BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001N18

Length=515
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009789499.1|  PREDICTED: zinc finger CCCH domain-containin...    157   3e-42   Nicotiana sylvestris
ref|XP_009595391.1|  PREDICTED: zinc finger CCCH domain-containin...    155   7e-42   Nicotiana tomentosiformis
ref|XP_004243370.1|  PREDICTED: zinc finger CCCH domain-containin...    146   2e-38   Solanum lycopersicum
ref|XP_011100356.1|  PREDICTED: zinc finger CCCH domain-containin...    143   3e-37   Sesamum indicum [beniseed]
ref|XP_007149822.1|  hypothetical protein PHAVU_005G101500g             139   7e-36   Phaseolus vulgaris [French bean]
ref|XP_007198967.1|  hypothetical protein PRUPE_ppa015121mg             138   3e-35   
ref|XP_003540372.2|  PREDICTED: zinc finger CCCH domain-containin...    137   9e-35   
gb|AJB84605.1|  C3H zinc finger protein                                 135   1e-34   Glycine max [soybeans]
ref|XP_002274948.1|  PREDICTED: zinc finger CCCH domain-containin...    134   2e-34   Vitis vinifera
gb|KEH39169.1|  zinc finger CCCH domain protein                         134   5e-34   Medicago truncatula
emb|CDP14823.1|  unnamed protein product                                134   1e-33   Coffea canephora [robusta coffee]
ref|XP_007132795.1|  hypothetical protein PHAVU_011G125300g             131   4e-33   Phaseolus vulgaris [French bean]
gb|EPS67507.1|  hypothetical protein M569_07268                         130   5e-33   Genlisea aurea
ref|XP_004487266.1|  PREDICTED: zinc finger CCCH domain-containin...    131   6e-33   Cicer arietinum [garbanzo]
ref|XP_004301223.1|  PREDICTED: zinc finger CCCH domain-containin...    130   1e-32   Fragaria vesca subsp. vesca
ref|XP_008362440.1|  PREDICTED: zinc finger CCCH domain-containin...    130   3e-32   
ref|XP_008342887.1|  PREDICTED: zinc finger CCCH domain-containin...    129   3e-32   
gb|KDP24097.1|  hypothetical protein JCGZ_25754                         126   3e-31   Jatropha curcas
ref|XP_008381588.1|  PREDICTED: zinc finger CCCH domain-containin...    126   6e-31   
ref|XP_002517875.1|  conserved hypothetical protein                     121   3e-30   
ref|XP_003539940.1|  PREDICTED: zinc finger CCCH domain-containin...    121   1e-29   Glycine max [soybeans]
gb|ADL36652.1|  C3HL domain class transcription factor                  122   2e-29   Malus domestica [apple tree]
ref|XP_011029046.1|  PREDICTED: zinc finger CCCH domain-containin...    120   6e-29   Populus euphratica
ref|XP_011047672.1|  PREDICTED: zinc finger CCCH domain-containin...    118   3e-28   Populus euphratica
ref|XP_003526267.1|  PREDICTED: zinc finger CCCH domain-containin...    117   4e-28   Glycine max [soybeans]
ref|XP_002309749.2|  zinc finger family protein                         117   8e-28   
ref|XP_006372730.1|  zinc finger family protein                         115   4e-27   Populus trichocarpa [western balsam poplar]
gb|EYU42142.1|  hypothetical protein MIMGU_mgv1a008328mg                114   8e-27   Erythranthe guttata [common monkey flower]
ref|XP_010689060.1|  PREDICTED: zinc finger CCCH domain-containin...    112   4e-26   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB12469.1|  hypothetical protein B456_002G020100                    110   1e-25   Gossypium raimondii
gb|AAX20386.1|  putative CCCH-type zinc finger transcription factor     110   1e-25   Gossypium hirsutum [American cotton]
ref|XP_009397189.1|  PREDICTED: zinc finger CCCH domain-containin...    109   2e-25   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010070036.1|  PREDICTED: zinc finger CCCH domain-containin...    108   6e-25   Eucalyptus grandis [rose gum]
gb|KJB84449.1|  hypothetical protein B456_N026500                       105   3e-24   Gossypium raimondii
ref|XP_010260283.1|  PREDICTED: zinc finger CCCH domain-containin...    106   5e-24   Nelumbo nucifera [Indian lotus]
ref|XP_010943958.1|  PREDICTED: zinc finger CCCH domain-containin...    103   5e-23   Elaeis guineensis
emb|CDY36994.1|  BnaC09g18100D                                          100   6e-23   Brassica napus [oilseed rape]
ref|XP_009403103.1|  PREDICTED: zinc finger CCCH domain-containin...    102   9e-23   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006418203.1|  hypothetical protein EUTSA_v10007884mg             102   1e-22   Eutrema salsugineum [saltwater cress]
emb|CDY13114.1|  BnaA09g17030D                                          102   1e-22   Brassica napus [oilseed rape]
ref|XP_004136841.1|  PREDICTED: zinc finger CCCH domain-containin...    102   2e-22   Cucumis sativus [cucumbers]
ref|XP_008455280.1|  PREDICTED: zinc finger CCCH domain-containin...    101   2e-22   Cucumis melo [Oriental melon]
ref|XP_006447247.1|  hypothetical protein CICLE_v10015314mg             101   3e-22   Citrus clementina [clementine]
ref|XP_010526073.1|  PREDICTED: zinc finger CCCH domain-containin...    100   4e-22   Tarenaya hassleriana [spider flower]
emb|CDX89867.1|  BnaA10g02150D                                          100   4e-22   
gb|KDO42121.1|  hypothetical protein CISIN_1g036437mg                   101   4e-22   Citrus sinensis [apfelsine]
ref|XP_009119364.1|  PREDICTED: zinc finger CCCH domain-containin...    100   4e-22   Brassica rapa
ref|XP_009113932.1|  PREDICTED: zinc finger CCCH domain-containin...    100   5e-22   Brassica rapa
ref|XP_010097108.1|  Zinc finger CCCH domain-containing protein 49      100   5e-22   Morus notabilis
ref|XP_010417368.1|  PREDICTED: zinc finger CCCH domain-containin...  99.8    7e-22   Camelina sativa [gold-of-pleasure]
emb|CDX82728.1|  BnaC07g01380D                                        99.8    1e-21   
ref|XP_010556843.1|  PREDICTED: zinc finger CCCH domain-containin...  99.8    1e-21   Tarenaya hassleriana [spider flower]
ref|XP_009102134.1|  PREDICTED: zinc finger CCCH domain-containin...  99.8    1e-21   Brassica rapa
ref|XP_010429604.1|  PREDICTED: zinc finger CCCH domain-containin...  99.4    1e-21   Camelina sativa [gold-of-pleasure]
ref|XP_011459526.1|  PREDICTED: zinc finger CCCH domain-containin...  99.8    1e-21   Fragaria vesca subsp. vesca
gb|AGL40443.1|  C3H-type zinc finger protein                          99.4    1e-21   Glycine max [soybeans]
ref|XP_003607493.1|  Zinc finger CCCH domain-containing protein       99.0    1e-21   Medicago truncatula
ref|XP_003525299.1|  PREDICTED: zinc finger CCCH domain-containin...  99.4    1e-21   
ref|XP_004960911.1|  PREDICTED: zinc finger CCCH domain-containin...  99.4    1e-21   Setaria italica
emb|CDY35891.1|  BnaA07g00960D                                        99.0    2e-21   Brassica napus [oilseed rape]
ref|NP_001042276.1|  Os01g0192000                                     99.4    2e-21   
gb|EAY72862.1|  hypothetical protein OsI_00733                        99.4    2e-21   Oryza sativa Indica Group [Indian rice]
ref|XP_006403122.1|  hypothetical protein EUTSA_v10003231mg           99.0    2e-21   Eutrema salsugineum [saltwater cress]
ref|XP_009101727.1|  PREDICTED: zinc finger CCCH domain-containin...  99.0    2e-21   Brassica rapa
emb|CDX94766.1|  BnaC07g17750D                                        99.0    2e-21   
gb|KFK42723.1|  zinc finger ccch domain-containing protein 2-like     99.0    2e-21   Arabis alpina [alpine rockcress]
ref|XP_010086901.1|  Zinc finger CCCH domain-containing protein 49    99.0    2e-21   Morus notabilis
ref|XP_008452695.1|  PREDICTED: zinc finger CCCH domain-containin...  99.0    2e-21   Cucumis melo [Oriental melon]
ref|XP_007204367.1|  hypothetical protein PRUPE_ppa007297mg           99.0    2e-21   
ref|XP_004141305.1|  PREDICTED: zinc finger CCCH domain-containin...  98.6    2e-21   Cucumis sativus [cucumbers]
emb|CDY22300.1|  BnaA06g36220D                                        99.0    2e-21   Brassica napus [oilseed rape]
ref|XP_008337620.1|  PREDICTED: zinc finger CCCH domain-containin...  99.0    3e-21   
gb|KDP33764.1|  hypothetical protein JCGZ_07335                       98.6    3e-21   Jatropha curcas
ref|NP_171875.1|  CCCH-type zinc finger protein SOMNUS                98.6    3e-21   Arabidopsis thaliana [mouse-ear cress]
dbj|BAC41895.1|  unknown protein                                      98.6    3e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008242454.1|  PREDICTED: zinc finger CCCH domain-containin...  98.6    3e-21   Prunus mume [ume]
ref|XP_009352588.1|  PREDICTED: zinc finger CCCH domain-containin...  98.6    3e-21   
ref|XP_010475007.1|  PREDICTED: zinc finger CCCH domain-containin...  98.2    3e-21   
ref|XP_010482518.1|  PREDICTED: zinc finger CCCH domain-containin...  98.6    3e-21   Camelina sativa [gold-of-pleasure]
ref|XP_002455022.1|  hypothetical protein SORBIDRAFT_03g003110        98.2    3e-21   
ref|XP_004505556.1|  PREDICTED: zinc finger CCCH domain-containin...  98.2    3e-21   Cicer arietinum [garbanzo]
ref|XP_002889476.1|  zinc finger (CCCH-type) family protein           98.6    3e-21   
ref|XP_010457395.1|  PREDICTED: zinc finger CCCH domain-containin...  98.6    3e-21   Camelina sativa [gold-of-pleasure]
gb|AGT16143.1|  nucleic acid binding protein                          98.6    3e-21   Saccharum hybrid cultivar R570
ref|XP_007012951.1|  Zinc finger C-x8-C-x5-C-x3-H type family pro...  98.6    3e-21   
ref|XP_010475006.1|  PREDICTED: zinc finger CCCH domain-containin...  98.6    3e-21   Camelina sativa [gold-of-pleasure]
ref|XP_003530556.1|  PREDICTED: zinc finger CCCH domain-containin...  98.2    3e-21   Glycine max [soybeans]
gb|ACU23866.1|  unknown                                               98.2    3e-21   Glycine max [soybeans]
gb|KJB54323.1|  hypothetical protein B456_009G029300                  98.2    3e-21   Gossypium raimondii
ref|XP_007160259.1|  hypothetical protein PHAVU_002G306100g           98.2    3e-21   Phaseolus vulgaris [French bean]
emb|CDY18184.1|  BnaC05g02070D                                        98.2    4e-21   Brassica napus [oilseed rape]
ref|XP_004135688.1|  PREDICTED: zinc finger CCCH domain-containin...  98.2    4e-21   Cucumis sativus [cucumbers]
gb|ADL36656.1|  C3HL domain class transcription factor                98.2    4e-21   Malus domestica [apple tree]
dbj|BAJ34229.1|  unnamed protein product                              97.8    4e-21   Eutrema halophilum
ref|XP_002440755.1|  hypothetical protein SORBIDRAFT_09g006050        98.2    4e-21   Sorghum bicolor [broomcorn]
ref|XP_006408900.1|  hypothetical protein EUTSA_v10002026mg           97.8    4e-21   Eutrema salsugineum [saltwater cress]
gb|AGL76984.1|  zinc finger CCCH domain-containing protein            98.2    4e-21   Cucumis melo [Oriental melon]
gb|ACO54858.1|  zinc finger protein ZF3                               98.2    4e-21   Cicer arietinum [garbanzo]
ref|XP_009361457.1|  PREDICTED: zinc finger CCCH domain-containin...  97.8    4e-21   Pyrus x bretschneideri [bai li]
ref|XP_008450813.1|  PREDICTED: zinc finger CCCH domain-containin...  97.8    4e-21   
ref|XP_006304480.1|  hypothetical protein CARUB_v10011207mg           98.2    5e-21   Capsella rubella
ref|XP_002275926.1|  PREDICTED: zinc finger CCCH domain-containin...  97.8    5e-21   Vitis vinifera
ref|XP_002863601.1|  zinc finger (CCCH-type) family protein           97.8    5e-21   
ref|XP_010049593.1|  PREDICTED: zinc finger CCCH domain-containin...  97.8    5e-21   
ref|XP_004158434.1|  PREDICTED: zinc finger CCCH domain-containin...  97.8    5e-21   
ref|XP_011078221.1|  PREDICTED: zinc finger CCCH domain-containin...  97.8    5e-21   Sesamum indicum [beniseed]
emb|CAN83255.1|  hypothetical protein VITISV_036981                   98.2    5e-21   Vitis vinifera
gb|KHM99829.1|  Zinc finger CCCH domain-containing protein 20         97.4    6e-21   Glycine soja [wild soybean]
gb|EYU30674.1|  hypothetical protein MIMGU_mgv1a009490mg              97.4    6e-21   Erythranthe guttata [common monkey flower]
ref|XP_008810557.1|  PREDICTED: zinc finger CCCH domain-containin...  97.4    6e-21   
ref|XP_001774473.1|  predicted protein                                94.0    6e-21   
ref|XP_007223349.1|  hypothetical protein PRUPE_ppa007432mg           97.4    6e-21   Prunus persica
gb|KJB27132.1|  hypothetical protein B456_004G283000                  97.4    6e-21   Gossypium raimondii
ref|XP_006280675.1|  hypothetical protein CARUB_v10026640mg           97.4    7e-21   Capsella rubella
ref|XP_006297982.1|  hypothetical protein CARUB_v10014025mg           97.4    7e-21   Capsella rubella
gb|KJB83088.1|  hypothetical protein B456_013G229000                  97.1    7e-21   Gossypium raimondii
emb|CBI20604.3|  unnamed protein product                              97.1    7e-21   Vitis vinifera
ref|XP_006408830.1|  hypothetical protein EUTSA_v10002045mg           97.1    8e-21   Eutrema salsugineum [saltwater cress]
emb|CDP08206.1|  unnamed protein product                              97.4    8e-21   Coffea canephora [robusta coffee]
dbj|BAJ85837.1|  predicted protein                                    97.4    8e-21   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004158433.1|  PREDICTED: zinc finger CCCH domain-containin...  97.1    8e-21   
ref|XP_010925500.1|  PREDICTED: zinc finger CCCH domain-containin...  97.4    9e-21   Elaeis guineensis
ref|XP_009408887.1|  PREDICTED: zinc finger CCCH domain-containin...  97.4    9e-21   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_199239.1|  zinc finger CCCH domain-containing protein 61       97.1    9e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010267090.1|  PREDICTED: zinc finger CCCH domain-containin...  97.1    9e-21   Nelumbo nucifera [Indian lotus]
ref|XP_009381212.1|  PREDICTED: zinc finger CCCH domain-containin...  97.4    9e-21   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003564747.1|  PREDICTED: zinc finger CCCH domain-containin...  97.1    1e-20   Brachypodium distachyon [annual false brome]
ref|XP_009388582.1|  PREDICTED: zinc finger CCCH domain-containin...  97.1    1e-20   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDP03218.1|  unnamed protein product                              97.1    1e-20   Coffea canephora [robusta coffee]
emb|CDM81668.1|  unnamed protein product                              97.1    1e-20   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010472617.1|  PREDICTED: zinc finger CCCH domain-containin...  96.3    1e-20   Camelina sativa [gold-of-pleasure]
gb|EPS57796.1|  hypothetical protein M569_17020                       96.7    1e-20   Genlisea aurea
ref|XP_008798608.1|  PREDICTED: zinc finger CCCH domain-containin...  96.7    1e-20   Phoenix dactylifera
ref|NP_001146853.1|  nucleic acid binding protein                     96.7    1e-20   Zea mays [maize]
ref|XP_009784195.1|  PREDICTED: zinc finger CCCH domain-containin...  96.3    1e-20   Nicotiana sylvestris
ref|XP_009337135.1|  PREDICTED: zinc finger CCCH domain-containin...  96.7    1e-20   Pyrus x bretschneideri [bai li]
ref|XP_010540993.1|  PREDICTED: zinc finger CCCH domain-containin...  96.3    1e-20   Tarenaya hassleriana [spider flower]
emb|CDX86670.1|  BnaC08g00330D                                        96.7    1e-20   
ref|XP_011458888.1|  PREDICTED: zinc finger CCCH domain-containin...  96.3    1e-20   Fragaria vesca subsp. vesca
gb|KJB06687.1|  hypothetical protein B456_001G009900                  96.7    2e-20   Gossypium raimondii
emb|CBI27968.3|  unnamed protein product                              96.3    2e-20   Vitis vinifera
ref|XP_009791791.1|  PREDICTED: zinc finger CCCH domain-containin...  96.3    2e-20   Nicotiana sylvestris
emb|CDY15473.1|  BnaA08g27570D                                        96.7    2e-20   Brassica napus [oilseed rape]
ref|NP_194648.1|  protein OXIDATION-RELATED ZINC FINGER 2             96.3    2e-20   Arabidopsis thaliana [mouse-ear cress]
ref|NP_179571.1|  oxidation-related zinc Finger 1                     96.3    2e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002886019.1|  hypothetical protein ARALYDRAFT_480488           96.3    2e-20   
ref|XP_002878901.1|  hypothetical protein ARALYDRAFT_481444           95.9    2e-20   
ref|XP_006294702.1|  hypothetical protein CARUB_v10023740mg           95.9    2e-20   Capsella rubella
ref|XP_008377933.1|  PREDICTED: zinc finger CCCH domain-containin...  96.3    2e-20   
ref|XP_009111142.1|  PREDICTED: zinc finger CCCH domain-containin...  96.3    2e-20   Brassica rapa
ref|XP_004503514.1|  PREDICTED: zinc finger CCCH domain-containin...  96.3    2e-20   Cicer arietinum [garbanzo]
gb|KDP34137.1|  hypothetical protein JCGZ_07708                       96.3    2e-20   Jatropha curcas
ref|XP_011081722.1|  PREDICTED: zinc finger CCCH domain-containin...  95.9    2e-20   Sesamum indicum [beniseed]
gb|AAM65505.1|  putative CCCH-type zinc finger protein                95.5    2e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002283114.2|  PREDICTED: zinc finger CCCH domain-containin...  96.7    2e-20   Vitis vinifera
ref|XP_002309525.2|  zinc finger family protein                       96.3    2e-20   
gb|KFK32533.1|  hypothetical protein AALP_AA6G255600                  95.5    2e-20   Arabis alpina [alpine rockcress]
ref|XP_001781195.1|  predicted protein                                92.4    2e-20   
ref|NP_180161.1|  putative Cys3His zinc finger protein ATCTH          95.5    2e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006451362.1|  hypothetical protein CICLE_v10008633mg           95.9    2e-20   
ref|XP_010668905.1|  PREDICTED: zinc finger CCCH domain-containin...  95.9    2e-20   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006475367.1|  PREDICTED: zinc finger CCCH domain-containin...  95.9    2e-20   Citrus sinensis [apfelsine]
ref|XP_002867421.1|  zinc finger (CCCH-type) family protein           95.9    2e-20   
gb|EYU20391.1|  hypothetical protein MIMGU_mgv1a008351mg              95.9    2e-20   Erythranthe guttata [common monkey flower]
dbj|BAJ33902.1|  unnamed protein product                              95.9    2e-20   Eutrema halophilum
ref|XP_006412868.1|  hypothetical protein EUTSA_v10025226mg           96.7    2e-20   
ref|XP_010494430.1|  PREDICTED: zinc finger CCCH domain-containin...  95.9    2e-20   Camelina sativa [gold-of-pleasure]
ref|XP_010433125.1|  PREDICTED: zinc finger CCCH domain-containin...  95.5    3e-20   Camelina sativa [gold-of-pleasure]
ref|XP_004513076.1|  PREDICTED: zinc finger CCCH domain-containin...  95.5    3e-20   Cicer arietinum [garbanzo]
ref|XP_010447881.1|  PREDICTED: zinc finger CCCH domain-containin...  95.5    3e-20   Camelina sativa [gold-of-pleasure]
ref|XP_010438328.1|  PREDICTED: zinc finger CCCH domain-containin...  95.5    3e-20   Camelina sativa [gold-of-pleasure]
ref|XP_011019549.1|  PREDICTED: zinc finger CCCH domain-containin...  95.9    3e-20   Populus euphratica
ref|XP_008655700.1|  PREDICTED: zinc finger CCCH domain-containin...  95.9    3e-20   Zea mays [maize]
gb|KJB54756.1|  hypothetical protein B456_009G047600                  95.5    3e-20   Gossypium raimondii
ref|XP_010244375.1|  PREDICTED: zinc finger CCCH domain-containin...  95.9    3e-20   Nelumbo nucifera [Indian lotus]
gb|AFW80253.1|  hypothetical protein ZEAMMB73_899917                  95.1    3e-20   
ref|XP_010441910.1|  PREDICTED: zinc finger CCCH domain-containin...  95.5    3e-20   Camelina sativa [gold-of-pleasure]
ref|XP_006285735.1|  hypothetical protein CARUB_v10007208mg           95.5    3e-20   
ref|XP_010481761.1|  PREDICTED: zinc finger CCCH domain-containin...  95.5    3e-20   Camelina sativa [gold-of-pleasure]
emb|CAN81808.1|  hypothetical protein VITISV_013303                   96.7    3e-20   Vitis vinifera
ref|XP_003529068.1|  PREDICTED: zinc finger CCCH domain-containin...  95.5    3e-20   Glycine max [soybeans]
ref|XP_003568774.1|  PREDICTED: zinc finger CCCH domain-containin...  95.5    3e-20   Brachypodium distachyon [annual false brome]
gb|KHN40356.1|  Zinc finger CCCH domain-containing protein 20         95.1    4e-20   Glycine soja [wild soybean]
ref|XP_003620782.1|  Zinc finger CCCH domain-containing protein       95.5    4e-20   Medicago truncatula
ref|XP_009608132.1|  PREDICTED: zinc finger CCCH domain-containin...  95.1    4e-20   Nicotiana tomentosiformis
ref|XP_004245129.1|  PREDICTED: zinc finger CCCH domain-containin...  94.7    4e-20   Solanum lycopersicum
ref|XP_007152945.1|  hypothetical protein PHAVU_004G173600g           95.1    4e-20   Phaseolus vulgaris [French bean]
gb|KFK40348.1|  hypothetical protein AALP_AA3G362300                  95.1    4e-20   Arabis alpina [alpine rockcress]
ref|XP_004287330.2|  PREDICTED: zinc finger CCCH domain-containin...  96.3    5e-20   Fragaria vesca subsp. vesca
gb|KJB27276.1|  hypothetical protein B456_004G288300                  94.7    5e-20   Gossypium raimondii
ref|XP_006355306.1|  PREDICTED: zinc finger CCCH domain-containin...  94.7    5e-20   Solanum tuberosum [potatoes]
ref|XP_007012220.1|  Zinc finger C-x8-C-x5-C-x3-H type family pro...  94.7    6e-20   
ref|XP_003516267.1|  PREDICTED: zinc finger CCCH domain-containin...  94.7    6e-20   Glycine max [soybeans]
gb|KEH21327.1|  zinc finger CCCH domain protein                       94.7    6e-20   Medicago truncatula
ref|XP_008794080.1|  PREDICTED: zinc finger CCCH domain-containin...  95.1    6e-20   Phoenix dactylifera
ref|XP_002978806.1|  hypothetical protein SELMODRAFT_443970           94.7    6e-20   Selaginella moellendorffii
ref|XP_008799753.1|  PREDICTED: zinc finger CCCH domain-containin...  94.7    7e-20   Phoenix dactylifera
gb|EEE62637.1|  hypothetical protein OsJ_17440                        94.7    7e-20   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002993351.1|  hypothetical protein SELMODRAFT_449116           96.3    7e-20   
ref|XP_009802285.1|  PREDICTED: zinc finger CCCH domain-containin...  94.4    7e-20   Nicotiana sylvestris
ref|XP_002972737.1|  hypothetical protein SELMODRAFT_441947           96.3    8e-20   Selaginella moellendorffii
ref|XP_004251650.1|  PREDICTED: zinc finger CCCH domain-containin...  94.7    8e-20   Solanum lycopersicum
ref|XP_010451167.1|  PREDICTED: zinc finger CCCH domain-containin...  92.8    8e-20   Camelina sativa [gold-of-pleasure]
gb|KFK31654.1|  hypothetical protein AALP_AA6G141300                  94.4    9e-20   Arabis alpina [alpine rockcress]
ref|XP_006853780.1|  hypothetical protein AMTR_s00056p00207550        95.1    9e-20   Amborella trichopoda
ref|XP_010909936.1|  PREDICTED: zinc finger CCCH domain-containin...  94.0    1e-19   Elaeis guineensis
gb|ABR16884.1|  unknown                                               95.9    1e-19   Picea sitchensis
ref|XP_006353579.1|  PREDICTED: zinc finger CCCH domain-containin...  94.0    1e-19   Solanum tuberosum [potatoes]
dbj|BAN44693.1|  zinc finger CCCH domain-containing protein           90.9    1e-19   Bruguiera gymnorhiza [Burma mangrove]
dbj|BAN44500.1|  zinc finger CCCH domain-containing protein           90.9    1e-19   Bruguiera gymnorhiza [Burma mangrove]
dbj|BAN44470.1|  zinc finger CCCH domain-containing protein           90.5    1e-19   Bruguiera gymnorhiza [Burma mangrove]
ref|XP_011094664.1|  PREDICTED: zinc finger CCCH domain-containin...  93.6    1e-19   Sesamum indicum [beniseed]
dbj|BAN44750.1|  zinc finger CCCH domain-containing protein           90.5    1e-19   Bruguiera sexangula
ref|NP_001144558.1|  uncharacterized protein LOC100277562             93.6    2e-19   
gb|ACN34007.1|  unknown                                               93.6    2e-19   Zea mays [maize]
gb|EAY96854.1|  hypothetical protein OsI_18775                        93.6    2e-19   Oryza sativa Indica Group [Indian rice]
ref|XP_009411222.1|  PREDICTED: zinc finger CCCH domain-containin...  93.2    2e-19   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001054861.1|  Os05g0195200                                     93.6    2e-19   
gb|EPS65346.1|  hypothetical protein M569_09425                       90.5    2e-19   Genlisea aurea
ref|XP_010924475.1|  PREDICTED: zinc finger CCCH domain-containin...  92.8    2e-19   Elaeis guineensis
ref|XP_010548687.1|  PREDICTED: zinc finger CCCH domain-containin...  93.2    2e-19   Tarenaya hassleriana [spider flower]
gb|ACF82790.1|  unknown                                               92.4    3e-19   Zea mays [maize]
gb|KHN16664.1|  Zinc finger CCCH domain-containing protein 49         92.4    3e-19   Glycine soja [wild soybean]
ref|XP_009128959.1|  PREDICTED: zinc finger CCCH domain-containin...  92.8    3e-19   Brassica rapa
ref|XP_006855265.1|  hypothetical protein AMTR_s00183p00052730        92.8    3e-19   Amborella trichopoda
gb|EYU29305.1|  hypothetical protein MIMGU_mgv1a008957mg              92.8    3e-19   Erythranthe guttata [common monkey flower]
gb|KJB07446.1|  hypothetical protein B456_001G024400                  92.4    3e-19   Gossypium raimondii
ref|XP_008795482.1|  PREDICTED: zinc finger CCCH domain-containin...  92.4    3e-19   Phoenix dactylifera
