+ MKKRLKE+E+EA ALRE
Sbjct  3    EEEHEVYGGEIPDVGEMDGDMEALNPDMDMAAADDDAVKELDEMKKRLKEMEDEAAALRE  62

Query  349  MQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRV  528
            MQAKVEKEM G QDP   +A+QA KEEVDARS++VGNVDYACTPEEVQQHFQ+CGTV+RV
Sbjct  63   MQAKVEKEM-GAQDPATIAANQAGKEEVDARSVFVGNVDYACTPEEVQQHFQTCGTVHRV  121

Query  529  TILTDKFG  552
            TILTDKFG
Sbjct  122  TILTDKFG  129



>ref|XP_003525045.1| PREDICTED: polyadenylate-binding protein 2 isoform X1 [Glycine 
max]
Length=215

 Score =   151 bits (382),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 86/128 (67%), Positives = 106/128 (83%), Gaps = 6/128 (5%)
 Frame = +1

Query  169  EQEEDVYGGEFPeegdmdadvdmaalaeaeaqedPNAKQDLENMKKRLKEIEEEAGALRE  348
            E+E +VYGGE P+EG+M+ D+DM+A  +  A       ++L+ MK+RLKE+EEEA ALRE
Sbjct  3    EEEHEVYGGEIPDEGEMEGDIDMSAADDDAAV------KELDEMKRRLKEMEEEAAALRE  56

Query  349  MQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRV  528
            MQAKV+KE+  VQDP  ++ASQA KEE D+RS++VGNVDYACTPEEVQQHFQSCGTVNRV
Sbjct  57   MQAKVDKEIGSVQDPANSAASQANKEEADSRSVFVGNVDYACTPEEVQQHFQSCGTVNRV  116

Query  529  TILTDKFG  552
            TILTDKFG
Sbjct  117  TILTDKFG  124



>ref|XP_009390281.1| PREDICTED: polyadenylate-binding protein 2-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=214

 Score =   151 bits (381),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 95/128 (74%), Positives = 109/128 (85%), Gaps = 7/128 (5%)
 Frame = +1

Query  169  EQEEDVYGGEFPeegdmdadvdmaalaeaeaqedPNAKQDLENMKKRLKEIEEEAGALRE  348
            E+E +VYGGE P+EGDMDADVDMA   E       +A ++L+ MK+RLKE+EEEA ALRE
Sbjct  4    EEEHEVYGGEIPDEGDMDADVDMARPDE-------DAAKELDEMKRRLKEMEEEAAALRE  56

Query  349  MQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRV  528
            MQAKVEKEM  VQDP +A+ASQA KEEVD+RS++VGNVDYACTPEEVQQHFQSCGTVNRV
Sbjct  57   MQAKVEKEMGSVQDPASAAASQASKEEVDSRSVFVGNVDYACTPEEVQQHFQSCGTVNRV  116

Query  529  TILTDKFG  552
            TILTDKFG
Sbjct  117  TILTDKFG  124



>gb|ACJ84516.1| unknown [Medicago truncatula]
 gb|AFK38775.1| unknown [Medicago truncatula]
 gb|KEH20798.1| polyadenylate-binding protein II [Medicago truncatula]
Length=216

 Score =   151 bits (381),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 83/128 (65%), Positives = 101/128 (79%), Gaps = 5/128 (4%)
 Frame = +1

Query  169  EQEEDVYGGEFPeegdmdadvdmaalaeaeaqedPNAKQDLENMKKRLKEIEEEAGALRE  348
            E+E +VYGGE P+  +M+ DVDM+A  +          ++L+ M++RLKE+EEEA ALRE
Sbjct  3    EEEHEVYGGEIPDVAEMEGDVDMSAADDEA-----GGMKELDEMRRRLKEMEEEAAALRE  57

Query  349  MQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRV  528
            M AKVEKE+  VQDP + +ASQ  KEE DARS++VGNVDYACTPEEVQQHFQSCGTVNRV
Sbjct  58   MHAKVEKEIGSVQDPASVAASQENKEEADARSVFVGNVDYACTPEEVQQHFQSCGTVNRV  117

Query  529  TILTDKFG  552
            TILTDKFG
Sbjct  118  TILTDKFG  125



>emb|CDY33952.1| BnaC02g43850D [Brassica napus]
Length=212

 Score =   150 bits (380),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 85/128 (66%), Positives = 103/128 (80%), Gaps = 8/128 (6%)
 Frame = +1

Query  169  EQEEDVYGGEFPeegdmdadvdmaalaeaeaqedPNAKQDLENMKKRLKEIEEEAGALRE  348
            E+E +VYGGE P+ G+MD D+DM    +       +A ++L+ MK+RLKEIE+EA ALRE
Sbjct  3    EEEHEVYGGEIPDVGEMDGDMDMTGADD-------DAAKELDEMKRRLKEIEDEAAALRE  55

Query  349  MQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRV  528
            MQAKVEK+M G QDP   ++ QA KEEVDARS++VGNVDYACTPEEVQQHFQSCGTV+RV
Sbjct  56   MQAKVEKDM-GPQDPATIASDQAGKEEVDARSVFVGNVDYACTPEEVQQHFQSCGTVHRV  114

Query  529  TILTDKFG  552
            TILTDKFG
Sbjct  115  TILTDKFG  122



>ref|XP_010463257.1| PREDICTED: polyadenylate-binding protein 2-like [Camelina sativa]
Length=220

 Score =   151 bits (381),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 87/128 (68%), Positives = 105/128 (82%), Gaps = 1/128 (1%)
 Frame = +1

Query  169  EQEEDVYGGEFPeegdmdadvdmaalaeaeaqedPNAKQDLENMKKRLKEIEEEAGALRE  348
            E+E +VYGGE P+ G+MD D+D        A  D +A ++L+ MKKRLKE+E+EA ALRE
Sbjct  3    EEEHEVYGGEIPDVGEMDGDMDAPNPDLDMAAADDDAVKELDEMKKRLKEMEDEAAALRE  62

Query  349  MQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRV  528
            MQAKVEKEM G QDP + +A+QA KEEVDARS++VGNVDYACTPEEVQQHFQ+CGTV+RV
Sbjct  63   MQAKVEKEMGG-QDPASIAANQAGKEEVDARSVFVGNVDYACTPEEVQQHFQTCGTVHRV  121

Query  529  TILTDKFG  552
            TILTDKFG
Sbjct  122  TILTDKFG  129



>ref|XP_010484391.1| PREDICTED: polyadenylate-binding protein 2-like isoform X2 [Camelina 
sativa]
Length=220

 Score =   151 bits (381),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 87/128 (68%), Positives = 105/128 (82%), Gaps = 1/128 (1%)
 Frame = +1

Query  169  EQEEDVYGGEFPeegdmdadvdmaalaeaeaqedPNAKQDLENMKKRLKEIEEEAGALRE  348
            E+E +VYGGE P+ G+MD D+D        A  D +A ++L+ MKKRLKE+E+EA ALRE
Sbjct  3    EEEHEVYGGEIPDVGEMDGDMDAPNPDLDMAAADDDAVKELDEMKKRLKEMEDEAAALRE  62

Query  349  MQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRV  528
            MQAKVEKEM G QDP + +A+QA KEEVDARS++VGNVDYACTPEEVQQHFQ+CGTV+RV
Sbjct  63   MQAKVEKEMGG-QDPASIAANQAGKEEVDARSVFVGNVDYACTPEEVQQHFQTCGTVHRV  121

Query  529  TILTDKFG  552
            TILTDKFG
Sbjct  122  TILTDKFG  129



>ref|XP_010444551.1| PREDICTED: polyadenylate-binding protein 2-like isoform X2 [Camelina 
sativa]
Length=220

 Score =   151 bits (381),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 87/128 (68%), Positives = 105/128 (82%), Gaps = 1/128 (1%)
 Frame = +1

Query  169  EQEEDVYGGEFPeegdmdadvdmaalaeaeaqedPNAKQDLENMKKRLKEIEEEAGALRE  348
            E+E +VYGGE P+ G+MD D+D        A  D +A ++L+ MKKRLKE+E+EA ALRE
Sbjct  3    EEEHEVYGGEIPDVGEMDGDMDAPNPDLDMAAADDDAVKELDEMKKRLKEMEDEAAALRE  62

Query  349  MQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRV  528
            MQAKVEKEM G QDP + +A+QA KEEVDARS++VGNVDYACTPEEVQQHFQ+CGTV+RV
Sbjct  63   MQAKVEKEMGG-QDPASIAANQAGKEEVDARSVFVGNVDYACTPEEVQQHFQTCGTVHRV  121

Query  529  TILTDKFG  552
            TILTDKFG
Sbjct  122  TILTDKFG  129



>gb|KCW56970.1| hypothetical protein EUGRSUZ_I02641 [Eucalyptus grandis]
Length=217

 Score =   150 bits (380),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 70/89 (79%), Positives = 82/89 (92%), Gaps = 0/89 (0%)
 Frame = +1

Query  286  DLENMKKRLKEIEEEAGALREMQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNVD  465
            +L++MKKRLKE+E+EA ALREMQAKVE+EM  VQDP  A+ASQA KEE+D+RSI+VGNVD
Sbjct  51   ELDDMKKRLKEMEDEAAALREMQAKVEREMGSVQDPANAAASQANKEEIDSRSIFVGNVD  110

Query  466  YACTPEEVQQHFQSCGTVNRVTILTDKFG  552
            Y+CTPEEVQQHFQSCGTVNRVTI TDK+G
Sbjct  111  YSCTPEEVQQHFQSCGTVNRVTIRTDKYG  139



>gb|EYU35168.1| hypothetical protein MIMGU_mgv1a013256mg [Erythranthe guttata]
Length=219

 Score =   151 bits (381),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 89/135 (66%), Positives = 100/135 (74%), Gaps = 7/135 (5%)
 Frame = +1

Query  169  EQEEDVYGGEFPeegdmdadvdmaalaeaeaqedPNAKQD------LENMKKRLKEIEEE  330
            EQ++DVYGGE P+  D   + D    AEA A     A  D      LE MKKRL+EIEEE
Sbjct  8    EQDDDVYGGELPQSEDSYMESDFDLSAEAAATAAAAAGGDDSKAKELEGMKKRLQEIEEE  67

Query  331  AGALREMQAKVEKEMTGV-QDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQS  507
            AG LR+MQAKVEK++    +D   AS +QAEKEEVD+RSIYVGNVDYACTPEEVQQHFQS
Sbjct  68   AGELRQMQAKVEKQLGNAEEDATGASVTQAEKEEVDSRSIYVGNVDYACTPEEVQQHFQS  127

Query  508  CGTVNRVTILTDKFG  552
            CGTVNRVTILTDKFG
Sbjct  128  CGTVNRVTILTDKFG  142



>ref|XP_010555595.1| PREDICTED: polyadenylate-binding protein 2-like [Tarenaya hassleriana]
Length=222

 Score =   151 bits (381),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 94/131 (72%), Positives = 104/131 (79%), Gaps = 3/131 (2%)
 Frame = +1

Query  169  EQEEDVYGGEFPeegdmdadvdma---alaeaeaqedPNAKQDLENMKKRLKEIEEEAGA  339
            +QE +VYGG+ PEE + + D +     A A  E QE  +  +DLE MKKRLKEIEEEAGA
Sbjct  6    DQEHEVYGGDIPEEEEGEMDAEEYDDGAAAGDEDQEPASGSKDLEEMKKRLKEIEEEAGA  65

Query  340  LREMQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTV  519
            LREMQAKVEKEM   QD ++ S S AEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTV
Sbjct  66   LREMQAKVEKEMGSGQDSSSGSPSLAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTV  125

Query  520  NRVTILTDKFG  552
            NRVTILTDKFG
Sbjct  126  NRVTILTDKFG  136



>gb|KCW56969.1| hypothetical protein EUGRSUZ_I02641 [Eucalyptus grandis]
Length=229

