BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001N17

Length=543
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_007203816.1|  hypothetical protein PRUPE_ppa005504m2g            187   1e-54   
ref|XP_010246130.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    191   2e-54   Nelumbo nucifera [Indian lotus]
gb|KEH24169.1|  lysosomal pro-X carboxypeptidase-like protein           190   4e-54   Medicago truncatula
ref|XP_002308456.2|  hypothetical protein POPTR_0006s22440g             190   6e-54   Populus trichocarpa [western balsam poplar]
ref|XP_006577716.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    184   6e-54   
ref|XP_008350184.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    189   1e-53   
ref|XP_011046918.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    189   1e-53   Populus euphratica
ref|XP_009801420.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    189   1e-53   Nicotiana sylvestris
gb|KJB16581.1|  hypothetical protein B456_002G237800                    187   2e-53   Gossypium raimondii
gb|KJB16583.1|  hypothetical protein B456_002G237800                    187   2e-53   Gossypium raimondii
gb|KJB16582.1|  hypothetical protein B456_002G237800                    187   3e-53   Gossypium raimondii
emb|CDP10629.1|  unnamed protein product                                188   4e-53   Coffea canephora [robusta coffee]
ref|XP_004494225.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    187   5e-53   Cicer arietinum [garbanzo]
emb|CBI30345.3|  unnamed protein product                                186   7e-53   Vitis vinifera
emb|CAN61013.1|  hypothetical protein VITISV_036738                     187   7e-53   Vitis vinifera
ref|XP_009624783.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    187   9e-53   Nicotiana tomentosiformis
ref|XP_009372536.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    187   9e-53   Pyrus x bretschneideri [bai li]
ref|XP_002281618.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    186   1e-52   Vitis vinifera
ref|XP_008243494.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        186   1e-52   
gb|KJB16580.1|  hypothetical protein B456_002G237800                    186   1e-52   Gossypium raimondii
gb|KJB16585.1|  hypothetical protein B456_002G237800                    187   1e-52   Gossypium raimondii
gb|KHN33176.1|  Lysosomal Pro-X carboxypeptidase                        183   4e-52   Glycine soja [wild soybean]
gb|KCW90503.1|  hypothetical protein EUGRSUZ_A02623                     184   4e-52   Eucalyptus grandis [rose gum]
ref|XP_010683638.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    185   5e-52   Beta vulgaris subsp. vulgaris [field beet]
gb|KEH24168.1|  lysosomal pro-X carboxypeptidase-like protein           184   6e-52   Medicago truncatula
ref|XP_010024706.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    184   8e-52   
gb|KEH24167.1|  lysosomal pro-X carboxypeptidase-like protein           184   1e-51   Medicago truncatula
ref|XP_003521479.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    184   1e-51   
ref|XP_011467971.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    183   2e-51   Fragaria vesca subsp. vesca
gb|KCW90505.1|  hypothetical protein EUGRSUZ_A02624                     181   5e-51   Eucalyptus grandis [rose gum]
ref|XP_004167790.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    181   6e-51   
ref|XP_004136495.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    181   7e-51   Cucumis sativus [cucumbers]
ref|XP_006430124.1|  hypothetical protein CICLE_v10011529mg             180   7e-51   
ref|XP_010059402.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    181   1e-50   Eucalyptus grandis [rose gum]
gb|KDO70542.1|  hypothetical protein CISIN_1g0106561mg                  177   2e-50   Citrus sinensis [apfelsine]
ref|XP_007027868.1|  Alpha/beta-Hydrolases superfamily protein is...    178   2e-50   
ref|XP_006577089.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    178   2e-50   Glycine max [soybeans]
ref|XP_004246480.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    180   2e-50   Solanum lycopersicum
ref|XP_006430123.1|  hypothetical protein CICLE_v10011529mg             180   3e-50   Citrus clementina [clementine]
ref|XP_004305645.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    180   3e-50   Fragaria vesca subsp. vesca
gb|KDP36180.1|  hypothetical protein JCGZ_08824                         179   6e-50   Jatropha curcas
ref|XP_007162943.1|  hypothetical protein PHAVU_001G193200g             179   8e-50   Phaseolus vulgaris [French bean]
ref|XP_006577088.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    179   1e-49   Glycine max [soybeans]
gb|KHN33177.1|  Lysosomal Pro-X carboxypeptidase                        178   1e-49   Glycine soja [wild soybean]
ref|XP_002530520.1|  lysosomal pro-X carboxypeptidase, putative         178   1e-49   Ricinus communis
ref|XP_007027867.1|  Alpha/beta-Hydrolases superfamily protein is...    177   3e-49   
ref|XP_006341228.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    177   3e-49   
gb|KHN02193.1|  Lysosomal Pro-X carboxypeptidase                        177   3e-49   Glycine soja [wild soybean]
ref|XP_006604647.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    177   4e-49   Glycine max [soybeans]
ref|XP_006481710.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    177   5e-49   Citrus sinensis [apfelsine]
ref|XP_008442879.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    175   2e-48   Cucumis melo [Oriental melon]
ref|XP_011094280.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        173   9e-48   Sesamum indicum [beniseed]
ref|XP_010931151.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    172   3e-47   Elaeis guineensis
gb|EYU18082.1|  hypothetical protein MIMGU_mgv1a005183mg                171   4e-47   Erythranthe guttata [common monkey flower]
ref|XP_008799734.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    169   2e-46   
gb|EPS74090.1|  hypothetical protein M569_00662                         165   9e-45   Genlisea aurea
gb|ABR17682.1|  unknown                                                 163   4e-44   Picea sitchensis
ref|XP_006854747.1|  hypothetical protein AMTR_s00030p00247420          160   5e-43   Amborella trichopoda
ref|XP_009383556.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    158   4e-42   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006841179.1|  hypothetical protein AMTR_s00086p00173170          153   2e-40   Amborella trichopoda
ref|XP_010260171.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    152   5e-40   Nelumbo nucifera [Indian lotus]
gb|KEH38910.1|  lysosomal pro-X carboxypeptidase-like protein           149   5e-39   Medicago truncatula
emb|CBI17114.3|  unnamed protein product                                146   3e-38   Vitis vinifera
ref|XP_002272152.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        146   5e-38   Vitis vinifera
ref|XP_002450303.1|  hypothetical protein SORBIDRAFT_05g003460          146   8e-38   Sorghum bicolor [broomcorn]
ref|XP_010267352.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    146   8e-38   Nelumbo nucifera [Indian lotus]
ref|XP_010247711.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    145   1e-37   Nelumbo nucifera [Indian lotus]
ref|XP_010245642.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    144   1e-37   Nelumbo nucifera [Indian lotus]
ref|XP_010245641.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    144   2e-37   Nelumbo nucifera [Indian lotus]
gb|KDO44732.1|  hypothetical protein CISIN_1g010487mg                   145   2e-37   Citrus sinensis [apfelsine]
ref|XP_008775539.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    143   3e-37   
ref|XP_010245640.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    144   3e-37   Nelumbo nucifera [Indian lotus]
ref|XP_007150130.1|  hypothetical protein PHAVU_005G1292000g            139   4e-37   Phaseolus vulgaris [French bean]
dbj|BAK05623.1|  predicted protein                                      143   7e-37   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KHN27695.1|  Lysosomal Pro-X carboxypeptidase                        143   8e-37   Glycine soja [wild soybean]