ref|XP_009610482.1|  PREDICTED: zinc finger CCCH domain-containin...  92.4    3e-19   Nicotiana tomentosiformis
ref|XP_008220427.1|  PREDICTED: zinc finger CCCH domain-containin...  92.4    3e-19   Prunus mume [ume]
ref|XP_002324748.2|  hypothetical protein POPTR_0018s04720g           92.8    4e-19   Populus trichocarpa [western balsam poplar]
gb|ABK92961.1|  unknown                                               92.8    4e-19   Populus trichocarpa [western balsam poplar]
ref|XP_009402941.1|  PREDICTED: zinc finger CCCH domain-containin...  92.4    4e-19   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB07447.1|  hypothetical protein B456_001G024400                  91.7    4e-19   Gossypium raimondii
ref|XP_009409364.1|  PREDICTED: zinc finger CCCH domain-containin...  92.4    4e-19   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009372717.1|  PREDICTED: zinc finger CCCH domain-containin...  93.6    5e-19   
ref|XP_002947407.1|  CCCH zinc finger protein                         94.7    6e-19   Volvox carteri f. nagariensis
ref|XP_009620041.1|  PREDICTED: zinc finger CCCH domain-containin...  91.7    7e-19   Nicotiana tomentosiformis
ref|XP_003603107.1|  Zinc finger CCCH domain-containing protein       90.9    8e-19   Medicago truncatula
ref|XP_009137834.1|  PREDICTED: zinc finger CCCH domain-containin...  91.3    1e-18   Brassica rapa
ref|XP_009385782.1|  PREDICTED: zinc finger CCCH domain-containin...  91.3    1e-18   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007043650.1|  Zinc finger C-x8-C-x5-C-x3-H type family pro...  91.3    1e-18   
ref|XP_003525974.1|  PREDICTED: zinc finger CCCH domain-containin...  90.1    1e-18   
ref|XP_002504751.1|  predicted protein                                90.9    1e-18   Micromonas commoda
ref|XP_008806226.1|  PREDICTED: zinc finger CCCH domain-containin...  88.2    2e-18   Phoenix dactylifera
ref|XP_009380460.1|  PREDICTED: zinc finger CCCH domain-containin...  90.1    2e-18   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009109049.1|  PREDICTED: zinc finger CCCH domain-containin...  90.1    2e-18   Brassica rapa
ref|XP_011012777.1|  PREDICTED: zinc finger CCCH domain-containin...  90.5    3e-18   Populus euphratica
ref|XP_003522232.1|  PREDICTED: zinc finger CCCH domain-containin...  88.6    3e-18   Glycine max [soybeans]
ref|XP_001417127.1|  predicted protein                                90.9    6e-18   Ostreococcus lucimarinus CCE9901
emb|CEF97418.1|  Ankyrin repeat                                       90.9    6e-18   Ostreococcus tauri
gb|ACU19973.1|  unknown                                               88.2    6e-18   Glycine max [soybeans]
ref|XP_001693433.1|  predicted protein                                85.5    6e-18   Chlamydomonas reinhardtii
ref|XP_004501483.1|  PREDICTED: zinc finger CCCH domain-containin...  87.8    8e-18   Cicer arietinum [garbanzo]
ref|XP_009396540.1|  PREDICTED: zinc finger CCCH domain-containin...  88.2    8e-18   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010526424.1|  PREDICTED: zinc finger CCCH domain-containin...  88.2    9e-18   Tarenaya hassleriana [spider flower]
gb|KCW81630.1|  hypothetical protein EUGRSUZ_C02990                   88.2    1e-17   Eucalyptus grandis [rose gum]
ref|XP_003064640.1|  predicted protein                                89.7    1e-17   Micromonas pusilla CCMP1545
ref|XP_010049147.1|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...  88.6    1e-17   Eucalyptus grandis [rose gum]
ref|XP_005843823.1|  hypothetical protein CHLNCDRAFT_139889           89.4    2e-17   Chlorella variabilis
gb|KCW79588.1|  hypothetical protein EUGRSUZ_C00948                   87.4    2e-17   Eucalyptus grandis [rose gum]
ref|XP_010047645.1|  PREDICTED: zinc finger CCCH domain-containin...  87.4    2e-17   Eucalyptus grandis [rose gum]
ref|XP_009415367.1|  PREDICTED: zinc finger CCCH domain-containin...  87.4    2e-17   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003519252.1|  PREDICTED: zinc finger CCCH domain-containin...  89.0    4e-17   Glycine max [soybeans]
ref|XP_004510954.1|  PREDICTED: zinc finger CCCH domain-containin...  89.0    4e-17   Cicer arietinum [garbanzo]
gb|AJB84602.1|  C3H zinc finger protein                               89.0    4e-17   Glycine max [soybeans]
ref|XP_002442230.1|  hypothetical protein SORBIDRAFT_08g016640        88.2    4e-17   
ref|XP_010237224.1|  PREDICTED: zinc finger CCCH domain-containin...  88.6    5e-17   
gb|KHN40076.1|  Zinc finger CCCH domain-containing protein 66         88.6    5e-17   Glycine soja [wild soybean]
ref|XP_006596425.1|  PREDICTED: zinc finger CCCH domain-containin...  88.6    5e-17   Glycine max [soybeans]
ref|XP_006345451.1|  PREDICTED: zinc finger CCCH domain-containin...  88.6    6e-17   Solanum tuberosum [potatoes]
dbj|BAJ96143.1|  predicted protein                                    88.2    6e-17   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KDP46484.1|  hypothetical protein JCGZ_08456                       88.2    7e-17   Jatropha curcas
ref|XP_010673641.1|  PREDICTED: zinc finger CCCH domain-containin...  87.4    1e-16   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004229627.1|  PREDICTED: zinc finger CCCH domain-containin...  87.8    1e-16   Solanum lycopersicum
ref|XP_006664596.1|  PREDICTED: zinc finger CCCH domain-containin...  85.9    1e-16   
gb|KJB09387.1|  hypothetical protein B456_001G138300                  87.4    1e-16   Gossypium raimondii
ref|XP_010097625.1|  Zinc finger CCCH domain-containing protein 66    87.4    1e-16   Morus notabilis
ref|XP_009799603.1|  PREDICTED: zinc finger CCCH domain-containin...  87.4    1e-16   Nicotiana sylvestris
emb|CDP14011.1|  unnamed protein product                              87.4    1e-16   
ref|XP_009599703.1|  PREDICTED: zinc finger CCCH domain-containin...  87.4    1e-16   
ref|XP_010937003.1|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...  87.4    2e-16   
ref|XP_010923439.1|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...  87.4    2e-16   
ref|XP_009395218.1|  PREDICTED: zinc finger CCCH domain-containin...  84.3    2e-16   
ref|XP_007148879.1|  hypothetical protein PHAVU_005G022000g           87.0    2e-16   
ref|XP_009795434.1|  PREDICTED: zinc finger CCCH domain-containin...  87.0    2e-16   
ref|XP_006349561.1|  PREDICTED: zinc finger CCCH domain-containin...  87.0    2e-16   
ref|XP_009396384.1|  PREDICTED: zinc finger CCCH domain-containin...  87.4    2e-16   
ref|XP_009795435.1|  PREDICTED: zinc finger CCCH domain-containin...  87.0    2e-16   
ref|XP_009395592.1|  PREDICTED: zinc finger CCCH domain-containin...  87.0    2e-16   
ref|NP_001066886.1|  Os12g0515500                                     86.7    2e-16   
ref|XP_007052531.1|  CCCH-type zinc finger protein with ARM repea...  87.0    2e-16   
ref|XP_003540529.1|  PREDICTED: zinc finger CCCH domain-containin...  87.0    2e-16   
ref|XP_004234834.1|  PREDICTED: zinc finger CCCH domain-containin...  87.0    2e-16   
ref|XP_004962884.1|  PREDICTED: zinc finger CCCH domain-containin...  86.7    2e-16   
emb|CDP07776.1|  unnamed protein product                              86.7    2e-16   
gb|KHN39938.1|  Zinc finger CCCH domain-containing protein 30         86.7    2e-16   
ref|XP_006598269.1|  PREDICTED: zinc finger CCCH domain-containin...  86.7    2e-16   
ref|XP_007015052.1|  C3HL domain class transcription factor, puta...  86.7    2e-16   
ref|XP_008674377.1|  PREDICTED: zinc finger CCCH domain-containin...  86.7    2e-16   
ref|XP_010695261.1|  PREDICTED: zinc finger CCCH domain-containin...  86.7    2e-16   
ref|XP_003078560.1|  putative finger transcription factor (ISS)       83.6    2e-16   
gb|EPS73621.1|  hypothetical protein M569_01136                       84.0    2e-16   
ref|XP_010275497.1|  PREDICTED: zinc finger CCCH domain-containin...  83.6    2e-16   
ref|XP_009618285.1|  PREDICTED: zinc finger CCCH domain-containin...  86.7    3e-16   
gb|EMS50712.1|  Zinc finger CCCH domain-containing protein 67         85.9    3e-16   
ref|XP_011075220.1|  PREDICTED: zinc finger CCCH domain-containin...  86.3    3e-16   
ref|XP_009777511.1|  PREDICTED: zinc finger CCCH domain-containin...  86.3    3e-16   
ref|XP_011078886.1|  PREDICTED: zinc finger CCCH domain-containin...  86.3    3e-16   
gb|KHG19524.1|  hypothetical protein F383_24471                       86.3    3e-16   
ref|XP_003533897.1|  PREDICTED: zinc finger CCCH domain-containin...  86.3    3e-16   
ref|XP_006587172.1|  PREDICTED: zinc finger CCCH domain-containin...  86.3    3e-16   
gb|KHG03427.1|  hypothetical protein F383_27140                       86.3    3e-16   
ref|XP_009610396.1|  PREDICTED: zinc finger CCCH domain-containin...  86.3    4e-16   
ref|NP_001267839.1|  zinc finger CCCH domain-containing protein 3...  86.3    4e-16   
gb|KJB36039.1|  hypothetical protein B456_006G138100                  86.3    4e-16   
ref|XP_004499884.1|  PREDICTED: zinc finger CCCH domain-containin...  86.3    4e-16   
ref|XP_011093548.1|  PREDICTED: zinc finger CCCH domain-containin...  85.9    4e-16   
ref|XP_011087691.1|  PREDICTED: zinc finger CCCH domain-containin...  85.9    4e-16   
ref|XP_009804762.1|  PREDICTED: zinc finger CCCH domain-containin...  85.9    4e-16   
gb|KJB36040.1|  hypothetical protein B456_006G138100                  85.9    4e-16   
ref|XP_009394396.1|  PREDICTED: zinc finger CCCH domain-containin...  85.9    4e-16   
gb|KDP26019.1|  hypothetical protein JCGZ_21052                       85.9    4e-16   
ref|XP_010278986.1|  PREDICTED: zinc finger CCCH domain-containin...  85.9    4e-16   
ref|XP_006482880.1|  PREDICTED: zinc finger CCCH domain-containin...  85.9    5e-16   
ref|XP_008801953.1|  PREDICTED: zinc finger CCCH domain-containin...  85.9    5e-16   
emb|CAI30889.1|  putative CCCH-type zinc finger protein CsSEF1        83.2    5e-16   
gb|KJB19291.1|  hypothetical protein B456_003G093600                  85.9    5e-16   
ref|XP_010508649.1|  PREDICTED: zinc finger CCCH domain-containin...  85.9    5e-16   
ref|XP_011468826.1|  PREDICTED: zinc finger CCCH domain-containin...  85.9    5e-16   
ref|XP_009394397.1|  PREDICTED: zinc finger CCCH domain-containin...  85.9    5e-16   
ref|XP_008444505.1|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...  83.2    5e-16   
ref|XP_010517688.1|  PREDICTED: zinc finger CCCH domain-containin...  85.9    5e-16   
ref|XP_004142912.1|  PREDICTED: zinc finger CCCH domain-containin...  83.2    5e-16   
ref|XP_010931016.1|  PREDICTED: zinc finger CCCH domain-containin...  85.5    5e-16   
ref|XP_002308038.2|  zinc finger family protein                       85.5    5e-16   
gb|KHG27269.1|  hypothetical protein F383_12616                       85.5    6e-16   
ref|XP_009411280.1|  PREDICTED: zinc finger CCCH domain-containin...  85.5    6e-16   
gb|EMT02642.1|  Zinc finger CCCH domain-containing protein 67         85.1    6e-16   
ref|XP_009781965.1|  PREDICTED: zinc finger CCCH domain-containin...  85.5    6e-16   
ref|XP_006411461.1|  hypothetical protein EUTSA_v10016315mg           85.5    6e-16   
gb|ACN25172.1|  unknown                                               85.1    6e-16   
ref|XP_007028819.1|  C3HL domain class transcription factor isofo...  85.5    6e-16   
ref|XP_008778227.1|  PREDICTED: zinc finger CCCH domain-containin...  85.5    6e-16   
ref|XP_009617179.1|  PREDICTED: zinc finger CCCH domain-containin...  85.5    6e-16   
ref|XP_002308039.2|  zinc finger family protein                       85.5    6e-16   
ref|XP_006351223.1|  PREDICTED: zinc finger CCCH domain-containin...  85.5    6e-16   
gb|KJB22263.1|  hypothetical protein B456_004G037500                  85.5    7e-16   
ref|XP_004249196.1|  PREDICTED: zinc finger CCCH domain-containin...  85.5    7e-16   
gb|EAZ28249.1|  hypothetical protein OsJ_12221                        85.5    7e-16   
ref|XP_004172043.1|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...  82.4    7e-16   
ref|XP_004249271.1|  PREDICTED: zinc finger CCCH domain-containin...  85.1    7e-16   
ref|XP_006351322.1|  PREDICTED: zinc finger CCCH domain-containin...  85.1    8e-16   
ref|XP_010688398.1|  PREDICTED: zinc finger CCCH domain-containin...  83.2    8e-16   
ref|XP_011020337.1|  PREDICTED: zinc finger CCCH domain-containin...  85.1    8e-16   
gb|KGN47076.1|  hypothetical protein Csa_6G185260                     85.1    8e-16   
ref|XP_008786132.1|  PREDICTED: zinc finger CCCH domain-containin...  85.1    8e-16   
gb|EPS64556.1|  hypothetical protein M569_10225                       84.7    8e-16   
ref|XP_004173380.1|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...  85.1    8e-16   
ref|XP_004143161.1|  PREDICTED: zinc finger CCCH domain-containin...  85.1    8e-16   
gb|KDP43473.1|  hypothetical protein JCGZ_16760                       85.1    8e-16   
ref|XP_011020339.1|  PREDICTED: zinc finger CCCH domain-containin...  85.1    8e-16   
ref|XP_003625157.1|  Zinc finger CCCH domain-containing protein       85.1    9e-16   
ref|XP_008464034.1|  PREDICTED: zinc finger CCCH domain-containin...  85.1    9e-16   
ref|XP_004493518.1|  PREDICTED: zinc finger CCCH domain-containin...  85.1    1e-15   
ref|XP_008657958.1|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...  84.0    1e-15   
gb|KHN46294.1|  Zinc finger CCCH domain-containing protein 30         84.7    1e-15   
ref|XP_006589016.1|  PREDICTED: zinc finger CCCH domain-containin...  84.7    1e-15   
ref|XP_006838347.1|  hypothetical protein AMTR_s00103p00162010        84.7    1e-15   
gb|KHN19451.1|  Zinc finger CCCH domain-containing protein 24         84.0    1e-15   
ref|XP_007145619.1|  hypothetical protein PHAVU_007G254100g           84.7    1e-15   
gb|EYU18755.1|  hypothetical protein MIMGU_mgv1a005424mg              84.0    1e-15   
ref|XP_010909716.1|  PREDICTED: zinc finger CCCH domain-containin...  84.7    1e-15   
emb|CDX97207.1|  BnaC09g44180D                                        84.3    1e-15   
gb|KJB74343.1|  hypothetical protein B456_011G289400                  84.7    1e-15   
ref|NP_001147048.1|  nucleic acid binding protein                     84.3    1e-15   
ref|XP_010092985.1|  Zinc finger CCCH domain-containing protein 30    84.7    1e-15   
ref|XP_002298434.1|  hypothetical protein POPTR_0001s27370g           84.7    1e-15   
gb|KHG10972.1|  hypothetical protein F383_11482                       84.3    1e-15   
gb|KEH28168.1|  ARM repeat CCCH-type zinc finger protein              84.3    1e-15   
emb|CDY53968.1|  BnaA10g30000D                                        84.3    1e-15   
gb|EMS62800.1|  Zinc finger CCCH domain-containing protein 24         84.3    1e-15   
ref|XP_011047401.1|  PREDICTED: zinc finger CCCH domain-containin...  84.7    1e-15   
ref|XP_009386116.1|  PREDICTED: zinc finger CCCH domain-containin...  84.7    1e-15   
ref|XP_009394601.1|  PREDICTED: zinc finger CCCH domain-containin...  81.6    1e-15   
ref|XP_006439117.1|  hypothetical protein CICLE_v10030816mg           84.7    1e-15   
ref|XP_009414744.1|  PREDICTED: zinc finger CCCH domain-containin...  84.7    1e-15   
ref|XP_002314035.2|  hypothetical protein POPTR_0009s06580g           84.7    1e-15   
gb|KHN37619.1|  Zinc finger CCCH domain-containing protein 30         84.3    1e-15   
ref|XP_009121831.1|  PREDICTED: zinc finger CCCH domain-containin...  84.3    1e-15   
gb|EPS63683.1|  hypothetical protein M569_11102                       84.3    1e-15   
dbj|BAG15872.1|  transcription factor                                 84.3    1e-15   
gb|KJB08973.1|  hypothetical protein B456_001G116400                  84.3    1e-15   
ref|XP_008778438.1|  PREDICTED: zinc finger CCCH domain-containin...  84.3    1e-15   
ref|XP_007016084.1|  Zinc finger family protein                       84.3    1e-15   
ref|XP_006286367.1|  hypothetical protein CARUB_v10000345mg           84.3    1e-15   
ref|XP_010088235.1|  Zinc finger CCCH domain-containing protein 30    84.3    1e-15   
ref|XP_007133821.1|  hypothetical protein PHAVU_011G211700g           84.3    1e-15   
gb|EMT08668.1|  Zinc finger CCCH domain-containing protein 24         84.0    1e-15   
ref|XP_007142204.1|  hypothetical protein PHAVU_008G260900g           83.6    1e-15   
ref|XP_010032980.1|  PREDICTED: zinc finger CCCH domain-containin...  84.3    1e-15   
ref|XP_010419842.1|  PREDICTED: zinc finger CCCH domain-containin...  84.3    1e-15   
ref|XP_007214231.1|  hypothetical protein PRUPE_ppa025636mg           84.3    1e-15   
ref|XP_008665236.1|  PREDICTED: zinc finger CCCH domain-containin...  84.3    1e-15   
ref|XP_006439118.1|  hypothetical protein CICLE_v10030816mg           84.3    1e-15   
ref|XP_004500271.1|  PREDICTED: zinc finger CCCH domain-containin...  84.3    1e-15   
ref|XP_010257240.1|  PREDICTED: zinc finger CCCH domain-containin...  84.3    1e-15   
ref|XP_002466619.1|  hypothetical protein SORBIDRAFT_01g011150        84.3    1e-15   
ref|XP_008461797.1|  PREDICTED: zinc finger CCCH domain-containin...  84.3    1e-15   
ref|XP_010257241.1|  PREDICTED: zinc finger CCCH domain-containin...  84.3    1e-15   
ref|XP_002277747.2|  PREDICTED: zinc finger CCCH domain-containin...  84.3    1e-15   
ref|XP_007142205.1|  hypothetical protein PHAVU_008G260900g           84.3    2e-15   
ref|XP_008220916.1|  PREDICTED: zinc finger CCCH domain-containin...  84.3    2e-15   
ref|XP_010492018.1|  PREDICTED: zinc finger CCCH domain-containin...  84.3    2e-15   
ref|XP_004172112.1|  PREDICTED: zinc finger CCCH domain-containin...  84.3    2e-15   
ref|XP_006655504.1|  PREDICTED: zinc finger CCCH domain-containin...  81.3    2e-15   
ref|XP_004982091.1|  PREDICTED: zinc finger CCCH domain-containin...  84.3    2e-15   
ref|XP_002871530.1|  hypothetical protein ARALYDRAFT_488102           84.3    2e-15   
ref|XP_010555058.1|  PREDICTED: zinc finger CCCH domain-containin...  84.3    2e-15   
ref|XP_004149598.1|  PREDICTED: zinc finger CCCH domain-containin...  84.3    2e-15   
ref|XP_006399772.1|  hypothetical protein EUTSA_v10012818mg           84.3    2e-15   
ref|XP_003568066.1|  PREDICTED: zinc finger CCCH domain-containin...  81.6    2e-15   
emb|CBI24886.3|  unnamed protein product                              83.6    2e-15   
gb|ADL36657.1|  C3HL domain class transcription factor                84.3    2e-15   
gb|AAM20612.1|  zinc finger transcription factor-like protein         84.3    2e-15   
gb|ACN39879.1|  unknown                                               84.3    2e-15   
ref|NP_196789.1|  zinc finger CCCH domain-containing protein 56       84.3    2e-15   
ref|XP_010453333.1|  PREDICTED: zinc finger CCCH domain-containin...  84.3    2e-15   
ref|XP_007208332.1|  hypothetical protein PRUPE_ppa002251mg           84.3    2e-15   
ref|NP_001050982.1|  Os03g0698800                                     84.3    2e-15   
ref|XP_003521185.1|  PREDICTED: zinc finger CCCH domain-containin...  84.0    2e-15   
ref|XP_009338915.1|  PREDICTED: zinc finger CCCH domain-containin...  84.3    2e-15   
emb|CBI29869.3|  unnamed protein product                              84.0    2e-15   
ref|XP_002525655.1|  transcription factor, putative                   84.3    2e-15   
gb|KJB55720.1|  hypothetical protein B456_009G091200                  84.3    2e-15   
ref|XP_011043783.1|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...  84.3    2e-15   
ref|XP_008384793.1|  PREDICTED: zinc finger CCCH domain-containin...  84.3    2e-15   
ref|XP_004242522.1|  PREDICTED: zinc finger CCCH domain-containin...  84.0    2e-15   
ref|XP_003615688.1|  Zinc finger CCCH domain-containing protein       84.3    2e-15   
gb|KJB55721.1|  hypothetical protein B456_009G091200                  84.0    2e-15   
gb|AAO38462.1|  unknown protein                                       84.3    2e-15   
ref|XP_010650896.1|  PREDICTED: zinc finger CCCH domain-containin...  84.0    2e-15   
ref|XP_010685536.1|  PREDICTED: zinc finger CCCH domain-containin...  84.0    2e-15   
gb|AES98646.2|  ARM repeat CCCH-type zinc finger protein              84.0    2e-15   
ref|XP_003559545.1|  PREDICTED: zinc finger CCCH domain-containin...  84.3    2e-15   
emb|CAN74402.1|  hypothetical protein VITISV_043632                   84.0    2e-15   
ref|XP_010253756.1|  PREDICTED: zinc finger CCCH domain-containin...  84.0    2e-15   
ref|XP_002299802.2|  hypothetical protein POPTR_0001s25960g           84.0    2e-15   
gb|KHN07386.1|  Zinc finger CCCH domain-containing protein 30         84.0    2e-15   
gb|EYU27048.1|  hypothetical protein MIMGU_mgv1a002486mg              84.0    2e-15   
gb|ADP02201.1|  zinc finger CCCH domain-containing protein            84.0    2e-15   
ref|XP_008355011.1|  PREDICTED: zinc finger CCCH domain-containin...  84.0    2e-15   
ref|XP_003632114.1|  PREDICTED: zinc finger CCCH domain-containin...  84.0    2e-15   
ref|XP_010650895.1|  PREDICTED: zinc finger CCCH domain-containin...  84.0    2e-15   
ref|XP_010483463.1|  PREDICTED: zinc finger CCCH domain-containin...  84.0    2e-15   
ref|XP_006488540.1|  PREDICTED: zinc finger CCCH domain-containin...  84.0    2e-15   
ref|XP_006425080.1|  hypothetical protein CICLE_v10027883mg           84.0    2e-15   
ref|XP_011032109.1|  PREDICTED: zinc finger CCCH domain-containin...  84.0    2e-15   
ref|XP_010443605.1|  PREDICTED: zinc finger CCCH domain-containin...  83.6    2e-15   
ref|XP_004242521.1|  PREDICTED: zinc finger CCCH domain-containin...  84.0    2e-15   
ref|XP_004294290.1|  PREDICTED: zinc finger CCCH domain-containin...  84.0    2e-15   
gb|KDO66906.1|  hypothetical protein CISIN_1g005270mg                 84.0    2e-15   
ref|XP_006651722.1|  PREDICTED: zinc finger CCCH domain-containin...  84.0    2e-15   
ref|XP_006425079.1|  hypothetical protein CICLE_v10027883mg           84.0    2e-15   
ref|XP_010453982.1|  PREDICTED: zinc finger CCCH domain-containin...  83.6    2e-15   
ref|XP_011032108.1|  PREDICTED: zinc finger CCCH domain-containin...  84.0    2e-15   
ref|XP_009347250.1|  PREDICTED: zinc finger CCCH domain-containin...  84.0    2e-15   
dbj|BAK06499.1|  predicted protein                                    84.0    2e-15   
emb|CAN78824.1|  hypothetical protein VITISV_006556                   84.0    2e-15   
ref|XP_006604367.1|  PREDICTED: zinc finger CCCH domain-containin...  84.0    2e-15   
ref|XP_002314096.2|  hypothetical protein POPTR_0009s05150g           84.0    2e-15   
ref|NP_200670.1|  zinc finger CCCH domain-containing protein 66       83.6    2e-15   
ref|XP_002864583.1|  zinc finger (CCCH-type) family protein           83.6    2e-15   
ref|XP_006488539.1|  PREDICTED: zinc finger CCCH domain-containin...  84.0    2e-15   
ref|XP_010672777.1|  PREDICTED: zinc finger CCCH domain-containin...  84.0    2e-15   
gb|KDO83403.1|  hypothetical protein CISIN_1g004911mg                 84.0    2e-15   
ref|XP_004136593.1|  PREDICTED: zinc finger CCCH domain-containin...  84.0    2e-15   
emb|CDX80350.1|  BnaC09g33920D                                        83.2    2e-15   
gb|EYU29028.1|  hypothetical protein MIMGU_mgv1a002533mg              83.6    2e-15   
emb|CDY52117.1|  BnaA10g29460D                                        83.2    2e-15   
ref|XP_006401060.1|  hypothetical protein EUTSA_v10012984mg           83.6    2e-15   
ref|XP_006280195.1|  hypothetical protein CARUB_v10026101mg           83.6    2e-15   
emb|CBI16373.3|  unnamed protein product                              83.2    3e-15   
ref|XP_009120378.1|  PREDICTED: zinc finger CCCH domain-containin...  83.2    3e-15   
gb|KDO83402.1|  hypothetical protein CISIN_1g004911mg                 83.6    3e-15   
ref|NP_001056099.1|  Os05g0525900                                     80.9    3e-15   
ref|XP_010057404.1|  PREDICTED: zinc finger CCCH domain-containin...  83.6    3e-15   
emb|CBI15944.3|  unnamed protein product                              83.6    3e-15   
ref|XP_010535372.1|  PREDICTED: zinc finger CCCH domain-containin...  83.2    3e-15   
ref|XP_002526717.1|  nucleic acid binding protein, putative           83.6    3e-15   
ref|XP_004961434.1|  PREDICTED: zinc finger CCCH domain-containin...  80.9    3e-15   
ref|XP_006421436.1|  hypothetical protein CICLE_v10004423mg           83.6    3e-15   
ref|XP_011033310.1|  PREDICTED: zinc finger CCCH domain-containin...  83.6    3e-15   
ref|XP_006493920.1|  PREDICTED: zinc finger CCCH domain-containin...  83.6    3e-15   
ref|XP_002526718.1|  nucleic acid binding protein, putative           83.6    3e-15   
ref|XP_011084902.1|  PREDICTED: zinc finger CCCH domain-containin...  83.6    3e-15   
ref|XP_010535371.1|  PREDICTED: zinc finger CCCH domain-containin...  83.2    3e-15   
ref|XP_002323312.1|  zinc finger family protein                       83.6    3e-15   
gb|KDO45407.1|  hypothetical protein CISIN_1g006944mg                 83.2    3e-15   
ref|XP_008240870.1|  PREDICTED: zinc finger CCCH domain-containin...  83.2    3e-15   