 Score =   151 bits (381),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 70/89 (79%), Positives = 82/89 (92%), Gaps = 0/89 (0%)
 Frame = +1

Query  286  DLENMKKRLKEIEEEAGALREMQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNVD  465
            +L++MKKRLKE+E+EA ALREMQAKVE+EM  VQDP  A+ASQA KEE+D+RSI+VGNVD
Sbjct  51   ELDDMKKRLKEMEDEAAALREMQAKVEREMGSVQDPANAAASQANKEEIDSRSIFVGNVD  110

Query  466  YACTPEEVQQHFQSCGTVNRVTILTDKFG  552
            Y+CTPEEVQQHFQSCGTVNRVTI TDK+G
Sbjct  111  YSCTPEEVQQHFQSCGTVNRVTIRTDKYG  139



>ref|XP_009404039.1| PREDICTED: polyadenylate-binding protein 2-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=222

 Score =   150 bits (380),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 90/136 (66%), Positives = 105/136 (77%), Gaps = 15/136 (11%)
 Frame = +1

Query  169  EQEEDVYGGEFPeegdmdadvdmaalaeaeaqedPNAKQDLENMKKRLKEIEEEAGALRE  348
            E+E +VYGGE P+E DMDADVD+    E       +A ++L+ MKKRLKE+EEEA ALRE
Sbjct  3    EEEHEVYGGEIPDEADMDADVDIGRSDE-------DAAKELDEMKKRLKEMEEEAAALRE  55

Query  349  MQAKVEKEMTGVQ--------DPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQ  504
            +QAKVEKEM   Q        DP  ++A+QA KEEVDARS++VGNVDYACTPEEVQQHFQ
Sbjct  56   IQAKVEKEMGAAQGPISSPSLDPAGSAATQASKEEVDARSVFVGNVDYACTPEEVQQHFQ  115

Query  505  SCGTVNRVTILTDKFG  552
            SCGTVNRVTILTDKFG
Sbjct  116  SCGTVNRVTILTDKFG  131



>ref|XP_002323754.1| hypothetical protein POPTR_0017s07850g [Populus trichocarpa]
 gb|EEF03887.1| hypothetical protein POPTR_0017s07850g [Populus trichocarpa]
Length=199

 Score =   150 bits (378),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 72/93 (77%), Positives = 85/93 (91%), Gaps = 1/93 (1%)
 Frame = +1

Query  277  AKQDLENMKKRLKEIEEEAGALREMQAKVEKEMTGVQDPNA-ASASQAEKEEVDARSIYV  453
            A  +L++MKKRLKE+E+EA ALREMQAKVEKEM  VQDP+A A+ASQA KEEVD+RS++V
Sbjct  16   AVPELDDMKKRLKEMEDEAAALREMQAKVEKEMGSVQDPSASATASQANKEEVDSRSVFV  75

Query  454  GNVDYACTPEEVQQHFQSCGTVNRVTILTDKFG  552
            GNVDYACTPEEVQQHFQ+CGTVNRVTI +DK+G
Sbjct  76   GNVDYACTPEEVQQHFQACGTVNRVTIRSDKYG  108



>gb|EYU35167.1| hypothetical protein MIMGU_mgv1a013256mg [Erythranthe guttata]
Length=226

 Score =   150 bits (380),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 89/135 (66%), Positives = 100/135 (74%), Gaps = 7/135 (5%)
 Frame = +1

Query  169  EQEEDVYGGEFPeegdmdadvdmaalaeaeaqedPNAKQD------LENMKKRLKEIEEE  330
            EQ++DVYGGE P+  D   + D    AEA A     A  D      LE MKKRL+EIEEE
Sbjct  8    EQDDDVYGGELPQSEDSYMESDFDLSAEAAATAAAAAGGDDSKAKELEGMKKRLQEIEEE  67

Query  331  AGALREMQAKVEKEMTGV-QDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQS  507
            AG LR+MQAKVEK++    +D   AS +QAEKEEVD+RSIYVGNVDYACTPEEVQQHFQS
Sbjct  68   AGELRQMQAKVEKQLGNAEEDATGASVTQAEKEEVDSRSIYVGNVDYACTPEEVQQHFQS  127

Query  508  CGTVNRVTILTDKFG  552
            CGTVNRVTILTDKFG
Sbjct  128  CGTVNRVTILTDKFG  142



>ref|XP_006279497.1| hypothetical protein CARUB_v10027046mg, partial [Capsella rubella]
 gb|EOA12395.1| hypothetical protein CARUB_v10027046mg, partial [Capsella rubella]
Length=233

 Score =   151 bits (381),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 83/123 (67%), Positives = 100/123 (81%), Gaps = 1/123 (1%)
 Frame = +1

Query  184  VYGGEFPeegdmdadvdmaalaeaeaqedPNAKQDLENMKKRLKEIEEEAGALREMQAKV  363
            VYGGE P+ G+MD D++           D +A ++L+ MKKRLKE+E+EA ALREMQAKV
Sbjct  21   VYGGEIPDVGEMDGDMEAPNPDLDMTAADDDAVKELDEMKKRLKEMEDEAAALREMQAKV  80

Query  364  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  543
            EKEM G QDP + +A+QA KEEVDARS++VGNVDYACTPEEVQQHFQ+CGTV+RVTILTD
Sbjct  81   EKEMGG-QDPASIAANQAGKEEVDARSVFVGNVDYACTPEEVQQHFQTCGTVHRVTILTD  139

Query  544  KFG  552
            KFG
Sbjct  140  KFG  142



>emb|CDX91567.1| BnaC02g15930D [Brassica napus]
Length=228

 Score =   150 bits (380),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 75/93 (81%), Positives = 81/93 (87%), Gaps = 1/93 (1%)
 Frame = +1

Query  274  NAKQDLENMKKRLKEIEEEAGALREMQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYV  453
            +A +DLE+MKKRLKEIEEEA ALREMQAK E +M   QDP++A  S AEKEEVD RSIYV
Sbjct  51   SASRDLEDMKKRLKEIEEEASALREMQAKAENDMAAAQDPSSA-ISAAEKEEVDLRSIYV  109

Query  454  GNVDYACTPEEVQQHFQSCGTVNRVTILTDKFG  552
            GNVDYACTPEEVQQHFQS GTVNRVTILTDKFG
Sbjct  110  GNVDYACTPEEVQQHFQSFGTVNRVTILTDKFG  142



>ref|XP_010094140.1| Polyadenylate-binding protein 2 [Morus notabilis]
 gb|EXB55273.1| Polyadenylate-binding protein 2 [Morus notabilis]
Length=197

 Score =   149 bits (377),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 68/89 (76%), Positives = 82/89 (92%), Gaps = 0/89 (0%)
 Frame = +1

Query  286  DLENMKKRLKEIEEEAGALREMQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNVD  465
            +L++MKKRLKE+E+EA ALREMQAKVEKEM  VQ+P+ A+ +QA +EEVD+RS++VGNVD
Sbjct  17   ELDDMKKRLKEMEDEAAALREMQAKVEKEMGSVQEPSTAAGTQANREEVDSRSVFVGNVD  76

Query  466  YACTPEEVQQHFQSCGTVNRVTILTDKFG  552
            Y+CTPEEVQQHFQSCGTVNRVTI TDKFG
Sbjct  77   YSCTPEEVQQHFQSCGTVNRVTIRTDKFG  105



>ref|XP_010676727.1| PREDICTED: polyadenylate-binding protein 1-like [Beta vulgaris 
subsp. vulgaris]
Length=222

 Score =   150 bits (379),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/90 (78%), Positives = 84/90 (93%), Gaps = 0/90 (0%)
 Frame = +1

Query  283  QDLENMKKRLKEIEEEAGALREMQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNV  462
            Q+LE+MKKRL+E+E+EAGALREMQAKVE+EM   ++  +A+ +QAEKEEVD+RS+YVGNV
Sbjct  43   QNLEDMKKRLEELEDEAGALREMQAKVEQEMGIPEESTSANPTQAEKEEVDSRSVYVGNV  102

Query  463  DYACTPEEVQQHFQSCGTVNRVTILTDKFG  552
            DYACTPEEVQQHFQSCGTVNRVTILTD+FG
Sbjct  103  DYACTPEEVQQHFQSCGTVNRVTILTDRFG  132



>ref|XP_009390280.1| PREDICTED: polyadenylate-binding protein 2-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=216

 Score =   150 bits (378),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 96/128 (75%), Positives = 109/128 (85%), Gaps = 5/128 (4%)
 Frame = +1

Query  169  EQEEDVYGGEFPeegdmdadvdmaalaeaeaqedPNAKQDLENMKKRLKEIEEEAGALRE  348
            E+E +VYGGE P+EGDMDADVDMA   E  A+      Q+L+ MK+RLKE+EEEA ALRE
Sbjct  4    EEEHEVYGGEIPDEGDMDADVDMARPDEDAAKL-----QELDEMKRRLKEMEEEAAALRE  58

Query  349  MQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRV  528
            MQAKVEKEM  VQDP +A+ASQA KEEVD+RS++VGNVDYACTPEEVQQHFQSCGTVNRV
Sbjct  59   MQAKVEKEMGSVQDPASAAASQASKEEVDSRSVFVGNVDYACTPEEVQQHFQSCGTVNRV  118

Query  529  TILTDKFG  552
            TILTDKFG
Sbjct  119  TILTDKFG  126



>ref|XP_009404038.1| PREDICTED: polyadenylate-binding protein 2-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=224

 Score =   150 bits (378),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 91/136 (67%), Positives = 105/136 (77%), Gaps = 13/136 (10%)
 Frame = +1

Query  169  EQEEDVYGGEFPeegdmdadvdmaalaeaeaqedPNAKQDLENMKKRLKEIEEEAGALRE  348
            E+E +VYGGE P+E DMDADVD+    E  A+      Q+L+ MKKRLKE+EEEA ALRE
Sbjct  3    EEEHEVYGGEIPDEADMDADVDIGRSDEDAAKL-----QELDEMKKRLKEMEEEAAALRE  57

Query  349  MQAKVEKEMTGVQ--------DPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQ  504
            +QAKVEKEM   Q        DP  ++A+QA KEEVDARS++VGNVDYACTPEEVQQHFQ
Sbjct  58   IQAKVEKEMGAAQGPISSPSLDPAGSAATQASKEEVDARSVFVGNVDYACTPEEVQQHFQ  117

Query  505  SCGTVNRVTILTDKFG  552
            SCGTVNRVTILTDKFG
Sbjct  118  SCGTVNRVTILTDKFG  133



>gb|KCW56971.1| hypothetical protein EUGRSUZ_I02641 [Eucalyptus grandis]
Length=221

 Score =   150 bits (378),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/89 (79%), Positives = 82/89 (92%), Gaps = 0/89 (0%)
 Frame = +1

Query  286  DLENMKKRLKEIEEEAGALREMQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNVD  465
            +L++MKKRLKE+E+EA ALREMQAKVE+EM  VQDP  A+ASQA KEE+D+RSI+VGNVD
Sbjct  51   ELDDMKKRLKEMEDEAAALREMQAKVEREMGSVQDPANAAASQANKEEIDSRSIFVGNVD  110

Query  466  YACTPEEVQQHFQSCGTVNRVTILTDKFG  552
            Y+CTPEEVQQHFQSCGTVNRVTI TDK+G
Sbjct  111  YSCTPEEVQQHFQSCGTVNRVTIRTDKYG  139



>gb|AFK37484.1| unknown [Lotus japonicus]
Length=200

 Score =   149 bits (376),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 70/88 (80%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = +1

Query  289  LENMKKRLKEIEEEAGALREMQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDY  468
            L++MKKRLKE+E+EA ALREMQAKVEKEM  V DP  ASASQ  +EEVD+RS++VGNVDY
Sbjct  21   LDDMKKRLKEMEDEAAALREMQAKVEKEMGSVPDPANASASQTNREEVDSRSVFVGNVDY  80