ref|XP_010932235.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    143   9e-37   Elaeis guineensis
ref|XP_010493391.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    143   1e-36   Camelina sativa [gold-of-pleasure]
ref|XP_007153468.1|  hypothetical protein PHAVU_003G038000g             142   1e-36   Phaseolus vulgaris [French bean]
ref|XP_010275727.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    142   1e-36   Nelumbo nucifera [Indian lotus]
ref|XP_010275726.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    143   1e-36   Nelumbo nucifera [Indian lotus]
ref|XP_006287573.1|  hypothetical protein CARUB_v10000783mg             142   1e-36   Capsella rubella
ref|XP_007047633.1|  Serine carboxypeptidase S28 family protein i...    141   1e-36   
gb|ABR17702.1|  unknown                                                 142   2e-36   Picea sitchensis
ref|XP_003539445.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    142   2e-36   Glycine max [soybeans]
ref|XP_008680725.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    142   2e-36   
gb|KDP43937.1|  hypothetical protein JCGZ_05404                         142   2e-36   Jatropha curcas
gb|AAM15096.1|  putative prolylcarboxypeptidase                         142   2e-36   Arabidopsis thaliana [mouse-ear cress]
ref|NP_850050.1|  alpha/beta-Hydrolases superfamily protein             142   2e-36   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006369373.1|  hypothetical protein POPTR_0001s221002g            139   2e-36   
emb|CDP10200.1|  unnamed protein product                                142   2e-36   Coffea canephora [robusta coffee]
ref|XP_002523751.1|  lysosomal pro-X carboxypeptidase, putative         142   2e-36   
ref|XP_004139280.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    142   3e-36   Cucumis sativus [cucumbers]
gb|KHN44803.1|  Lysosomal Pro-X carboxypeptidase                        141   3e-36   Glycine soja [wild soybean]
ref|XP_007047632.1|  Serine carboxypeptidase S28 family protein i...    141   4e-36   
ref|XP_006485140.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    141   4e-36   
gb|KHN29944.1|  Lysosomal Pro-X carboxypeptidase                        139   4e-36   Glycine soja [wild soybean]
gb|KDO44734.1|  hypothetical protein CISIN_1g0127111mg                  135   6e-36   Citrus sinensis [apfelsine]
ref|XP_009617834.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        140   6e-36   Nicotiana tomentosiformis
ref|XP_007150131.1|  hypothetical protein PHAVU_005G129300g             135   6e-36   Phaseolus vulgaris [French bean]
gb|KDP38645.1|  hypothetical protein JCGZ_03998                         140   8e-36   Jatropha curcas
ref|XP_002523506.1|  lysosomal pro-X carboxypeptidase, putative         140   8e-36   Ricinus communis
ref|XP_010247724.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    140   8e-36   Nelumbo nucifera [Indian lotus]
emb|CDY46135.1|  BnaA04g14230D                                          140   9e-36   Brassica napus [oilseed rape]
ref|XP_009140531.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        140   1e-35   Brassica rapa
ref|XP_008457347.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        140   1e-35   Cucumis melo [Oriental melon]
ref|XP_010254368.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    140   1e-35   Nelumbo nucifera [Indian lotus]
ref|XP_009767201.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        140   1e-35   Nicotiana sylvestris
ref|XP_002878742.1|  serine carboxypeptidase S28 family protein         139   1e-35   Arabidopsis lyrata subsp. lyrata
ref|XP_007150133.1|  hypothetical protein PHAVU_005G129500g             139   1e-35   Phaseolus vulgaris [French bean]
ref|XP_007011978.1|  Alpha/beta-Hydrolases superfamily protein is...    139   2e-35   
emb|CDY09173.1|  BnaA02g05990D                                          139   2e-35   Brassica napus [oilseed rape]
ref|XP_009126572.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        139   2e-35   Brassica rapa
ref|XP_010525816.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        139   2e-35   
ref|XP_010421084.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    139   2e-35   
gb|KJB07579.1|  hypothetical protein B456_001G030800                    139   2e-35   Gossypium raimondii
gb|KJB07578.1|  hypothetical protein B456_001G030800                    139   2e-35   Gossypium raimondii
gb|KHG29529.1|  Lysosomal Pro-X carboxypeptidase                        139   2e-35   Gossypium arboreum [tree cotton]
ref|XP_006343677.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    139   3e-35   Solanum tuberosum [potatoes]
ref|XP_010421083.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    139   3e-35   Camelina sativa [gold-of-pleasure]
gb|EPS59259.1|  hypothetical protein M569_15548                         139   3e-35   Genlisea aurea
ref|XP_004242567.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        139   3e-35   Solanum lycopersicum
emb|CDY20293.1|  BnaC04g36630D                                          139   3e-35   Brassica napus [oilseed rape]
ref|XP_002523750.1|  Lysosomal Pro-X carboxypeptidase, putative         138   4e-35   Ricinus communis
ref|XP_007011977.1|  Alpha/beta-Hydrolases superfamily protein is...    138   4e-35   
ref|XP_007155791.1|  hypothetical protein PHAVU_003G232100g             138   4e-35   Phaseolus vulgaris [French bean]
gb|EMT30656.1|  Lysosomal Pro-X carboxypeptidase                        138   5e-35   
gb|AGV54352.1|  lysosomal Pro-X carboxypeptidase-like protein           138   6e-35   Phaseolus vulgaris [French bean]
ref|XP_002313554.2|  hypothetical protein POPTR_0009s00750g             138   6e-35   
ref|XP_007155790.1|  hypothetical protein PHAVU_003G232100g             138   7e-35   Phaseolus vulgaris [French bean]
ref|XP_003517871.2|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    138   7e-35   Glycine max [soybeans]
ref|XP_006388622.1|  hypothetical protein POPTR_0135s002102g            136   8e-35   
emb|CBI18675.3|  unnamed protein product                                137   8e-35   Vitis vinifera
ref|XP_009631310.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        137   9e-35   
ref|XP_003633162.2|  PREDICTED: lysosomal Pro-X carboxypeptidase        137   1e-34   
ref|XP_011073662.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        137   1e-34   Sesamum indicum [beniseed]
ref|XP_004487553.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    137   1e-34   Cicer arietinum [garbanzo]
gb|KJB54926.1|  hypothetical protein B456_009G054400                    137   1e-34   Gossypium raimondii
ref|XP_010493397.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    136   1e-34   
ref|XP_010316042.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    137   1e-34   Solanum lycopersicum
ref|XP_004231954.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    137   1e-34   Solanum lycopersicum
ref|XP_010493394.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    137   2e-34   Camelina sativa [gold-of-pleasure]
ref|XP_004980174.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    137   2e-34   
ref|XP_006294084.1|  hypothetical protein CARUB_v10023078mg             137   2e-34   Capsella rubella
ref|XP_010419296.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    136   2e-34   
ref|XP_009785587.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    137   2e-34   Nicotiana sylvestris
ref|XP_004145825.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    136   2e-34   Cucumis sativus [cucumbers]
ref|XP_011017985.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    136   2e-34   Populus euphratica
ref|XP_008458662.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    136   2e-34   Cucumis melo [Oriental melon]
ref|XP_006404933.1|  hypothetical protein EUTSA_v10000143mg             136   2e-34   Eutrema salsugineum [saltwater cress]
ref|XP_002324555.2|  serine carboxypeptidase S28 family protein         136   2e-34   Populus trichocarpa [western balsam poplar]
gb|KJB54925.1|  hypothetical protein B456_009G054400                    136   2e-34   Gossypium raimondii
ref|XP_010472431.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    136   3e-34   Camelina sativa [gold-of-pleasure]