>ref|XP_009789499.1| PREDICTED: zinc finger CCCH domain-containing protein 61-like 
[Nicotiana sylvestris]
Length=430

 Score =   157 bits (396),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 96/132 (73%), Positives = 108/132 (82%), Gaps = 6/132 (5%)
 Frame = +3

Query  132  CGE-HLHKFHPSHQLFFNRKYLRDPEIPPRKLLSRRP--SGEPEMPH-MESPTKMQQEDT  299
            C E H HKFHPSHQL+ N+K LRD +IPPRKLLSRR   S +P     M+SP      DT
Sbjct  5    CAEQHHHKFHPSHQLYLNKKSLRDIDIPPRKLLSRRSNLSADPVSDMFMDSPK--SDSDT  62

Query  300  QFQKFLpynnsddddddpyssdnFRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPR  479
             FQKFLPYN+ D+DD DPYSSD+FRM+EFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPR
Sbjct  63   LFQKFLPYNSLDEDDSDPYSSDHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPR  122

Query  480  KYHYSGTVCAEF  515
            ++HYSGTVC+EF
Sbjct  123  RFHYSGTVCSEF  134



>ref|XP_009595391.1| PREDICTED: zinc finger CCCH domain-containing protein 61-like 
[Nicotiana tomentosiformis]
Length=428

 Score =   155 bits (393),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 92/130 (71%), Positives = 106/130 (82%), Gaps = 2/130 (2%)
 Frame = +3

Query  132  CGE-HLHKFHPSHQLFFNRKYLRDPEIPPRKLLSRRPSGEPE-MPHMESPTKMQQEDTQF  305
            C E H HKFHPSHQL+ N+K LRD +IPPRKLLSRR +   + +  M   +     DT F
Sbjct  5    CAEQHHHKFHPSHQLYLNKKSLRDIDIPPRKLLSRRSNLSVDPVSDMFMDSPKSDSDTLF  64

Query  306  QKFLpynnsddddddpyssdnFRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKY  485
            QKFLPYN+ D+DD DPYSSD+FRM+EFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPR++
Sbjct  65   QKFLPYNSLDEDDSDPYSSDHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRRF  124

Query  486  HYSGTVCAEF  515
            HYSGTVC+EF
Sbjct  125  HYSGTVCSEF  134



>ref|XP_004243370.1| PREDICTED: zinc finger CCCH domain-containing protein 2 [Solanum 
lycopersicum]
Length=417

 Score =   146 bits (369),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 91/136 (67%), Positives = 105/136 (77%), Gaps = 12/136 (9%)
 Frame = +3

Query  132  CGE-HLHKFHPSHQLFFNRKYLRDPEIPPRKLLSRRPSGEP------EMPHMESPTKMQQ  290
            C E H HKFHPSHQL+  +K LRD +IPPRKLLSRR +         ++  M+SP    +
Sbjct  5    CAELHHHKFHPSHQLY--KKSLRDIDIPPRKLLSRRATLSSIDHVVSDVQFMDSPK--SE  60

Query  291  EDTQFQKFL-pynnsddddddpyssdnFRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARR  467
             D QFQKFL   +  DDDD DPYSSD+FRM+EFKVRRCTRSRSHDWTDCPFAHPGEKARR
Sbjct  61   SDAQFQKFLPYNSLDDDDDADPYSSDHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARR  120

Query  468  RDPRKYHYSGTVCAEF  515
            RDPR++HYSGTVC+EF
Sbjct  121  RDPRRFHYSGTVCSEF  136



>ref|XP_011100356.1| PREDICTED: zinc finger CCCH domain-containing protein 2-like 
[Sesamum indicum]
Length=397

 Score =   143 bits (360),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 95/139 (68%), Positives = 107/139 (77%), Gaps = 9/139 (6%)
 Frame = +3

Query  114  VMGSDNCGEHLHKFHPSHQLFFNRKYLRDPEIPPRKLLSRRPSGEPEMPH-----MESPT  278
            +MGS  C E  HKFH SHQL+  +K LR+ +IPPRKLLSRR S     P      M+SP 
Sbjct  1    MMGSV-CAEQQHKFHHSHQLYLTKKSLREIDIPPRKLLSRRSSAPSPSPADMSFMMDSP-  58

Query  279  KMQQEDTQFQKFLpynnsddddddpyssdnFRMFEFKVRRCTRSRSHDWTDCPFAHPGEK  458
              + EDT F KFLP NN DDDD DPYSSD+FRM+EFKVR+C RSRSHDWTDCPFAHPGEK
Sbjct  59   --KAEDTVFSKFLPCNNLDDDDSDPYSSDHFRMYEFKVRKCNRSRSHDWTDCPFAHPGEK  116

Query  459  ARRRDPRKYHYSGTVCAEF  515
            ARRRDPR+YHYSGTVC+EF
Sbjct  117  ARRRDPRRYHYSGTVCSEF  135



>ref|XP_007149822.1| hypothetical protein PHAVU_005G101500g [Phaseolus vulgaris]
 gb|ESW21816.1| hypothetical protein PHAVU_005G101500g [Phaseolus vulgaris]
Length=391

 Score =   139 bits (350),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 83/124 (67%), Positives = 96/124 (77%), Gaps = 7/124 (6%)
 Frame = +3

Query  147  HKFHPSHQLFFNRKYLRDPEIPPRKLLSRRPSGEPEMPHMESPTKMQQEDTQFQKFLpyn  326
            HKFHPSHQ    +K LR+ +IPPRKLL+RR +    +  + S      +DT  QKFLP N
Sbjct  9    HKFHPSHQFLSPKKTLREIDIPPRKLLTRRATAACGISDLFS------DDTMLQKFLPSN  62

Query  327  nsddddddp-yssdnFRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTV  503
            N DD D+D  YSSD+FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPR+YHYSGTV
Sbjct  63   NLDDSDEDDPYSSDHFRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRRYHYSGTV  122

Query  504  CAEF  515
            C ++
Sbjct  123  CPDY  126



>ref|XP_007198967.1| hypothetical protein PRUPE_ppa015121mg [Prunus persica]
 gb|EMJ00166.1| hypothetical protein PRUPE_ppa015121mg [Prunus persica]
Length=429

 Score =   138 bits (347),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 84/140 (60%), Positives = 99/140 (71%), Gaps = 12/140 (9%)
 Frame = +3

Query  132  CGEHLHKFHPSHQLFFNRKYLRDP--EIPPRKLLSRRPSGE---PEMPHMESPTKMQQED  296
            C E  HKFHPSHQL  ++K L +   +IPPRKLL+RR   +      P M SP     ++
Sbjct  5    CAEQQHKFHPSHQLLSSKKSLHNTTIDIPPRKLLTRRTQTQDFPSSSPDMYSPRFSTADE  64

Query  297  TQFQKFLpynnsddddddpy-------ssdnFRMFEFKVRRCTRSRSHDWTDCPFAHPGE  455
               +KFLPYN + DD D+         SSD+FRMFEFKVRRCTRSRSHDWTDCPFAHPGE
Sbjct  65   ALLRKFLPYNAAADDSDEDDAHSSDPYSSDHFRMFEFKVRRCTRSRSHDWTDCPFAHPGE  124

Query  456  KARRRDPRKYHYSGTVCAEF  515
            KARRRDPR+YHYSGTVCA++
Sbjct  125  KARRRDPRRYHYSGTVCADY  144



>ref|XP_003540372.2| PREDICTED: zinc finger CCCH domain-containing protein 2-like 
[Glycine max]
Length=486

 Score =   137 bits (345),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 78/123 (63%), Positives = 90/123 (73%), Gaps = 7/123 (6%)
 Frame = +3

Query  147  HKFHPSHQLFFNRKYLRDPEIPPRKLLSRRPSGEPEMPHMESPTKMQQEDTQFQKFLpyn  326
            HKF+PSHQL   +K LR+ +IPPRKLL+RR +       +        E+T  QKFLP N
Sbjct  103  HKFYPSHQLLSPKKTLREIDIPPRKLLTRRAAA-----CVGGTDVYSSEETMLQKFLPSN  157

Query  327  nsddddddpyssdnFRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVC  506
            +SD+DD        FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPR+YHYSGTVC
Sbjct  158  DSDEDDPYSSDH--FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRRYHYSGTVC  215

Query  507  AEF  515
             E+
Sbjct  216  PEY  218



>gb|AJB84605.1| C3H zinc finger protein [Glycine max]
Length=391

 Score =   135 bits (341),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 81/131 (62%), Positives = 94/131 (72%), Gaps = 9/131 (7%)
 Frame = +3

Query  123  SDNCGEHLHKFHPSHQLFFNRKYLRDPEIPPRKLLSRRPSGEPEMPHMESPTKMQQEDTQ  302
            S  C E  HKF+PSHQL   +K LR+ +IPPRKLL+RR +           T +  E+T 
Sbjct  2    SGVCAEQ-HKFYPSHQLLSPKKTLREIDIPPRKLLTRRAA------KCVGGTDVYSEETM  54

Query  303  FQKFLpynnsddddddpyssdnFRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRK  482
             QKFLP N+SD+DD        FRMFEFKVR+CTRSRSHDWTDCPFAHPGEKARRRDPR+
Sbjct  55   QQKFLPSNDSDEDDPYSSDH--FRMFEFKVRQCTRSRSHDWTDCPFAHPGEKARRRDPRR  112

Query  483  YHYSGTVCAEF  515
            YHYSGTVC E+
Sbjct  113  YHYSGTVCPEY  123



>ref|XP_002274948.1| PREDICTED: zinc finger CCCH domain-containing protein 2 [Vitis 
vinifera]
Length=360

 Score =   134 bits (338),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 86/125 (69%), Positives = 99/125 (79%), Gaps = 6/125 (5%)
 Frame = +3

Query  147  HKFHPSHQLFFNRKYLRDPEIPPRKLLSRRPSG-EPEMPHMESPTKMQQE-DTQFQKFLp  320
            HKF  SHQLF N+K +   +IPPRKLLSRR +  E      +SP  +    +T FQKFLP
Sbjct  9    HKFFLSHQLF-NKKTI---DIPPRKLLSRRANSLESSDIFSDSPKALGAAGETLFQKFLP  64

Query  321  ynnsddddddpyssdnFRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGT  500
            +N  DDD+ DPYSSD+FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPR+YHYSGT
Sbjct  65   FNCGDDDESDPYSSDHFRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRRYHYSGT  124

Query  501  VCAEF  515
            VC+E+
Sbjct  125  VCSEY  129



>gb|KEH39169.1| zinc finger CCCH domain protein [Medicago truncatula]
Length=415

 Score =   134 bits (337),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 81/123 (66%), Positives = 96/123 (78%), Gaps = 8/123 (7%)
 Frame = +3

Query  147  HKFHPSHQLFFNRKYLRDPEIPPRKLLSRRPSGEPEMPHMESPTKMQQEDTQFQKFLpyn  326
            HKFH S+Q    +K LRD +IPPRKLL+RR        +  +   +  +DT  QKFLP+N
Sbjct  12   HKFHSSYQPLSPKKSLRDIDIPPRKLLTRR--------NTTAAVDIFSDDTILQKFLPHN  63

Query  327  nsddddddpyssdnFRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVC  506
            +SD D DDPYSSD+FRM+EFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPR++HYSGTVC
Sbjct  64   DSDSDSDDPYSSDHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRRFHYSGTVC  123

Query  507  AEF  515
             E+
Sbjct  124  PEY  126



>emb|CDP14823.1| unnamed protein product [Coffea canephora]
Length=512

 Score =   134 bits (337),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 87/128 (68%), Positives = 100/128 (78%), Gaps = 9/128 (7%)
 Frame = +3

Query  147  HKFHPSHQL-FFNRKYLRDPEIPPRKLLSRRPSGEPEMPHMESPTKM----QQEDTQFQK  311
            HKFH   QL + N+K  R+ EIPPRKLLSRR +    M H++S        + E+   QK
Sbjct  138  HKFH---QLSYLNKKSPREIEIPPRKLLSRRAAASGSM-HLDSGDMFMDSPKAEEALLQK  193

Query  312  FLpynnsddddddpyssdnFRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHY  491
            FLPYNN DDDD DPYSSD+FRM+EFKVR+CTRSRSHDWTDCPFAHPGEKARRRDPR+YHY
Sbjct  194  FLPYNNIDDDDADPYSSDHFRMYEFKVRKCTRSRSHDWTDCPFAHPGEKARRRDPRRYHY  253

Query  492  SGTVCAEF  515
            SGTVC+EF
Sbjct  254  SGTVCSEF  261



>ref|XP_007132795.1| hypothetical protein PHAVU_011G125300g [Phaseolus vulgaris]
 gb|ESW04789.1| hypothetical protein PHAVU_011G125300g [Phaseolus vulgaris]
Length=362

 Score =   131 bits (329),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 78/136 (57%), Positives = 90/136 (66%), Gaps = 16/136 (12%)
 Frame = +3

Query  123  SDNCGEHLHKFHPSHQLFFNRKYLRDPEIPPRKLLSRRPSGEPEMPHMESPTKMQQEDTQ  302
            S  C EH  +  PSHQL   +K LR+ +IPPRKLL RR + +           M  +DT 
Sbjct  2    STICSEHKFQLQPSHQLLSLKKSLREIDIPPRKLLMRRAAAD-----------MFSDDTL  50

Query  303  FQKFLpynnsddddddpy-----ssdnFRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARR  467
              K+LP   S D DD        +SD FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARR
Sbjct  51   LHKYLPNTKSMDSDDSDDVGDPYASDEFRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARR  110

Query  468  RDPRKYHYSGTVCAEF  515
            RDPR++HYSGTVC E+
Sbjct  111  RDPRRFHYSGTVCPEY  126



>gb|EPS67507.1| hypothetical protein M569_07268 [Genlisea aurea]
Length=343

 Score =   130 bits (328),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 82/134 (61%), Positives = 98/134 (73%), Gaps = 10/134 (7%)
 Frame = +3

Query  117  MGSDNCGEHLHKFHPSHQLFFNRKYLRDPEIPPRKLLSRRPSGEPEMPHMESPTKMQQED  296
            MGS  C E  HKFH SHQL  ++K LR+ +IPPRKLL RR         M +    + ED
Sbjct  1    MGSV-CAEQHHKFHSSHQLNLSKKSLREIDIPPRKLLGRRG--------MVAAAAAEVED  51

Query  297  TQFQKFLpynnsddddddp-yssdnFRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRD  473
              F KFLP N+ +++DD   YSSD+FRMFEFKVR+C RSRSHDWTDCPFAHPGEKARRRD
Sbjct  52   AAFSKFLPCNSVEEEDDSDPYSSDHFRMFEFKVRKCNRSRSHDWTDCPFAHPGEKARRRD  111

Query  474  PRKYHYSGTVCAEF  515
            PR++HYSG VC++F
Sbjct  112  PRRFHYSGNVCSDF  125



>ref|XP_004487266.1| PREDICTED: zinc finger CCCH domain-containing protein 61-like 
[Cicer arietinum]
Length=392

 Score =   131 bits (329),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 80/123 (65%), Positives = 96/123 (78%), Gaps = 12/123 (10%)
 Frame = +3

Query  147  HKFHPSHQLFFNRKYLRDPEIPPRKLLSRRPSGEPEMPHMESPTKMQQEDTQFQKFLpyn  326
            HKFH S+Q    +K LR+ +IPPRKLL+RR +             M  +DT  QKFLP+N
Sbjct  11   HKFHSSYQPLSPKKPLREIDIPPRKLLTRRTA------------DMFSDDTILQKFLPHN  58

Query  327  nsddddddpyssdnFRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVC  506
            +SD D DDPYSSD+FRM+EFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPR++HYSG+VC
Sbjct  59   DSDSDSDDPYSSDHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRRFHYSGSVC  118

Query  507  AEF  515
            +E+
Sbjct  119  SEY  121



>ref|XP_004301223.1| PREDICTED: zinc finger CCCH domain-containing protein 2-like 
[Fragaria vesca subsp. vesca]
Length=404

 Score =   130 bits (327),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 83/138 (60%), Positives = 99/138 (72%), Gaps = 9/138 (7%)
 Frame = +3

Query  123  SDNCGEHLHKFHPSHQLFFNRK---YLRDPEIPPRKLLSRRPSGEPEM---PHM-ESPTK  281
            S  C E  HKFH SH L  ++K    LR+ +IPPRKLL+RR +   ++   P M +SP  
Sbjct  2    SSVCAEQ-HKFHTSHHLLSSKKSHHLLREVDIPPRKLLTRRSAAHQDISSSPDMYDSPRF  60

Query  282  MQQEDTQFQKFLpynnsddddddpyssdnFRMFEFKVRRCTRSRSHDWTDCPFAHPGEKA  461
               ++   +KFLPYN+ DDDDD   S   FRM+EFKVRRCTRSRSHDWTDCPFAHPGEKA
Sbjct  61   SASDEAVLRKFLPYNSDDDDDDPYSSDH-FRMYEFKVRRCTRSRSHDWTDCPFAHPGEKA  119

Query  462  RRRDPRKYHYSGTVCAEF  515
            RRRDPR YHYSGTVCA++
Sbjct  120  RRRDPRCYHYSGTVCADY  137



>ref|XP_008362440.1| PREDICTED: zinc finger CCCH domain-containing protein 2-like 
[Malus domestica]
Length=439

 Score =   130 bits (326),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 87/144 (60%), Positives = 101/144 (70%), Gaps = 14/144 (10%)
 Frame = +3

Query  123  SDNCGEHLHKFHPSHQLFFNRK-YLRDP--EIPPRKLLSRR-----PSGEP-EMPHMESP  275
            S  C E  HKFHPSHQL  ++K  LRD   +IPPRKLL+RR     PS +        SP
Sbjct  2    SSVCAEQ-HKFHPSHQLLSSKKTLLRDTNIDIPPRKLLTRRSPQEFPSSDVYAAADYXSP  60

Query  276  TKMQQEDTQFQKFLpynnsddddddpy----ssdnFRMFEFKVRRCTRSRSHDWTDCPFA  443
            +    ++   +KFLPYN   DD DD      SSD+FRMFEFKVRRCTRSRSHDWTDCPFA
Sbjct  61   SFSSADEALLRKFLPYNTGSDDSDDDEVDPYSSDHFRMFEFKVRRCTRSRSHDWTDCPFA  120

Query  444  HPGEKARRRDPRKYHYSGTVCAEF  515
            HPGEKARRRDPR++HYSGTVCA++
Sbjct  121  HPGEKARRRDPRRHHYSGTVCADY  144



>ref|XP_008342887.1| PREDICTED: zinc finger CCCH domain-containing protein 2-like 
[Malus domestica]
Length=439

 Score =   129 bits (325),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 87/144 (60%), Positives = 101/144 (70%), Gaps = 14/144 (10%)
 Frame = +3

Query  123  SDNCGEHLHKFHPSHQLFFNRK-YLRDP--EIPPRKLLSRR-----PSGEP-EMPHMESP  275
            S  C E  HKFHPSHQL  ++K  LRD   +IPPRKLL+RR     PS +        SP
Sbjct  2    SSVCAEQ-HKFHPSHQLLSSKKTLLRDTNIDIPPRKLLTRRSPQEFPSSDVYAAADYRSP  60

Query  276  TKMQQEDTQFQKFLpynnsddddddpy----ssdnFRMFEFKVRRCTRSRSHDWTDCPFA  443
            +    ++   +KFLPYN   DD DD      SSD+FRMFEFKVRRCTRSRSHDWTDCPFA
Sbjct  61   SFSSADEALLRKFLPYNTGSDDSDDDEVDPYSSDHFRMFEFKVRRCTRSRSHDWTDCPFA  120

Query  444  HPGEKARRRDPRKYHYSGTVCAEF  515
            HPGEKARRRDPR++HYSGTVCA++
Sbjct  121  HPGEKARRRDPRRHHYSGTVCADY  144



>gb|KDP24097.1| hypothetical protein JCGZ_25754 [Jatropha curcas]
Length=364

 Score =   126 bits (316),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 78/135 (58%), Positives = 93/135 (69%), Gaps = 5/135 (4%)
 Frame = +3

Query  123  SDNCGEHLHKFHPSHQLFFNRKYLRDPEIPPRKLLSRRPSGE-PEMPHMESPTK---MQQ  290
            S  C E  HK +PSHQLF  +K  +D EIPPRKL S++   E P+M   +S  +   +  
Sbjct  2    STVCAEQ-HKLYPSHQLFSCKKPFKDLEIPPRKLFSKKILQENPDMSPFDSTLRKFILFN  60

Query  291  EDTQFQKFLpynnsddddddpyssdnFRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRR  470
            +         +    ++D DPYSSD+FRM+EFKVRRCTRSRSHDWTDCPFAHPGEKARRR
Sbjct  61   DSNNGDHSNSHEKLSNEDLDPYSSDHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRR  120

Query  471  DPRKYHYSGTVCAEF  515
            DPRKYHYSG VC EF
Sbjct  121  DPRKYHYSGAVCPEF  135



>ref|XP_008381588.1| PREDICTED: zinc finger CCCH domain-containing protein 2 [Malus 
domestica]
Length=436

 Score =   126 bits (316),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 82/133 (62%), Positives = 94/133 (71%), Gaps = 10/133 (8%)
 Frame = +3

Query  147  HKFHPSHQL-FFNRKYLRDP--EIPPRKLLSRRPSGEPEMPHM------ESPTKMQQEDT  299
            H FHPSHQL  F +  LRD   +IPPRKLL+RR   E     M       SP     ++ 
Sbjct  9    HNFHPSHQLQSFKKTLLRDSNTDIPPRKLLTRRSPQEFPSSDMYAAADCGSPRFSSADEA  68

Query  300  QFQKFLpynnsddddddp-yssdnFRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDP  476
              +KFLP N   DDD+   YSSD+FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDP
Sbjct  69   LVRKFLPCNTGSDDDEVDPYSSDHFRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDP  128

Query  477  RKYHYSGTVCAEF  515
            R++HYSGTVCA++
Sbjct  129  RRHHYSGTVCADY  141



>ref|XP_002517875.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF44393.1| conserved hypothetical protein [Ricinus communis]
Length=236

 Score =   121 bits (303),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 76/143 (53%), Positives = 90/143 (63%), Gaps = 18/143 (13%)
 Frame = +3

Query  123  SDNCGEHLHKFHPSHQLFFNRKYLRDPEIPPRKLLSRRPSGEPEMPHMESPTKMQQEDTQ  302
            S  C E  HK +PSH LF   K  +D +IPPRKLLS++   E     + SP      ++ 
Sbjct  2    STVCAEQ-HKLYPSHPLFSPNKSFKDLDIPPRKLLSKKTFQESSPDMLSSPF-----ESH  55

Query  303  FQKFLpynnsddddddpy------------ssdnFRMFEFKVRRCTRSRSHDWTDCPFAH  446
              KFLP N+    D++              SSD+FRM+EFKVRRCTRSRSHDWTDCPFAH
Sbjct  56   LHKFLPCNDLISSDNNHDQRGSDDQDLDPYSSDHFRMYEFKVRRCTRSRSHDWTDCPFAH  115

Query  447  PGEKARRRDPRKYHYSGTVCAEF  515
            PGEKA RRDPRKYHYSG +C EF
Sbjct  116  PGEKALRRDPRKYHYSGAICPEF  138



>ref|XP_003539940.1| PREDICTED: zinc finger CCCH domain-containing protein 2-like 
[Glycine max]
Length=356

 Score =   121 bits (304),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 77/133 (58%), Positives = 90/133 (68%), Gaps = 11/133 (8%)
 Frame = +3

Query  135  GEHLHKFHPSHQLFFNRKYLRDPEIP--PRKLLSRRPSGEPEMPHMESPTKMQQEDTQFQ  308
             EH  +  PSHQL   +K LRD +IP  PRKLL+RR +   ++        M  +DT   
Sbjct  6    SEHKFQLQPSHQLLSLKKSLRDIDIPVPPRKLLTRRSAAVHDVS-----GDMFSDDTLRH  60