Query  469  ACTPEEVQQHFQSCGTVNRVTILTDKFG  552
            +CTPEEVQQHFQSCGTVNRVTI TDKFG
Sbjct  81   SCTPEEVQQHFQSCGTVNRVTIRTDKFG  108



>emb|CDY33970.1| BnaC02g43670D [Brassica napus]
Length=211

 Score =   149 bits (377),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 85/128 (66%), Positives = 103/128 (80%), Gaps = 8/128 (6%)
 Frame = +1

Query  169  EQEEDVYGGEFPeegdmdadvdmaalaeaeaqedPNAKQDLENMKKRLKEIEEEAGALRE  348
            E+E +VYGGE P+ G+MD D+DM    +       +A ++L+ MK+RLKEIE+EA ALRE
Sbjct  3    EEEHEVYGGEIPDVGEMDGDMDMTGADD-------DAAKELDEMKRRLKEIEDEAAALRE  55

Query  349  MQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRV  528
            MQAKVEK+M G QDP   ++ QA KEEVDARS++VGNVDYACTPEEVQQHFQSCGTV+RV
Sbjct  56   MQAKVEKDM-GPQDPATIASDQAGKEEVDARSVFVGNVDYACTPEEVQQHFQSCGTVHRV  114

Query  529  TILTDKFG  552
            TILTDKFG
Sbjct  115  TILTDKFG  122



>ref|XP_004250109.1| PREDICTED: polyadenylate-binding protein 2 isoform X1 [Solanum 
lycopersicum]
Length=219

 Score =   149 bits (377),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 85/129 (66%), Positives = 103/129 (80%), Gaps = 5/129 (4%)
 Frame = +1

Query  169  EQEEDVYGGEFPeegdmdadvdmaalaeaeaqedPNAKQDLENMKKRLKEIEEEAGALRE  348
            E+E +VYGGE P EGDM+       +A A+     +A ++L+ MKKRLKE+E+EA ALRE
Sbjct  3    EEEHEVYGGEIPIEGDMEPHGADVDMATADD----DAVKELDEMKKRLKEMEDEAAALRE  58

Query  349  MQAKVEKEMTGVQD-PNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNR  525
            MQAKVEKEM  VQD P + +ASQ  +EE+D+RSI+VGNVDYACTPEEVQQHFQ+CGTVNR
Sbjct  59   MQAKVEKEMGSVQDDPASTAASQENREELDSRSIFVGNVDYACTPEEVQQHFQACGTVNR  118

Query  526  VTILTDKFG  552
            VTILTDKFG
Sbjct  119  VTILTDKFG  127



>gb|EYU23964.1| hypothetical protein MIMGU_mgv1a013628mg [Erythranthe guttata]
Length=215

 Score =   149 bits (375),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 75/92 (82%), Positives = 83/92 (90%), Gaps = 0/92 (0%)
 Frame = +1

Query  277  AKQDLENMKKRLKEIEEEAGALREMQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVG  456
            A ++L+ MKKRLKE+EEEA ALREMQAKVEKEM   QDP +A+AS A KEEVD+RS+YVG
Sbjct  33   ASKELDEMKKRLKEMEEEAAALREMQAKVEKEMGAAQDPASAAASAASKEEVDSRSVYVG  92

Query  457  NVDYACTPEEVQQHFQSCGTVNRVTILTDKFG  552
            NVDYACTPEEVQQHFQSCGTVNRVTILTDKFG
Sbjct  93   NVDYACTPEEVQQHFQSCGTVNRVTILTDKFG  124



>ref|XP_002983261.1| hypothetical protein SELMODRAFT_117870 [Selaginella moellendorffii]
 gb|EFJ15603.1| hypothetical protein SELMODRAFT_117870 [Selaginella moellendorffii]
Length=219

 Score =   149 bits (375),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 73/90 (81%), Positives = 81/90 (90%), Gaps = 2/90 (2%)
 Frame = +1

Query  283  QDLENMKKRLKEIEEEAGALREMQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNV  462
            ++LE+MKKRLKE+E+EA ALR+MQAKVEKEM   QD NAAS  QA KEE DARS+YVGNV
Sbjct  41   KELEDMKKRLKEMEDEAAALRDMQAKVEKEMGASQDANAAS--QAGKEEADARSVYVGNV  98

Query  463  DYACTPEEVQQHFQSCGTVNRVTILTDKFG  552
            DY+CTPEEVQQHFQSCGTVNRVTILTDKFG
Sbjct  99   DYSCTPEEVQQHFQSCGTVNRVTILTDKFG  128



>ref|XP_002873452.1| polyadenylate-binding protein family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH49711.1| polyadenylate-binding protein family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=202

 Score =   148 bits (374),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 81/128 (63%), Positives = 94/128 (73%), Gaps = 4/128 (3%)
 Frame = +1

Query  169  EQEEDVYGGEFPeegdmdadvdmaalaeaeaqedPNAKQDLENMKKRLKEIEEEAGALRE  348
            E+E +VYGGE PE  + D       ++  +     +A  +L  MKKRLKE+EEEA ALRE
Sbjct  3    EEEHEVYGGEIPEVEETDVPDPDIDMSAGDD----DAVTELAEMKKRLKEMEEEAAALRE  58

Query  349  MQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRV  528
            MQAKVEKEM   QDP   +A+Q  KEEVDARS+YVGNVDYACTPEEVQ HFQ+CGTVNRV
Sbjct  59   MQAKVEKEMGATQDPATMAANQEGKEEVDARSVYVGNVDYACTPEEVQLHFQTCGTVNRV  118

Query  529  TILTDKFG  552
            TIL DKFG
Sbjct  119  TILMDKFG  126



>ref|NP_850803.1| RNA recognition motif-containing protein [Arabidopsis thaliana]
 gb|AED91528.1| RNA recognition motif-containing protein [Arabidopsis thaliana]
Length=202

 Score =   148 bits (374),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 83/128 (65%), Positives = 97/128 (76%), Gaps = 4/128 (3%)
 Frame = +1

Query  169  EQEEDVYGGEFPeegdmdadvdmaalaeaeaqedPNAKQDLENMKKRLKEIEEEAGALRE  348
            E+E +VYGGE PE GD D       ++ A+     +A  +L  MK+RLKE+EEEA ALRE
Sbjct  3    EEEHEVYGGEIPEVGDTDVPDPDIDMSAADE----DAVTELAEMKRRLKEMEEEAAALRE  58

Query  349  MQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRV  528
            MQAKVEKEM   QDP + +A+Q  KEEVDARS+YVGNVDYACTPEEVQ HFQ+CGTVNRV
Sbjct  59   MQAKVEKEMGATQDPASMAANQEGKEEVDARSVYVGNVDYACTPEEVQLHFQTCGTVNRV  118

Query  529  TILTDKFG  552
            TIL DKFG
Sbjct  119  TILMDKFG  126



>ref|XP_007047889.1| RNA-binding (RRM/RBD/RNP motifs) family protein isoform 2 [Theobroma 
cacao]
 gb|EOX92046.1| RNA-binding (RRM/RBD/RNP motifs) family protein isoform 2 [Theobroma 
cacao]
Length=215

 Score =   149 bits (375),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 84/133 (63%), Positives = 102/133 (77%), Gaps = 16/133 (12%)
 Frame = +1

Query  169  EQEEDVYGGEFPeegdmdadvdmaalaeaeaqedPNAKQDL-----ENMKKRLKEIEEEA  333
            E+E +VYGGE P+EG+M+ D+D             NA  D+     + +KKRLKE+E+EA
Sbjct  3    EEEHEVYGGEIPDEGEMEGDLDPH-----------NADVDMSAADDDAVKKRLKEMEDEA  51

Query  334  GALREMQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCG  513
             ALREMQAKVEKEM  VQDP  A+A+QA +EE D+RS++VGNVDYACTPEEVQQHFQSCG
Sbjct  52   AALREMQAKVEKEMGAVQDPAGAAANQASREEADSRSVFVGNVDYACTPEEVQQHFQSCG  111

Query  514  TVNRVTILTDKFG  552
            TVNRVTILTDK+G
Sbjct  112  TVNRVTILTDKYG  124



>ref|NP_196597.1| RNA recognition motif-containing protein [Arabidopsis thaliana]
 sp|Q9LX90.1|PABN3_ARATH RecName: Full=Polyadenylate-binding protein 3; Short=AtPabN2; 
Short=AtPabN3; Short=Poly(A)-binding protein 3; AltName: Full=Nuclear 
poly(A)-binding protein 3; AltName: Full=Poly(A)-binding 
protein III; Short=PABIII [Arabidopsis thaliana]
 emb|CAB89408.1| RNA binding protein-like [Arabidopsis thaliana]
 gb|AAO41941.1| putative polyadenylate-binding protein II (PAB2) [Arabidopsis 
thaliana]
 gb|AAO50536.1| putative polyadenylate-binding protein II (PAB2) [Arabidopsis 
thaliana]
 gb|AED91529.1| RNA recognition motif-containing protein [Arabidopsis thaliana]
Length=217

 Score =   148 bits (374),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 83/128 (65%), Positives = 97/128 (76%), Gaps = 4/128 (3%)
 Frame = +1

Query  169  EQEEDVYGGEFPeegdmdadvdmaalaeaeaqedPNAKQDLENMKKRLKEIEEEAGALRE  348
            E+E +VYGGE PE GD D       ++ A+     +A  +L  MK+RLKE+EEEA ALRE
Sbjct  3    EEEHEVYGGEIPEVGDTDVPDPDIDMSAADE----DAVTELAEMKRRLKEMEEEAAALRE  58

Query  349  MQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRV  528
            MQAKVEKEM   QDP + +A+Q  KEEVDARS+YVGNVDYACTPEEVQ HFQ+CGTVNRV
Sbjct  59   MQAKVEKEMGATQDPASMAANQEGKEEVDARSVYVGNVDYACTPEEVQLHFQTCGTVNRV  118

Query  529  TILTDKFG  552
            TIL DKFG
Sbjct  119  TILMDKFG  126



>ref|XP_010937390.1| PREDICTED: polyadenylate-binding protein 2 isoform X1 [Elaeis 
guineensis]
Length=235

 Score =   149 bits (375),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 86/142 (61%), Positives = 106/142 (75%), Gaps = 14/142 (10%)
 Frame = +1

Query  169  EQEEDVYGGEFPeegdmdadvdmaalaeaeaqedPNAKQDLENMKKRLKEIEEEAGALRE  348
            E+E +VYG + P+EG+M+ D+D         + D +A ++L+ MKKRLKE+EEEA ALRE
Sbjct  3    EEEHEVYGQDIPDEGEMEGDIDPHGADVDMTRADDDAVKELDEMKKRLKEMEEEAAALRE  62

Query  349  MQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGN--------------VDYACTPEE  486
            MQAKVEKEM  VQDP +A+A+QA +EEVD+RS++VGN              VDYACTPEE
Sbjct  63   MQAKVEKEMGAVQDPASAAATQASREEVDSRSVFVGNITMNSCVTLGLIHDVDYACTPEE  122

Query  487  VQQHFQSCGTVNRVTILTDKFG  552
            VQQHFQSCGTVNRVTILTDKFG
Sbjct  123  VQQHFQSCGTVNRVTILTDKFG  144



>ref|XP_011097543.1| PREDICTED: polyadenylate-binding protein 2 isoform X1 [Sesamum 
indicum]
Length=217

 Score =   148 bits (374),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 89/128 (70%), Positives = 107/128 (84%), Gaps = 4/128 (3%)
 Frame = +1

Query  169  EQEEDVYGGEFPeegdmdadvdmaalaeaeaqedPNAKQDLENMKKRLKEIEEEAGALRE  348
            E+E +VYGGE P+EG+M+AD D+   A  +      A ++L+ MKKRLKE+EEEA ALRE
Sbjct  3    EEEHEVYGGEIPDEGEMEADADVEMPAADDD----AAAKELDEMKKRLKEMEEEAAALRE  58