gb|EYU25337.1|  hypothetical protein MIMGU_mgv1a004964mg                136   3e-34   Erythranthe guttata [common monkey flower]
ref|XP_006424403.1|  hypothetical protein CICLE_v10028401mg             135   3e-34   
ref|XP_006484933.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    135   4e-34   Citrus sinensis [apfelsine]
ref|XP_001776094.1|  predicted protein                                  135   4e-34   
gb|KJB35194.1|  hypothetical protein B456_006G103600                    135   4e-34   Gossypium raimondii
ref|XP_009773191.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        135   4e-34   Nicotiana sylvestris
gb|ABR16397.1|  unknown                                                 135   5e-34   Picea sitchensis
ref|XP_010454563.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    135   8e-34   Camelina sativa [gold-of-pleasure]
ref|XP_010419297.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    137   8e-34   
gb|KHG27095.1|  Lysosomal Pro-X carboxypeptidase                        135   8e-34   Gossypium arboreum [tree cotton]
ref|XP_010267351.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    134   8e-34   
ref|XP_010047139.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        135   9e-34   Eucalyptus grandis [rose gum]
ref|XP_007150128.1|  hypothetical protein PHAVU_005G129100g             135   9e-34   Phaseolus vulgaris [French bean]
ref|XP_004160099.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    134   1e-33   
emb|CDY28234.1|  BnaA01g06150D                                          131   1e-33   Brassica napus [oilseed rape]
gb|KHG26338.1|  Lysosomal Pro-X carboxypeptidase                        134   1e-33   Gossypium arboreum [tree cotton]
ref|XP_006363792.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    134   1e-33   Solanum tuberosum [potatoes]
ref|XP_011005419.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    134   1e-33   Populus euphratica
ref|XP_006494707.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    133   1e-33   Citrus sinensis [apfelsine]
ref|XP_010026544.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    134   1e-33   Eucalyptus grandis [rose gum]
ref|XP_011089978.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    134   1e-33   Sesamum indicum [beniseed]
gb|KCW59597.1|  hypothetical protein EUGRSUZ_H02342                     134   1e-33   Eucalyptus grandis [rose gum]
ref|XP_009592890.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        134   1e-33   Nicotiana tomentosiformis
ref|XP_003576298.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    134   1e-33   Brachypodium distachyon [annual false brome]
ref|XP_010429398.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    134   2e-33   Camelina sativa [gold-of-pleasure]
ref|XP_006494702.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    132   2e-33   Citrus sinensis [apfelsine]
gb|KFK32665.1|  serine carboxypeptidase s28 family protein              134   2e-33   Arabis alpina [alpine rockcress]
ref|XP_009150668.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        134   2e-33   Brassica rapa
ref|XP_006494706.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    132   2e-33   Citrus sinensis [apfelsine]
emb|CDY08753.1|  BnaA06g24710D                                          134   2e-33   Brassica napus [oilseed rape]
gb|KFK28424.1|  hypothetical protein AALP_AA8G512800                    134   2e-33   Arabis alpina [alpine rockcress]
ref|XP_006657192.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    134   2e-33   Oryza brachyantha
ref|XP_009591854.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    133   2e-33   
ref|XP_007016018.1|  Serine carboxypeptidase S28 family protein         134   2e-33   
ref|XP_009779688.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    134   2e-33   Nicotiana sylvestris
ref|XP_006408695.1|  hypothetical protein EUTSA_v10001967mg             134   2e-33   Eutrema salsugineum [saltwater cress]
ref|XP_006349129.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    133   2e-33   
ref|XP_010254367.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    133   3e-33   Nelumbo nucifera [Indian lotus]
ref|XP_010254366.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    133   3e-33   Nelumbo nucifera [Indian lotus]
ref|XP_010023342.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    133   3e-33   Eucalyptus grandis [rose gum]
ref|XP_010444594.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    133   3e-33   Camelina sativa [gold-of-pleasure]
ref|XP_007207893.1|  hypothetical protein PRUPE_ppa021011mg             133   3e-33   
ref|XP_010463531.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    133   3e-33   Camelina sativa [gold-of-pleasure]
ref|XP_006349128.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    133   3e-33   
ref|XP_008228032.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    133   4e-33   
ref|XP_002271961.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    133   4e-33   Vitis vinifera
gb|KJB09004.1|  hypothetical protein B456_001G118300                    133   4e-33   Gossypium raimondii
ref|XP_010651746.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    132   4e-33   Vitis vinifera
ref|XP_007205160.1|  hypothetical protein PRUPE_ppa005445mg             131   4e-33   
emb|CDY45627.1|  BnaCnng13350D                                          133   4e-33   Brassica napus [oilseed rape]
ref|XP_010680789.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    132   4e-33   
ref|XP_002324914.2|  hypothetical protein POPTR_0018s02600g             132   4e-33   Populus trichocarpa [western balsam poplar]
ref|XP_010518734.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        133   4e-33   Tarenaya hassleriana [spider flower]
ref|XP_003563318.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        133   5e-33   Brachypodium distachyon [annual false brome]
ref|XP_004295648.2|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    132   5e-33   Fragaria vesca subsp. vesca
ref|XP_009390988.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        132   5e-33   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002438750.1|  hypothetical protein SORBIDRAFT_10g025520          133   5e-33   Sorghum bicolor [broomcorn]
ref|XP_004250994.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    132   5e-33   Solanum lycopersicum
ref|XP_006488629.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    132   7e-33   
gb|KJB35187.1|  hypothetical protein B456_006G103400                    132   7e-33   Gossypium raimondii
ref|NP_001065793.1|  Os11g0156200                                       132   7e-33   
dbj|BAJ92142.1|  predicted protein                                      132   8e-33   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004251370.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    132   8e-33   Solanum lycopersicum
ref|XP_010099406.1|  Lysosomal Pro-X carboxypeptidase                   132   9e-33   Morus notabilis
dbj|BAJ86079.1|  predicted protein                                      132   9e-33   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KDP32459.1|  hypothetical protein JCGZ_13384                         132   9e-33   Jatropha curcas
ref|NP_001058206.1|  Os06g0647400                                       132   9e-33   
ref|XP_008344907.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    130   1e-32   
dbj|BAJ87416.1|  predicted protein                                      132   1e-32   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CBI17112.3|  unnamed protein product                                132   1e-32   Vitis vinifera
ref|XP_008360152.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    129   1e-32   
gb|KCW59601.1|  hypothetical protein EUGRSUZ_H023452                    131   1e-32   Eucalyptus grandis [rose gum]
ref|XP_006408697.1|  hypothetical protein EUTSA_v10002179mg             131   1e-32   
ref|XP_007205161.1|  hypothetical protein PRUPE_ppa005445mg             130   1e-32   
gb|EAY80009.1|  hypothetical protein OsI_35177                          131   1e-32   Oryza sativa Indica Group [Indian rice]
gb|KHN38601.1|  Lysosomal Pro-X carboxypeptidase                        131   1e-32   Glycine soja [wild soybean]