Query  309  KFLpynnsddddddpy----ssdnFRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDP  476
            K+LP+N S D  DD      +SD FRMFEFKVRRCTRSRSHDWTDCPF HPGEKARRRDP
Sbjct  61   KYLPHNGSTDSSDDDSGDPYASDQFRMFEFKVRRCTRSRSHDWTDCPFVHPGEKARRRDP  120

Query  477  RKYHYSGTVCAEF  515
            R++HYS TVC EF
Sbjct  121  RRFHYSATVCPEF  133



>gb|ADL36652.1| C3HL domain class transcription factor [Malus domestica]
Length=439

 Score =   122 bits (305),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 81/136 (60%), Positives = 92/136 (68%), Gaps = 13/136 (10%)
 Frame = +3

Query  147  HKFHPSHQL-FFNRKYLRDP--EIPPRKLLSRRPSGEPEMPHM------ESPTKMQQEDT  299
            H FHPSHQL  F +  LRD   + PPRKLL+RR   E     M       SP     ++ 
Sbjct  9    HNFHPSHQLQSFKKTLLRDSNTDFPPRKLLTRRIPQEFPSSDMYAAADRGSPRFSSADEA  68

Query  300  QFQKFLpynnsddddddpy----ssdnFRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARR  467
              +KFLP N   DD DD      SSD+FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARR
Sbjct  69   LVRKFLPCNTGSDDSDDDEVDPYSSDHFRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARR  128

Query  468  RDPRKYHYSGTVCAEF  515
            RDPR++HYSGTVCA++
Sbjct  129  RDPRRHHYSGTVCADY  144



>ref|XP_011029046.1| PREDICTED: zinc finger CCCH domain-containing protein 2 [Populus 
euphratica]
Length=382

 Score =   120 bits (300),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 76/133 (57%), Positives = 91/133 (68%), Gaps = 14/133 (11%)
 Frame = +3

Query  132  CGEHLHKFHPSHQLFFNRKYLRDPEIPPRKLLSRRPSGEPEMPHMESPTKMQQEDTQFQK  311
            C E  HK +  HQL   ++ LRD EI PRKLL+++        H ES   M   +T  Q+
Sbjct  5    CAEQ-HKPYTPHQLLSPKRPLRDLEILPRKLLTKKT-------HQES-LDMSPYETNLQR  55

Query  312  FLpynnsddddddpy-----ssdnFRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDP  476
            FLPYN+  ++          SSD+FRM+EFKVRRCTRSRSHDWTDCPFAHPGEKARRRDP
Sbjct  56   FLPYNDYSNEKVVDGELDPYSSDHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDP  115

Query  477  RKYHYSGTVCAEF  515
            R++HYSGTVC EF
Sbjct  116  RRFHYSGTVCPEF  128



>ref|XP_011047672.1| PREDICTED: zinc finger CCCH domain-containing protein 2-like 
[Populus euphratica]
Length=382

 Score =   118 bits (295),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 72/128 (56%), Positives = 89/128 (70%), Gaps = 13/128 (10%)
 Frame = +3

Query  147  HKFHPSHQLFFNRKYLRDPEIPPRKLLSRRPSGEPEMPHMESPTKMQQEDTQFQKFLpyn  326
            HK +PS Q+   +K  RD EIPPR LL+R+        H E+   +   +T  Q+FLPYN
Sbjct  9    HKLYPSRQILSPKKLFRDLEIPPRTLLTRKT-------HQET-LDVSPYETNLQEFLPYN  60

Query  327  nsddddddpy-----ssdnFRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHY  491
            + +++ D        SSD+FRM+EFKVRRCTRSRSHDWTDCPFAHPGEKARRRD R++HY
Sbjct  61   DYNNEIDIDDELDPYSSDHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDLRRFHY  120

Query  492  SGTVCAEF  515
            SG VC EF
Sbjct  121  SGAVCPEF  128



>ref|XP_003526267.1| PREDICTED: zinc finger CCCH domain-containing protein 2-like 
[Glycine max]
Length=351

 Score =   117 bits (294),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 70/134 (52%), Positives = 84/134 (63%), Gaps = 22/134 (16%)
 Frame = +3

Query  138  EHLHKFHPSHQLFFNRKYLRDPEIP--PRKLLSRRP------SGEPEMPHMESPTKMQQE  293
            EH  +  PSHQL   +K L D +IP  PRKLL+RR       SG+  +PH  S      +
Sbjct  7    EHKFQLQPSHQLLSLKKSLGDIDIPVPPRKLLTRRSAAVHDGSGDIYLPHSGSTDSSTDD  66

Query  294  DTQFQKFLpynnsddddddpyssdnFRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRD  473
            D+    +              +SD FRMFEFKVRRC+RSRSHDWTDCPF HPGEKARRRD
Sbjct  67   DSDGDPY--------------ASDQFRMFEFKVRRCSRSRSHDWTDCPFVHPGEKARRRD  112

Query  474  PRKYHYSGTVCAEF  515
            PR+++YSGTVC EF
Sbjct  113  PRRFYYSGTVCPEF  126



>ref|XP_002309749.2| zinc finger family protein [Populus trichocarpa]
 gb|EEE90199.2| zinc finger family protein [Populus trichocarpa]
Length=383

 Score =   117 bits (292),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 75/129 (58%), Positives = 91/129 (71%), Gaps = 14/129 (11%)
 Frame = +3

Query  147  HKFHPSHQLFFNRK-YLRDPEIPPRKLLSRRPSGEPEMPHMESPTKMQQEDTQFQKFLpy  323
            HK  PSHQ+    K  +RD EIPPRKLL+R+        H E+   +   +T  Q+FLPY
Sbjct  9    HKLFPSHQILSPHKPLIRDLEIPPRKLLTRKT-------HQET-LDVSPYETDLQEFLPY  60

Query  324  nnsddddddpy-----ssdnFRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYH  488
            N+S+++ D        SSD+FRM+EFKVRRCTRSRSHDWTDCPFAHPGEKARRRD R++H
Sbjct  61   NDSNNEIDIDDELDPYSSDHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDLRRFH  120

Query  489  YSGTVCAEF  515
            YSG VC EF
Sbjct  121  YSGAVCPEF  129



>ref|XP_006372730.1| zinc finger family protein [Populus trichocarpa]
 gb|ERP50527.1| zinc finger family protein [Populus trichocarpa]
Length=382

 Score =   115 bits (287),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 73/133 (55%), Positives = 89/133 (67%), Gaps = 14/133 (11%)
 Frame = +3

Query  132  CGEHLHKFHPSHQLFFNRKYLRDPEIPPRKLLSRRPSGEPEMPHMESPTKMQQEDTQFQK  311
            C E  HK +  HQL   ++  RD EI P KLL+++        H E+   M   +T  Q+
Sbjct  5    CAEQ-HKPYTPHQLLSPKRPFRDLEILPGKLLTKKT-------HQET-LDMSPYETNLQR  55

Query  312  FLpynnsddddddpy-----ssdnFRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDP  476
            FLPYN+  ++          SSD+FRM+EFKVRRCTRSRSHDWTDCPFAHPGEKARRRDP
Sbjct  56   FLPYNDYSNEKVLDGELDPYSSDHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDP  115

Query  477  RKYHYSGTVCAEF  515
            R++HYSGTVC EF
Sbjct  116  RRFHYSGTVCPEF  128



>gb|EYU42142.1| hypothetical protein MIMGU_mgv1a008328mg [Erythranthe guttata]
Length=377

 Score =   114 bits (285),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 87/137 (64%), Positives = 102/137 (74%), Gaps = 4/137 (3%)
 Frame = +3

Query  114  VMGSDNCGEHLHKFHPSHQLFFN--RKYLRDPEIPPRKLLSRRPSGEPEMPHMESPTKMQ  287
            +MGS    +  HKFH SHQLF N  +K LRD +IPPRKLL RR +       + S +  +
Sbjct  1    MMGSVCAEQQQHKFHHSHQLFNNLTKKSLRDIDIPPRKLLGRRSAAAAAAGDVYSDSP-R  59

Query  288  QEDTQFQKFLpynnsddddddp-yssdnFRMFEFKVRRCTRSRSHDWTDCPFAHPGEKAR  464
             ED  F KFLPYNN+D D+DD  YSSD FR++EFKVR+C RSRSHDWTDCPFAHPGEKAR
Sbjct  60   AEDAVFSKFLPYNNADADEDDDPYSSDQFRIYEFKVRKCNRSRSHDWTDCPFAHPGEKAR  119

Query  465  RRDPRKYHYSGTVCAEF  515
            RRDPR+Y YSGTVC+EF
Sbjct  120  RRDPRRYRYSGTVCSEF  136



>ref|XP_010689060.1| PREDICTED: zinc finger CCCH domain-containing protein 2-like 
[Beta vulgaris subsp. vulgaris]
Length=403

 Score =   112 bits (280),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 71/134 (53%), Positives = 82/134 (61%), Gaps = 21/134 (16%)
 Frame = +3

Query  150  KFHPSHQLFFNRKYLRDPEIPPRKLLSRRP-SGEPEMPHMESPTKMQQEDTQFQKFLpyn  326
            KFHP   L   +K L+D  IPPRKLLSRR  + E   P  E+   +        KFLP N
Sbjct  19   KFHP---LISPKKALQDLNIPPRKLLSRRSDAAEYYSPSSEAAASL------MHKFLPCN  69

Query  327  nsddddddpy-----------ssdnFRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRD  473
                                 SSD FRM+EFKVR+CTRSRSHDWTDCPF+HPGEKARRRD
Sbjct  70   GDSSPTGGGSDDAFDPDDDPYSSDEFRMYEFKVRKCTRSRSHDWTDCPFSHPGEKARRRD  129

Query  474  PRKYHYSGTVCAEF  515
            PR++HYSGTVC E+
Sbjct  130  PRRFHYSGTVCPEY  143



>gb|KJB12469.1| hypothetical protein B456_002G020100 [Gossypium raimondii]
Length=340

 Score =   110 bits (275),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 68/123 (55%), Positives = 83/123 (67%), Gaps = 11/123 (9%)
 Frame = +3

Query  153  FHPSHQLFFNRKYLRDPEIPPRK--LLSRRPSGEPEMPHMESPTKMQQEDTQFQKFLpyn  326
            + PSH L   +   +D EIPPRK  L     +   E+PH E+         +  K+LP N
Sbjct  5    YDPSHHLTSKKLCFKDLEIPPRKKQLHCCHNAAAMELPHHEA---------RLHKYLPSN  55

Query  327  nsddddddpyssdnFRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVC  506
              DD  DDPY +D+FRM+EFKVRRCTRSRSHDWTDCPFAHPGEKARRRDP +Y YS T+C
Sbjct  56   EDDDGTDDPYGTDHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPTRYQYSSTIC  115

Query  507  AEF  515
            ++F
Sbjct  116  SDF  118



>gb|AAX20386.1| putative CCCH-type zinc finger transcription factor [Gossypium 
hirsutum]
Length=339

 Score =   110 bits (275),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 68/123 (55%), Positives = 83/123 (67%), Gaps = 11/123 (9%)
 Frame = +3

Query  153  FHPSHQLFFNRKYLRDPEIPPRK--LLSRRPSGEPEMPHMESPTKMQQEDTQFQKFLpyn  326
            + PSH L   +   +D EIPPRK  L     +   E+PH E+         +  K+LP N
Sbjct  5    YDPSHHLTSKKLCFKDLEIPPRKKQLHCCHNAAAMELPHHEA---------RLHKYLPSN  55

Query  327  nsddddddpyssdnFRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVC  506
              DD  DDPY +D+FRM+EFKVRRCTRSRSHDWTDCPFAHPGEKARRRDP +Y YS T+C
Sbjct  56   EDDDGTDDPYGTDHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPTRYQYSSTIC  115

Query  507  AEF  515
            ++F
Sbjct  116  SDF  118



>ref|XP_009397189.1| PREDICTED: zinc finger CCCH domain-containing protein 2-like 
[Musa acuminata subsp. malaccensis]
Length=304

 Score =   109 bits (273),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 71/117 (61%), Gaps = 15/117 (13%)
 Frame = +3

Query  165  HQLFFNRKYLRDPEIPPRKLLSRRPSGEPEMPHMESPTKMQQEDTQFQKFLpynnsdddd  344
            H L   +K L D ++P RKLL +RP     +P +E  +     D     +          
Sbjct  11   HHLLCEKKALSDLDLPHRKLL-QRPRLSVLLPDVEDDSGDGAVDEVVDVY----------  59

Query  345  ddpyssdnFRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
                SSD FRM+EFKVRRC R RSHDWTDCPFAHPGEKARRRDPR+YHYSG VC EF
Sbjct  60   ----SSDEFRMYEFKVRRCMRGRSHDWTDCPFAHPGEKARRRDPRRYHYSGAVCPEF  112



>ref|XP_010070036.1| PREDICTED: zinc finger CCCH domain-containing protein 2-like 
[Eucalyptus grandis]
 gb|KCW89555.1| hypothetical protein EUGRSUZ_A01839 [Eucalyptus grandis]
Length=370

 Score =   108 bits (271),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 48/49 (98%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAE+
Sbjct  64   FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEY  112



>gb|KJB84449.1| hypothetical protein B456_N026500, partial [Gossypium raimondii]
Length=245

 Score =   105 bits (261),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 66/123 (54%), Positives = 82/123 (67%), Gaps = 11/123 (9%)
 Frame = +3

Query  153  FHPSHQLFFNRKYLRDPEIPPRK--LLSRRPSGEPEMPHMESPTKMQQEDTQFQKFLpyn  326
            + P H L   +   +D EIPPRK  L     +   E+PH E+         +  K+LP N
Sbjct  5    YDPLHHLTSKKLCFKDLEIPPRKKQLHCCHNAASMELPHHEA---------RLHKYLPSN  55

Query  327  nsddddddpyssdnFRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVC  506
              DD  DDPY +D+FRM+EFKVRRCTRSRSHDWTDCPFAHPGEKARRRDP +Y YS T+C
Sbjct  56   EDDDGTDDPYGTDHFRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPIRYQYSSTIC  115

Query  507  AEF  515
            +++
Sbjct  116  SDY  118



>ref|XP_010260283.1| PREDICTED: zinc finger CCCH domain-containing protein 2-like 
[Nelumbo nucifera]
Length=388

 Score =   106 bits (265),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 87/127 (69%), Gaps = 10/127 (8%)
 Frame = +3

Query  162  SHQLFFN-RKYLRDPEIPPRKLLSRR------PSGEPEM--PHMESPTKMQQEDTQFQKF  314
            +HQ F + +K L D +    KLLSRR          P++    ME P+  ++      KF
Sbjct  8    NHQSFLSGKKGLGDIDAQSGKLLSRRVKLTVSSDTSPDLFGDAMEKPS-FEETHHLVHKF  66

Query  315  LpynnsddddddpyssdnFRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYS  494
            LPYN  DDDD DPYS+D FRM+EFKVRRC RSRSHDWTDCPFAHPGEKARRRDPR++HYS
Sbjct  67   LPYNGGDDDDSDPYSNDEFRMYEFKVRRCMRSRSHDWTDCPFAHPGEKARRRDPRRFHYS  126

Query  495  GTVCAEF  515
            G VC +F
Sbjct  127  GNVCTDF  133



>ref|XP_010943958.1| PREDICTED: zinc finger CCCH domain-containing protein 2-like 
[Elaeis guineensis]
Length=336

 Score =   103 bits (256),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 62/132 (47%), Positives = 82/132 (62%), Gaps = 14/132 (11%)
 Frame = +3

Query  144  LHKFHPSHQ--LFFNRKYLRDPEIPPRKLLSRRPSGEPEMPHMESPTKMQQEDTQFQKFL  317
            +H F    Q  L++ R  L D ++PPRK+L R     P +  +  P   Q ++ +F +  
Sbjct  1    MHAFSTEKQQLLYYGRNPLLDLDVPPRKILHR-----PGLT-IYVPDDDQDQEPKFNEEG  54

Query  318  pynnsdddd------ddpyssdnFRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPR  479
               + +++        D YS D FRM+EFKVRRC R RSHDWTDCPFAHPGEKARRRDPR
Sbjct  55   KEIDGEEEGEEEEEEVDTYSCDEFRMYEFKVRRCMRGRSHDWTDCPFAHPGEKARRRDPR  114

Query  480  KYHYSGTVCAEF  515
            +YHYSG +C +F
Sbjct  115  RYHYSGAICPDF  126



>emb|CDY36994.1| BnaC09g18100D [Brassica napus]
Length=187

 Score =   100 bits (249),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 61/104 (59%), Positives = 71/104 (68%), Gaps = 14/104 (13%)
 Frame = +3

Query  204  EIPPRKLLSRRPSGEPEMPHMESPTKMQQEDTQFQKFLpynnsddddddpyssdnFRMFE  383
            +IPPRKLLS   S     P    P    Q++  +           D DDPY+ D+FRM+E
Sbjct  17   DIPPRKLLSSAIS-----PSSPCPEDKVQKECCYDS---------DSDDPYAGDHFRMYE  62

Query  384  FKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FK+RRCTRSRSHDWTDCPFAHPGEKARRRDPR+YHY+G VC EF
Sbjct  63   FKIRRCTRSRSHDWTDCPFAHPGEKARRRDPRRYHYTGEVCPEF  106



>ref|XP_009403103.1| PREDICTED: zinc finger CCCH domain-containing protein 2-like 
[Musa acuminata subsp. malaccensis]
Length=307

 Score =   102 bits (254),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 76/117 (65%), Gaps = 12/117 (10%)
 Frame = +3

Query  165  HQLFFNRKYLRDPEIPPRKLLSRRPSGEPEMPHMESPTKMQQEDTQFQKFLpynnsdddd  344
            H+L   ++ L + ++PPR+LL +RP     +P  E   +   E +  ++           
Sbjct  10   HRLCCEKRALLNLDLPPRRLL-QRPGLSVVLPEEEDEEEDGGEGSVDEEV----------  58

Query  345  ddpyssdnFRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
             D YSSD FRM+EFKVRRC R RSHDWTDCPFAHPGEKARRRDPR+YHYSG VC +F
Sbjct  59   -DVYSSDEFRMYEFKVRRCMRGRSHDWTDCPFAHPGEKARRRDPRRYHYSGVVCPDF  114



>ref|XP_006418203.1| hypothetical protein EUTSA_v10007884mg [Eutrema salsugineum]
 gb|ESQ36556.1| hypothetical protein EUTSA_v10007884mg [Eutrema salsugineum]
Length=388

 Score =   102 bits (254),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 67/120 (56%), Positives = 73/120 (61%), Gaps = 16/120 (13%)
 Frame = +3

Query  204  EIPPRKLLSRRPSGEPEMPHMESPTKMQ----------------QEDTQFQKFLpynnsd  335
            EIPPRKLL    S   E     SP K                   ED    K +     D
Sbjct  9    EIPPRKLLLSSKSFPAESSPRSSPRKHNWNKSNKLTSEHEEDSFNEDNNNNKEVKEYCYD  68

Query  336  dddddpyssdnFRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
             D DDPY+SD+FRMFEFK+RRCTRSRSHDWTDCPFAHPGEKARRRDPR++ YSG VC EF
Sbjct  69   SDTDDPYASDHFRMFEFKIRRCTRSRSHDWTDCPFAHPGEKARRRDPRRFQYSGEVCPEF  128



>emb|CDY13114.1| BnaA09g17030D [Brassica napus]
Length=375

 Score =   102 bits (253),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 61/104 (59%), Positives = 71/104 (68%), Gaps = 14/104 (13%)
 Frame = +3

Query  204  EIPPRKLLSRRPSGEPEMPHMESPTKMQQEDTQFQKFLpynnsddddddpyssdnFRMFE  383
            +IPPRKLLS   S     P    P    Q++  +           D DDPY+ D+FRM+E
Sbjct  17   DIPPRKLLSSAIS-----PSSPCPEYKAQKECCYDS---------DSDDPYAGDHFRMYE  62

Query  384  FKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FK+RRCTRSRSHDWTDCPFAHPGEKARRRDPR+YHY+G VC EF
Sbjct  63   FKIRRCTRSRSHDWTDCPFAHPGEKARRRDPRRYHYTGEVCPEF  106



>ref|XP_004136841.1| PREDICTED: zinc finger CCCH domain-containing protein 2-like 
[Cucumis sativus]
 ref|XP_004155466.1| PREDICTED: zinc finger CCCH domain-containing protein 2-like 
[Cucumis sativus]
 gb|KGN43643.1| hypothetical protein Csa_7G049250 [Cucumis sativus]
Length=388

 Score =   102 bits (253),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 44/49 (90%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRM+EFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPR++HYSGT+C EF
Sbjct  86   FRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRRFHYSGTMCPEF  134



>ref|XP_008455280.1| PREDICTED: zinc finger CCCH domain-containing protein 2-like 
[Cucumis melo]
Length=337

 Score =   101 bits (252),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 44/49 (90%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRM+EFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPR++HYSGT+C EF
Sbjct  40   FRMYEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRRFHYSGTMCPEF  88



>ref|XP_006447247.1| hypothetical protein CICLE_v10015314mg [Citrus clementina]
 ref|XP_006469930.1| PREDICTED: zinc finger CCCH domain-containing protein 2-like 
[Citrus sinensis]
 gb|ESR60487.1| hypothetical protein CICLE_v10015314mg [Citrus clementina]
Length=429

 Score =   101 bits (252),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 42/49 (86%), Positives = 47/49 (96%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRM+EFK+RRCTRSRSHDWTDCPFAHP EKARRRDPR+YHYSG VC+E+
Sbjct  107  FRMYEFKIRRCTRSRSHDWTDCPFAHPSEKARRRDPRRYHYSGAVCSEY  155



>ref|XP_010526073.1| PREDICTED: zinc finger CCCH domain-containing protein 23 [Tarenaya 
hassleriana]
Length=350

 Score =   100 bits (250),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 44/49 (90%), Positives = 47/49 (96%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRM+EFKVRRC+RSRSHDWT+CPFAHPGEKARRRDPRKYHYSGT C EF
Sbjct  84   FRMYEFKVRRCSRSRSHDWTECPFAHPGEKARRRDPRKYHYSGTACPEF  132



>emb|CDX89867.1| BnaA10g02150D [Brassica napus]
Length=390

 Score =   100 bits (250),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 66/123 (54%), Positives = 74/123 (60%), Gaps = 19/123 (15%)
 Frame = +3

Query  204  EIPPRKLLSRRPSGEPEMPHMESPTK-------------------MQQEDTQFQKFLpyn  326
            EIPPRKLL    S   E     SP K                     +++T   K     
Sbjct  9    EIPPRKLLLSSKSFSGEASPRSSPRKHNWNNKSNKISTSEQGEDSFNEDNTNNNKDTKEY  68

Query  327  nsddddddpyssdnFRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVC  506
              D D DDPY+SD+FRMFEFK+RRCTRSRSHDWTDCPFAHPGEKARRRDPR++ YSG VC
Sbjct  69   CYDSDTDDPYASDHFRMFEFKIRRCTRSRSHDWTDCPFAHPGEKARRRDPRRFQYSGEVC  128

Query  507  AEF  515
             EF
Sbjct  129  PEF  131



>gb|KDO42121.1| hypothetical protein CISIN_1g036437mg [Citrus sinensis]
Length=431

 Score =   101 bits (251),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 42/49 (86%), Positives = 47/49 (96%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRM+EFK+RRCTRSRSHDWTDCPFAHP EKARRRDPR+YHYSG VC+E+
Sbjct  109  FRMYEFKIRRCTRSRSHDWTDCPFAHPSEKARRRDPRRYHYSGAVCSEY  157



>ref|XP_009119364.1| PREDICTED: zinc finger CCCH domain-containing protein 2-like 
[Brassica rapa]
Length=390

 Score =   100 bits (250),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 66/123 (54%), Positives = 74/123 (60%), Gaps = 19/123 (15%)
 Frame = +3

Query  204  EIPPRKLLSRRPSGEPEMPHMESPTK-------------------MQQEDTQFQKFLpyn  326
            EIPPRKLL    S   E     SP K                     +++T   K     
Sbjct  9    EIPPRKLLLSSKSFSGEASPRSSPRKHNWNNKSNKISTSEQGEDSFNEDNTNNNKDTKEY  68

Query  327  nsddddddpyssdnFRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVC  506
              D D DDPY+SD+FRMFEFK+RRCTRSRSHDWTDCPFAHPGEKARRRDPR++ YSG VC
Sbjct  69   CYDSDTDDPYASDHFRMFEFKIRRCTRSRSHDWTDCPFAHPGEKARRRDPRRFQYSGEVC  128

Query  507  AEF  515
             EF
Sbjct  129  PEF  131



>ref|XP_009113932.1| PREDICTED: zinc finger CCCH domain-containing protein 61 [Brassica 
rapa]
Length=377

 Score =   100 bits (249),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 54/104 (52%), Positives = 65/104 (63%), Gaps = 14/104 (13%)
 Frame = +3

Query  204  EIPPRKLLSRRPSGEPEMPHMESPTKMQQEDTQFQKFLpynnsddddddpyssdnFRMFE  383
            +IPPRKLLS   S     P  ++      +      +              + D+FRM+E
Sbjct  17   DIPPRKLLSSAVSPSSPCPEDKAQKDCCYDSDSDDPY--------------AGDHFRMYE  62

Query  384  FKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FK+RRCTRSRSHDWTDCPFAHPGEKARRRDPR+YHY+G VC EF
Sbjct  63   FKIRRCTRSRSHDWTDCPFAHPGEKARRRDPRRYHYTGEVCPEF  106



>ref|XP_010097108.1| Zinc finger CCCH domain-containing protein 49 [Morus notabilis]
 gb|EXB66909.1| Zinc finger CCCH domain-containing protein 49 [Morus notabilis]
Length=347

 Score =   100 bits (249),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 44/49 (90%), Positives = 46/49 (94%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRMFEFKVRRC R RSHDWT+CPFAHPGEKARRRDPRK+HYSGT CAEF
Sbjct  96   FRMFEFKVRRCARGRSHDWTECPFAHPGEKARRRDPRKHHYSGTACAEF  144



>ref|XP_010417368.1| PREDICTED: zinc finger CCCH domain-containing protein 23-like 
[Camelina sativa]
Length=304

 Score = 99.8 bits (247),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 51/85 (60%), Positives = 61/85 (72%), Gaps = 0/85 (0%)
 Frame = +3

Query  261  HMESPTKMQQEDTQFQKFLpynnsddddddpyssdnFRMFEFKVRRCTRSRSHDWTDCPF  440
            H  SP+      T   ++LP N   +D D+   +D FRM+EFK+RRC R RSHDWT+CPF
Sbjct  40   HPHSPSPFLDSFTSLYRYLPSNELTNDSDESSLTDEFRMYEFKIRRCARGRSHDWTECPF  99