Query  349  MQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRV  528
            MQAKVEKEM  VQDP +A+A+QA KEEVD+RS++VGNVDYACTPEEVQQHFQ+CGTVNRV
Sbjct  59   MQAKVEKEMGAVQDPASAAAAQASKEEVDSRSVFVGNVDYACTPEEVQQHFQACGTVNRV  118

Query  529  TILTDKFG  552
            TILTDKFG
Sbjct  119  TILTDKFG  126



>ref|XP_010444550.1| PREDICTED: polyadenylate-binding protein 2-like isoform X1 [Camelina 
sativa]
Length=221

 Score =   148 bits (374),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 85/129 (66%), Positives = 102/129 (79%), Gaps = 2/129 (2%)
 Frame = +1

Query  169  EQEEDVYGGEFPeegdmd-advdmaalaeaeaqedPNAKQDLENMKKRLKEIEEEAGALR  345
            E+E +VYGGE P+ G+MD          +  A +D   K +L+ MKKRLKE+E+EA ALR
Sbjct  3    EEEHEVYGGEIPDVGEMDGDMDAPNPDLDMAAADDDAVKVELDEMKKRLKEMEDEAAALR  62

Query  346  EMQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNR  525
            EMQAKVEKEM G QDP + +A+QA KEEVDARS++VGNVDYACTPEEVQQHFQ+CGTV+R
Sbjct  63   EMQAKVEKEMGG-QDPASIAANQAGKEEVDARSVFVGNVDYACTPEEVQQHFQTCGTVHR  121

Query  526  VTILTDKFG  552
            VTILTDKFG
Sbjct  122  VTILTDKFG  130



>ref|XP_009611267.1| PREDICTED: polyadenylate-binding protein 2 [Nicotiana tomentosiformis]
 ref|XP_009757522.1| PREDICTED: polyadenylate-binding protein 2 [Nicotiana sylvestris]
Length=216

 Score =   148 bits (373),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 87/128 (68%), Positives = 106/128 (83%), Gaps = 5/128 (4%)
 Frame = +1

Query  169  EQEEDVYGGEFPeegdmdadvdmaalaeaeaqedPNAKQDLENMKKRLKEIEEEAGALRE  348
            E+E +VYGGE P E +M+AD++    A  +     +A ++L+ MKKRLKE+E+EA ALRE
Sbjct  3    EEEHEVYGGEIPMEAEMEADMEHHGGAADD-----DAVKELDEMKKRLKEMEDEAVALRE  57

Query  349  MQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRV  528
            MQAKVEKEM  VQDP +A+ASQA +EEVD+RSI+VGNVDYACTPEEVQQHFQ+CGTVNRV
Sbjct  58   MQAKVEKEMGSVQDPASAAASQASREEVDSRSIFVGNVDYACTPEEVQQHFQACGTVNRV  117

Query  529  TILTDKFG  552
            TILTDKFG
Sbjct  118  TILTDKFG  125



>ref|XP_010484390.1| PREDICTED: polyadenylate-binding protein 2-like isoform X1 [Camelina 
sativa]
Length=221

 Score =   148 bits (373),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 85/129 (66%), Positives = 102/129 (79%), Gaps = 2/129 (2%)
 Frame = +1

Query  169  EQEEDVYGGEFPeegdmd-advdmaalaeaeaqedPNAKQDLENMKKRLKEIEEEAGALR  345
            E+E +VYGGE P+ G+MD          +  A +D   K +L+ MKKRLKE+E+EA ALR
Sbjct  3    EEEHEVYGGEIPDVGEMDGDMDAPNPDLDMAAADDDAVKVELDEMKKRLKEMEDEAAALR  62

Query  346  EMQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNR  525
            EMQAKVEKEM G QDP + +A+QA KEEVDARS++VGNVDYACTPEEVQQHFQ+CGTV+R
Sbjct  63   EMQAKVEKEMGG-QDPASIAANQAGKEEVDARSVFVGNVDYACTPEEVQQHFQTCGTVHR  121

Query  526  VTILTDKFG  552
            VTILTDKFG
Sbjct  122  VTILTDKFG  130



>ref|XP_002961293.1| hypothetical protein SELMODRAFT_74095 [Selaginella moellendorffii]
 gb|EFJ38832.1| hypothetical protein SELMODRAFT_74095 [Selaginella moellendorffii]
Length=221

 Score =   148 bits (373),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 73/90 (81%), Positives = 81/90 (90%), Gaps = 2/90 (2%)
 Frame = +1

Query  283  QDLENMKKRLKEIEEEAGALREMQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNV  462
            ++LE+MKKRLKE+E+EA ALR+MQAKVEKEM   QD NAAS  QA KEE DARS+YVGNV
Sbjct  43   KELEDMKKRLKEMEDEAAALRDMQAKVEKEMGAGQDANAAS--QAGKEEADARSVYVGNV  100

Query  463  DYACTPEEVQQHFQSCGTVNRVTILTDKFG  552
            DY+CTPEEVQQHFQSCGTVNRVTILTDKFG
Sbjct  101  DYSCTPEEVQQHFQSCGTVNRVTILTDKFG  130



>ref|XP_009624759.1| PREDICTED: polyadenylate-binding protein 2-like [Nicotiana tomentosiformis]
Length=196

 Score =   147 bits (370),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 71/89 (80%), Positives = 83/89 (93%), Gaps = 1/89 (1%)
 Frame = +1

Query  286  DLENMKKRLKEIEEEAGALREMQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNVD  465
            +L++MKKRLKE+E+EA ALREMQAKVEKEM  VQDP AA+A+QA +EEVDARSI+VGNVD
Sbjct  17   ELDDMKKRLKEMEDEAVALREMQAKVEKEMGSVQDP-AAAANQANREEVDARSIFVGNVD  75

Query  466  YACTPEEVQQHFQSCGTVNRVTILTDKFG  552
            Y+CTPEEVQQHFQ+CGTVNRVTI T+KFG
Sbjct  76   YSCTPEEVQQHFQACGTVNRVTIRTNKFG  104



>ref|XP_007159120.1| hypothetical protein PHAVU_002G210300g [Phaseolus vulgaris]
 gb|ESW31114.1| hypothetical protein PHAVU_002G210300g [Phaseolus vulgaris]
Length=198

 Score =   147 bits (370),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 70/92 (76%), Positives = 80/92 (87%), Gaps = 0/92 (0%)
 Frame = +1

Query  277  AKQDLENMKKRLKEIEEEAGALREMQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVG  456
            A  +L+ MKKRLKE+E+EA ALREMQAKVEKEM  VQ P  A++SQ  KEEVD+RS++VG
Sbjct  16   AGLELDGMKKRLKEMEDEASALREMQAKVEKEMGSVQAPAPAASSQNNKEEVDSRSVFVG  75

Query  457  NVDYACTPEEVQQHFQSCGTVNRVTILTDKFG  552
            NVDY+CTPEEVQQHFQSCGTVNRVTI TDKFG
Sbjct  76   NVDYSCTPEEVQQHFQSCGTVNRVTIRTDKFG  107



>ref|XP_001752237.1| predicted protein [Physcomitrella patens]
 gb|EDQ82970.1| predicted protein, partial [Physcomitrella patens]
Length=156

 Score =   145 bits (366),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 68/85 (80%), Positives = 75/85 (88%), Gaps = 0/85 (0%)
 Frame = +1

Query  298  MKKRLKEIEEEAGALREMQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACT  477
            MKKRLKE+EEEA ALR+MQAKVEKEM G QD    S +QA +EE DARS++VGNVDY+CT
Sbjct  1    MKKRLKEMEEEAAALRDMQAKVEKEMGGSQDSAITSGAQANREEADARSVFVGNVDYSCT  60

Query  478  PEEVQQHFQSCGTVNRVTILTDKFG  552
            PEEVQQHFQSCGTVNRVTILTDKFG
Sbjct  61   PEEVQQHFQSCGTVNRVTILTDKFG  85



>ref|XP_002525843.1| poly-A binding protein, putative [Ricinus communis]
 gb|EEF36537.1| poly-A binding protein, putative [Ricinus communis]
Length=198

 Score =   146 bits (369),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 69/89 (78%), Positives = 81/89 (91%), Gaps = 1/89 (1%)
 Frame = +1

Query  286  DLENMKKRLKEIEEEAGALREMQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNVD  465
            +L++MKKRLKE+E+EA ALREMQAKVEKEM   QDP AA ASQA +EEVD+RS++VGNVD
Sbjct  20   ELDDMKKRLKEMEDEAAALREMQAKVEKEMGSSQDPTAA-ASQANREEVDSRSVFVGNVD  78

Query  466  YACTPEEVQQHFQSCGTVNRVTILTDKFG  552
            Y+CTPEEVQQHFQSCGTVNR+TI TDK+G
Sbjct  79   YSCTPEEVQQHFQSCGTVNRITIRTDKYG  107



>ref|XP_009776052.1| PREDICTED: polyadenylate-binding protein 2-like [Nicotiana sylvestris]
Length=196

 Score =   146 bits (369),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 69/89 (78%), Positives = 83/89 (93%), Gaps = 1/89 (1%)
 Frame = +1

Query  286  DLENMKKRLKEIEEEAGALREMQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNVD  465
            +L++MKKRLKE+E+EA ALREMQAKVEKEM  VQDP AA+A+QA +EEVD+RS++VGNVD
Sbjct  17   ELDDMKKRLKEMEDEAAALREMQAKVEKEMGSVQDP-AAAANQANREEVDSRSVFVGNVD  75

Query  466  YACTPEEVQQHFQSCGTVNRVTILTDKFG  552
            Y+CTPEEVQQHFQ+CGTVNRVTI T+KFG
Sbjct  76   YSCTPEEVQQHFQACGTVNRVTIRTNKFG  104



>gb|KJB79638.1| hypothetical protein B456_013G060100 [Gossypium raimondii]
Length=194

 Score =   146 bits (368),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 71/93 (76%), Positives = 84/93 (90%), Gaps = 1/93 (1%)
 Frame = +1

Query  277  AKQDLENMKKRLKEIEEEAGALREMQAKVEKEMTGVQDPNAAS-ASQAEKEEVDARSIYV  453
            + +DL++MKKRLKE+EEEA ALREMQAKVEKEM  VQDP AA+  SQA +EEVD+RS++V
Sbjct  13   STEDLDDMKKRLKEMEEEAAALREMQAKVEKEMGSVQDPAAAAATSQANREEVDSRSVFV  72

Query  454  GNVDYACTPEEVQQHFQSCGTVNRVTILTDKFG  552
            GNVDY+CTPEEVQQHFQ+CGTVNRVTI TDK+G
Sbjct  73   GNVDYSCTPEEVQQHFQTCGTVNRVTIRTDKYG  105



>emb|CDP20626.1| unnamed protein product [Coffea canephora]
Length=196

 Score =   146 bits (368),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 70/89 (79%), Positives = 83/89 (93%), Gaps = 0/89 (0%)
 Frame = +1

Query  286  DLENMKKRLKEIEEEAGALREMQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNVD  465
            +L++MKKRLKE+E+EA ALREMQAKVEKEM  VQDP AA+ASQA +EEVD+RS++VGNVD
Sbjct  17   ELDDMKKRLKEMEDEAAALREMQAKVEKEMGAVQDPAAAAASQANREEVDSRSVFVGNVD  76

Query  466  YACTPEEVQQHFQSCGTVNRVTILTDKFG  552
            Y+CTPEEVQQHFQ+CGTVNRVTI T+KFG
Sbjct  77   YSCTPEEVQQHFQACGTVNRVTIRTNKFG  105