gb|EYU36116.1|  hypothetical protein MIMGU_mgv1a004675mg                131   1e-32   Erythranthe guttata [common monkey flower]
gb|KCW59600.1|  hypothetical protein EUGRSUZ_H023452                    131   1e-32   Eucalyptus grandis [rose gum]
ref|XP_006280309.1|  hypothetical protein CARUB_v10026232mg             131   1e-32   Capsella rubella
ref|XP_008344905.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    130   2e-32   
ref|XP_007205162.1|  hypothetical protein PRUPE_ppa005445mg             131   2e-32   
ref|XP_004965729.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    131   2e-32   Setaria italica
emb|CAN63232.1|  hypothetical protein VITISV_004830                     130   2e-32   Vitis vinifera
ref|XP_008385547.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    128   2e-32   
ref|XP_011036743.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    131   2e-32   Populus euphratica
ref|XP_010023346.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    131   2e-32   Eucalyptus grandis [rose gum]
ref|XP_004145770.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    130   2e-32   Cucumis sativus [cucumbers]
gb|KCW84338.1|  hypothetical protein EUGRSUZ_B01187                     130   2e-32   Eucalyptus grandis [rose gum]
gb|EEC81080.1|  hypothetical protein OsI_23902                          130   3e-32   Oryza sativa Indica Group [Indian rice]
gb|KCW50724.1|  hypothetical protein EUGRSUZ_J00402                     130   3e-32   Eucalyptus grandis [rose gum]
ref|XP_008659849.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    130   3e-32   Zea mays [maize]
ref|XP_010036093.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    130   3e-32   Eucalyptus grandis [rose gum]
ref|XP_008237071.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        130   3e-32   Prunus mume [ume]
gb|AFW87519.1|  putative serine peptidase S28 family protein            130   3e-32   
ref|XP_007208680.1|  hypothetical protein PRUPE_ppa025450mg             130   4e-32   Prunus persica
ref|XP_009342192.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    130   4e-32   Pyrus x bretschneideri [bai li]
ref|XP_002271733.2|  PREDICTED: lysosomal Pro-X carboxypeptidase        130   5e-32   Vitis vinifera
ref|XP_003549991.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    130   5e-32   Glycine max [soybeans]
ref|XP_010031430.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    130   5e-32   
ref|XP_009127344.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    130   5e-32   Brassica rapa
emb|CAA16683.1|  lysosomal Pro-X carboxypeptidase - like protein        129   7e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006380821.1|  hypothetical protein POPTR_0007s14600g             129   8e-32   
ref|XP_011031335.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        129   8e-32   Populus euphratica
gb|KJB18076.1|  hypothetical protein B456_003G033300                    129   8e-32   Gossypium raimondii
gb|KJB18075.1|  hypothetical protein B456_003G033300                    129   8e-32   Gossypium raimondii
gb|KDO60326.1|  hypothetical protein CISIN_1g023618mg                   125   8e-32   Citrus sinensis [apfelsine]
ref|XP_010535638.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        129   9e-32   Tarenaya hassleriana [spider flower]
ref|XP_008661011.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    129   9e-32   Zea mays [maize]
ref|NP_201377.2|  Serine carboxypeptidase S28 family protein            129   9e-32   Arabidopsis thaliana [mouse-ear cress]
dbj|BAB10683.1|  lysosomal Pro-X carboxypeptidase                       129   1e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002310325.2|  hypothetical protein POPTR_0007s14600g             129   1e-31   
ref|XP_002523752.1|  Lysosomal Pro-X carboxypeptidase, putative         129   1e-31   Ricinus communis
gb|EYU41362.1|  hypothetical protein MIMGU_mgv1a0060842mg               126   1e-31   Erythranthe guttata [common monkey flower]
ref|XP_006424410.1|  hypothetical protein CICLE_v10030022mg             128   1e-31   
gb|AAL77662.1|  AT5g65760/MPA24_11                                      129   1e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008458664.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    128   1e-31   
ref|XP_006393989.1|  hypothetical protein EUTSA_v10003988mg             129   1e-31   Eutrema salsugineum [saltwater cress]
ref|XP_011466418.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    129   1e-31   Fragaria vesca subsp. vesca
ref|XP_004288288.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    129   1e-31   Fragaria vesca subsp. vesca
gb|KDO60325.1|  hypothetical protein CISIN_1g023618mg                   125   1e-31   Citrus sinensis [apfelsine]
ref|XP_008458663.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    128   1e-31   Cucumis melo [Oriental melon]
emb|CAN64373.1|  hypothetical protein VITISV_018663                     130   1e-31   Vitis vinifera
ref|XP_010100139.1|  Lysosomal Pro-X carboxypeptidase                   130   1e-31   
ref|XP_002270231.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        128   2e-31   Vitis vinifera
ref|XP_006424414.1|  hypothetical protein CICLE_v100282721mg            127   2e-31   
ref|XP_009356983.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    128   2e-31   Pyrus x bretschneideri [bai li]
gb|EMT03388.1|  Lysosomal Pro-X carboxypeptidase                        127   2e-31   
gb|KCW50729.1|  hypothetical protein EUGRSUZ_J00403                     126   3e-31   
ref|XP_009356965.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    127   3e-31   
ref|XP_008226847.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    127   3e-31   
emb|CAN65360.1|  hypothetical protein VITISV_036071                     128   3e-31   
ref|XP_009356964.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    127   3e-31   
gb|KGN46898.1|  hypothetical protein Csa_6G149390                       127   4e-31   
emb|CBI17113.3|  unnamed protein product                                128   4e-31   
ref|XP_008349805.1|  PREDICTED: uncharacterized protein LOC103413093    130   4e-31   
ref|XP_008458665.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    127   4e-31   
gb|EMT13135.1|  Lysosomal Pro-X carboxypeptidase                        127   4e-31   
ref|XP_004145824.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    127   4e-31   
ref|XP_004160098.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    127   4e-31   
ref|XP_002523754.1|  Lysosomal Pro-X carboxypeptidase, putative         127   5e-31   
ref|XP_010527988.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    127   5e-31   
gb|KCW50728.1|  hypothetical protein EUGRSUZ_J00403                     126   5e-31   
ref|XP_010031433.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    127   5e-31   
ref|XP_004295650.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    127   6e-31   
emb|CBI17109.3|  unnamed protein product                                129   6e-31   
ref|XP_010100142.1|  Lysosomal Pro-X carboxypeptidase                   127   6e-31   
gb|KCW50727.1|  hypothetical protein EUGRSUZ_J00403                     126   6e-31   
ref|XP_010031429.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    126   7e-31   
ref|XP_002869352.1|  serine carboxypeptidase S28 family protein         126   7e-31   
gb|EMS54705.1|  Lysosomal Pro-X carboxypeptidase                        127   9e-31   
gb|KFK43799.1|  hypothetical protein AALP_AA1G174100                    126   9e-31   
gb|EMS54706.1|  Lysosomal Pro-X carboxypeptidase                        127   1e-30   
ref|XP_002108777.1|  hypothetical protein TRIADDRAFT_19181              125   1e-30   
gb|KDO36925.1|  hypothetical protein CISIN_1g023602mg                   122   1e-30   
ref|XP_010031431.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    125   2e-30   
emb|CDP02648.1|  unnamed protein product                                125   2e-30   
gb|KDO36924.1|  hypothetical protein CISIN_1g023602mg                   123   2e-30   
gb|KCW50722.1|  hypothetical protein EUGRSUZ_J00400                     125   2e-30   
ref|XP_006285773.1|  hypothetical protein CARUB_v10007247mg             125   2e-30   