Query  441  AHPGEKARRRDPRKYHYSGTVCAEF  515
            AHPGEKARRRDPRK+HYSGT C EF
Sbjct  100  AHPGEKARRRDPRKFHYSGTACPEF  124



>emb|CDX82728.1| BnaC07g01380D [Brassica napus]
Length=351

 Score = 99.8 bits (247),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 43/49 (88%), Positives = 46/49 (94%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRM+EFKVRRCTR RSHDWT+CP+AHPGEKARRRDPRKYHYSGT C EF
Sbjct  78   FRMYEFKVRRCTRGRSHDWTECPYAHPGEKARRRDPRKYHYSGTACPEF  126



>ref|XP_010556843.1| PREDICTED: zinc finger CCCH domain-containing protein 2 [Tarenaya 
hassleriana]
Length=399

 Score = 99.8 bits (247),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 61/111 (55%), Positives = 74/111 (67%), Gaps = 7/111 (6%)
 Frame = +3

Query  204  EIPPRKLL--SRRPSGEPEMPHMESPTKMQQ-----EDTQFQKFLpynnsddddddpyss  362
            EIPPRKLL  ++  +  P   H  +  K  +      D+           D D DDPY++
Sbjct  20   EIPPRKLLLSAKTAAASPGREHKLNWNKTNKIPTTDHDSHSDNDSREYCYDSDSDDPYAA  79

Query  363  dnFRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            D+FRM+EFK+RRCTRSRSHDWTDCPFAHPGEKARRRDPR+Y YSG VC E+
Sbjct  80   DHFRMYEFKIRRCTRSRSHDWTDCPFAHPGEKARRRDPRRYSYSGEVCPEY  130



>ref|XP_009102134.1| PREDICTED: zinc finger CCCH domain-containing protein 20 [Brassica 
rapa]
Length=357

 Score = 99.8 bits (247),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 43/49 (88%), Positives = 46/49 (94%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRM+EFKVRRCTR RSHDWT+CP+AHPGEKARRRDPRKYHYSGT C EF
Sbjct  78   FRMYEFKVRRCTRGRSHDWTECPYAHPGEKARRRDPRKYHYSGTACPEF  126



>ref|XP_010429604.1| PREDICTED: zinc finger CCCH domain-containing protein 23-like 
[Camelina sativa]
Length=306

 Score = 99.4 bits (246),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 51/85 (60%), Positives = 61/85 (72%), Gaps = 0/85 (0%)
 Frame = +3

Query  261  HMESPTKMQQEDTQFQKFLpynnsddddddpyssdnFRMFEFKVRRCTRSRSHDWTDCPF  440
            H  SP+      T   ++LP N   +D D+   +D F M+EFK+RRC RSRSHDWT+CPF
Sbjct  41   HPHSPSPFLDSFTSLYRYLPSNELTNDSDESSLTDEFHMYEFKIRRCARSRSHDWTECPF  100

Query  441  AHPGEKARRRDPRKYHYSGTVCAEF  515
            AHPGEKARRRDPRK+HYSGT C EF
Sbjct  101  AHPGEKARRRDPRKFHYSGTACPEF  125



>ref|XP_011459526.1| PREDICTED: zinc finger CCCH domain-containing protein 20 [Fragaria 
vesca subsp. vesca]
Length=400

 Score = 99.8 bits (247),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 43/49 (88%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRMFEFKVRRC R RSHDWTDCPFAHPGEKARRRDPRK+HYSGT C +F
Sbjct  98   FRMFEFKVRRCARGRSHDWTDCPFAHPGEKARRRDPRKFHYSGTACPDF  146



>gb|AGL40443.1| C3H-type zinc finger protein [Glycine max]
Length=353

 Score = 99.4 bits (246),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 43/49 (88%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRMFEFKVRRC R RSHDWTDCP+AHPGEKARRRDPRKYHYSGT C +F
Sbjct  75   FRMFEFKVRRCARCRSHDWTDCPYAHPGEKARRRDPRKYHYSGTACPDF  123



>ref|XP_003607493.1| Zinc finger CCCH domain-containing protein [Medicago truncatula]
 gb|AES89690.1| zinc finger C-x8-C-x5-C-x3-H type family protein [Medicago truncatula]
Length=317

 Score = 99.0 bits (245),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 54/104 (52%), Positives = 64/104 (62%), Gaps = 23/104 (22%)
 Frame = +3

Query  204  EIPPRKLLSRRPSGEPEMPHMESPTKMQQEDTQFQKFLpynnsddddddpyssdnFRMFE  383
             IPPRKLL+RR       P   + T M  ++  F                   D+FRM+E
Sbjct  29   NIPPRKLLTRRS------PTTTAVTDMFSDEDPFSS-----------------DHFRMYE  65

Query  384  FKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FK+RRCTRSRSHDWTDCPFAHPGEKARRRDP +Y YSG VC ++
Sbjct  66   FKIRRCTRSRSHDWTDCPFAHPGEKARRRDPLRYQYSGEVCPDY  109



>ref|XP_003525299.1| PREDICTED: zinc finger CCCH domain-containing protein 20-like 
[Glycine max]
Length=353

 Score = 99.4 bits (246),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 43/49 (88%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRMFEFKVRRC R RSHDWTDCP+AHPGEKARRRDPRKYHYSGT C +F
Sbjct  75   FRMFEFKVRRCARCRSHDWTDCPYAHPGEKARRRDPRKYHYSGTACPDF  123



>ref|XP_004960911.1| PREDICTED: zinc finger CCCH domain-containing protein 35-like 
[Setaria italica]
Length=390

 Score = 99.4 bits (246),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 41/49 (84%), Positives = 46/49 (94%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRM+EFKVRRC+R RSHDWTDCP+AHPGEKARRRDPR+YHYSGT C +F
Sbjct  69   FRMYEFKVRRCSRGRSHDWTDCPYAHPGEKARRRDPRRYHYSGTACPDF  117



>emb|CDY35891.1| BnaA07g00960D [Brassica napus]
Length=324

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 43/49 (88%), Positives = 46/49 (94%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRM+EFKVRRCTR RSHDWT+CP+AHPGEKARRRDPRKYHYSGT C EF
Sbjct  78   FRMYEFKVRRCTRGRSHDWTECPYAHPGEKARRRDPRKYHYSGTACPEF  126



>ref|NP_001042276.1| Os01g0192000 [Oryza sativa Japonica Group]
 sp|Q9FU27.1|C3H2_ORYSJ RecName: Full=Zinc finger CCCH domain-containing protein 2; Short=OsC3H2; 
AltName: Full=Protein DELAY OF THE ONSET OF SENESCENCE; 
Short=OsDOS [Oryza sativa Japonica Group]
 dbj|BAB12694.1| CCCH-type zinc finger protein -like [Oryza sativa Japonica Group]
 dbj|BAF04190.1| Os01g0192000 [Oryza sativa Japonica Group]
 dbj|BAG94757.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|ADX60249.1| C3H transcription factor [Oryza sativa Japonica Group]
Length=386

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 42/49 (86%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRM+EFKVRRC R RSHDWT+CPFAHPGEKARRRDPRKYHYSGT C +F
Sbjct  77   FRMYEFKVRRCARGRSHDWTECPFAHPGEKARRRDPRKYHYSGTACPDF  125



>gb|EAY72862.1| hypothetical protein OsI_00733 [Oryza sativa Indica Group]
Length=386

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 42/49 (86%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRM+EFKVRRC R RSHDWT+CPFAHPGEKARRRDPRKYHYSGT C +F
Sbjct  77   FRMYEFKVRRCARGRSHDWTECPFAHPGEKARRRDPRKYHYSGTACPDF  125



>ref|XP_006403122.1| hypothetical protein EUTSA_v10003231mg [Eutrema salsugineum]
 gb|ESQ44575.1| hypothetical protein EUTSA_v10003231mg [Eutrema salsugineum]
Length=377

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 42/49 (86%), Positives = 47/49 (96%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRM+EFK+RRCTRSRSHDWTDCPF+HPGEKARRRDPR+YHY+G VC EF
Sbjct  55   FRMYEFKIRRCTRSRSHDWTDCPFSHPGEKARRRDPRRYHYTGEVCPEF  103



>ref|XP_009101727.1| PREDICTED: zinc finger CCCH domain-containing protein 61-like 
[Brassica rapa]
Length=378

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 42/49 (86%), Positives = 47/49 (96%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRM+EFK+RRCTRSRSHDWTDCPF+HPGEKARRRDPR+YHY+G VC EF
Sbjct  61   FRMYEFKIRRCTRSRSHDWTDCPFSHPGEKARRRDPRRYHYTGEVCPEF  109



>emb|CDX94766.1| BnaC07g17750D [Brassica napus]
Length=380

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 42/49 (86%), Positives = 47/49 (96%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRM+EFK+RRCTRSRSHDWTDCPF+HPGEKARRRDPR+YHY+G VC EF
Sbjct  61   FRMYEFKIRRCTRSRSHDWTDCPFSHPGEKARRRDPRRYHYTGDVCPEF  109



>gb|KFK42723.1| zinc finger ccch domain-containing protein 2-like [Arabis alpina]
Length=393

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 67/122 (55%), Positives = 75/122 (61%), Gaps = 18/122 (15%)
 Frame = +3

Query  204  EIPPRKLLSRRPSGEPEMPHMESP---------TKMQQEDTQFQKF---------Lpynn  329
            EIPPRKLL    S   E     SP          K+ + D Q   F         +    
Sbjct  9    EIPPRKLLLSSKSFPGESSPRSSPRKHNWNNKIIKISEHDHQEDGFNDENNNKKEVKEYC  68

Query  330  sddddddpyssdnFRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCA  509
             D D DDPY+SD+FRMFEFK+RRCTRSRSHDWTDCPFAHPGEKARRRDPR++ YSG VC 
Sbjct  69   YDSDTDDPYASDHFRMFEFKIRRCTRSRSHDWTDCPFAHPGEKARRRDPRRFQYSGEVCP  128

Query  510  EF  515
            EF
Sbjct  129  EF  130



>ref|XP_010086901.1| Zinc finger CCCH domain-containing protein 49 [Morus notabilis]
 gb|EXB24692.1| Zinc finger CCCH domain-containing protein 49 [Morus notabilis]
Length=387

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 42/49 (86%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRMFEFKVRRC R RSHDWT+CP+AHPGEKARRRDPRKYHYSGT C +F
Sbjct  97   FRMFEFKVRRCARGRSHDWTECPYAHPGEKARRRDPRKYHYSGTACPDF  145



>ref|XP_008452695.1| PREDICTED: zinc finger CCCH domain-containing protein 20-like 
[Cucumis melo]
Length=351

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 42/49 (86%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRMFEFK+RRC R RSHDWT+CP+AHPGEKARRRDPRKYHYSGT C EF
Sbjct  77   FRMFEFKIRRCARGRSHDWTECPYAHPGEKARRRDPRKYHYSGTACPEF  125



>ref|XP_007204367.1| hypothetical protein PRUPE_ppa007297mg [Prunus persica]
 gb|EMJ05566.1| hypothetical protein PRUPE_ppa007297mg [Prunus persica]
Length=374

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 42/49 (86%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRMFEFKVRRC R RSHDWT+CP+AHPGEKARRRDPRKYHYSGT C +F
Sbjct  97   FRMFEFKVRRCARGRSHDWTECPYAHPGEKARRRDPRKYHYSGTACPDF  145



>ref|XP_004141305.1| PREDICTED: zinc finger CCCH domain-containing protein 49-like 
[Cucumis sativus]
 ref|XP_004167716.1| PREDICTED: zinc finger CCCH domain-containing protein 49-like 
[Cucumis sativus]
Length=349

 Score = 98.6 bits (244),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 42/49 (86%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRMFEFK+RRC R RSHDWT+CP+AHPGEKARRRDPRKYHYSGT C EF
Sbjct  77   FRMFEFKIRRCARGRSHDWTECPYAHPGEKARRRDPRKYHYSGTACPEF  125



>emb|CDY22300.1| BnaA06g36220D [Brassica napus]
Length=391

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 42/49 (86%), Positives = 47/49 (96%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRM+EFK+RRCTRSRSHDWTDCPF+HPGEKARRRDPR+YHY+G VC EF
Sbjct  61   FRMYEFKIRRCTRSRSHDWTDCPFSHPGEKARRRDPRRYHYTGEVCPEF  109



>ref|XP_008337620.1| PREDICTED: zinc finger CCCH domain-containing protein 20-like 
[Malus domestica]
Length=397

 Score = 99.0 bits (245),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 42/49 (86%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRMFEFKVRRC R RSHDWT+CP+AHPGEKARRRDPRKYHYSGT C +F
Sbjct  97   FRMFEFKVRRCARGRSHDWTECPYAHPGEKARRRDPRKYHYSGTACPDF  145



>gb|KDP33764.1| hypothetical protein JCGZ_07335 [Jatropha curcas]
Length=387

 Score = 98.6 bits (244),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 42/49 (86%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRMFEFKVRRC R RSHDWT+CP+AHPGEKARRRDPRKYHYSGT C +F
Sbjct  93   FRMFEFKVRRCARGRSHDWTECPYAHPGEKARRRDPRKYHYSGTACPDF  141



>ref|NP_171875.1| CCCH-type zinc finger protein SOMNUS [Arabidopsis thaliana]
 sp|Q9ZWA1.1|C3H2_ARATH RecName: Full=Zinc finger CCCH domain-containing protein 2; Short=AtC3H2; 
AltName: Full=Protein SOMNUS; Short=SOM [Arabidopsis 
thaliana]
 gb|AAD10689.1| Hypothetical protein [Arabidopsis thaliana]
 gb|AEE27614.1| CCCH-type zinc finger protein SOMNUS [Arabidopsis thaliana]
Length=393

 Score = 98.6 bits (244),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 43/49 (88%), Positives = 46/49 (94%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRMFEFK+RRCTRSRSHDWTDCPFAHPGEKARRRDPR++ YSG VC EF
Sbjct  83   FRMFEFKIRRCTRSRSHDWTDCPFAHPGEKARRRDPRRFQYSGEVCPEF  131



>dbj|BAC41895.1| unknown protein [Arabidopsis thaliana]
 gb|AAO63406.1| At1g03790 [Arabidopsis thaliana]
Length=393

 Score = 98.6 bits (244),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 43/49 (88%), Positives = 46/49 (94%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRMFEFK+RRCTRSRSHDWTDCPFAHPGEKARRRDPR++ YSG VC EF
Sbjct  83   FRMFEFKIRRCTRSRSHDWTDCPFAHPGEKARRRDPRRFQYSGEVCPEF  131



>ref|XP_008242454.1| PREDICTED: zinc finger CCCH domain-containing protein 20-like 
[Prunus mume]
Length=397

 Score = 98.6 bits (244),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 42/49 (86%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRMFEFKVRRC R RSHDWT+CP+AHPGEKARRRDPRKYHYSGT C +F
Sbjct  97   FRMFEFKVRRCARGRSHDWTECPYAHPGEKARRRDPRKYHYSGTACPDF  145



>ref|XP_009352588.1| PREDICTED: zinc finger CCCH domain-containing protein 20-like 
[Pyrus x bretschneideri]
Length=389

 Score = 98.6 bits (244),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 42/49 (86%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRMFEFKVRRC R RSHDWT+CP+AHPGEKARRRDPRKYHYSGT C +F
Sbjct  97   FRMFEFKVRRCARGRSHDWTECPYAHPGEKARRRDPRKYHYSGTACPDF  145



>ref|XP_010475007.1| PREDICTED: zinc finger CCCH domain-containing protein 2-like 
isoform X2 [Camelina sativa]
Length=361

 Score = 98.2 bits (243),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 43/49 (88%), Positives = 46/49 (94%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRMFEFK+RRCTRSRSHDWTDCPFAHPGEKARRRDPR++ YSG VC EF
Sbjct  88   FRMFEFKIRRCTRSRSHDWTDCPFAHPGEKARRRDPRRFQYSGEVCPEF  136



>ref|XP_010482518.1| PREDICTED: zinc finger CCCH domain-containing protein 2-like 
[Camelina sativa]
Length=399

 Score = 98.6 bits (244),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 43/49 (88%), Positives = 46/49 (94%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRMFEFK+RRCTRSRSHDWTDCPFAHPGEKARRRDPR++ YSG VC EF
Sbjct  88   FRMFEFKIRRCTRSRSHDWTDCPFAHPGEKARRRDPRRFQYSGEVCPEF  136



>ref|XP_002455022.1| hypothetical protein SORBIDRAFT_03g003110 [Sorghum bicolor]
 gb|EES00142.1| hypothetical protein SORBIDRAFT_03g003110 [Sorghum bicolor]
Length=350

 Score = 98.2 bits (243),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 42/49 (86%), Positives = 46/49 (94%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRM+EFKVRRC R+RSHDWT+CPFAHPGEKARRRDPRKYHYSGT C +F
Sbjct  44   FRMYEFKVRRCARARSHDWTECPFAHPGEKARRRDPRKYHYSGTACPDF  92



>ref|XP_004505556.1| PREDICTED: zinc finger CCCH domain-containing protein 61-like 
[Cicer arietinum]
Length=331

 Score = 98.2 bits (243),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 54/102 (53%), Positives = 59/102 (58%), Gaps = 27/102 (26%)
 Frame = +3

Query  210  PPRKLLSRRPSGEPEMPHMESPTKMQQEDTQFQKFLpynnsddddddpyssdnFRMFEFK  389
            PPRKLL+RR      +P  E P    Q                          FRM+EFK
Sbjct  32   PPRKLLARRQPAADMLPD-EDPYSSDQ--------------------------FRMYEFK  64

Query  390  VRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            VRRCTRSRSHDWTDCPFAHPGEKARRRDP KY YSG VC ++
Sbjct  65   VRRCTRSRSHDWTDCPFAHPGEKARRRDPLKYQYSGEVCPDY  106



>ref|XP_002889476.1| zinc finger (CCCH-type) family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65735.1| zinc finger (CCCH-type) family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=396

 Score = 98.6 bits (244),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 43/49 (88%), Positives = 46/49 (94%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRMFEFK+RRCTRSRSHDWTDCPFAHPGEKARRRDPR++ YSG VC EF
Sbjct  86   FRMFEFKIRRCTRSRSHDWTDCPFAHPGEKARRRDPRRFQYSGEVCPEF  134



>ref|XP_010457395.1| PREDICTED: zinc finger CCCH domain-containing protein 2 [Camelina 
sativa]
Length=398

 Score = 98.6 bits (244),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 43/49 (88%), Positives = 46/49 (94%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRMFEFK+RRCTRSRSHDWTDCPFAHPGEKARRRDPR++ YSG VC EF
Sbjct  88   FRMFEFKIRRCTRSRSHDWTDCPFAHPGEKARRRDPRRFQYSGEVCPEF  136



>gb|AGT16143.1| nucleic acid binding protein [Saccharum hybrid cultivar R570]
Length=387

 Score = 98.6 bits (244),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 42/49 (86%), Positives = 46/49 (94%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRM+EFKVRRC R+RSHDWT+CPFAHPGEKARRRDPRKYHYSGT C +F
Sbjct  77   FRMYEFKVRRCARARSHDWTECPFAHPGEKARRRDPRKYHYSGTACPDF  125



>ref|XP_007012951.1| Zinc finger C-x8-C-x5-C-x3-H type family protein, putative [Theobroma 
cacao]
 gb|EOY30570.1| Zinc finger C-x8-C-x5-C-x3-H type family protein, putative [Theobroma 
cacao]
Length=404

 Score = 98.6 bits (244),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 42/49 (86%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRMFEFKVRRC R RSHDWT+CP+AHPGEKARRRDPRKYHYSGT C +F
Sbjct  93   FRMFEFKVRRCARGRSHDWTECPYAHPGEKARRRDPRKYHYSGTACPDF  141



>ref|XP_010475006.1| PREDICTED: zinc finger CCCH domain-containing protein 2-like 
isoform X1 [Camelina sativa]
Length=398

 Score = 98.6 bits (244),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 43/49 (88%), Positives = 46/49 (94%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRMFEFK+RRCTRSRSHDWTDCPFAHPGEKARRRDPR++ YSG VC EF
Sbjct  88   FRMFEFKIRRCTRSRSHDWTDCPFAHPGEKARRRDPRRFQYSGEVCPEF  136



>ref|XP_003530556.1| PREDICTED: zinc finger CCCH domain-containing protein 20-like 
[Glycine max]
Length=355

 Score = 98.2 bits (243),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 42/49 (86%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRMFEFKVRRC R RSHDWT+CP+AHPGEKARRRDPRKYHYSGT C +F
Sbjct  75   FRMFEFKVRRCARGRSHDWTECPYAHPGEKARRRDPRKYHYSGTACPDF  123



>gb|ACU23866.1| unknown [Glycine max]
Length=355

 Score = 98.2 bits (243),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 42/49 (86%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRMFEFKVRRC R RSHDWT+CP+AHPGEKARRRDPRKYHYSGT C +F
Sbjct  75   FRMFEFKVRRCARGRSHDWTECPYAHPGEKARRRDPRKYHYSGTACPDF  123



>gb|KJB54323.1| hypothetical protein B456_009G029300 [Gossypium raimondii]
Length=367

 Score = 98.2 bits (243),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 41/49 (84%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRM+EFKVRRC R R+HDWTDCP+AHPGEKARRRDPRKYHYSGT C +F
Sbjct  92   FRMYEFKVRRCGRGRAHDWTDCPYAHPGEKARRRDPRKYHYSGTACTDF  140



>ref|XP_007160259.1| hypothetical protein PHAVU_002G306100g [Phaseolus vulgaris]
 gb|ESW32253.1| hypothetical protein PHAVU_002G306100g [Phaseolus vulgaris]
Length=359

 Score = 98.2 bits (243),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 42/49 (86%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRMFEFKVRRC R RSHDWT+CP+AHPGEKARRRDPRKYHYSGT C +F
Sbjct  81   FRMFEFKVRRCARGRSHDWTECPYAHPGEKARRRDPRKYHYSGTACPDF  129



>emb|CDY18184.1| BnaC05g02070D [Brassica napus]
Length=394

 Score = 98.2 bits (243),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 43/49 (88%), Positives = 46/49 (94%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRMFEFK+RRCTRSRSHDWTDCPFAHPGEKARRRDPR++ YSG VC EF
Sbjct  87   FRMFEFKIRRCTRSRSHDWTDCPFAHPGEKARRRDPRRFQYSGEVCPEF  135



>ref|XP_004135688.1| PREDICTED: zinc finger CCCH domain-containing protein 49-like 
[Cucumis sativus]
Length=382

 Score = 98.2 bits (243),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 41/49 (84%), Positives = 46/49 (94%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FR+FEFKVR+CTR RSHDWT+CP+AHPGEKARRRDPRKYHYSGT C +F
Sbjct  95   FRIFEFKVRKCTRGRSHDWTECPYAHPGEKARRRDPRKYHYSGTACPDF  143



>gb|ADL36656.1| C3HL domain class transcription factor [Malus domestica]
Length=369

 Score = 98.2 bits (243),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 42/49 (86%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRMFEFKVRRC R RSHDWTDCP+AHPGEKARRRDPRKYHYSG  C +F
Sbjct  91   FRMFEFKVRRCARGRSHDWTDCPYAHPGEKARRRDPRKYHYSGAACPDF  139



>dbj|BAJ34229.1| unnamed protein product [Thellungiella halophila]
Length=359

 Score = 97.8 bits (242),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 42/49 (86%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRMFEFKVRRC R RSHDWT+CP+AHPGEKARRRDPRKYHYSGT C +F
Sbjct  78   FRMFEFKVRRCARGRSHDWTECPYAHPGEKARRRDPRKYHYSGTACPDF  126



>ref|XP_002440755.1| hypothetical protein SORBIDRAFT_09g006050 [Sorghum bicolor]
 gb|EES19185.1| hypothetical protein SORBIDRAFT_09g006050 [Sorghum bicolor]
Length=399

 Score = 98.2 bits (243),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 40/49 (82%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRM+EFKVRRC+R RSHDWTDCP+AHPGEKARRRDPR+YHYSG  C +F
Sbjct  73   FRMYEFKVRRCSRGRSHDWTDCPYAHPGEKARRRDPRRYHYSGAACPDF  121



>ref|XP_006408900.1| hypothetical protein EUTSA_v10002026mg [Eutrema salsugineum]
 gb|ESQ50353.1| hypothetical protein EUTSA_v10002026mg [Eutrema salsugineum]
Length=359

 Score = 97.8 bits (242),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 42/49 (86%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRMFEFKVRRC R RSHDWT+CP+AHPGEKARRRDPRKYHYSGT C +F
Sbjct  78   FRMFEFKVRRCARGRSHDWTECPYAHPGEKARRRDPRKYHYSGTACPDF  126



>gb|AGL76984.1| zinc finger CCCH domain-containing protein [Cucumis melo]
Length=385

 Score = 98.2 bits (243),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 41/49 (84%), Positives = 46/49 (94%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FR+FEFKVR+CTR RSHDWT+CP+AHPGEKARRRDPRKYHYSGT C +F
Sbjct  98   FRIFEFKVRKCTRGRSHDWTECPYAHPGEKARRRDPRKYHYSGTACPDF  146



>gb|ACO54858.1| zinc finger protein ZF3 [Cicer arietinum]
Length=385

 Score = 98.2 bits (243),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 41/49 (84%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRMFEFK+RRC R RSHDWT+CP+AHPGEKARRRDPRKYHYSGT C +F
Sbjct  85   FRMFEFKIRRCARGRSHDWTECPYAHPGEKARRRDPRKYHYSGTACPDF  133



>ref|XP_009361457.1| PREDICTED: zinc finger CCCH domain-containing protein 23-like 
[Pyrus x bretschneideri]
Length=373

 Score = 97.8 bits (242),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 42/49 (86%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRMFEFKVRRC R RSHDWTDCP+AHPGEKARRRDPRKYHYSG  C +F
Sbjct  91   FRMFEFKVRRCARGRSHDWTDCPYAHPGEKARRRDPRKYHYSGAACPDF  139



>ref|XP_008450813.1| PREDICTED: zinc finger CCCH domain-containing protein 49-like 
[Cucumis melo]
Length=382

 Score = 97.8 bits (242),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 41/49 (84%), Positives = 46/49 (94%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FR+FEFKVR+CTR RSHDWT+CP+AHPGEKARRRDPRKYHYSGT C +F
Sbjct  95   FRIFEFKVRKCTRGRSHDWTECPYAHPGEKARRRDPRKYHYSGTACPDF  143