>gb|KHG28448.1| Polyadenylate-binding 2 [Gossypium arboreum]
 gb|KJB79640.1| hypothetical protein B456_013G060100 [Gossypium raimondii]
Length=195

 Score =   145 bits (367),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 71/90 (79%), Positives = 82/90 (91%), Gaps = 1/90 (1%)
 Frame = +1

Query  286  DLENMKKRLKEIEEEAGALREMQAKVEKEMTGVQDPNAAS-ASQAEKEEVDARSIYVGNV  462
            DL++MKKRLKE+EEEA ALREMQAKVEKEM  VQDP AA+  SQA +EEVD+RS++VGNV
Sbjct  17   DLDDMKKRLKEMEEEAAALREMQAKVEKEMGSVQDPAAAAATSQANREEVDSRSVFVGNV  76

Query  463  DYACTPEEVQQHFQSCGTVNRVTILTDKFG  552
            DY+CTPEEVQQHFQ+CGTVNRVTI TDK+G
Sbjct  77   DYSCTPEEVQQHFQTCGTVNRVTIRTDKYG  106



>gb|KJB79637.1| hypothetical protein B456_013G060100 [Gossypium raimondii]
Length=195

 Score =   145 bits (367),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 71/90 (79%), Positives = 82/90 (91%), Gaps = 1/90 (1%)
 Frame = +1

Query  286  DLENMKKRLKEIEEEAGALREMQAKVEKEMTGVQDPNAAS-ASQAEKEEVDARSIYVGNV  462
            DL++MKKRLKE+EEEA ALREMQAKVEKEM  VQDP AA+  SQA +EEVD+RS++VGNV
Sbjct  17   DLDDMKKRLKEMEEEAAALREMQAKVEKEMGSVQDPAAAAATSQANREEVDSRSVFVGNV  76

Query  463  DYACTPEEVQQHFQSCGTVNRVTILTDKFG  552
            DY+CTPEEVQQHFQ+CGTVNRVTI TDK+G
Sbjct  77   DYSCTPEEVQQHFQTCGTVNRVTIRTDKYG  106



>gb|KJB79639.1| hypothetical protein B456_013G060100 [Gossypium raimondii]
Length=183

 Score =   145 bits (365),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 71/90 (79%), Positives = 82/90 (91%), Gaps = 1/90 (1%)
 Frame = +1

Query  286  DLENMKKRLKEIEEEAGALREMQAKVEKEMTGVQDPNAAS-ASQAEKEEVDARSIYVGNV  462
            DL++MKKRLKE+EEEA ALREMQAKVEKEM  VQDP AA+  SQA +EEVD+RS++VGNV
Sbjct  17   DLDDMKKRLKEMEEEAAALREMQAKVEKEMGSVQDPAAAAATSQANREEVDSRSVFVGNV  76

Query  463  DYACTPEEVQQHFQSCGTVNRVTILTDKFG  552
            DY+CTPEEVQQHFQ+CGTVNRVTI TDK+G
Sbjct  77   DYSCTPEEVQQHFQTCGTVNRVTIRTDKYG  106



>ref|XP_010027917.1| PREDICTED: polyadenylate-binding protein 2 isoform X2 [Eucalyptus 
grandis]
 gb|KCW54561.1| hypothetical protein EUGRSUZ_I00520 [Eucalyptus grandis]
Length=217

 Score =   146 bits (368),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 87/128 (68%), Positives = 103/128 (80%), Gaps = 4/128 (3%)
 Frame = +1

Query  169  EQEEDVYGGEFPeegdmdadvdmaalaeaeaqedPNAKQDLENMKKRLKEIEEEAGALRE  348
            E+E +VYGGE P EG+++ D+D        +  D +A ++L+ MKKRLKE+EEEA ALRE
Sbjct  3    EEEHEVYGGEIPVEGELEGDMDTHHADVDMSTADDDAVKELDEMKKRLKEMEEEAAALRE  62

Query  349  MQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRV  528
            MQAKVEKEM    DP +A+ASQA KEEVD RS++VGNVDYACTPEEVQQHFQSCGTVNRV
Sbjct  63   MQAKVEKEM----DPASAAASQASKEEVDTRSVFVGNVDYACTPEEVQQHFQSCGTVNRV  118

Query  529  TILTDKFG  552
            TILTDKFG
Sbjct  119  TILTDKFG  126



>ref|XP_010937391.1| PREDICTED: polyadenylate-binding protein 2 isoform X2 [Elaeis 
guineensis]
Length=233

 Score =   145 bits (367),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 73/103 (71%), Positives = 83/103 (81%), Gaps = 14/103 (14%)
 Frame = +1

Query  286  DLENMKKRLKEIEEEAGALREMQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGN--  459
            +L+ MKKRLKE+EEEA ALREMQAKVEKEM  VQDP +A+A+QA +EEVD+RS++VGN  
Sbjct  40   ELDEMKKRLKEMEEEAAALREMQAKVEKEMGAVQDPASAAATQASREEVDSRSVFVGNIT  99

Query  460  ------------VDYACTPEEVQQHFQSCGTVNRVTILTDKFG  552
                        VDYACTPEEVQQHFQSCGTVNRVTILTDKFG
Sbjct  100  MNSCVTLGLIHDVDYACTPEEVQQHFQSCGTVNRVTILTDKFG  142



>gb|AHA84276.1| polyadenylate-binding protein 2 [Phaseolus vulgaris]
Length=211

 Score =   145 bits (365),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 87/128 (68%), Positives = 104/128 (81%), Gaps = 10/128 (8%)
 Frame = +1

Query  169  EQEEDVYGGEFPeegdmdadvdmaalaeaeaqedPNAKQDLENMKKRLKEIEEEAGALRE  348
            E+E +VYGGE P+EG+M+ DVDM+A  +  A       ++L+ MK+RLKE+EEEA ALRE
Sbjct  3    EEEHEVYGGEIPDEGEMEGDVDMSAADDDAAV------KELDEMKRRLKEMEEEAAALRE  56

Query  349  MQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRV  528
            MQAKVEKE+    DP  A+ASQA KEE D+RS++VGNVDYACTPEEVQQHFQSCGTVNRV
Sbjct  57   MQAKVEKEI----DPANAAASQANKEEADSRSVFVGNVDYACTPEEVQQHFQSCGTVNRV  112

Query  529  TILTDKFG  552
            TILTDKFG
Sbjct  113  TILTDKFG  120



>ref|XP_001784768.1| predicted protein [Physcomitrella patens]
 gb|EDQ50428.1| predicted protein [Physcomitrella patens]
Length=219

 Score =   145 bits (365),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 80/134 (60%), Positives = 98/134 (73%), Gaps = 6/134 (4%)
 Frame = +1

Query  169  EQEEDVYGGEFPeegdmdadvdmaalaeaeaqedPN------AKQDLENMKKRLKEIEEE  330
            E+E +VYGG+ P E + D + D+    +    +  +      A ++LE MKKRLKE+EEE
Sbjct  2    EEEHEVYGGDIPVEVEGDIEGDLDGEPDDLLLKGDDTATDEAASKELEEMKKRLKEMEEE  61

Query  331  AGALREMQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSC  510
            A ALR+MQAKVEKEM+ VQD      S A +EE DARS++VGNVDY+CTPEEVQQHFQSC
Sbjct  62   AAALRDMQAKVEKEMSAVQDSVGKDGSPANREEADARSVFVGNVDYSCTPEEVQQHFQSC  121

Query  511  GTVNRVTILTDKFG  552
            GTVNRVTILTDKFG
Sbjct  122  GTVNRVTILTDKFG  135



>gb|KDP40916.1| hypothetical protein JCGZ_24915 [Jatropha curcas]
Length=197

 Score =   144 bits (363),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 69/92 (75%), Positives = 80/92 (87%), Gaps = 1/92 (1%)
 Frame = +1

Query  277  AKQDLENMKKRLKEIEEEAGALREMQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVG  456
            A  +L++MKKRLKE+E+EA ALREMQAKVEKEM   QDP AA  SQA +EEVD+RS++VG
Sbjct  16   AVPELDDMKKRLKEMEDEAAALREMQAKVEKEMGSAQDP-AAGTSQASREEVDSRSVFVG  74

Query  457  NVDYACTPEEVQQHFQSCGTVNRVTILTDKFG  552
            NVDY+C PEEVQQHFQSCGTVNRVTI TDK+G
Sbjct  75   NVDYSCNPEEVQQHFQSCGTVNRVTIRTDKYG  106



>ref|XP_006399527.1| hypothetical protein EUTSA_v10014635mg [Eutrema salsugineum]
 gb|ESQ40980.1| hypothetical protein EUTSA_v10014635mg [Eutrema salsugineum]
Length=202

 Score =   143 bits (361),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 77/128 (60%), Positives = 96/128 (75%), Gaps = 4/128 (3%)
 Frame = +1

Query  169  EQEEDVYGGEFPeegdmdadvdmaalaeaeaqedPNAKQDLENMKKRLKEIEEEAGALRE  348
            ++E +VYGGE P+ G+M+       ++  +     +A ++L+ MK+RLKE+EEEA ALRE
Sbjct  3    DEEHEVYGGEIPDVGEMEVPDPDIDMSAGDD----DAVKELDEMKRRLKEMEEEAAALRE  58

Query  349  MQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRV  528
            MQAKVEK+M   QD  +    QA KEEVDARS+YVGNVDYACTPEEVQ HFQ+CGTVNRV
Sbjct  59   MQAKVEKDMGAAQDSASTETDQAVKEEVDARSVYVGNVDYACTPEEVQLHFQTCGTVNRV  118

Query  529  TILTDKFG  552
            TIL DKFG
Sbjct  119  TILMDKFG  126



>ref|XP_004288178.1| PREDICTED: polyadenylate-binding protein 2-like [Fragaria vesca 
subsp. vesca]
Length=222

 Score =   143 bits (361),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 87/129 (67%), Positives = 102/129 (79%), Gaps = 1/129 (1%)
 Frame = +1

Query  169  EQEEDVYGGEFPeegdmdadvdmaalaeaeaqedPNAK-QDLENMKKRLKEIEEEAGALR  345
            E+E +VYG E P+E +M+ D+D        +  D +A  ++L+ MKKRLKE+EEEA ALR
Sbjct  3    EEEHEVYGAEIPDEAEMEGDLDPNHADVDMSTADDDAAVKELDEMKKRLKEMEEEAAALR  62

Query  346  EMQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNR  525
            EMQAKVEKEM   QDP AA+ SQA KEE DARS++VGNVDYACTPEEVQQHFQSCGTVNR
Sbjct  63   EMQAKVEKEMGAAQDPAAAAVSQAHKEEADARSVFVGNVDYACTPEEVQQHFQSCGTVNR  122

Query  526  VTILTDKFG  552
            VTILTDKFG
Sbjct  123  VTILTDKFG  131



>ref|XP_006399528.1| hypothetical protein EUTSA_v10014635mg [Eutrema salsugineum]
 gb|ESQ40981.1| hypothetical protein EUTSA_v10014635mg [Eutrema salsugineum]
Length=217

 Score =   143 bits (360),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 77/128 (60%), Positives = 96/128 (75%), Gaps = 4/128 (3%)
 Frame = +1

Query  169  EQEEDVYGGEFPeegdmdadvdmaalaeaeaqedPNAKQDLENMKKRLKEIEEEAGALRE  348
            ++E +VYGGE P+ G+M+       ++  +     +A ++L+ MK+RLKE+EEEA ALRE
Sbjct  3    DEEHEVYGGEIPDVGEMEVPDPDIDMSAGDD----DAVKELDEMKRRLKEMEEEAAALRE  58

Query  349  MQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRV  528
            MQAKVEK+M   QD  +    QA KEEVDARS+YVGNVDYACTPEEVQ HFQ+CGTVNRV
Sbjct  59   MQAKVEKDMGAAQDSASTETDQAVKEEVDARSVYVGNVDYACTPEEVQLHFQTCGTVNRV  118