gb|EMT22763.1|  Lysosomal Pro-X carboxypeptidase                        123   2e-30   
gb|KJB55686.1|  hypothetical protein B456_009G088900                    125   3e-30   
ref|XP_007016017.1|  Serine carboxypeptidase S28 family protein         125   3e-30   
ref|XP_002874097.1|  serine carboxypeptidase S28 family protein         125   3e-30   
ref|XP_006424417.1|  hypothetical protein CICLE_v10028252mg             125   3e-30   
gb|EEE51674.1|  hypothetical protein OsJ_33022                          120   3e-30   
ref|XP_004509045.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    124   4e-30   
gb|KDO78810.1|  hypothetical protein CISIN_1g0096312mg                  122   4e-30   
ref|XP_010100140.1|  Lysosomal Pro-X carboxypeptidase                   124   5e-30   
ref|XP_010432914.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    124   6e-30   
ref|XP_002263389.2|  PREDICTED: lysosomal Pro-X carboxypeptidase        124   6e-30   
gb|EMT22761.1|  Lysosomal Pro-X carboxypeptidase                        124   8e-30   
ref|XP_002271797.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        123   8e-30   
gb|KDP43936.1|  hypothetical protein JCGZ_05403                         123   1e-29   
emb|CAN64374.1|  hypothetical protein VITISV_018664                     123   1e-29   
ref|XP_004151265.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    122   1e-29   
gb|KDO78808.1|  hypothetical protein CISIN_1g0096312mg                  122   1e-29   
ref|XP_002438752.1|  hypothetical protein SORBIDRAFT_10g025540          121   1e-29   
gb|KCW50734.1|  hypothetical protein EUGRSUZ_J00406                     122   2e-29   
gb|KDO78806.1|  hypothetical protein CISIN_1g0096312mg                  122   2e-29   
ref|XP_004293172.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    122   2e-29   
ref|XP_010034149.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    124   2e-29   
gb|KDO78803.1|  hypothetical protein CISIN_1g0096312mg                  122   2e-29   
ref|XP_006287572.1|  hypothetical protein CARUB_v10000782mg             122   2e-29   
ref|XP_010031432.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    122   2e-29   
gb|EEC81081.1|  hypothetical protein OsI_23904                          119   2e-29   
ref|XP_006424406.1|  hypothetical protein CICLE_v10030241mg             122   3e-29   
ref|XP_006378927.1|  hypothetical protein POPTR_0009s00740g             121   3e-29   
ref|NP_851059.1|  Serine carboxypeptidase S28 family protein            122   3e-29   
emb|CDP17394.1|  unnamed protein product                                122   3e-29   
ref|XP_006487982.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    122   3e-29   
ref|XP_010093782.1|  Lysosomal Pro-X carboxypeptidase                   121   3e-29   
gb|AFW76173.1|  putative serine peptidase S28 family protein            119   4e-29   
gb|KDO44739.1|  hypothetical protein CISIN_1g047044mg                   119   4e-29   
gb|KDP32128.1|  hypothetical protein JCGZ_12589                         122   4e-29   
ref|NP_197677.2|  Serine carboxypeptidase S28 family protein            121   4e-29   
ref|XP_002313555.2|  hypothetical protein POPTR_0009s00740g             121   5e-29   
ref|XP_006378926.1|  hypothetical protein POPTR_0009s00740g             121   5e-29   
ref|XP_006369370.1|  hypothetical protein POPTR_0001s220902g            120   5e-29   
gb|KDO44737.1|  hypothetical protein CISIN_1g038117mg                   121   6e-29   
ref|XP_006466409.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    121   6e-29   
gb|ACR34132.1|  unknown                                                 120   8e-29   
gb|KCW50737.1|  hypothetical protein EUGRSUZ_J00408                     120   8e-29   
ref|XP_010034145.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    120   9e-29   
ref|XP_006369369.1|  hypothetical protein POPTR_0001s220902g            120   1e-28   
ref|XP_010031434.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    120   1e-28   
ref|XP_006388621.1|  hypothetical protein POPTR_0135s00200g             120   1e-28   
ref|XP_006369368.1|  hypothetical protein POPTR_0001s220902g            120   1e-28   
gb|AAM61502.1|  prolylcarboxypeptidase-like protein                     120   1e-28   
ref|XP_006369365.1|  hypothetical protein POPTR_0001s220902g            120   1e-28   
ref|XP_006369367.1|  hypothetical protein POPTR_0001s220902g            120   1e-28   
ref|XP_011004991.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    120   1e-28   
ref|XP_011403304.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    119   1e-28   
gb|KCW50433.1|  hypothetical protein EUGRSUZ_J00172                     120   1e-28   
ref|XP_011005222.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    120   1e-28   
ref|XP_006424411.1|  hypothetical protein CICLE_v10028519mg             119   1e-28   
gb|KEH31545.1|  serine carboxypeptidase S28 family protein              120   1e-28   
emb|CDP07008.1|  unnamed protein product                                120   2e-28   
gb|ACO10272.1|  Lysosomal Pro-X carboxypeptidase precursor              119   2e-28   
ref|XP_011005420.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    119   2e-28   
ref|XP_004172321.1|  PREDICTED: LOW QUALITY PROTEIN: lysosomal Pr...    119   2e-28   
ref|XP_007016019.1|  Serine carboxypeptidase S28 family protein, ...    119   2e-28   
ref|XP_006426159.1|  hypothetical protein CICLE_v10025375mg             119   2e-28   
ref|XP_008798889.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    119   3e-28   
ref|XP_011004990.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    119   3e-28   
ref|XP_011005221.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    119   3e-28   
ref|XP_008464256.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    118   3e-28   
ref|XP_006485136.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    119   3e-28   
ref|XP_002601798.1|  hypothetical protein BRAFLDRAFT_279167             119   3e-28   
ref|XP_008798888.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    119   3e-28   
ref|XP_006424409.1|  hypothetical protein CICLE_v10030113mg             119   4e-28   
ref|XP_002874100.1|  hypothetical protein ARALYDRAFT_910290             119   4e-28   
ref|NP_001142279.1|  uncharacterized protein LOC100274448 precursor     119   6e-28   
gb|KCW50493.1|  hypothetical protein EUGRSUZ_J00219                     118   6e-28   
ref|XP_006495294.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    115   9e-28   
ref|XP_002315345.1|  hypothetical protein POPTR_0010s23860g             118   1e-27   
ref|XP_006484930.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    115   1e-27   
gb|ACO10617.1|  Lysosomal Pro-X carboxypeptidase precursor              117   2e-27   
gb|KCW50732.1|  hypothetical protein EUGRSUZ_J00405                     117   2e-27   
ref|XP_010034183.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    117   2e-27   
ref|XP_972807.1|  PREDICTED: lysosomal Pro-X carboxypeptidase           116   3e-27   
ref|XP_002299661.1|  hypothetical protein POPTR_0001s22070g             116   3e-27   
gb|ACG41459.1|  lysosomal Pro-X carboxypeptidase precursor              117   3e-27   
gb|AFW87518.1|  putative serine peptidase S28 family protein            119   4e-27   
ref|XP_002962799.1|  hypothetical protein SELMODRAFT_78251              115   4e-27   
ref|XP_002962483.1|  hypothetical protein SELMODRAFT_78660              115   4e-27   
ref|XP_002399549.1|  prolylcarboxypeptidase, putative                   114   4e-27   
ref|XP_003596267.1|  Lysosomal Pro-X carboxypeptidase                   115   4e-27   
ref|XP_002864979.1|  serine carboxypeptidase S28 family protein         115   6e-27   
emb|CDY09174.1|  BnaA02g06000D                                          115   6e-27   
ref|XP_009406760.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    115   6e-27   
ref|XP_009406759.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    115   7e-27   
gb|KFK36399.1|  hypothetical protein AALP_AA4G119300                    117   9e-27   
ref|XP_010497694.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    108   1e-26   
ref|XP_006495097.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    115   1e-26   