>ref|XP_006304480.1| hypothetical protein CARUB_v10011207mg [Capsella rubella]
 gb|EOA37378.1| hypothetical protein CARUB_v10011207mg [Capsella rubella]
Length=394

 Score = 98.2 bits (243),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 43/49 (88%), Positives = 46/49 (94%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRMFEFK+RRCTRSRSHDWTDCPFAHPGEKARRRDPR++ YSG VC EF
Sbjct  86   FRMFEFKIRRCTRSRSHDWTDCPFAHPGEKARRRDPRRFQYSGEVCPEF  134



>ref|XP_002275926.1| PREDICTED: zinc finger CCCH domain-containing protein 23 [Vitis 
vinifera]
Length=379

 Score = 97.8 bits (242),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 42/49 (86%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRMFEFKVRRC R RSHDWT+CP+AHPGEKARRRDPRK+HYSGT C EF
Sbjct  92   FRMFEFKVRRCARGRSHDWTECPYAHPGEKARRRDPRKFHYSGTACPEF  140



>ref|XP_002863601.1| zinc finger (CCCH-type) family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39860.1| zinc finger (CCCH-type) family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=382

 Score = 97.8 bits (242),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 41/49 (84%), Positives = 47/49 (96%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRM+EFK+RRCTRSRSHDWTDCPF+HPGEKARRRDPR++HY+G VC EF
Sbjct  61   FRMYEFKIRRCTRSRSHDWTDCPFSHPGEKARRRDPRRFHYTGEVCPEF  109



>ref|XP_010049593.1| PREDICTED: zinc finger CCCH domain-containing protein 20-like 
[Eucalyptus grandis]
 gb|KCW82283.1| hypothetical protein EUGRSUZ_C03701 [Eucalyptus grandis]
Length=384

 Score = 97.8 bits (242),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 42/49 (86%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRM+EFKVRRC R RSHDWT+CP+AHPGEKARRRDPRKYHYSGT C EF
Sbjct  102  FRMYEFKVRRCARGRSHDWTECPYAHPGEKARRRDPRKYHYSGTACPEF  150



>ref|XP_004158434.1| PREDICTED: zinc finger CCCH domain-containing protein 20-like 
isoform 2 [Cucumis sativus]
Length=352

 Score = 97.8 bits (242),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 41/49 (84%), Positives = 46/49 (94%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FR+FEFKVR+CTR RSHDWT+CP+AHPGEKARRRDPRKYHYSGT C +F
Sbjct  95   FRIFEFKVRKCTRGRSHDWTECPYAHPGEKARRRDPRKYHYSGTACPDF  143



>ref|XP_011078221.1| PREDICTED: zinc finger CCCH domain-containing protein 20-like 
[Sesamum indicum]
Length=353

 Score = 97.8 bits (242),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 42/49 (86%), Positives = 46/49 (94%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRMFEFKVR+CTR RSHDWT+CPFAHPGEKARRRDPRK+HYSGT C +F
Sbjct  95   FRMFEFKVRKCTRGRSHDWTECPFAHPGEKARRRDPRKFHYSGTACPDF  143



>emb|CAN83255.1| hypothetical protein VITISV_036981 [Vitis vinifera]
Length=426

 Score = 98.2 bits (243),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 42/49 (86%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRMFEFKVRRC R RSHDWT+CP+AHPGEKARRRDPRK+HYSGT C EF
Sbjct  139  FRMFEFKVRRCARGRSHDWTECPYAHPGEKARRRDPRKFHYSGTACPEF  187



>gb|KHM99829.1| Zinc finger CCCH domain-containing protein 20 [Glycine soja]
Length=307

 Score = 97.4 bits (241),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 41/46 (89%), Positives = 44/46 (96%), Gaps = 0/46 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVC  506
            FRMFEFKVRRC R RSHDWT+CP+AHPGEKARRRDPRKYHYSG+VC
Sbjct  75   FRMFEFKVRRCARGRSHDWTECPYAHPGEKARRRDPRKYHYSGSVC  120



>gb|EYU30674.1| hypothetical protein MIMGU_mgv1a009490mg [Erythranthe guttata]
Length=340

 Score = 97.4 bits (241),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 42/49 (86%), Positives = 46/49 (94%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRMFEFKVRRCTR RSHDWT+CPFAHPGEKARRRDPR++HYSGT C +F
Sbjct  100  FRMFEFKVRRCTRGRSHDWTECPFAHPGEKARRRDPRRFHYSGTACPDF  148



>ref|XP_008810557.1| PREDICTED: zinc finger CCCH domain-containing protein 2-like 
[Phoenix dactylifera]
Length=334

 Score = 97.4 bits (241),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 41/49 (84%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRM+EFKVRRC R RSHDWTDCPFAHPGEKARRRDPR+YHYSG +C +F
Sbjct  64   FRMYEFKVRRCMRGRSHDWTDCPFAHPGEKARRRDPRRYHYSGAICPDF  112



>ref|XP_001774473.1| predicted protein [Physcomitrella patens]
 gb|EDQ60697.1| predicted protein, partial [Physcomitrella patens]
Length=137

 Score = 94.0 bits (232),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 42/49 (86%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRMFEFKVRRC R RSHDWT+CPFAHPGEKARRRDPR+YHYSGT C +F
Sbjct  36   FRMFEFKVRRCMRGRSHDWTECPFAHPGEKARRRDPRRYHYSGTACPDF  84



>ref|XP_007223349.1| hypothetical protein PRUPE_ppa007432mg [Prunus persica]
 gb|EMJ24548.1| hypothetical protein PRUPE_ppa007432mg [Prunus persica]
Length=368

 Score = 97.4 bits (241),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 42/49 (86%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRMFEFKVRRC R RSHDWT+CP+AHPGEKARRRDPRKYHYSG  C EF
Sbjct  90   FRMFEFKVRRCARGRSHDWTECPYAHPGEKARRRDPRKYHYSGAACPEF  138



>gb|KJB27132.1| hypothetical protein B456_004G283000 [Gossypium raimondii]
Length=353

 Score = 97.4 bits (241),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 40/49 (82%), Positives = 46/49 (94%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRMFEFK+R+C R R+HDWT+CP+AHPGEKARRRDPRKYHYSGT CA+F
Sbjct  95   FRMFEFKIRKCPRGRAHDWTECPYAHPGEKARRRDPRKYHYSGTACADF  143



>ref|XP_006280675.1| hypothetical protein CARUB_v10026640mg [Capsella rubella]
 gb|EOA13573.1| hypothetical protein CARUB_v10026640mg [Capsella rubella]
Length=364

 Score = 97.4 bits (241),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 41/49 (84%), Positives = 47/49 (96%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRM+EFK+RRCTRSRSHDWTDCPF+HPGEKARRRDPR++HY+G VC EF
Sbjct  48   FRMYEFKIRRCTRSRSHDWTDCPFSHPGEKARRRDPRRFHYTGEVCPEF  96



>ref|XP_006297982.1| hypothetical protein CARUB_v10014025mg [Capsella rubella]
 gb|EOA30880.1| hypothetical protein CARUB_v10014025mg [Capsella rubella]
Length=363

 Score = 97.4 bits (241),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 41/49 (84%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRM+EFKVRRC R RSHDWT+CP+AHPGEKARRRDPRKYHYSGT C +F
Sbjct  80   FRMYEFKVRRCARGRSHDWTECPYAHPGEKARRRDPRKYHYSGTACPDF  128



>gb|KJB83088.1| hypothetical protein B456_013G229000 [Gossypium raimondii]
Length=332

 Score = 97.1 bits (240),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 41/49 (84%), Positives = 46/49 (94%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRMFEFKVRRC R RSHDWT+CP+AHPGEKARRRDPRK+HYSGT C++F
Sbjct  81   FRMFEFKVRRCGRGRSHDWTECPYAHPGEKARRRDPRKFHYSGTACSDF  129



>emb|CBI20604.3| unnamed protein product [Vitis vinifera]
Length=306

 Score = 97.1 bits (240),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 42/49 (86%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRMFEFKVRRC R RSHDWT+CP+AHPGEKARRRDPRK+HYSGT C EF
Sbjct  70   FRMFEFKVRRCARGRSHDWTECPYAHPGEKARRRDPRKFHYSGTACPEF  118



>ref|XP_006408830.1| hypothetical protein EUTSA_v10002045mg [Eutrema salsugineum]
 gb|ESQ50283.1| hypothetical protein EUTSA_v10002045mg [Eutrema salsugineum]
Length=316

 Score = 97.1 bits (240),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 42/49 (86%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRM+EFKVRRC+R RSHDWT+CPFAHPGEKARRRDP KYHYSGT C EF
Sbjct  85   FRMYEFKVRRCSRGRSHDWTECPFAHPGEKARRRDPTKYHYSGTACPEF  133



>emb|CDP08206.1| unnamed protein product [Coffea canephora]
Length=378

 Score = 97.4 bits (241),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 41/49 (84%), Positives = 46/49 (94%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRMFEFKVRRC R+RSHDWT+CP+AHPGEKARRRDPRKYHYSG+ C +F
Sbjct  88   FRMFEFKVRRCARARSHDWTECPYAHPGEKARRRDPRKYHYSGSACPDF  136



>dbj|BAJ85837.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ95980.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ88325.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=379

 Score = 97.4 bits (241),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 41/49 (84%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRM++FKVRRC R RSHDWT+CPFAHPGEKARRRDPRKYHYSGT C +F
Sbjct  71   FRMYDFKVRRCARGRSHDWTECPFAHPGEKARRRDPRKYHYSGTACPDF  119



>ref|XP_004158433.1| PREDICTED: zinc finger CCCH domain-containing protein 20-like 
isoform 1 [Cucumis sativus]
Length=363

 Score = 97.1 bits (240),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 41/49 (84%), Positives = 46/49 (94%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FR+FEFKVR+CTR RSHDWT+CP+AHPGEKARRRDPRKYHYSGT C +F
Sbjct  95   FRIFEFKVRKCTRGRSHDWTECPYAHPGEKARRRDPRKYHYSGTACPDF  143



>ref|XP_010925500.1| PREDICTED: zinc finger CCCH domain-containing protein 2-like 
[Elaeis guineensis]
Length=394

 Score = 97.4 bits (241),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 41/49 (84%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRM+EFKVRRC R RSHDWT+CP+AHPGEKARRRDPRKYHYSGT C +F
Sbjct  95   FRMYEFKVRRCARGRSHDWTECPYAHPGEKARRRDPRKYHYSGTACPDF  143



>ref|XP_009408887.1| PREDICTED: zinc finger CCCH domain-containing protein 2-like 
[Musa acuminata subsp. malaccensis]
Length=395

 Score = 97.4 bits (241),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 41/49 (84%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRM+EFKVRRC R RSHDWT+CPFAHPGEKARRRDPRKYHYSG  C +F
Sbjct  90   FRMYEFKVRRCARGRSHDWTECPFAHPGEKARRRDPRKYHYSGAACPDF  138



>ref|NP_199239.1| zinc finger CCCH domain-containing protein 61 [Arabidopsis thaliana]
 sp|Q9FKW2.1|C3H61_ARATH RecName: Full=Zinc finger CCCH domain-containing protein 61; 
Short=AtC3H61 [Arabidopsis thaliana]
 dbj|BAB10111.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAK59423.1| unknown protein [Arabidopsis thaliana]
 gb|AAN13124.1| unknown protein [Arabidopsis thaliana]
 gb|AED95082.1| zinc finger CCCH domain-containing protein 61 [Arabidopsis thaliana]
Length=381

 Score = 97.1 bits (240),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 41/49 (84%), Positives = 47/49 (96%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRM+EFK+RRCTRSRSHDWTDCPF+HPGEKARRRDPR++HY+G VC EF
Sbjct  61   FRMYEFKIRRCTRSRSHDWTDCPFSHPGEKARRRDPRRFHYTGEVCPEF  109



>ref|XP_010267090.1| PREDICTED: zinc finger CCCH domain-containing protein 20-like 
[Nelumbo nucifera]
Length=387

 Score = 97.1 bits (240),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 41/49 (84%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRM+EFKVRRC R RSHDWT+CPFAHPGEKARRRDPRK+HYSGT C +F
Sbjct  95   FRMYEFKVRRCARGRSHDWTECPFAHPGEKARRRDPRKFHYSGTACPDF  143



>ref|XP_009381212.1| PREDICTED: zinc finger CCCH domain-containing protein 2-like 
[Musa acuminata subsp. malaccensis]
Length=401

 Score = 97.4 bits (241),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 41/49 (84%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRM+EFKVRRC R RSHDWT+CPFAHPGEKARRRDPRKYHYSG  C +F
Sbjct  93   FRMYEFKVRRCARGRSHDWTECPFAHPGEKARRRDPRKYHYSGAACPDF  141



>ref|XP_003564747.1| PREDICTED: zinc finger CCCH domain-containing protein 2-like 
[Brachypodium distachyon]
Length=385

 Score = 97.1 bits (240),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 41/49 (84%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRM++FKVRRC R RSHDWT+CPFAHPGEKARRRDPRKYHYSGT C +F
Sbjct  79   FRMYDFKVRRCVRGRSHDWTECPFAHPGEKARRRDPRKYHYSGTACPDF  127



>ref|XP_009388582.1| PREDICTED: zinc finger CCCH domain-containing protein 2-like 
[Musa acuminata subsp. malaccensis]
Length=402

 Score = 97.1 bits (240),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 41/49 (84%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRM+EFKVRRC R RSHDWT+CPFAHPGEKARRRDPRKYHYSG  C +F
Sbjct  98   FRMYEFKVRRCARGRSHDWTECPFAHPGEKARRRDPRKYHYSGAACPDF  146



>emb|CDP03218.1| unnamed protein product [Coffea canephora]
Length=395

 Score = 97.1 bits (240),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 41/49 (84%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRMFEFKVR+C R RSHDWT+CP+AHPGEKARRRDPRKYHYSGT C +F
Sbjct  106  FRMFEFKVRKCMRGRSHDWTECPYAHPGEKARRRDPRKYHYSGTACPDF  154



>emb|CDM81668.1| unnamed protein product [Triticum aestivum]
Length=387

 Score = 97.1 bits (240),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 41/49 (84%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRM++FKVRRC R RSHDWT+CPFAHPGEKARRRDPRKYHYSGT C +F
Sbjct  78   FRMYDFKVRRCARGRSHDWTECPFAHPGEKARRRDPRKYHYSGTACPDF  126



>ref|XP_010472617.1| PREDICTED: zinc finger CCCH domain-containing protein 23-like 
[Camelina sativa]
Length=304

 Score = 96.3 bits (238),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 49/85 (58%), Positives = 60/85 (71%), Gaps = 0/85 (0%)
 Frame = +3

Query  261  HMESPTKMQQEDTQFQKFLpynnsddddddpyssdnFRMFEFKVRRCTRSRSHDWTDCPF  440
            H  SP+      +   ++LP N   +D D+   +D FRM+EFK+RRC R  SHDWT+CPF
Sbjct  40   HPHSPSPFLDSFSSLYRYLPSNELTNDSDESSLTDEFRMYEFKIRRCARGGSHDWTECPF  99

Query  441  AHPGEKARRRDPRKYHYSGTVCAEF  515
            AHPGEKARRRDPRK+HYSGT C EF
Sbjct  100  AHPGEKARRRDPRKFHYSGTACPEF  124



>gb|EPS57796.1| hypothetical protein M569_17020, partial [Genlisea aurea]
Length=368

 Score = 96.7 bits (239),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 57/118 (48%), Positives = 69/118 (58%), Gaps = 5/118 (4%)
 Frame = +3

Query  177  FNRKYLRDPEIPPRKLLSRRPS--GEPEMPHMESPTKMQQE---DTQFQKFLpynnsddd  341
            ++ +Y  DP +  +  +S   S  G P+ PH E      Q          F+      D 
Sbjct  20   WDHRYAEDPTVHIQSPISHGLSAGGSPDGPHFEQALAALQRFLPSNSDDAFVAEGEDFDV  79

Query  342  dddpyssdnFRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
              D +S DNFRMFEFKV++C  +RSHDWT CPFAHPGEKARRRDPRK HYSGT C EF
Sbjct  80   PVDAFSCDNFRMFEFKVKKCALARSHDWTACPFAHPGEKARRRDPRKCHYSGTACPEF  137



>ref|XP_008798608.1| PREDICTED: zinc finger CCCH domain-containing protein 2-like 
[Phoenix dactylifera]
Length=395

 Score = 96.7 bits (239),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 41/49 (84%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRM+EFKVRRC R RSHDWT+CP+AHPGEKARRRDPRKYHYSGT C +F
Sbjct  91   FRMYEFKVRRCARGRSHDWTECPYAHPGEKARRRDPRKYHYSGTACPDF  139



>ref|NP_001146853.1| nucleic acid binding protein [Zea mays]
 gb|ACG23956.1| nucleic acid binding protein [Zea mays]
 tpg|DAA53030.1| TPA: nucleic acid binding protein [Zea mays]
Length=370

 Score = 96.7 bits (239),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 41/49 (84%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRM+EFKVRRC R+RSHDWT+CPFAHPGEKARRRDPRKYHYSG  C +F
Sbjct  73   FRMYEFKVRRCARARSHDWTECPFAHPGEKARRRDPRKYHYSGAACPDF  121



>ref|XP_009784195.1| PREDICTED: zinc finger CCCH domain-containing protein 20-like 
[Nicotiana sylvestris]
Length=353

 Score = 96.3 bits (238),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 40/49 (82%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRM+EFKVR+C R RSHDWT+CP+AHPGEKARRRDPRKYHYSGT C +F
Sbjct  84   FRMYEFKVRKCARGRSHDWTECPYAHPGEKARRRDPRKYHYSGTACPDF  132



>ref|XP_009337135.1| PREDICTED: zinc finger CCCH domain-containing protein 23-like 
[Pyrus x bretschneideri]
Length=372

 Score = 96.7 bits (239),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 41/49 (84%), Positives = 43/49 (88%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRMFEFKVRRC   RSHDWTDCP+AHPGEKARRRDPRKYHYSG  C +F
Sbjct  94   FRMFEFKVRRCAHGRSHDWTDCPYAHPGEKARRRDPRKYHYSGAACPDF  142



>ref|XP_010540993.1| PREDICTED: zinc finger CCCH domain-containing protein 20-like 
[Tarenaya hassleriana]
Length=363

 Score = 96.3 bits (238),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 41/49 (84%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRM+EFKVRRC R RSHDWT+CP+AHPGEKARRRDPRKYHYSGT C +F
Sbjct  80   FRMYEFKVRRCARGRSHDWTECPYAHPGEKARRRDPRKYHYSGTACPDF  128



>emb|CDX86670.1| BnaC08g00330D [Brassica napus]
Length=373

 Score = 96.7 bits (239),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 42/49 (86%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRMFEFK+RRCTRSRSHDWTDCPFAHPGEKARRRDPR++ YS  VC EF
Sbjct  77   FRMFEFKIRRCTRSRSHDWTDCPFAHPGEKARRRDPRRFQYSAEVCPEF  125



>ref|XP_011458888.1| PREDICTED: zinc finger CCCH domain-containing protein 20 [Fragaria 
vesca subsp. vesca]
Length=339

 Score = 96.3 bits (238),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 41/49 (84%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRMFEFKVRRC R RSHDWT+CP+AHPGEKARRRDPRKYHYSG+ C +F
Sbjct  76   FRMFEFKVRRCARGRSHDWTECPYAHPGEKARRRDPRKYHYSGSACPDF  124



>gb|KJB06687.1| hypothetical protein B456_001G009900 [Gossypium raimondii]
Length=392

 Score = 96.7 bits (239),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 40/49 (82%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRM+EFK+RRC R RSHDWT+CP+AHPGEKARRRDPRKYHYSGT C +F
Sbjct  93   FRMYEFKIRRCARGRSHDWTECPYAHPGEKARRRDPRKYHYSGTACPDF  141



>emb|CBI27968.3| unnamed protein product [Vitis vinifera]
Length=364

 Score = 96.3 bits (238),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 41/49 (84%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRMFEFKVRRC R RSHDWT+CP+AHPGEKARRRDPRK+HYSGT C +F
Sbjct  77   FRMFEFKVRRCARGRSHDWTECPYAHPGEKARRRDPRKFHYSGTACPDF  125



>ref|XP_009791791.1| PREDICTED: zinc finger CCCH domain-containing protein 20-like 
[Nicotiana sylvestris]
Length=386

 Score = 96.3 bits (238),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 40/49 (82%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRM+EFKVR+C R +SHDWT+CP+AHPGEKARRRDPRKYHYSGT C EF
Sbjct  100  FRMYEFKVRKCARGKSHDWTECPYAHPGEKARRRDPRKYHYSGTACPEF  148



>emb|CDY15473.1| BnaA08g27570D [Brassica napus]
Length=399

 Score = 96.7 bits (239),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 42/49 (86%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRMFEFK+RRCTRSRSHDWTDCPFAHPGEKARRRDPR++ YS  VC EF
Sbjct  75   FRMFEFKIRRCTRSRSHDWTDCPFAHPGEKARRRDPRRFQYSAEVCPEF  123



>ref|NP_194648.1| protein OXIDATION-RELATED ZINC FINGER 2 [Arabidopsis thaliana]
 sp|Q9M0G2.1|C3H49_ARATH RecName: Full=Zinc finger CCCH domain-containing protein 49; 
Short=AtC3H49 [Arabidopsis thaliana]
 emb|CAB79677.1| putative protein [Arabidopsis thaliana]
 gb|AAK76644.1| unknown protein [Arabidopsis thaliana]
 gb|AAL85054.1| unknown protein [Arabidopsis thaliana]
 gb|AAM62857.1| putative CCCH-type zinc finger protein [Arabidopsis thaliana]
 gb|AEE85600.1| zinc finger CCCH domain-containing protein 49 [Arabidopsis thaliana]
Length=356

 Score = 96.3 bits (238),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 71/115 (62%), Gaps = 11/115 (10%)
 Frame = +3

Query  204  EIPPRKLLSRRPSGEPEMPHMESP-TKMQQEDTQFQKFLpyn----------nsdddddd  350
            EIPP  +L    + E   P M SP   M +     Q++LP N             D   D
Sbjct  14   EIPPWPVLEELTTSEFFSPVMNSPDCSMLEALAGLQRYLPSNEPDPESYPDLLGPDSPID  73

Query  351  pyssdnFRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
             YS D+FRM++FKVRRC R RSHDWT+CP+AHPGEKARRRDPRKYHYSGT C +F
Sbjct  74   AYSCDHFRMYDFKVRRCARGRSHDWTECPYAHPGEKARRRDPRKYHYSGTACPDF  128



>ref|NP_179571.1| oxidation-related zinc Finger 1 [Arabidopsis thaliana]
 sp|O82199.1|C3H20_ARATH RecName: Full=Zinc finger CCCH domain-containing protein 20; 
Short=AtC3H20 [Arabidopsis thaliana]
 gb|AAC62135.1| putative CCCH-type zinc finger protein [Arabidopsis thaliana]
 gb|AAM60847.1| putative CCCH-type zinc finger protein [Arabidopsis thaliana]
 gb|AAM97061.1| putative CCCH-type zinc finger protein [Arabidopsis thaliana]
 gb|AAN72125.1| putative CCCH-type zinc finger protein [Arabidopsis thaliana]
 gb|AEC06929.1| oxidation-related zinc Finger 1 [Arabidopsis thaliana]
Length=359

 Score = 96.3 bits (238),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 41/49 (84%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRM+EFKVRRC R RSHDWT+CP+AHPGEKARRRDPRK+HYSGT C EF
Sbjct  79   FRMYEFKVRRCARGRSHDWTECPYAHPGEKARRRDPRKFHYSGTACPEF  127



>ref|XP_002886019.1| hypothetical protein ARALYDRAFT_480488 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62278.1| hypothetical protein ARALYDRAFT_480488 [Arabidopsis lyrata subsp. 
lyrata]
Length=357

 Score = 96.3 bits (238),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 41/49 (84%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRM+EFKVRRC R RSHDWT+CP+AHPGEKARRRDPRK+HYSGT C EF
Sbjct  79   FRMYEFKVRRCARGRSHDWTECPYAHPGEKARRRDPRKFHYSGTACPEF  127



>ref|XP_002878901.1| hypothetical protein ARALYDRAFT_481444 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH55160.1| hypothetical protein ARALYDRAFT_481444 [Arabidopsis lyrata subsp. 
lyrata]
Length=313

 Score = 95.9 bits (237),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 40/49 (82%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRM+EFK+RRC R RSHDWT+CPFAHPGEKARRRDPRK+HY+GT C EF
Sbjct  91   FRMYEFKIRRCARGRSHDWTECPFAHPGEKARRRDPRKFHYAGTACPEF  139



>ref|XP_006294702.1| hypothetical protein CARUB_v10023740mg [Capsella rubella]
 gb|EOA27600.1| hypothetical protein CARUB_v10023740mg [Capsella rubella]
Length=298

 Score = 95.9 bits (237),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 52/92 (57%), Positives = 65/92 (71%), Gaps = 2/92 (2%)
 Frame = +3

Query  240  SGEPEMPHMESPTKMQQEDTQFQKFLpynnsddddddpyssdnFRMFEFKVRRCTRSRSH  419
            +G  + PH  SP+          ++LP N   +D D+P  +D FRM+EFK+RRC+R RSH
Sbjct  31   NGVNDYPH--SPSPYLDSFASLHRYLPSNELTEDSDEPSLTDEFRMYEFKIRRCSRGRSH  88

Query  420  DWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            DWT+CP+AHPGEKARRRDPRK HYSGT C EF
Sbjct  89   DWTECPYAHPGEKARRRDPRKVHYSGTACPEF  120



>ref|XP_008377933.1| PREDICTED: zinc finger CCCH domain-containing protein 23-like 
[Malus domestica]
Length=372

 Score = 96.3 bits (238),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 41/49 (84%), Positives = 43/49 (88%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRMFEFKVRRC   RSHDWTDCP+AHPGEKARRRDPRKYHYSG  C +F
Sbjct  94   FRMFEFKVRRCAHGRSHDWTDCPYAHPGEKARRRDPRKYHYSGAACPDF  142



>ref|XP_009111142.1| PREDICTED: zinc finger CCCH domain-containing protein 2-like 
[Brassica rapa]
Length=399

 Score = 96.3 bits (238),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 42/49 (86%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRMFEFK+RRCTRSRSHDWTDCPFAHPGEKARRRDPR++ YS  VC EF
Sbjct  75   FRMFEFKIRRCTRSRSHDWTDCPFAHPGEKARRRDPRRFQYSAEVCPEF  123



>ref|XP_004503514.1| PREDICTED: zinc finger CCCH domain-containing protein 20-like 
[Cicer arietinum]
Length=385

 Score = 96.3 bits (238),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 40/49 (82%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRMFEFK+RRC R RSHDWT+CP+AHPGEKARRRDPRK+HYSGT C +F
Sbjct  85   FRMFEFKIRRCARGRSHDWTECPYAHPGEKARRRDPRKFHYSGTACPDF  133