Query  529  TILTDKFG  552
            TIL DKFG
Sbjct  119  TILMDKFG  126



>ref|XP_009393548.1| PREDICTED: polyadenylate-binding protein 2-like [Musa acuminata 
subsp. malaccensis]
Length=227

 Score =   143 bits (361),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 91/128 (71%), Positives = 108/128 (84%), Gaps = 5/128 (4%)
 Frame = +1

Query  169  EQEEDVYGGEFPeegdmdadvdmaalaeaeaqedPNAKQDLENMKKRLKEIEEEAGALRE  348
            E+E +VYGGE P+E DMDADVDMA   E  A+      Q+L+ MK+RLKE+E+EA ALRE
Sbjct  14   EEEHEVYGGEIPDEADMDADVDMALPNENAAKL-----QELDEMKRRLKEMEDEAAALRE  68

Query  349  MQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRV  528
            +QAKVEKEM  VQ+ ++A+A+QA KEEVDARS++VGNVDYACTPEEVQQHFQSCGTVNRV
Sbjct  69   IQAKVEKEMGAVQESSSAAATQASKEEVDARSVFVGNVDYACTPEEVQQHFQSCGTVNRV  128

Query  529  TILTDKFG  552
            TILTDKFG
Sbjct  129  TILTDKFG  136



>ref|XP_001784990.1| predicted protein [Physcomitrella patens]
 gb|EDQ50211.1| predicted protein [Physcomitrella patens]
Length=216

 Score =   142 bits (359),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 80/134 (60%), Positives = 97/134 (72%), Gaps = 6/134 (4%)
 Frame = +1

Query  169  EQEEDVYGGEFPeegdmdadvdmaalaeaeaqedPN------AKQDLENMKKRLKEIEEE  330
            E+E +VYGG+ PEE + D + D+    +    +  +      A ++LE MKKRLKE+EEE
Sbjct  2    EEEHEVYGGDIPEEVEGDIEGDLDGEPDDLVLKGDDTTTDEAASKELEEMKKRLKEMEEE  61

Query  331  AGALREMQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSC  510
            A ALR+MQAKVEKEM  VQD      S   +EE DARS++VGNVDY+CTPEEVQQHFQSC
Sbjct  62   AAALRDMQAKVEKEMGAVQDSVGKDGSATNREEADARSVFVGNVDYSCTPEEVQQHFQSC  121

Query  511  GTVNRVTILTDKFG  552
            GTVNRVTILTDKFG
Sbjct  122  GTVNRVTILTDKFG  135



>ref|XP_006492630.1| PREDICTED: polyadenylate-binding protein 2-like isoform X2 [Citrus 
sinensis]
Length=196

 Score =   142 bits (357),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 66/93 (71%), Positives = 78/93 (84%), Gaps = 0/93 (0%)
 Frame = +1

Query  274  NAKQDLENMKKRLKEIEEEAGALREMQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYV  453
            N + +L++MK RLKE+EEEA ALR+M AKV  EM   QDP A  +SQA +EEVD+RS++V
Sbjct  13   NKQVELDDMKIRLKEMEEEATALRQMHAKVGNEMASKQDPGAGGSSQANREEVDSRSVFV  72

Query  454  GNVDYACTPEEVQQHFQSCGTVNRVTILTDKFG  552
            GNVDY+CTPEEVQQHFQSCGTVNRVTI TDKFG
Sbjct  73   GNVDYSCTPEEVQQHFQSCGTVNRVTIRTDKFG  105



>ref|XP_011092431.1| PREDICTED: polyadenylate-binding protein 2-like isoform X1 [Sesamum 
indicum]
Length=197

 Score =   141 bits (356),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 67/88 (76%), Positives = 81/88 (92%), Gaps = 0/88 (0%)
 Frame = +1

Query  289  LENMKKRLKEIEEEAGALREMQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDY  468
            L++MKKRLKE+E+EA ALREMQAKVE+EM  VQDP AA+A+Q  +EEVD+RS++VGNVDY
Sbjct  18   LDDMKKRLKEMEDEAAALREMQAKVEQEMGAVQDPAAAAANQTNREEVDSRSVFVGNVDY  77

Query  469  ACTPEEVQQHFQSCGTVNRVTILTDKFG  552
            +CTPEEVQQHFQSCGTVNRVTI T+K+G
Sbjct  78   SCTPEEVQQHFQSCGTVNRVTIRTNKYG  105



>ref|XP_006359788.1| PREDICTED: polyadenylate-binding protein 2-like [Solanum tuberosum]
Length=196

 Score =   141 bits (355),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 71/93 (76%), Positives = 84/93 (90%), Gaps = 0/93 (0%)
 Frame = +1

Query  274  NAKQDLENMKKRLKEIEEEAGALREMQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYV  453
            N   +L++MKKRLKE+E+EA ALREMQAKVEKEM  VQDP AA+A+QA KEEVD+RS++V
Sbjct  12   NGAGELDDMKKRLKEMEDEAVALREMQAKVEKEMGSVQDPAAAAANQANKEEVDSRSVFV  71

Query  454  GNVDYACTPEEVQQHFQSCGTVNRVTILTDKFG  552
            GNVDY+CTPEEVQQHFQ+CGTVNRVTI T+KFG
Sbjct  72   GNVDYSCTPEEVQQHFQACGTVNRVTIRTNKFG  104



>ref|XP_004964966.1| PREDICTED: polyadenylate-binding protein 2-like isoform X2 [Setaria 
italica]
Length=202

 Score =   141 bits (355),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 70/93 (75%), Positives = 81/93 (87%), Gaps = 3/93 (3%)
 Frame = +1

Query  274  NAKQDLENMKKRLKEIEEEAGALREMQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYV  453
            +A ++L+ MK+RLKE+EEEA ALREMQAKV KEM GV DPNA ++    KEE+DARS++V
Sbjct  28   DAAKELDEMKRRLKEMEEEAAALREMQAKVAKEMQGV-DPNATTSEN--KEEMDARSVFV  84

Query  454  GNVDYACTPEEVQQHFQSCGTVNRVTILTDKFG  552
            GNVDYACTPEEVQQHF SCGTVNRVTILTDKFG
Sbjct  85   GNVDYACTPEEVQQHFNSCGTVNRVTILTDKFG  117



>ref|NP_001057163.1| Os06g0219600 [Oryza sativa Japonica Group]
 dbj|BAD37238.1| putative poly(A) binding protein II [Oryza sativa Japonica Group]
 dbj|BAF19077.1| Os06g0219600 [Oryza sativa Japonica Group]
 dbj|BAG93873.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87443.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE65343.1| hypothetical protein OsJ_20615 [Oryza sativa Japonica Group]
Length=204

 Score =   141 bits (355),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 70/90 (78%), Positives = 79/90 (88%), Gaps = 3/90 (3%)
 Frame = +1

Query  283  QDLENMKKRLKEIEEEAGALREMQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNV  462
            Q+L+ MK+RLKE+EEEA ALREMQ KV KEM G+ DPNA+S+    KEE+DARS+YVGNV
Sbjct  33   QELDEMKRRLKEMEEEANALREMQTKVAKEMQGL-DPNASSSES--KEEMDARSVYVGNV  89

Query  463  DYACTPEEVQQHFQSCGTVNRVTILTDKFG  552
            DYACTPEEVQQHF SCGTVNRVTILTDKFG
Sbjct  90   DYACTPEEVQQHFNSCGTVNRVTILTDKFG  119



>ref|XP_004964965.1| PREDICTED: polyadenylate-binding protein 2-like isoform X1 [Setaria 
italica]
Length=204

 Score =   141 bits (355),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 70/90 (78%), Positives = 79/90 (88%), Gaps = 3/90 (3%)
 Frame = +1

Query  283  QDLENMKKRLKEIEEEAGALREMQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNV  462
            Q+L+ MK+RLKE+EEEA ALREMQAKV KEM GV DPNA ++    KEE+DARS++VGNV
Sbjct  33   QELDEMKRRLKEMEEEAAALREMQAKVAKEMQGV-DPNATTSEN--KEEMDARSVFVGNV  89

Query  463  DYACTPEEVQQHFQSCGTVNRVTILTDKFG  552
            DYACTPEEVQQHF SCGTVNRVTILTDKFG
Sbjct  90   DYACTPEEVQQHFNSCGTVNRVTILTDKFG  119



>gb|ACF87534.1| unknown [Zea mays]
 gb|ACG33217.1| polyadenylate-binding protein 2 [Zea mays]
Length=203

 Score =   140 bits (353),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 68/90 (76%), Positives = 80/90 (89%), Gaps = 3/90 (3%)
 Frame = +1

Query  283  QDLENMKKRLKEIEEEAGALREMQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNV  462
            Q+L++MK+RLKE+EEEA ALREMQAKV KEM GV DPNA ++    KEE+D+RS+++GNV
Sbjct  32   QELDDMKRRLKEMEEEAAALREMQAKVAKEMQGV-DPNATTSEN--KEEMDSRSVFIGNV  88

Query  463  DYACTPEEVQQHFQSCGTVNRVTILTDKFG  552
            DYACTPEEVQQHF SCGTVNRVTILTDKFG
Sbjct  89   DYACTPEEVQQHFNSCGTVNRVTILTDKFG  118



>ref|XP_006655919.1| PREDICTED: polyadenylate-binding protein 2-like [Oryza brachyantha]
Length=204

 Score =   140 bits (353),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 70/90 (78%), Positives = 78/90 (87%), Gaps = 3/90 (3%)
 Frame = +1

Query  283  QDLENMKKRLKEIEEEAGALREMQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNV  462
            Q+L+ MK+RLKE+EEEA ALREMQAKV KEM G+ DPNA  +    KEE+DARS+YVGNV
Sbjct  33   QELDEMKRRLKEMEEEANALREMQAKVAKEMQGL-DPNATPSES--KEEMDARSVYVGNV  89

Query  463  DYACTPEEVQQHFQSCGTVNRVTILTDKFG  552
            DYACTPEEVQQHF SCGTVNRVTILTDKFG
Sbjct  90   DYACTPEEVQQHFNSCGTVNRVTILTDKFG  119



>ref|XP_002436725.1| hypothetical protein SORBIDRAFT_10g007620 [Sorghum bicolor]
 gb|EER88092.1| hypothetical protein SORBIDRAFT_10g007620 [Sorghum bicolor]
Length=203

 Score =   140 bits (352),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 69/90 (77%), Positives = 79/90 (88%), Gaps = 3/90 (3%)
 Frame = +1

Query  283  QDLENMKKRLKEIEEEAGALREMQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNV  462
            Q+L+ MK+RLKE+EEEA ALREMQAKV KEM GV DPNA ++    KEE+D+RS++VGNV
Sbjct  32   QELDEMKRRLKEMEEEAAALREMQAKVAKEMQGV-DPNATTSEN--KEEMDSRSVFVGNV  88

Query  463  DYACTPEEVQQHFQSCGTVNRVTILTDKFG  552
            DYACTPEEVQQHF SCGTVNRVTILTDKFG
Sbjct  89   DYACTPEEVQQHFNSCGTVNRVTILTDKFG  118



>dbj|BAD17091.1| putative poly(A) binding protein [Oryza sativa Japonica Group]
 gb|EAY87595.1| hypothetical protein OsI_09006 [Oryza sativa Indica Group]
 dbj|BAG92338.1| unnamed protein product [Oryza sativa Japonica Group]
Length=216

 Score =   140 bits (353),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 70/91 (77%), Positives = 78/91 (86%), Gaps = 1/91 (1%)
 Frame = +1

Query  283  QDLENMKKRLKEIEEEAGALREMQAKVEKEMTGVQDPNAASASQAE-KEEVDARSIYVGN  459
            Q+L+ MK+RLKE+EEEA ALR+MQAKV KEM G       SAS AE KE+VDARS+YVGN
Sbjct  37   QELDQMKRRLKEMEEEAAALRDMQAKVAKEMQGGPPGGDPSASTAEAKEQVDARSVYVGN  96