ref|XP_002109366.1|  hypothetical protein TRIADDRAFT_21030              114   1e-26   
ref|XP_002737003.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    114   1e-26   
ref|XP_002424063.1|  Lysosomal Pro-X carboxypeptidase, putative         114   1e-26   
ref|XP_002127825.3|  PREDICTED: lysosomal Pro-X carboxypeptidase        114   1e-26   
ref|XP_010794419.1|  PREDICTED: dipeptidyl peptidase 2                  114   1e-26   
ref|XP_006640629.1|  PREDICTED: dipeptidyl peptidase 2-like             114   2e-26   
gb|EMP29991.1|  Dipeptidyl peptidase 2                                  114   2e-26   
gb|AEE61895.1|  unknown                                                 114   2e-26   
gb|EYC16010.1|  hypothetical protein Y032_0035g3093                     109   2e-26   
ref|XP_005038441.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        114   2e-26   
ref|XP_010943424.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        114   2e-26   
ref|XP_006369363.1|  hypothetical protein POPTR_0001s22060g             114   3e-26   
ref|XP_006436579.1|  hypothetical protein CICLE_v10033867mg             113   3e-26   
ref|XP_007066121.1|  PREDICTED: dipeptidyl peptidase 2                  114   3e-26   
ref|XP_006286678.1|  hypothetical protein CARUB_v10002667mg             113   3e-26   
gb|KDR15687.1|  Lysosomal Pro-X carboxypeptidase                        113   3e-26   
ref|XP_011438787.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    113   4e-26   
gb|ACJ72063.1|  prolylcarboxypeptidase                                  110   4e-26   
ref|XP_006485335.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    112   5e-26   
ref|XP_002874098.1|  serine carboxypeptidase S28 family protein         112   6e-26   
ref|XP_008122266.1|  PREDICTED: dipeptidyl peptidase 2                  112   6e-26   
emb|CCQ71326.1|  hypothetical Pro-X carboxypeptidase-like protein...    112   6e-26   
ref|XP_011260887.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        112   7e-26   
ref|XP_008333819.1|  PREDICTED: dipeptidyl peptidase 2 isoform X2       112   7e-26   
ref|XP_004364392.1|  prolylcarboxypeptidase                             112   8e-26   
ref|NP_001013333.1|  dipeptidyl peptidase 2 precursor                   112   9e-26   
ref|XP_008333821.1|  PREDICTED: dipeptidyl peptidase 2 isoform X4       111   1e-25   
ref|XP_002188561.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        111   1e-25   
gb|AAH95721.1|  Dpp7 protein                                            111   1e-25   
ref|XP_005171903.1|  PREDICTED: dipeptidyl peptidase 2 isoform X1       112   1e-25   
ref|XP_010683431.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        112   2e-25   
ref|XP_008333818.1|  PREDICTED: dipeptidyl peptidase 2 isoform X1       111   2e-25   
ref|XP_006022789.1|  PREDICTED: dipeptidyl peptidase 2                  111   2e-25   
ref|XP_005095813.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    111   2e-25   
ref|XP_002408973.1|  prolylcarboxypeptidase, putative                   110   2e-25   
ref|XP_003569899.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        111   2e-25   
ref|XP_002609737.1|  hypothetical protein BRAFLDRAFT_78548              110   2e-25   
dbj|BAK01568.1|  predicted protein                                      111   2e-25   
ref|XP_006264912.1|  PREDICTED: dipeptidyl peptidase 2                  111   3e-25   
gb|AGM32450.1|  heat shock protein-like protein                         108   3e-25   
ref|XP_797434.3|  PREDICTED: dipeptidyl peptidase 2-like                110   3e-25   
emb|CAF90249.1|  unnamed protein product                                110   4e-25   
gb|AFW84965.1|  putative serine peptidase S28 family protein            110   4e-25   
ref|XP_008654499.1|  PREDICTED: uncharacterized protein LOC100217...    110   4e-25   
ref|XP_009062874.1|  hypothetical protein LOTGIDRAFT_235397             110   5e-25   
emb|CAF90612.1|  unnamed protein product                                110   5e-25   
ref|XP_009100981.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        110   6e-25   
gb|KFV12726.1|  Dipeptidyl peptidase 2                                  108   6e-25   
ref|XP_005485885.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        109   6e-25   
ref|XP_002458558.1|  hypothetical protein SORBIDRAFT_03g035680          110   6e-25   
ref|XP_010078682.1|  PREDICTED: dipeptidyl peptidase 2                  108   6e-25   
ref|XP_005510815.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        109   6e-25   
ref|XP_003203584.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        110   6e-25   
ref|XP_010874484.1|  PREDICTED: dipeptidyl peptidase 2                  110   7e-25   
ref|XP_010152633.1|  PREDICTED: dipeptidyl peptidase 2-like             105   7e-25   
gb|ACA09612.1|  prolyl carboxypeptidase                                 109   9e-25   
ref|XP_425654.3|  PREDICTED: lysosomal Pro-X carboxypeptidase           109   1e-24   
emb|CDQ87513.1|  unnamed protein product                                109   1e-24   
gb|ELU04397.1|  hypothetical protein CAPTEDRAFT_174591                  109   1e-24   
gb|AJC98200.1|  AGAP000994                                              108   1e-24   
gb|ETN60051.1|  lysosomal Pro-X carboxypeptidase                        108   1e-24   
ref|XP_309189.4|  AGAP000994-PA                                         108   1e-24   
ref|XP_011478128.1|  PREDICTED: dipeptidyl peptidase 2                  108   1e-24   
gb|ACO09321.1|  Dipeptidyl-peptidase 2 precursor                        109   1e-24   
gb|EFX79132.1|  hypothetical protein DAPPUDRAFT_225197                  108   1e-24   
ref|XP_010738027.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        109   1e-24   
ref|XP_005026125.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        108   1e-24   
ref|XP_005807458.1|  PREDICTED: dipeptidyl peptidase 2-like             108   2e-24   
ref|XP_011333559.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        108   2e-24   
gb|ACE75375.1|  prolylcarboxypeptidase                                  108   2e-24   
emb|CDM83096.1|  unnamed protein product                                108   2e-24   
gb|KFB48883.1|  AGAP000994-PA-like protein                              108   3e-24   
ref|XP_010863507.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        108   3e-24   
gb|KFV77829.1|  Dipeptidyl peptidase 2                                  108   3e-24   
ref|XP_009666336.1|  PREDICTED: dipeptidyl peptidase 2                  108   3e-24   
ref|XP_002401170.1|  prolylcarboxypeptidase, putative                   108   3e-24   
gb|KGL81500.1|  Dipeptidyl peptidase 2                                  107   3e-24   
ref|XP_010139237.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        107   3e-24   
ref|XP_010219032.1|  PREDICTED: dipeptidyl peptidase 2                  107   3e-24   
ref|XP_005231403.1|  PREDICTED: dipeptidyl peptidase 2                  107   3e-24   
gb|ELU17643.1|  hypothetical protein CAPTEDRAFT_152094                  107   3e-24   
ref|XP_002599211.1|  hypothetical protein BRAFLDRAFT_200045             107   3e-24   
ref|XP_010399419.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        108   4e-24   
ref|NP_001044360.1|  Os01g0767100                                       108   4e-24   
ref|XP_001651053.1|  AAEL005521-PA                                      107   4e-24   
ref|XP_010190194.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    104   4e-24   
ref|XP_008307030.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        107   4e-24   
ref|XP_011053362.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        107   5e-24   
ref|XP_003968706.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    107   5e-24   
ref|XP_002681417.1|  lysosomal carboxypeptidase                         107   6e-24   
gb|AJC98202.1|  AGAP000994                                              107   6e-24   
ref|XP_011162923.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        107   6e-24   
gb|EMS59622.1|  Lysosomal Pro-X carboxypeptidase                        106   6e-24   
ref|XP_008283381.1|  PREDICTED: dipeptidyl peptidase 2 isoform X1       107   6e-24   