>gb|KDP34137.1| hypothetical protein JCGZ_07708 [Jatropha curcas]
Length=371

 Score = 96.3 bits (238),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 40/49 (82%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRM+EFKVRRC R RSHDWT+CP+AHPGEKARRRDPR+YHYSGT C +F
Sbjct  79   FRMYEFKVRRCARGRSHDWTECPYAHPGEKARRRDPRRYHYSGTACPDF  127



>ref|XP_011081722.1| PREDICTED: zinc finger CCCH domain-containing protein 23 [Sesamum 
indicum]
Length=366

 Score = 95.9 bits (237),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 40/49 (82%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRMFEFKV++C R+RSHDWT+CPFAHPGEKARRRDPRKYHYSG  C +F
Sbjct  90   FRMFEFKVKKCARARSHDWTECPFAHPGEKARRRDPRKYHYSGNACPDF  138



>gb|AAM65505.1| putative CCCH-type zinc finger protein [Arabidopsis thaliana]
Length=315

 Score = 95.5 bits (236),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 40/49 (82%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FR++EFK+RRC R RSHDWT+CPFAHPGEKARRRDPRK+HYSGT C EF
Sbjct  91   FRIYEFKIRRCARGRSHDWTECPFAHPGEKARRRDPRKFHYSGTACPEF  139



>ref|XP_002283114.2| PREDICTED: zinc finger CCCH domain-containing protein 20 [Vitis 
vinifera]
Length=428

 Score = 96.7 bits (239),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 41/49 (84%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRMFEFKVRRC R RSHDWT+CP+AHPGEKARRRDPRK+HYSGT C +F
Sbjct  139  FRMFEFKVRRCARGRSHDWTECPYAHPGEKARRRDPRKFHYSGTACPDF  187



>ref|XP_002309525.2| zinc finger family protein [Populus trichocarpa]
 gb|EEE93048.2| zinc finger family protein [Populus trichocarpa]
Length=390

 Score = 96.3 bits (238),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 40/49 (82%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRM+EFKV+RC R RSHDWT+CP+AHPGEKARRRDPR+YHYSGT C EF
Sbjct  83   FRMYEFKVKRCARGRSHDWTECPYAHPGEKARRRDPRRYHYSGTACPEF  131



>gb|KFK32533.1| hypothetical protein AALP_AA6G255600 [Arabis alpina]
Length=291

 Score = 95.5 bits (236),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 42/49 (86%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRM+EFKVRRCTR RSHDW +CPFAH GEKARRRDPRKYHYSGT C EF
Sbjct  61   FRMYEFKVRRCTRGRSHDWCECPFAHQGEKARRRDPRKYHYSGTSCPEF  109



>ref|XP_001781195.1| predicted protein [Physcomitrella patens]
 ref|XP_001781215.1| predicted protein, partial [Physcomitrella patens]
 gb|EDQ53980.1| predicted protein, partial [Physcomitrella patens]
 gb|EDQ54000.1| predicted protein, partial [Physcomitrella patens]
Length=137

 Score = 92.4 bits (228),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 41/49 (84%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRMFEFKVRRC R RSHDWT+CPFAHPGEKARRRDPR++HYSGT C +F
Sbjct  36   FRMFEFKVRRCMRGRSHDWTECPFAHPGEKARRRDPRRFHYSGTACPDF  84



>ref|NP_180161.1| putative Cys3His zinc finger protein ATCTH [Arabidopsis thaliana]
 ref|NP_001189604.1| putative Cys3His zinc finger protein ATCTH [Arabidopsis thaliana]
 sp|O82307.1|C3H23_ARATH RecName: Full=Zinc finger CCCH domain-containing protein 23; 
Short=AtC3H23; AltName: Full=Protein ATCTH [Arabidopsis thaliana]
 gb|AAK43909.1|AF370590_1 putative CCCH-type zinc finger protein [Arabidopsis thaliana]
 gb|AAK52987.1|AF375403_1 At2g25900/F17H15.7 [Arabidopsis thaliana]
 gb|AAC42256.1| putative CCCH-type zinc finger protein [Arabidopsis thaliana]
 gb|AAM91054.1| At2g25900/F17H15.7 [Arabidopsis thaliana]
 dbj|BAC41945.1| putative Cys3His zinc finger protein ATCTH [Arabidopsis thaliana]
 gb|AEC07769.1| putative Cys3His zinc finger protein ATCTH [Arabidopsis thaliana]
 gb|AEC07770.1| putative Cys3His zinc finger protein ATCTH [Arabidopsis thaliana]
Length=315

 Score = 95.5 bits (236),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 40/49 (82%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FR++EFK+RRC R RSHDWT+CPFAHPGEKARRRDPRK+HYSGT C EF
Sbjct  91   FRIYEFKIRRCARGRSHDWTECPFAHPGEKARRRDPRKFHYSGTACPEF  139



>ref|XP_006451362.1| hypothetical protein CICLE_v10008633mg [Citrus clementina]
 gb|ESR64602.1| hypothetical protein CICLE_v10008633mg [Citrus clementina]
Length=381

 Score = 95.9 bits (237),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 40/49 (82%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRM+EFKVR+C R RSHDWT+CP+AHPGEKARRRDPRKYHYSGT C +F
Sbjct  93   FRMYEFKVRKCARGRSHDWTECPYAHPGEKARRRDPRKYHYSGTACPDF  141



>ref|XP_010668905.1| PREDICTED: zinc finger CCCH domain-containing protein 23-like 
[Beta vulgaris subsp. vulgaris]
Length=386

 Score = 95.9 bits (237),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 40/49 (82%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRM+EFK+R+C R RSHDWT+CP+AHPGEKARRRDPRKYHYSGT C EF
Sbjct  69   FRMYEFKIRKCARGRSHDWTECPYAHPGEKARRRDPRKYHYSGTACPEF  117



>ref|XP_006475367.1| PREDICTED: zinc finger CCCH domain-containing protein 20-like 
[Citrus sinensis]
 gb|KDO55907.1| hypothetical protein CISIN_1g016862mg [Citrus sinensis]
Length=381

 Score = 95.9 bits (237),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 40/49 (82%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRM+EFKVR+C R RSHDWT+CP+AHPGEKARRRDPRKYHYSGT C +F
Sbjct  93   FRMYEFKVRKCARGRSHDWTECPYAHPGEKARRRDPRKYHYSGTACPDF  141



>ref|XP_002867421.1| zinc finger (CCCH-type) family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43680.1| zinc finger (CCCH-type) family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=356

 Score = 95.9 bits (237),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 40/49 (82%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRM++FKVRRC R RSHDWT+CP+AHPGEKARRRDPRKYHYSGT C +F
Sbjct  80   FRMYDFKVRRCARGRSHDWTECPYAHPGEKARRRDPRKYHYSGTACPDF  128



>gb|EYU20391.1| hypothetical protein MIMGU_mgv1a008351mg [Erythranthe guttata]
Length=376

 Score = 95.9 bits (237),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 40/49 (82%), Positives = 46/49 (94%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRMFEFKV++C R+RSHDWT+CPFAHPGEKARRRDPRKYHYSG+ C +F
Sbjct  94   FRMFEFKVKKCARARSHDWTECPFAHPGEKARRRDPRKYHYSGSACPDF  142



>dbj|BAJ33902.1| unnamed protein product [Thellungiella halophila]
Length=365

 Score = 95.9 bits (237),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 40/49 (82%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRM++FKVRRC R RSHDWT+CP+AHPGEKARRRDPRKYHYSGT C +F
Sbjct  80   FRMYDFKVRRCARGRSHDWTECPYAHPGEKARRRDPRKYHYSGTACPDF  128



>ref|XP_006412868.1| hypothetical protein EUTSA_v10025226mg [Eutrema salsugineum]
 gb|ESQ54321.1| hypothetical protein EUTSA_v10025226mg [Eutrema salsugineum]
Length=439

 Score = 96.7 bits (239),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 40/49 (82%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRM++FKVRRC R RSHDWT+CP+AHPGEKARRRDPRKYHYSGT C +F
Sbjct  154  FRMYDFKVRRCARGRSHDWTECPYAHPGEKARRRDPRKYHYSGTACPDF  202



>ref|XP_010494430.1| PREDICTED: zinc finger CCCH domain-containing protein 61-like 
[Camelina sativa]
Length=375

 Score = 95.9 bits (237),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 40/49 (82%), Positives = 46/49 (94%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRM+EFK+RRCTRSRSHDWTDCPF+HPGEKARRRDPR++HY G VC E+
Sbjct  56   FRMYEFKIRRCTRSRSHDWTDCPFSHPGEKARRRDPRRFHYIGEVCPEY  104



>ref|XP_010433125.1| PREDICTED: zinc finger CCCH domain-containing protein 49-like 
[Camelina sativa]
Length=356

 Score = 95.5 bits (236),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 40/49 (82%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRM++FKVRRC R RSHDWT+CP+AHPGEKARRRDPRKYHYSGT C +F
Sbjct  80   FRMYDFKVRRCARGRSHDWTECPYAHPGEKARRRDPRKYHYSGTACPDF  128



>ref|XP_004513076.1| PREDICTED: zinc finger CCCH domain-containing protein 20-like 
[Cicer arietinum]
Length=365

 Score = 95.5 bits (236),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 39/49 (80%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRM+EFK+RRC R RSHDWT+CP+AHPGEKARRRDPRK+HYSGT C +F
Sbjct  86   FRMYEFKIRRCARGRSHDWTECPYAHPGEKARRRDPRKFHYSGTACPDF  134



>ref|XP_010447881.1| PREDICTED: zinc finger CCCH domain-containing protein 49-like 
[Camelina sativa]
Length=356

 Score = 95.5 bits (236),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 40/49 (82%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRM++FKVRRC R RSHDWT+CP+AHPGEKARRRDPRKYHYSGT C +F
Sbjct  80   FRMYDFKVRRCARGRSHDWTECPYAHPGEKARRRDPRKYHYSGTACPDF  128



>ref|XP_010438328.1| PREDICTED: zinc finger CCCH domain-containing protein 49 [Camelina 
sativa]
 ref|XP_010438329.1| PREDICTED: zinc finger CCCH domain-containing protein 49 [Camelina 
sativa]
 ref|XP_010438330.1| PREDICTED: zinc finger CCCH domain-containing protein 49 [Camelina 
sativa]
Length=356

 Score = 95.5 bits (236),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 40/49 (82%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRM++FKVRRC R RSHDWT+CP+AHPGEKARRRDPRKYHYSGT C +F
Sbjct  80   FRMYDFKVRRCARGRSHDWTECPYAHPGEKARRRDPRKYHYSGTACPDF  128



>ref|XP_011019549.1| PREDICTED: zinc finger CCCH domain-containing protein 20-like 
[Populus euphratica]
Length=390

 Score = 95.9 bits (237),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 40/49 (82%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRM+EFKV+RC R RSHDWT+CP+AHPGEKARRRDPR+YHYSGT C EF
Sbjct  83   FRMYEFKVKRCARGRSHDWTECPYAHPGEKARRRDPRRYHYSGTACPEF  131



>ref|XP_008655700.1| PREDICTED: zinc finger CCCH domain-containing protein 2-like 
[Zea mays]
 gb|AFT82650.1| C3H47 C3H type transcription factor, partial [Zea mays subsp. 
mays]
 gb|AFW80254.1| hypothetical protein ZEAMMB73_899917 [Zea mays]
 gb|AFW80255.1| hypothetical protein ZEAMMB73_899917 [Zea mays]
Length=378

 Score = 95.9 bits (237),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 40/49 (82%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRM+EFKVRRC R+RSHDWT+CPFAHPGEKARRRDPR+YHYSG  C +F
Sbjct  73   FRMYEFKVRRCARARSHDWTECPFAHPGEKARRRDPRRYHYSGAACPDF  121



>gb|KJB54756.1| hypothetical protein B456_009G047600 [Gossypium raimondii]
Length=362

 Score = 95.5 bits (236),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 40/49 (82%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRM+EFKVRRC R RSHDWT+CP+AHPGEKARRRDPRK+HYSGT C +F
Sbjct  81   FRMYEFKVRRCARGRSHDWTECPYAHPGEKARRRDPRKFHYSGTACPDF  129



>ref|XP_010244375.1| PREDICTED: zinc finger CCCH domain-containing protein 20 [Nelumbo 
nucifera]
Length=391

 Score = 95.9 bits (237),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 40/49 (82%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRM+EFKVRRC R RSHDWT+CP+AHPGEKARRRDPRK+HYSGT C +F
Sbjct  99   FRMYEFKVRRCARGRSHDWTECPYAHPGEKARRRDPRKFHYSGTACPDF  147



>gb|AFW80253.1| hypothetical protein ZEAMMB73_899917 [Zea mays]
Length=296

 Score = 95.1 bits (235),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 40/49 (82%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRM+EFKVRRC R+RSHDWT+CPFAHPGEKARRRDPR+YHYSG  C +F
Sbjct  73   FRMYEFKVRRCARARSHDWTECPFAHPGEKARRRDPRRYHYSGAACPDF  121



>ref|XP_010441910.1| PREDICTED: zinc finger CCCH domain-containing protein 61 [Camelina 
sativa]
Length=375

 Score = 95.5 bits (236),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 40/49 (82%), Positives = 46/49 (94%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRM+EFK+RRCTRSRSHDWTDCPF+HPGEKARRRDPR++HY G VC E+
Sbjct  56   FRMYEFKIRRCTRSRSHDWTDCPFSHPGEKARRRDPRRFHYIGEVCPEY  104



>ref|XP_006285735.1| hypothetical protein CARUB_v10007208mg [Capsella rubella]
 gb|EOA18633.1| hypothetical protein CARUB_v10007208mg [Capsella rubella]
Length=361

 Score = 95.5 bits (236),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 40/49 (82%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRM++FKVRRC R RSHDWT+CP+AHPGEKARRRDPRKYHYSGT C +F
Sbjct  80   FRMYDFKVRRCARGRSHDWTECPYAHPGEKARRRDPRKYHYSGTACPDF  128



>ref|XP_010481761.1| PREDICTED: zinc finger CCCH domain-containing protein 61 [Camelina 
sativa]
Length=367

 Score = 95.5 bits (236),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 40/49 (82%), Positives = 46/49 (94%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRM+EFK+RRCTRSRSHDWTDCPF+HPGEKARRRDPR++HY G VC E+
Sbjct  56   FRMYEFKIRRCTRSRSHDWTDCPFSHPGEKARRRDPRRFHYIGEVCPEY  104



>emb|CAN81808.1| hypothetical protein VITISV_013303 [Vitis vinifera]
Length=460

 Score = 96.7 bits (239),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 41/49 (84%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRMFEFKVRRC R RSHDWT+CP+AHPGEKARRRDPRK+HYSGT C +F
Sbjct  139  FRMFEFKVRRCARGRSHDWTECPYAHPGEKARRRDPRKFHYSGTACPDF  187



>ref|XP_003529068.1| PREDICTED: zinc finger CCCH domain-containing protein 20-like 
isoform 1 [Glycine max]
Length=359

 Score = 95.5 bits (236),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 53/91 (58%), Positives = 61/91 (67%), Gaps = 9/91 (10%)
 Frame = +3

Query  270  SPTKMQQEDTQFQKFLpynnsddddddpyssdn---------FRMFEFKVRRCTRSRSHD  422
            SP  +Q+  T  Q+FLP N +D D D     D          FRM+EFKVRRC R RSHD
Sbjct  43   SPYYLQEALTALQRFLPSNETDADSDTEAQPDAAVDAYSCDHFRMYEFKVRRCARGRSHD  102

Query  423  WTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            WT+CP+AHPGEKARRRDPRK+HYSG  C EF
Sbjct  103  WTECPYAHPGEKARRRDPRKFHYSGAACPEF  133



>ref|XP_003568774.1| PREDICTED: zinc finger CCCH domain-containing protein 35-like 
[Brachypodium distachyon]
Length=384

 Score = 95.5 bits (236),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 41/49 (84%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRM+EFKVRRCTR RSHDWTDCPFAHPGEKARRRDPR+Y YSG  C +F
Sbjct  73   FRMYEFKVRRCTRGRSHDWTDCPFAHPGEKARRRDPRRYCYSGAACPDF  121



>gb|KHN40356.1| Zinc finger CCCH domain-containing protein 20 [Glycine soja]
Length=332

 Score = 95.1 bits (235),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 63/91 (69%), Gaps = 9/91 (10%)
 Frame = +3

Query  270  SPTKMQQEDTQFQKFLpynnsdd---------ddddpyssdnFRMFEFKVRRCTRSRSHD  422
            SP  +Q+  T  Q+FLP N +D             D YS D+FRM+EFKVRRC R RSHD
Sbjct  16   SPYYLQEALTALQRFLPSNETDADSDTEAQPDAAVDAYSCDHFRMYEFKVRRCARGRSHD  75

Query  423  WTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            WT+CP+AHPGEKARRRDPRK+HYSG  C EF
Sbjct  76   WTECPYAHPGEKARRRDPRKFHYSGAACPEF  106



>ref|XP_003620782.1| Zinc finger CCCH domain-containing protein [Medicago truncatula]
 gb|AES77000.1| zinc finger CCCH domain protein [Medicago truncatula]
Length=377

 Score = 95.5 bits (236),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 39/49 (80%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRM+EFK+RRC R RSHDWT+CP+AHPGEKARRRDPRK+HYSGT C +F
Sbjct  104  FRMYEFKIRRCARGRSHDWTECPYAHPGEKARRRDPRKFHYSGTACPDF  152



>ref|XP_009608132.1| PREDICTED: zinc finger CCCH domain-containing protein 20-like 
[Nicotiana tomentosiformis]
Length=386

 Score = 95.1 bits (235),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 39/49 (80%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRM+EFKVR+C R +SHDWT+CP+AHPGEKARRRDPRKYHYSGT C +F
Sbjct  100  FRMYEFKVRKCARGKSHDWTECPYAHPGEKARRRDPRKYHYSGTACPDF  148



>ref|XP_004245129.1| PREDICTED: zinc finger CCCH domain-containing protein 20-like 
[Solanum lycopersicum]
Length=320

 Score = 94.7 bits (234),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 40/49 (82%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRM+EFKVR+C R RSHDWT+CP+AHPGEKARRRDPRKYHYSGT C +F
Sbjct  74   FRMYEFKVRKCARGRSHDWTECPYAHPGEKARRRDPRKYHYSGTSCPDF  122



>ref|XP_007152945.1| hypothetical protein PHAVU_004G173600g [Phaseolus vulgaris]
 gb|ESW24939.1| hypothetical protein PHAVU_004G173600g [Phaseolus vulgaris]
Length=354

 Score = 95.1 bits (235),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 39/49 (80%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRM+EFK+RRC R RSHDWT+CP+AHPGEKARRRDPRK+HYSG  C EF
Sbjct  85   FRMYEFKIRRCARGRSHDWTECPYAHPGEKARRRDPRKFHYSGAACPEF  133



>gb|KFK40348.1| hypothetical protein AALP_AA3G362300 [Arabis alpina]
Length=350

 Score = 95.1 bits (235),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 40/49 (82%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRM+EFKVRRC R RSHDWT+CP+AHPGEKARRRDPRK+HYSG  C EF
Sbjct  72   FRMYEFKVRRCARGRSHDWTECPYAHPGEKARRRDPRKFHYSGVACPEF  120



>ref|XP_004287330.2| PREDICTED: zinc finger CCCH domain-containing protein 49-like 
[Fragaria vesca subsp. vesca]
Length=478

 Score = 96.3 bits (238),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 40/49 (82%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRMFEFKVRRC R RSHDWTDCPFAHPGE+A+RRDPRK+HYSG+ C +F
Sbjct  51   FRMFEFKVRRCARGRSHDWTDCPFAHPGEEAQRRDPRKFHYSGSACPDF  99



>gb|KJB27276.1| hypothetical protein B456_004G288300 [Gossypium raimondii]
Length=361

 Score = 94.7 bits (234),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 40/49 (82%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRM+EFKVRRC R RSHDWT+CP+AHPGEKARRRDPRK+HYSGT C +F
Sbjct  81   FRMYEFKVRRCARGRSHDWTECPYAHPGEKARRRDPRKFHYSGTACPDF  129



>ref|XP_006355306.1| PREDICTED: zinc finger CCCH domain-containing protein 20-like 
[Solanum tuberosum]
Length=350

 Score = 94.7 bits (234),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 40/49 (82%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRM+EFKVR+C R RSHDWT+CP+AHPGEKARRRDPRKYHYSGT C +F
Sbjct  74   FRMYEFKVRKCARGRSHDWTECPYAHPGEKARRRDPRKYHYSGTSCPDF  122



>ref|XP_007012220.1| Zinc finger C-x8-C-x5-C-x3-H type family protein, putative [Theobroma 
cacao]
 gb|EOY29839.1| Zinc finger C-x8-C-x5-C-x3-H type family protein, putative [Theobroma 
cacao]
Length=377

 Score = 94.7 bits (234),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 40/49 (82%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRM+EFKVRRC R RSHDWT+CP+AHPGEKARRRDPRK+HYSGT C +F
Sbjct  96   FRMYEFKVRRCARGRSHDWTECPYAHPGEKARRRDPRKFHYSGTACPDF  144



>ref|XP_003516267.1| PREDICTED: zinc finger CCCH domain-containing protein 20-like 
[Glycine max]
Length=350

 Score = 94.7 bits (234),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 51/93 (55%), Positives = 63/93 (68%), Gaps = 11/93 (12%)
 Frame = +3

Query  270  SPTKMQQEDTQFQKFLpynnsddddddpyssd-----------nFRMFEFKVRRCTRSRS  416
            SP  +Q+  T  Q+FLP N +D D D   ++            +FRM+EFKVRRC R RS
Sbjct  43   SPYHLQEALTALQRFLPSNETDADSDSSEAAQPDAAVDAYTCDHFRMYEFKVRRCARGRS  102

Query  417  HDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            HDWT+CP+AHPGEKARRRDPR++HYSG  C EF
Sbjct  103  HDWTECPYAHPGEKARRRDPRRFHYSGVACPEF  135



>gb|KEH21327.1| zinc finger CCCH domain protein [Medicago truncatula]
Length=381

 Score = 94.7 bits (234),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 40/49 (82%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRMFEFK+RRC R RSHDWT+CPF+HPGEKARRRDPRKY+YSGT C +F
Sbjct  82   FRMFEFKIRRCARGRSHDWTECPFSHPGEKARRRDPRKYNYSGTSCPDF  130



>ref|XP_008794080.1| PREDICTED: zinc finger CCCH domain-containing protein 2-like 
[Phoenix dactylifera]
Length=404

 Score = 95.1 bits (235),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 40/49 (82%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRM+EFKVRRC R RSHDWT+CP+AHPGEKARRRDPRK+HYSGT C +F
Sbjct  95   FRMYEFKVRRCARGRSHDWTECPYAHPGEKARRRDPRKFHYSGTACPDF  143



>ref|XP_002978806.1| hypothetical protein SELMODRAFT_443970 [Selaginella moellendorffii]
 ref|XP_002984720.1| hypothetical protein SELMODRAFT_446000 [Selaginella moellendorffii]
 gb|EFJ14365.1| hypothetical protein SELMODRAFT_446000 [Selaginella moellendorffii]
 gb|EFJ20253.1| hypothetical protein SELMODRAFT_443970 [Selaginella moellendorffii]
Length=383

 Score = 94.7 bits (234),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 41/49 (84%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRMFEFKVRRC R RSHDWT+CPFAHPGEKARRRDPR++HYSGT C +F
Sbjct  58   FRMFEFKVRRCMRGRSHDWTECPFAHPGEKARRRDPRRFHYSGTSCPDF  106



>ref|XP_008799753.1| PREDICTED: zinc finger CCCH domain-containing protein 20-like 
[Phoenix dactylifera]
Length=381

 Score = 94.7 bits (234),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 40/49 (82%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRM+EFKVRRC R RSHDWT+CP+AHPGEKARRRDPR++HYSGT C EF
Sbjct  107  FRMYEFKVRRCPRGRSHDWTECPYAHPGEKARRRDPRRFHYSGTACPEF  155



>gb|EEE62637.1| hypothetical protein OsJ_17440 [Oryza sativa Japonica Group]
Length=379

 Score = 94.7 bits (234),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 40/49 (82%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRM+EFKVRRC R RSHDWT+CPFAHPGEKARRRDPR+Y YSGT C +F
Sbjct  78   FRMYEFKVRRCARGRSHDWTECPFAHPGEKARRRDPRRYCYSGTACPDF  126



>ref|XP_002993351.1| hypothetical protein SELMODRAFT_449116 [Selaginella moellendorffii]
 gb|EFJ05536.1| hypothetical protein SELMODRAFT_449116 [Selaginella moellendorffii]
Length=581

 Score = 96.3 bits (238),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 41/49 (84%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRMFEFKVRRC R RSHDWT+CPFAHPGEKARRRDPR++HYSGT C +F
Sbjct  115  FRMFEFKVRRCMRGRSHDWTECPFAHPGEKARRRDPRRFHYSGTACPDF  163



>ref|XP_009802285.1| PREDICTED: zinc finger CCCH domain-containing protein 20-like 
[Nicotiana sylvestris]
Length=343

 Score = 94.4 bits (233),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 40/49 (82%), Positives = 43/49 (88%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRMFEFKVR C R RSHDWT+CP+ HPGEKARRRDPRKYHYSGT C +F
Sbjct  71   FRMFEFKVRNCARGRSHDWTECPYLHPGEKARRRDPRKYHYSGTACPDF  119



>ref|XP_002972737.1| hypothetical protein SELMODRAFT_441947 [Selaginella moellendorffii]
 gb|EFJ25958.1| hypothetical protein SELMODRAFT_441947 [Selaginella moellendorffii]
Length=581

 Score = 96.3 bits (238),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 41/49 (84%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRMFEFKVRRC R RSHDWT+CPFAHPGEKARRRDPR++HYSGT C +F
Sbjct  116  FRMFEFKVRRCMRGRSHDWTECPFAHPGEKARRRDPRRFHYSGTACPDF  164



>ref|XP_004251650.1| PREDICTED: zinc finger CCCH domain-containing protein 20 [Solanum 
lycopersicum]
Length=405

 Score = 94.7 bits (234),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 40/49 (82%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRM+EFKVRRC R RSHDWT+CP+ HPGEKARRRDPRK+HYSGT C EF
Sbjct  117  FRMYEFKVRRCGRGRSHDWTECPYVHPGEKARRRDPRKFHYSGTACPEF  165



>ref|XP_010451167.1| PREDICTED: zinc finger CCCH domain-containing protein 61-like 
[Camelina sativa]
Length=221