Query  460  VDYACTPEEVQQHFQSCGTVNRVTILTDKFG  552
            VDYACTPEEVQQHFQ+CGTVNRVTILTDKFG
Sbjct  97   VDYACTPEEVQQHFQACGTVNRVTILTDKFG  127



>ref|XP_011092432.1| PREDICTED: polyadenylate-binding protein 2-like isoform X2 [Sesamum 
indicum]
Length=177

 Score =   139 bits (349),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 66/85 (78%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = +1

Query  298  MKKRLKEIEEEAGALREMQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACT  477
            MKKRLKE+E+EA ALREMQAKVE+EM  VQDP AA+A+Q  +EEVD+RS++VGNVDY+CT
Sbjct  1    MKKRLKEMEDEAAALREMQAKVEQEMGAVQDPAAAAANQTNREEVDSRSVFVGNVDYSCT  60

Query  478  PEEVQQHFQSCGTVNRVTILTDKFG  552
            PEEVQQHFQSCGTVNRVTI T+K+G
Sbjct  61   PEEVQQHFQSCGTVNRVTIRTNKYG  85



>ref|XP_002975089.1| hypothetical protein SELMODRAFT_102545 [Selaginella moellendorffii]
 gb|EFJ23874.1| hypothetical protein SELMODRAFT_102545 [Selaginella moellendorffii]
Length=224

 Score =   140 bits (352),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 83/128 (65%), Positives = 95/128 (74%), Gaps = 5/128 (4%)
 Frame = +1

Query  169  EQEEDVYGGEFPeegdmdadvdmaalaeaeaqedPNAKQDLENMKKRLKEIEEEAGALRE  348
            E E +VYGGE PEE + D + D    A  +         +LE MKKRLKE+E+EA ALR+
Sbjct  8    EDEHEVYGGEIPEEVEGDLEGDQGDDAGGDDP----TSTELEEMKKRLKEMEDEAAALRD  63

Query  349  MQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRV  528
            MQAKVEKEM   QDP AA+   + KEE DARS+YVGNVDY+CTPEEVQQHFQSCGTVNRV
Sbjct  64   MQAKVEKEMGAGQDPAAAAQQAS-KEEADARSVYVGNVDYSCTPEEVQQHFQSCGTVNRV  122

Query  529  TILTDKFG  552
            TILTDKFG
Sbjct  123  TILTDKFG  130



>ref|XP_001766601.1| predicted protein [Physcomitrella patens]
 gb|EDQ68666.1| predicted protein [Physcomitrella patens]
Length=238

 Score =   140 bits (353),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 81/134 (60%), Positives = 98/134 (73%), Gaps = 8/134 (6%)
 Frame = +1

Query  169  EQEEDVYGGEFPeegdmdadvdmaalaeaeaqedPN------AKQDLENMKKRLKEIEEE  330
            E+E +VYGG+ P+E + + +VD     E    +  +      A ++LE MKKRLKE+EEE
Sbjct  2    EEEHEVYGGDIPDEVEGELEVDSDGDGEDLLLKGEDVGTDEVASKELEEMKKRLKEMEEE  61

Query  331  AGALREMQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSC  510
            A ALR+MQAKVEKEM G Q     +  QA +EE DARS++VGNVDYACTPEEVQQHFQSC
Sbjct  62   AAALRDMQAKVEKEMGGSQ--ALTNGDQANREEADARSVFVGNVDYACTPEEVQQHFQSC  119

Query  511  GTVNRVTILTDKFG  552
            GTVNRVTILTDKFG
Sbjct  120  GTVNRVTILTDKFG  133



>ref|NP_001048174.1| Os02g0757900 [Oryza sativa Japonica Group]
 dbj|BAD17090.1| putative poly(A) binding protein [Oryza sativa Japonica Group]
 dbj|BAF10088.1| Os02g0757900 [Oryza sativa Japonica Group]
 dbj|BAG87827.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE57840.1| hypothetical protein OsJ_08453 [Oryza sativa Japonica Group]
Length=212

 Score =   139 bits (351),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 69/90 (77%), Positives = 80/90 (89%), Gaps = 3/90 (3%)
 Frame = +1

Query  283  QDLENMKKRLKEIEEEAGALREMQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNV  462
            Q+L+ MK+RLKE+EEEA ALR+MQAKV KEM G  DP+A++A    KE+VDARS+YVGNV
Sbjct  37   QELDQMKRRLKEMEEEAAALRDMQAKVAKEMQG-GDPSASTAEA--KEQVDARSVYVGNV  93

Query  463  DYACTPEEVQQHFQSCGTVNRVTILTDKFG  552
            DYACTPEEVQQHFQ+CGTVNRVTILTDKFG
Sbjct  94   DYACTPEEVQQHFQACGTVNRVTILTDKFG  123



>ref|XP_004248796.1| PREDICTED: polyadenylate-binding protein 2-like [Solanum lycopersicum]
Length=196

 Score =   139 bits (349),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 70/93 (75%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = +1

Query  274  NAKQDLENMKKRLKEIEEEAGALREMQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYV  453
            N   +L++MKKRLKE+E+EA ALREMQAKVEKEM  VQDP AA+A+QA KEEVD+RS++V
Sbjct  12   NGAGELDDMKKRLKEMEDEAVALREMQAKVEKEMGSVQDPAAAAANQANKEEVDSRSVFV  71

Query  454  GNVDYACTPEEVQQHFQSCGTVNRVTILTDKFG  552
            GNVDY+CTPEEVQQHFQ+CG VNRVTI T+KFG
Sbjct  72   GNVDYSCTPEEVQQHFQACGMVNRVTIRTNKFG  104



>ref|XP_009385628.1| PREDICTED: polyadenylate-binding protein 2-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=222

 Score =   139 bits (351),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 76/129 (59%), Positives = 97/129 (75%), Gaps = 1/129 (1%)
 Frame = +1

Query  169  EQEEDVYGGEFPeegdmdadvdmaalaeaeaqedPN-AKQDLENMKKRLKEIEEEAGALR  345
            E+E ++YGGE P+E D  ADV+ +  A       P+ + ++L  MKKRLK ++EEA ALR
Sbjct  3    EEEHEIYGGEIPDEVDSVADVETSNTAAVLLPCPPSRSHKELGEMKKRLKAMDEEAAALR  62

Query  346  EMQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNR  525
            E+QAKVEKEM+ +QDP + SAS+  K EVD+RS++VGNVDYACT E V+ HFQS GTVNR
Sbjct  63   EIQAKVEKEMSAIQDPASTSASETSKAEVDSRSVFVGNVDYACTSEVVRMHFQSSGTVNR  122

Query  526  VTILTDKFG  552
            VTILTD FG
Sbjct  123  VTILTDTFG  131



>ref|XP_004953974.1| PREDICTED: polyadenylate-binding protein 2-A-like [Setaria italica]
Length=212

 Score =   139 bits (351),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 69/90 (77%), Positives = 80/90 (89%), Gaps = 3/90 (3%)
 Frame = +1

Query  283  QDLENMKKRLKEIEEEAGALREMQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNV  462
            Q+L+ MK+RLKE+EEEA ALR+MQAKV KEM G  DP+A++A    KE+VDARS+YVGNV
Sbjct  37   QELDEMKRRLKEMEEEAAALRDMQAKVAKEMQG-GDPSASTAEA--KEQVDARSVYVGNV  93

Query  463  DYACTPEEVQQHFQSCGTVNRVTILTDKFG  552
            DYACTPEEVQQHFQ+CGTVNRVTILTDKFG
Sbjct  94   DYACTPEEVQQHFQACGTVNRVTILTDKFG  123



>ref|XP_009760239.1| PREDICTED: polyadenylate-binding protein 2-like [Nicotiana sylvestris]
Length=197

 Score =   139 bits (349),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 67/92 (73%), Positives = 81/92 (88%), Gaps = 0/92 (0%)
 Frame = +1

Query  277  AKQDLENMKKRLKEIEEEAGALREMQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVG  456
            A  +++ MKKRLKE+E+E+ AL EMQAKVEKEM  VQDP AA+A+QA +EEVD RS++VG
Sbjct  14   AAVEMDEMKKRLKEMEDESAALLEMQAKVEKEMGSVQDPAAAAATQANREEVDGRSVFVG  73

Query  457  NVDYACTPEEVQQHFQSCGTVNRVTILTDKFG  552
            NVDY+CTPEEVQQHFQ+CGTVNRVTI T+KFG
Sbjct  74   NVDYSCTPEEVQQHFQACGTVNRVTIRTNKFG  105



>ref|XP_006288515.1| hypothetical protein CARUB_v10001786mg, partial [Capsella rubella]
 gb|EOA21413.1| hypothetical protein CARUB_v10001786mg, partial [Capsella rubella]
Length=238

 Score =   140 bits (352),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 67/94 (71%), Positives = 80/94 (85%), Gaps = 1/94 (1%)
 Frame = +1

Query  274  NAKQDLENMKKRLKEIEEEAGALREMQAKVEKEMTGVQDPNAASASQAE-KEEVDARSIY  450
            +A ++LE MK+RLKE+E+EA ALREMQAKVE +M   QDP ++ A+  E KEEVDARS+Y
Sbjct  69   DAVRELEEMKRRLKEMEDEAAALREMQAKVESDMAATQDPASSMATNQEGKEEVDARSVY  128

Query  451  VGNVDYACTPEEVQQHFQSCGTVNRVTILTDKFG  552
            VGNVDY+CTPEEVQ HFQ+CGTVNRVTIL DKFG
Sbjct  129  VGNVDYSCTPEEVQLHFQTCGTVNRVTILMDKFG  162



>ref|NP_001132591.1| uncharacterized protein LOC100194063 [Zea mays]
 gb|ACF81506.1| unknown [Zea mays]
 gb|ACG37014.1| polyadenylate-binding protein 2 [Zea mays]
 gb|AFW73517.1| polyadenylate-binding protein 2 [Zea mays]
Length=212

 Score =   139 bits (350),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 69/90 (77%), Positives = 80/90 (89%), Gaps = 3/90 (3%)
 Frame = +1

Query  283  QDLENMKKRLKEIEEEAGALREMQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNV  462
            Q+L+ MK+RLKE+EEEA ALR+MQAKV KEM G  DP+A++A    KE+VDARS+YVGNV
Sbjct  37   QELDEMKRRLKEMEEEAAALRDMQAKVAKEMQG-GDPSASTAEA--KEQVDARSVYVGNV  93

Query  463  DYACTPEEVQQHFQSCGTVNRVTILTDKFG  552
            DYACTPEEVQQHFQ+CGTVNRVTILTDKFG
Sbjct  94   DYACTPEEVQQHFQACGTVNRVTILTDKFG  123



>ref|XP_006647930.1| PREDICTED: polyadenylate-binding protein 2-A-like [Oryza brachyantha]
Length=212

 Score =   139 bits (350),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 69/90 (77%), Positives = 80/90 (89%), Gaps = 3/90 (3%)
 Frame = +1

Query  283  QDLENMKKRLKEIEEEAGALREMQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNV  462
            Q+L+ MK+RLKE+EEEA ALR+MQAKV KEM G  DP+A++A    KE+VDARS+YVGNV
Sbjct  37   QELDEMKRRLKEMEEEAAALRDMQAKVAKEMQG-GDPSASTAEA--KEQVDARSVYVGNV  93

Query  463  DYACTPEEVQQHFQSCGTVNRVTILTDKFG  552
            DYACTPEEVQQHFQ+CGTVNRVTILTDKFG
Sbjct  94   DYACTPEEVQQHFQACGTVNRVTILTDKFG  123