>ref|XP_007203816.1| hypothetical protein PRUPE_ppa005504m2g, partial [Prunus persica]
 gb|EMJ05015.1| hypothetical protein PRUPE_ppa005504m2g, partial [Prunus persica]
Length=318

 Score =   187 bits (474),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 104/180 (58%), Positives = 126/180 (70%), Gaps = 13/180 (7%)
 Frame = +2

Query  23   IMNSRILLLLLFSYF------AISFAKttptfpfpfptIINEPDGFSAASTKTTYNNQVY  184
            I  S +   L FS+F       ISF+KTT        ++I  P+  SA++      N++Y
Sbjct  3    ITKSSMSPFLCFSFFFVLQFPLISFSKTTLAGARFPSSLIT-PEKVSASA-----QNKLY  56

Query  185  DTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFARETG  364
             TKYFTQILDHF F P+SYQTFQQRYLI+D +WGGAKN APIFVY G E +IE FA+  G
Sbjct  57   RTKYFTQILDHFNFYPKSYQTFQQRYLISDTFWGGAKNNAPIFVYTGNEGNIEWFAQNVG  116

Query  365  SIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKE-ATSSSKTLGYLSSTQALADYATLIIDL  541
             + E APHF  LVVFIEHRFYGKS+P+GG K  A S++ TLG+LSSTQALADYA+LI DL
Sbjct  117  FLYETAPHFKALVVFIEHRFYGKSIPYGGKKSVAYSNATTLGHLSSTQALADYASLITDL  176



>ref|XP_010246130.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Nelumbo nucifera]
Length=504

 Score =   191 bits (485),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 94/123 (76%), Positives = 102/123 (83%), Gaps = 1/123 (1%)
 Frame = +2

Query  176  QVYDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFAR  355
            Q Y+TKYFTQ LDHF F PQSYQTFQQRYLINDKYWGGA+N APIFVY G E DIE FA+
Sbjct  50   QFYETKYFTQTLDHFNFQPQSYQTFQQRYLINDKYWGGAQNNAPIFVYTGNEGDIEWFAQ  109

Query  356  ETGSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKE-ATSSSKTLGYLSSTQALADYATLI  532
             TG + E AP F  L+VFIEHRFYG S+PFGG KE A S++ TLGYLSSTQALADYATLI
Sbjct  110  NTGFMYETAPKFKALLVFIEHRFYGSSIPFGGDKEVAYSNASTLGYLSSTQALADYATLI  169

Query  533  IDL  541
            IDL
Sbjct  170  IDL  172



>gb|KEH24169.1| lysosomal pro-X carboxypeptidase-like protein [Medicago truncatula]
Length=501

 Score =   190 bits (483),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 90/124 (73%), Positives = 103/124 (83%), Gaps = 1/124 (1%)
 Frame = +2

Query  173  NQVYDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFA  352
            N +Y TK+FTQILDHF + PQSYQTFQQRYLIND YWGGAK  APIFVYMG E DI+ FA
Sbjct  49   NGLYRTKFFTQILDHFNYNPQSYQTFQQRYLINDTYWGGAKKKAPIFVYMGNEGDIQWFA  108