 Score = 92.8 bits (229),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 40/49 (82%), Positives = 46/49 (94%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRM+EFK+RRCTRSRSHDWTDCPF+HPGEKARRRDPR++HY G VC E+
Sbjct  56   FRMYEFKIRRCTRSRSHDWTDCPFSHPGEKARRRDPRRFHYIGEVCPEY  104



>gb|KFK31654.1| hypothetical protein AALP_AA6G141300 [Arabis alpina]
Length=372

 Score = 94.4 bits (233),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 40/49 (82%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRM+EFK+RRCTRSRSHDWTDCPF+HPGEKARRRDPR + Y+G VC EF
Sbjct  58   FRMYEFKIRRCTRSRSHDWTDCPFSHPGEKARRRDPRLFQYTGEVCPEF  106



>ref|XP_006853780.1| hypothetical protein AMTR_s00056p00207550 [Amborella trichopoda]
 gb|ERN15247.1| hypothetical protein AMTR_s00056p00207550 [Amborella trichopoda]
Length=446

 Score = 95.1 bits (235),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 39/49 (80%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRM++FKVRRC R RSHDWT+CP+AHPGEKARRRDPRK+HYSGT C +F
Sbjct  132  FRMYDFKVRRCVRGRSHDWTECPYAHPGEKARRRDPRKFHYSGTACPDF  180



>ref|XP_010909936.1| PREDICTED: zinc finger CCCH domain-containing protein 20-like 
[Elaeis guineensis]
Length=345

 Score = 94.0 bits (232),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 39/49 (80%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRM+EFKVRRC R RSHDWT+CP+AHPGEKARRRDPR++HYSG  C EF
Sbjct  76   FRMYEFKVRRCPRGRSHDWTECPYAHPGEKARRRDPRRFHYSGAACTEF  124



>gb|ABR16884.1| unknown [Picea sitchensis]
Length=581

 Score = 95.9 bits (237),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 40/49 (82%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRM+EFKVRRC R RSHDWT+CPFAHPGEKARRRDPR++HYSGT C +F
Sbjct  157  FRMYEFKVRRCMRGRSHDWTECPFAHPGEKARRRDPRRFHYSGTACPDF  205



>ref|XP_006353579.1| PREDICTED: zinc finger CCCH domain-containing protein 20-like 
[Solanum tuberosum]
Length=402

 Score = 94.0 bits (232),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 39/49 (80%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRM+EFKV+RC R RSHDWT+CP+ HPGEKARRRDPRK+HYSGT C EF
Sbjct  118  FRMYEFKVKRCGRGRSHDWTECPYVHPGEKARRRDPRKFHYSGTACPEF  166



>dbj|BAN44693.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44709.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44714.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
Length=142

 Score = 90.9 bits (224),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 39/49 (80%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRM+ FKVRRC R RSHDWT+CP+AHPGEKARRRDPRK+HYSGT C +F
Sbjct  76   FRMYVFKVRRCPRGRSHDWTECPYAHPGEKARRRDPRKFHYSGTACPDF  124



>dbj|BAN44500.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44503.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44504.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44505.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44506.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44507.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44512.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44514.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44524.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44526.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44527.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44528.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44530.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44531.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44532.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44533.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44534.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44535.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44536.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44537.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44538.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44539.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44540.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44541.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44542.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44543.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44544.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44545.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44546.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44547.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44548.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44549.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44610.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44611.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44612.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44613.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44614.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44615.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44616.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44617.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44618.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44619.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44620.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44621.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44622.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44623.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44624.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44625.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44626.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44627.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44628.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44629.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44630.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44631.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44632.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44633.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44634.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44635.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44636.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44637.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44638.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44639.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44721.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44722.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44723.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44725.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44726.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44727.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44729.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44730.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44731.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44732.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44733.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44734.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44736.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44739.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44740.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44741.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44742.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44743.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44746.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44747.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
Length=142

 Score = 90.9 bits (224),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 39/49 (80%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRM+ FKVRRC R RSHDWT+CP+AHPGEKARRRDPRK+HYSGT C +F
Sbjct  76   FRMYVFKVRRCPRGRSHDWTECPYAHPGEKARRRDPRKFHYSGTACPDF  124



>dbj|BAN44470.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44471.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44472.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44473.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44474.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44475.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44476.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44477.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44478.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44479.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44480.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44481.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44482.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44483.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44484.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44485.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44486.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44487.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44488.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44489.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44490.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44491.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44492.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44493.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44494.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44495.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44496.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44497.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44498.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44499.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44501.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44502.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44508.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44509.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44510.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44511.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44513.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44515.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44516.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44517.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44518.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44519.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44520.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44521.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44522.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44523.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44525.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44529.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44550.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44551.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44552.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44553.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44554.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44555.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44556.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44557.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44558.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44559.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44560.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44561.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44562.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44563.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44564.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44565.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44566.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44567.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44568.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44569.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44570.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44571.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44572.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44573.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44574.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44575.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44576.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44577.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44578.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44579.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44580.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44581.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44582.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44583.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44584.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44585.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44586.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44587.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44588.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44589.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44590.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44591.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44592.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44593.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44594.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44595.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44596.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44597.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44598.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44599.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44600.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44601.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44602.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44603.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44604.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44605.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44606.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44607.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44608.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44609.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44640.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44641.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44642.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44643.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44644.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44645.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44646.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44647.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44648.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44649.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44650.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44651.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44652.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44653.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44654.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44655.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44656.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44657.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44658.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44659.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44660.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44661.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44662.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44663.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44664.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44665.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44666.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44667.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44668.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44669.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44670.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44671.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44672.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44673.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44674.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44675.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44676.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44677.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44678.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44679.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44680.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44681.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44682.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44683.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44684.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44685.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44686.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44687.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44688.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44689.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44690.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44691.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44692.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44694.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44695.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44696.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44697.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44698.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44699.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44700.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44701.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44702.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44703.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44704.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44705.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44706.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44707.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44708.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44710.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44711.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44712.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44713.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44715.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44716.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44717.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44718.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44719.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44720.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44724.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44728.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44735.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44737.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44738.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44744.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44745.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44748.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
 dbj|BAN44749.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
gymnorhiza]
Length=142

 Score = 90.5 bits (223),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 39/49 (80%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRM+ FKVRRC R RSHDWT+CP+AHPGEKARRRDPRK+HYSGT C +F
Sbjct  76   FRMYVFKVRRCPRGRSHDWTECPYAHPGEKARRRDPRKFHYSGTACPDF  124



>ref|XP_011094664.1| PREDICTED: zinc finger CCCH domain-containing protein 20-like 
[Sesamum indicum]
Length=369

 Score = 93.6 bits (231),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 39/49 (80%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRMFEFKV++C  +RSHDWT+CPFAHPGEKARRRDPRKYHYSG+ C +F
Sbjct  89   FRMFEFKVKKCALARSHDWTECPFAHPGEKARRRDPRKYHYSGSACPDF  137



>dbj|BAN44750.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
sexangula]
 dbj|BAN44751.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
sexangula]
 dbj|BAN44752.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
sexangula]
 dbj|BAN44753.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
sexangula]
 dbj|BAN44754.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
sexangula]
 dbj|BAN44755.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
sexangula]
 dbj|BAN44756.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
sexangula]
 dbj|BAN44757.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
sexangula]
 dbj|BAN44758.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
sexangula]
 dbj|BAN44759.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
sexangula]
 dbj|BAN44760.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
sexangula]
 dbj|BAN44761.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
sexangula]
 dbj|BAN44762.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
sexangula]
 dbj|BAN44763.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
sexangula]
 dbj|BAN44764.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
sexangula]
 dbj|BAN44765.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
sexangula]
 dbj|BAN44766.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
sexangula]
 dbj|BAN44767.1| zinc finger CCCH domain-containing protein, partial [Bruguiera 
sexangula]
Length=142

 Score = 90.5 bits (223),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 39/49 (80%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRM+ FKVRRC R RSHDWT+CP+AHPGEKARRRDPRK+HYSGT C +F
Sbjct  76   FRMYVFKVRRCPRGRSHDWTECPYAHPGEKARRRDPRKFHYSGTACPDF  124



>ref|NP_001144558.1| uncharacterized protein LOC100277562 [Zea mays]
 gb|ACG41357.1| hypothetical protein [Zea mays]
Length=391

 Score = 93.6 bits (231),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 38/49 (78%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRM+EFKVRRC+R R+HDWT CP+AHPGEKARRRDPR+YHYSG  C +F
Sbjct  73   FRMYEFKVRRCSRGRNHDWTACPYAHPGEKARRRDPRRYHYSGAACPDF  121



>gb|ACN34007.1| unknown [Zea mays]
 gb|AFT82649.1| C3H39 C3H type transcription factor, partial [Zea mays subsp. 
mays]
 gb|AFW77468.1| hypothetical protein ZEAMMB73_138519 [Zea mays]
 gb|AFW77469.1| hypothetical protein ZEAMMB73_138519 [Zea mays]
Length=394

 Score = 93.6 bits (231),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 38/49 (78%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRM+EFKVRRC+R R+HDWT CP+AHPGEKARRRDPR+YHYSG  C +F
Sbjct  74   FRMYEFKVRRCSRGRNHDWTACPYAHPGEKARRRDPRRYHYSGAACPDF  122



>gb|EAY96854.1| hypothetical protein OsI_18775 [Oryza sativa Indica Group]
Length=404

 Score = 93.6 bits (231),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 40/49 (82%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRM+EFKVRRC R RSHDWT+CPFAHPGEKARRRDPR+Y YSGT C +F
Sbjct  78   FRMYEFKVRRCARGRSHDWTECPFAHPGEKARRRDPRRYCYSGTACPDF  126



>ref|XP_009411222.1| PREDICTED: zinc finger CCCH domain-containing protein 2-like 
[Musa acuminata subsp. malaccensis]
Length=324

 Score = 93.2 bits (230),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 38/49 (78%), Positives = 46/49 (94%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRM+EFKVRRC R RSHDWT+CP+AHPGEKARRRDPR++HYSG++C +F
Sbjct  87   FRMYEFKVRRCPRGRSHDWTECPYAHPGEKARRRDPRRFHYSGSLCPDF  135



>ref|NP_001054861.1| Os05g0195200 [Oryza sativa Japonica Group]
 sp|Q6L4N4.1|C3H35_ORYSJ RecName: Full=Zinc finger CCCH domain-containing protein 35; 
Short=OsC3H35; AltName: Full=Protein DELAY OF THE ONSET OF SENESCENCE-like 
[Oryza sativa Japonica Group]
 gb|AAT38071.1| putative zinc finger transcription factor [Oryza sativa Japonica 
Group]
 dbj|BAF16775.1| Os05g0195200 [Oryza sativa Japonica Group]
Length=402

 Score = 93.6 bits (231),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 40/49 (82%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRM+EFKVRRC R RSHDWT+CPFAHPGEKARRRDPR+Y YSGT C +F
Sbjct  78   FRMYEFKVRRCARGRSHDWTECPFAHPGEKARRRDPRRYCYSGTACPDF  126



>gb|EPS65346.1| hypothetical protein M569_09425, partial [Genlisea aurea]
Length=155

 Score = 90.5 bits (223),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 39/49 (80%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRMFEFKV++C  +RSHDWT CPFAHPGEKARRRDPRKYHYSG+ C +F
Sbjct  40   FRMFEFKVKKCALARSHDWTACPFAHPGEKARRRDPRKYHYSGSACPDF  88



>ref|XP_010924475.1| PREDICTED: zinc finger CCCH domain-containing protein 2-like 
[Elaeis guineensis]
Length=351

 Score = 92.8 bits (229),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 39/49 (80%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRM+EFKVRRC R RSHDWT+CP+AHPGEKARRRDPR++HYSG  C EF
Sbjct  76   FRMYEFKVRRCPRGRSHDWTECPYAHPGEKARRRDPRRFHYSGDACPEF  124



>ref|XP_010548687.1| PREDICTED: zinc finger CCCH domain-containing protein 20-like 
[Tarenaya hassleriana]
Length=363

 Score = 93.2 bits (230),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 39/49 (80%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRM+EFKVRRC R RSHDWT+CP+ HPGEKARRRDPR+YHYSGT C +F
Sbjct  80   FRMYEFKVRRCGRGRSHDWTECPYVHPGEKARRRDPRQYHYSGTSCPDF  128



>gb|ACF82790.1| unknown [Zea mays]
Length=296

 Score = 92.4 bits (228),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 39/47 (83%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = +3

Query  375  MFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            M+EFKVRRC R+RSHDWT+CPFAHPGEKARRRDPRKYHYSG  C +F
Sbjct  1    MYEFKVRRCARARSHDWTECPFAHPGEKARRRDPRKYHYSGAACPDF  47



>gb|KHN16664.1| Zinc finger CCCH domain-containing protein 49 [Glycine soja]
Length=317

 Score = 92.4 bits (228),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 39/43 (91%), Positives = 41/43 (95%), Gaps = 0/43 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSG  497
            FRMFEFKVRRC R RSHDWT+CP+AHPGEKARRRDPRKYHYSG
Sbjct  75   FRMFEFKVRRCARGRSHDWTECPYAHPGEKARRRDPRKYHYSG  117



>ref|XP_009128959.1| PREDICTED: zinc finger CCCH domain-containing protein 49-like 
[Brassica rapa]
Length=361

 Score = 92.8 bits (229),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 39/49 (80%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRM++FKVRRC R RSHDWT+CP+AHPGEKARRRDPRKY YSGT C +F
Sbjct  80   FRMYDFKVRRCARGRSHDWTECPYAHPGEKARRRDPRKYSYSGTACPDF  128



>ref|XP_006855265.1| hypothetical protein AMTR_s00183p00052730 [Amborella trichopoda]
 gb|ERN16732.1| hypothetical protein AMTR_s00183p00052730 [Amborella trichopoda]
Length=361

 Score = 92.8 bits (229),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 38/49 (78%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRMF+FKV++C R RSHDWT+CPFAHPGEKARRRDPR++HYSG VC +F
Sbjct  80   FRMFDFKVKKCARGRSHDWTECPFAHPGEKARRRDPRRFHYSGVVCPDF  128



>gb|EYU29305.1| hypothetical protein MIMGU_mgv1a008957mg [Erythranthe guttata]
Length=357

 Score = 92.8 bits (229),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 38/49 (78%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRMFEFKV++C  +RSHDWT+CPFAHPGEKARRRDPR+YHYSG+ C +F
Sbjct  82   FRMFEFKVKKCALARSHDWTECPFAHPGEKARRRDPRRYHYSGSACPDF  130



>gb|KJB07446.1| hypothetical protein B456_001G024400 [Gossypium raimondii]
Length=359

 Score = 92.4 bits (228),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 39/49 (80%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRM+EFKVRRC R RSHDWT CP+AHPGEKARRRDPRK+HYSG+ C +F
Sbjct  82   FRMYEFKVRRCARGRSHDWTACPYAHPGEKARRRDPRKFHYSGSACPDF  130



>ref|XP_008795482.1| PREDICTED: zinc finger CCCH domain-containing protein 20-like 
[Phoenix dactylifera]
Length=351

 Score = 92.4 bits (228),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 39/49 (80%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRM+EFKVRRC R RSHDWT+CP+AHPGEKARRRDPR++HYSG  C EF
Sbjct  76   FRMYEFKVRRCPRGRSHDWTECPYAHPGEKARRRDPRRFHYSGDACPEF  124



>ref|XP_009610482.1| PREDICTED: zinc finger CCCH domain-containing protein 20-like 
[Nicotiana tomentosiformis]
Length=352

 Score = 92.4 bits (228),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 39/49 (80%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRM+EFKVR+C R RSHDWT+CP+AHPGEKARRRDPRKY YSGT C +F
Sbjct  84   FRMYEFKVRKCARGRSHDWTECPYAHPGEKARRRDPRKYFYSGTACPDF  132



>ref|XP_008220427.1| PREDICTED: zinc finger CCCH domain-containing protein 23 [Prunus 
mume]
Length=368

 Score = 92.4 bits (228),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 41/49 (84%), Positives = 43/49 (88%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRMFEFKVRRC R RSHD T+CP+AHPGEKARRRDPRKYHYSG  C EF
Sbjct  90   FRMFEFKVRRCARGRSHDCTECPYAHPGEKARRRDPRKYHYSGAACPEF  138



>ref|XP_002324748.2| hypothetical protein POPTR_0018s04720g [Populus trichocarpa]
 gb|EEF03313.2| hypothetical protein POPTR_0018s04720g [Populus trichocarpa]
Length=384

 Score = 92.8 bits (229),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 39/49 (80%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRM+ FKVRRC R RSHDWT+CP+AHPGEKARRRDP++YHYSGT C EF
Sbjct  81   FRMYVFKVRRCGRGRSHDWTECPYAHPGEKARRRDPQRYHYSGTACPEF  129



>gb|ABK92961.1| unknown [Populus trichocarpa]
Length=384

 Score = 92.8 bits (229),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 39/49 (80%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRM+ FKVRRC R RSHDWT+CP+AHPGEKARRRDP++YHYSGT C EF
Sbjct  81   FRMYVFKVRRCGRGRSHDWTECPYAHPGEKARRRDPQRYHYSGTACPEF  129



>ref|XP_009402941.1| PREDICTED: zinc finger CCCH domain-containing protein 35-like 
[Musa acuminata subsp. malaccensis]
Length=375

 Score = 92.4 bits (228),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 39/49 (80%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRM+EFKVRRC R RSHDWT+CPF HPGEKARRRDPRKYHYS   C +F
Sbjct  85   FRMYEFKVRRCARGRSHDWTECPFVHPGEKARRRDPRKYHYSSAACPDF  133



>gb|KJB07447.1| hypothetical protein B456_001G024400 [Gossypium raimondii]
Length=267

 Score = 91.7 bits (226),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 39/49 (80%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRM+EFKVRRC R RSHDWT CP+AHPGEKARRRDPRK+HYSG+ C +F
Sbjct  82   FRMYEFKVRRCARGRSHDWTACPYAHPGEKARRRDPRKFHYSGSACPDF  130



>ref|XP_009409364.1| PREDICTED: zinc finger CCCH domain-containing protein 2-like 
[Musa acuminata subsp. malaccensis]
Length=371

 Score = 92.4 bits (228),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 39/49 (80%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRM+EFKVRRC R R+HDWT+CP AHPGEKARRRDPRK+ YSGT CA+F
Sbjct  83   FRMYEFKVRRCARGRTHDWTECPLAHPGEKARRRDPRKHRYSGTPCADF  131



>ref|XP_009372717.1| PREDICTED: zinc finger CCCH domain-containing protein 20-like 
[Pyrus x bretschneideri]
Length=500

 Score = 93.6 bits (231),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 40/49 (82%), Positives = 43/49 (88%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
             RMFEFKVRRC R  SHDWT+CP+AHPGEKARRRDPRKYHYSGT C +F
Sbjct  95   VRMFEFKVRRCARGPSHDWTECPYAHPGEKARRRDPRKYHYSGTGCPDF  143



>ref|XP_002947407.1| CCCH zinc finger protein [Volvox carteri f. nagariensis]
 gb|EFJ51455.1| CCCH zinc finger protein [Volvox carteri f. nagariensis]
Length=880

 Score = 94.7 bits (234),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 39/49 (80%), Positives = 43/49 (88%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRMF+FKV+RC R+R HDWT CPFAHPGEKA+RRDPRKY YSGT C EF
Sbjct  88   FRMFQFKVKRCPRARPHDWTQCPFAHPGEKAKRRDPRKYRYSGTACPEF  136



>ref|XP_009620041.1| PREDICTED: zinc finger CCCH domain-containing protein 20 [Nicotiana 
tomentosiformis]
Length=364

 Score = 91.7 bits (226),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 39/49 (80%), Positives = 43/49 (88%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRMFEFKVR+C R RSHDWT+CP+ H GEKARRRDPRKYHYSGT C +F
Sbjct  97   FRMFEFKVRKCARGRSHDWTECPYLHHGEKARRRDPRKYHYSGTACPDF  145



>ref|XP_003603107.1| Zinc finger CCCH domain-containing protein [Medicago truncatula]
 gb|AES73358.1| zinc finger CCCH domain protein [Medicago truncatula]
Length=278

 Score = 90.9 bits (224),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 39/49 (80%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRMFEFKVR+C R RSHDWTDCP++HPGEKARRRDP+KY+YSG  C EF
Sbjct  54   FRMFEFKVRKCQRGRSHDWTDCPYSHPGEKARRRDPQKYNYSGNPCPEF  102



>ref|XP_009137834.1| PREDICTED: zinc finger CCCH domain-containing protein 49 [Brassica 
rapa]
Length=366

 Score = 91.3 bits (225),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 38/49 (78%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRM++FKVRRC R RSHDWT+CP+AHPGEKARRRDP KY+YSGT C +F
Sbjct  97   FRMYDFKVRRCARGRSHDWTECPYAHPGEKARRRDPAKYNYSGTACPDF  145



>ref|XP_009385782.1| PREDICTED: zinc finger CCCH domain-containing protein 35-like 
[Musa acuminata subsp. malaccensis]
Length=377

 Score = 91.3 bits (225),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 39/49 (80%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRM+EFKVRRC R R+HDWT+CPFAHPGEKARRRDPRK+ YSGT C +F
Sbjct  84   FRMYEFKVRRCARGRAHDWTECPFAHPGEKARRRDPRKHRYSGTSCPDF  132



>ref|XP_007043650.1| Zinc finger C-x8-C-x5-C-x3-H type family protein, putative [Theobroma 
cacao]
 gb|EOX99481.1| Zinc finger C-x8-C-x5-C-x3-H type family protein, putative [Theobroma 
cacao]
Length=365

 Score = 91.3 bits (225),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 71/137 (52%), Positives = 86/137 (63%), Gaps = 19/137 (14%)
 Frame = +3

Query  123  SDNCGEHLHKFHPSH-QLFFNRKYLRDPEIPPRKLLSRRPSGEPEMPHMESPTKMQQE-D  296
            S  C E  HKF PSH QL F     +D EIPPRKLL           H +    MQ   +
Sbjct  2    STACAEQ-HKFQPSHPQLPF-----KDIEIPPRKLLLSHN-------HFQENATMQIPFE  48

Query  297  TQFQKFL----pynnsddddddpyssdnFRMFEFKVRRCTRSRSHDWTDCPFAHPGEKAR  464
               Q++L         + +D D Y++D+FRM+EFKVRRCTRSRSHDWTDCPFAHP EKAR
Sbjct  49   ASLQQYLPSNRNNAEDEGNDADRYATDHFRMYEFKVRRCTRSRSHDWTDCPFAHPNEKAR  108

Query  465  RRDPRKYHYSGTVCAEF  515
            RRDPR++ YS TVC++F
Sbjct  109  RRDPRRFRYSSTVCSDF  125



>ref|XP_003525974.1| PREDICTED: zinc finger CCCH domain-containing protein 23-like 
[Glycine max]
Length=253

 Score = 90.1 bits (222),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 46/87 (53%), Positives = 60/87 (69%), Gaps = 0/87 (0%)
 Frame = +3

Query  255  MPHMESPTKMQQEDTQFQKFLpynnsddddddpyssdnFRMFEFKVRRCTRSRSHDWTDC  434
            +P++E P            F+  +++ D     +SSD+FRMF+FKVR C R RSHDWT+C
Sbjct  2    IPNVEIPHWDADGGGPLSPFISSSSNADKCSLLFSSDHFRMFQFKVRICPRGRSHDWTEC  61

Query  435  PFAHPGEKARRRDPRKYHYSGTVCAEF  515
            P+AHP EKARRRDPRKYHYSGT C ++
Sbjct  62   PYAHPAEKARRRDPRKYHYSGTACPDY  88



>ref|XP_002504751.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO66009.1| predicted protein [Micromonas sp. RCC299]
Length=351

 Score = 90.9 bits (224),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 37/49 (76%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRM+EFKVRRC+R+R+HDWT+CPF HPGEKARRRDPR+++Y GT C EF
Sbjct  41   FRMYEFKVRRCSRTRAHDWTECPFTHPGEKARRRDPRRFNYCGTACPEF  89



>ref|XP_008806226.1| PREDICTED: zinc finger CCCH domain-containing protein 2-like 
[Phoenix dactylifera]
Length=163

 Score = 88.2 bits (217),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 38/49 (78%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRM+EFKVRRC R RSHDW  CP+AHPGEKA RRDPRKY YSGT C +F
Sbjct  109  FRMYEFKVRRCARGRSHDWMKCPYAHPGEKAHRRDPRKYPYSGTACPDF  157



>ref|XP_009380460.1| PREDICTED: zinc finger CCCH domain-containing protein 35-like 
[Musa acuminata subsp. malaccensis]
Length=370

 Score = 90.1 bits (222),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 38/49 (78%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRM+EFKVRRC+R R+HDWT+CPFAHPGEKARRRDPRK+ YSG  C +F
Sbjct  82   FRMYEFKVRRCSRGRAHDWTECPFAHPGEKARRRDPRKHRYSGAPCPDF  130



>ref|XP_009109049.1| PREDICTED: zinc finger CCCH domain-containing protein 49-like 
[Brassica rapa]
Length=352

 Score = 90.1 bits (222),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 38/49 (78%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRM++FKV RC+R RSHDWT+CP+AHPGEKARRRDP KY+YSGT C EF
Sbjct  79   FRMYDFKVLRCSRGRSHDWTECPYAHPGEKARRRDPTKYNYSGTACPEF  127



>ref|XP_011012777.1| PREDICTED: zinc finger CCCH domain-containing protein 20-like 
[Populus euphratica]
Length=387

 Score = 90.5 bits (223),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 38/49 (78%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRM+ FKVRRC R RSHDWT+CP+AHPGEKARRRDP++Y+YSGT C EF
Sbjct  84   FRMYVFKVRRCGRGRSHDWTECPYAHPGEKARRRDPQRYNYSGTACPEF  132



>ref|XP_003522232.1| PREDICTED: zinc finger CCCH domain-containing protein 20-like 
[Glycine max]
Length=233

 Score = 88.6 bits (218),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 38/49 (78%), Positives = 43/49 (88%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRMF+FKVR C R RSHDWT+CP+AHP EKARRRDPRKYHYSGT C ++
Sbjct  37   FRMFQFKVRNCPRGRSHDWTECPYAHPAEKARRRDPRKYHYSGTSCPDY  85



>ref|XP_001417127.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO95420.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=556

 Score = 90.9 bits (224),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +3

Query  369  FRMFEFKVRRCTRSRSHDWTDCPFAHPGEKARRRDPRKYHYSGTVCAEF  515
            FRM+EFK+RRC+R+R+HDWT+CP+ HPGEKARRRDPR+++Y GT C EF
Sbjct  191  FRMYEFKIRRCSRTRAHDWTECPYTHPGEKARRRDPRRFNYCGTACPEF  239



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 554939364720