>ref|XP_006288516.1| hypothetical protein CARUB_v10001786mg, partial [Capsella rubella]
 gb|EOA21414.1| hypothetical protein CARUB_v10001786mg, partial [Capsella rubella]
Length=253

 Score =   140 bits (353),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 67/94 (71%), Positives = 80/94 (85%), Gaps = 1/94 (1%)
 Frame = +1

Query  274  NAKQDLENMKKRLKEIEEEAGALREMQAKVEKEMTGVQDPNAASASQAE-KEEVDARSIY  450
            +A ++LE MK+RLKE+E+EA ALREMQAKVE +M   QDP ++ A+  E KEEVDARS+Y
Sbjct  69   DAVRELEEMKRRLKEMEDEAAALREMQAKVESDMAATQDPASSMATNQEGKEEVDARSVY  128

Query  451  VGNVDYACTPEEVQQHFQSCGTVNRVTILTDKFG  552
            VGNVDY+CTPEEVQ HFQ+CGTVNRVTIL DKFG
Sbjct  129  VGNVDYSCTPEEVQLHFQTCGTVNRVTILMDKFG  162



>ref|XP_004964967.1| PREDICTED: polyadenylate-binding protein 2-like isoform X3 [Setaria 
italica]
Length=202

 Score =   138 bits (348),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 69/90 (77%), Positives = 78/90 (87%), Gaps = 5/90 (6%)
 Frame = +1

Query  283  QDLENMKKRLKEIEEEAGALREMQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNV  462
            Q+L+ MK+RLKE+EEEA ALREMQAKV KEM   QDPNA ++    KEE+DARS++VGNV
Sbjct  33   QELDEMKRRLKEMEEEAAALREMQAKVAKEM---QDPNATTSEN--KEEMDARSVFVGNV  87

Query  463  DYACTPEEVQQHFQSCGTVNRVTILTDKFG  552
            DYACTPEEVQQHF SCGTVNRVTILTDKFG
Sbjct  88   DYACTPEEVQQHFNSCGTVNRVTILTDKFG  117



>gb|KDO50216.1| hypothetical protein CISIN_1g029268mg [Citrus sinensis]
Length=196

 Score =   138 bits (348),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 65/93 (70%), Positives = 77/93 (83%), Gaps = 0/93 (0%)
 Frame = +1

Query  274  NAKQDLENMKKRLKEIEEEAGALREMQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYV  453
            N + +L++MK RLKE+EEEA ALR+M AKV  EM   QDP A  +S A +EEVD+RS++V
Sbjct  13   NKQVELDDMKIRLKEMEEEATALRQMHAKVGNEMASKQDPAAGGSSLANREEVDSRSVFV  72

Query  454  GNVDYACTPEEVQQHFQSCGTVNRVTILTDKFG  552
            GNVDY+CTPEEVQQHFQSCGTVNRVTI TDKFG
Sbjct  73   GNVDYSCTPEEVQQHFQSCGTVNRVTIRTDKFG  105



>ref|XP_009385630.1| PREDICTED: polyadenylate-binding protein 2-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=210

 Score =   138 bits (347),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 75/128 (59%), Positives = 93/128 (73%), Gaps = 11/128 (9%)
 Frame = +1

Query  169  EQEEDVYGGEFPeegdmdadvdmaalaeaeaqedPNAKQDLENMKKRLKEIEEEAGALRE  348
            E+E ++YGGE P+E D  ADV+ +           N   +L  MKKRLK ++EEA ALRE
Sbjct  3    EEEHEIYGGEIPDEVDSVADVETS-----------NTAAELGEMKKRLKAMDEEAAALRE  51

Query  349  MQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRV  528
            +QAKVEKEM+ +QDP + SAS+  K EVD+RS++VGNVDYACT E V+ HFQS GTVNRV
Sbjct  52   IQAKVEKEMSAIQDPASTSASETSKAEVDSRSVFVGNVDYACTSEVVRMHFQSSGTVNRV  111

Query  529  TILTDKFG  552
            TILTD FG
Sbjct  112  TILTDTFG  119



>gb|EMT14995.1| Polyadenylate-binding protein 2 [Aegilops tauschii]
Length=177

 Score =   137 bits (344),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 68/89 (76%), Positives = 78/89 (88%), Gaps = 3/89 (3%)
 Frame = +1

Query  286  DLENMKKRLKEIEEEAGALREMQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNVD  465
            +L+ MK+RLKE+EEEA ALR+MQAKV KEM G  D NA++A    KE+VDARS+YVGNVD
Sbjct  3    ELDEMKRRLKEMEEEAAALRDMQAKVAKEMQG-GDANASTAE--AKEQVDARSVYVGNVD  59

Query  466  YACTPEEVQQHFQSCGTVNRVTILTDKFG  552
            YACTPEEVQQHFQ+CGTVNRVTILTDKFG
Sbjct  60   YACTPEEVQQHFQACGTVNRVTILTDKFG  88



>ref|XP_003570602.1| PREDICTED: polyadenylate-binding protein 2-like [Brachypodium 
distachyon]
Length=210

 Score =   137 bits (346),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 69/93 (74%), Positives = 81/93 (87%), Gaps = 3/93 (3%)
 Frame = +1

Query  274  NAKQDLENMKKRLKEIEEEAGALREMQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYV  453
            +A ++L+ MK+RLKE+EEEA ALR+MQAKV KEM G  D NA++A    KE+VDARS+YV
Sbjct  32   DAAKELDEMKRRLKEMEEEAAALRDMQAKVAKEMQG-GDANASTAEA--KEQVDARSVYV  88

Query  454  GNVDYACTPEEVQQHFQSCGTVNRVTILTDKFG  552
            GNVDYACTPEEVQQHFQ+CGTVNRVTILTDKFG
Sbjct  89   GNVDYACTPEEVQQHFQACGTVNRVTILTDKFG  121



>ref|XP_002988978.1| hypothetical protein SELMODRAFT_159820 [Selaginella moellendorffii]
 gb|EFJ10007.1| hypothetical protein SELMODRAFT_159820 [Selaginella moellendorffii]
Length=178

 Score =   136 bits (343),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 68/85 (80%), Positives = 75/85 (88%), Gaps = 1/85 (1%)
 Frame = +1

Query  298  MKKRLKEIEEEAGALREMQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACT  477
            MKKRLKE+E+EA ALR+MQAKVEKEM   QDP AA+   + KEE DARS+YVGNVDY+CT
Sbjct  1    MKKRLKEMEDEAAALRDMQAKVEKEMGAGQDPAAAAQQAS-KEEADARSVYVGNVDYSCT  59

Query  478  PEEVQQHFQSCGTVNRVTILTDKFG  552
            PEEVQQHFQSCGTVNRVTILTDKFG
Sbjct  60   PEEVQQHFQSCGTVNRVTILTDKFG  84



>ref|XP_009385631.1| PREDICTED: polyadenylate-binding protein 2-like isoform X3 [Musa 
acuminata subsp. malaccensis]
Length=216

 Score =   137 bits (346),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 76/128 (59%), Positives = 94/128 (73%), Gaps = 5/128 (4%)
 Frame = +1

Query  169  EQEEDVYGGEFPeegdmdadvdmaalaeaeaqedPNAKQDLENMKKRLKEIEEEAGALRE  348
            E+E ++YGGE P+E D  ADV+ +  A           Q+L  MKKRLK ++EEA ALRE
Sbjct  3    EEEHEIYGGEIPDEVDSVADVETSNTAAYRIPL-----QELGEMKKRLKAMDEEAAALRE  57

Query  349  MQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRV  528
            +QAKVEKEM+ +QDP + SAS+  K EVD+RS++VGNVDYACT E V+ HFQS GTVNRV
Sbjct  58   IQAKVEKEMSAIQDPASTSASETSKAEVDSRSVFVGNVDYACTSEVVRMHFQSSGTVNRV  117

Query  529  TILTDKFG  552
            TILTD FG
Sbjct  118  TILTDTFG  125



>ref|XP_008658656.1| PREDICTED: polyadenylate-binding protein 2 isoform X1 [Zea mays]
Length=227

 Score =   137 bits (346),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 67/90 (74%), Positives = 78/90 (87%), Gaps = 5/90 (6%)
 Frame = +1

Query  283  QDLENMKKRLKEIEEEAGALREMQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNV  462
            Q+L+ MK+RLKE+EEEA ALREMQAKV K+M   QDPNA ++    KEE+D+RS++VGNV
Sbjct  60   QELDEMKRRLKEMEEEAAALREMQAKVAKDM---QDPNATTSEN--KEEMDSRSVFVGNV  114

Query  463  DYACTPEEVQQHFQSCGTVNRVTILTDKFG  552
            DYACTPEEVQQHF SCGTVNRVTILTDKFG
Sbjct  115  DYACTPEEVQQHFNSCGTVNRVTILTDKFG  144



>gb|ACR34224.1| unknown [Zea mays]
 gb|AFW85286.1| polyadenylate-binding protein 2 [Zea mays]
Length=199

 Score =   136 bits (343),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 67/90 (74%), Positives = 78/90 (87%), Gaps = 5/90 (6%)
 Frame = +1

Query  283  QDLENMKKRLKEIEEEAGALREMQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNV  462
            Q+L+ MK+RLKE+EEEA ALREMQAKV K+M   QDPNA ++    KEE+D+RS++VGNV
Sbjct  32   QELDEMKRRLKEMEEEAAALREMQAKVAKDM---QDPNATTSEN--KEEMDSRSVFVGNV  86

Query  463  DYACTPEEVQQHFQSCGTVNRVTILTDKFG  552
            DYACTPEEVQQHF SCGTVNRVTILTDKFG
Sbjct  87   DYACTPEEVQQHFNSCGTVNRVTILTDKFG  116



>ref|NP_001149957.1| polyadenylate-binding protein 2 [Zea mays]
 gb|ACG37339.1| polyadenylate-binding protein 2 [Zea mays]
Length=199

 Score =   136 bits (343),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 67/90 (74%), Positives = 78/90 (87%), Gaps = 5/90 (6%)
 Frame = +1

Query  283  QDLENMKKRLKEIEEEAGALREMQAKVEKEMTGVQDPNAASASQAEKEEVDARSIYVGNV  462
            Q+L+ MK+RLKE+EEEA ALREMQAKV K+M   QDPNA ++    KEE+D+RS++VGNV
Sbjct  32   QELDEMKRRLKEMEEEAAALREMQAKVAKDM---QDPNATTSEN--KEEMDSRSVFVGNV  86

Query  463  DYACTPEEVQQHFQSCGTVNRVTILTDKFG  552
            DYACTPEEVQQHF SCGTVNRVTILTDKFG
Sbjct  87   DYACTPEEVQQHFNSCGTVNRVTILTDKFG  116



>ref|XP_010491699.1| PREDICTED: polyadenylate-binding protein 2-like isoform X1 [Camelina 
sativa]
Length=219

 Score =   136 bits (343),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 79/130 (61%), Positives = 97/130 (75%), Gaps = 6/130 (5%)
 Frame = +1

Query  169  EQEEDVYGGEFPeegdmdadvdmaalaeaeaqedPNAKQDLENMKKRLKEIEEEAGALRE  348
            E+E  VYGGE PE G++D       ++ A+     +A ++L+ MK+RLKE+E+EA ALRE
Sbjct  3    EEEHQVYGGEIPEVGEVDVPDPDFDISAADD----DAVRELDEMKRRLKEMEDEAAALRE  58

Query  349  MQAKVEKEMTGV-QDPNAASASQAE-KEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVN  522
            MQAKVE EM    QDP +  A+  E KEEVDARS+YVGNVDYACTP+EVQ HFQ+CGTVN
Sbjct  59   MQAKVETEMGATTQDPTSGMATNQEGKEEVDARSVYVGNVDYACTPDEVQLHFQTCGTVN  118

Query  523  RVTILTDKFG  552
            RVTIL DKFG
Sbjct  119  RVTILMDKFG  128



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 603802497760