Query  353  RETGSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKE-ATSSSKTLGYLSSTQALADYATL  529
            + TG + E AP+FN ++VFIEHR+YGKS+PFGG  E A  +S TLGY+SSTQALADYATL
Sbjct  109  QNTGFMFEIAPYFNAILVFIEHRYYGKSIPFGGNDEVANKTSSTLGYMSSTQALADYATL  168

Query  530  IIDL  541
            IIDL
Sbjct  169  IIDL  172



>ref|XP_002308456.2| hypothetical protein POPTR_0006s22440g [Populus trichocarpa]
 gb|EEE91979.2| hypothetical protein POPTR_0006s22440g [Populus trichocarpa]
Length=504

 Score =   190 bits (482),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 91/124 (73%), Positives = 105/124 (85%), Gaps = 1/124 (1%)
 Frame = +2

Query  173  NQVYDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFA  352
            N++Y  K+FTQ+LDH+TF PQSY+TFQQRYLINDKYWGGA+  APIF+Y G E DIE FA
Sbjct  46   NELYHEKFFTQVLDHYTFRPQSYKTFQQRYLINDKYWGGAEKNAPIFLYTGNEGDIEWFA  105

Query  353  RETGSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKE-ATSSSKTLGYLSSTQALADYATL  529
            + TG I + APHF  L+VFIEHRFYGKS+PFGG KE A S+S TLGYL+STQALADYATL
Sbjct  106  QNTGFIFDIAPHFKPLLVFIEHRFYGKSMPFGGNKEVAYSNSSTLGYLTSTQALADYATL  165

Query  530  IIDL  541
            IIDL
Sbjct  166  IIDL  169



>ref|XP_006577716.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Glycine max]
Length=294

 Score =   184 bits (468),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 90/124 (73%), Positives = 103/124 (83%), Gaps = 1/124 (1%)
 Frame = +2

Query  173  NQVYDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFA  352
            N +Y TK+FTQIL HF++ PQSYQTFQQRYLIND YWGGAKN APIFVYMG E DIE  A
Sbjct  48   NGLYTTKFFTQILGHFSYNPQSYQTFQQRYLINDTYWGGAKNNAPIFVYMGNEGDIEWIA  107

Query  353  RETGSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKE-ATSSSKTLGYLSSTQALADYATL  529
            + TG + + AP+F  L+VFIEHR+YGKS PFGG +E A ++S TLGYLSSTQALADYATL
Sbjct  108  QITGFMFDTAPYFKALLVFIEHRYYGKSFPFGGNEEVANANSSTLGYLSSTQALADYATL  167

Query  530  IIDL  541
            IIDL
Sbjct  168  IIDL  171



>ref|XP_008350184.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Malus domestica]
Length=514

 Score =   189 bits (480),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 91/124 (73%), Positives = 105/124 (85%), Gaps = 1/124 (1%)
 Frame = +2

Query  173  NQVYDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFA  352
            NQ+Y T+YFTQILDHF F P+SYQTFQQRYLIND +WGGAK+ APIFVY G E +IE FA
Sbjct  56   NQLYRTRYFTQILDHFNFYPKSYQTFQQRYLINDTHWGGAKSNAPIFVYTGNEGNIEWFA  115

Query  353  RETGSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKE-ATSSSKTLGYLSSTQALADYATL  529
            + TG + E APHF  L+VFIEHRFYGKS+P+GG KE A S++ TLGYLSSTQALADYA+L
Sbjct  116  QNTGFLYETAPHFKALIVFIEHRFYGKSIPYGGNKEVAYSNATTLGYLSSTQALADYASL  175

Query  530  IIDL  541
            IIDL
Sbjct  176  IIDL  179



>ref|XP_011046918.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Populus euphratica]
Length=504

 Score =   189 bits (480),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 91/124 (73%), Positives = 105/124 (85%), Gaps = 1/124 (1%)
 Frame = +2

Query  173  NQVYDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFA  352
            +++Y  K+FTQ+LDH+TF PQSY+TFQQRYLINDKYWGGA+  APIF+Y G E DIE FA
Sbjct  46   HELYHEKFFTQVLDHYTFRPQSYKTFQQRYLINDKYWGGAEKNAPIFLYTGNEGDIEWFA  105

Query  353  RETGSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKE-ATSSSKTLGYLSSTQALADYATL  529
            + TG I + APHF  LVVFIEHRFYGKS+PFGG KE A S+S TLGYL+STQALADYATL
Sbjct  106  QNTGFIFDIAPHFKPLVVFIEHRFYGKSMPFGGNKEVAYSNSSTLGYLTSTQALADYATL  165

Query  530  IIDL  541
            IIDL
Sbjct  166  IIDL  169



>ref|XP_009801420.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Nicotiana sylvestris]
Length=508

 Score =   189 bits (479),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 91/124 (73%), Positives = 102/124 (82%), Gaps = 1/124 (1%)
 Frame = +2

Query  173  NQVYDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFA  352
            N++Y+TKYFTQILDHF + P SYQTFQQRYL NDK WGGAK  APIFVY G E DIE F 
Sbjct  49   NKLYETKYFTQILDHFNYNPDSYQTFQQRYLFNDKNWGGAKTNAPIFVYTGNEGDIEWFT  108

Query  353  RETGSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKE-ATSSSKTLGYLSSTQALADYATL  529
            + TG + E APHF  L+VFIEHRFYGKS+P+GG KE A S++ TLGYLSSTQALADYATL
Sbjct  109  QNTGFMFEIAPHFKALLVFIEHRFYGKSIPYGGDKEIAYSNTSTLGYLSSTQALADYATL  168

Query  530  IIDL  541
            IIDL
Sbjct  169  IIDL  172



>gb|KJB16581.1| hypothetical protein B456_002G237800 [Gossypium raimondii]
Length=436

 Score =   187 bits (474),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 89/129 (69%), Positives = 104/129 (81%), Gaps = 1/129 (1%)
 Frame = +2

Query  158  KTTYNNQVYDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDD  337
            K++  N++Y TKYFTQILDHF F P+SYQ FQ RYLIND YWGG K  +PIFVY G E D
Sbjct  48   KSSGTNKLYKTKYFTQILDHFNFNPKSYQKFQHRYLINDTYWGGPKKNSPIFVYTGNEGD  107

Query  338  IEPFARETGSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKE-ATSSSKTLGYLSSTQALA  514
            IE FA+ TG + + APHF  L+VFIEHRFYGKS+PFGG K+ A S++ TLGYL+STQALA
Sbjct  108  IEWFAQNTGFMFDIAPHFQALLVFIEHRFYGKSIPFGGDKDVAYSNASTLGYLTSTQALA  167

Query  515  DYATLIIDL  541
            DYATLIIDL
Sbjct  168  DYATLIIDL  176



>gb|KJB16583.1| hypothetical protein B456_002G237800 [Gossypium raimondii]
Length=436

 Score =   187 bits (474),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 89/129 (69%), Positives = 104/129 (81%), Gaps = 1/129 (1%)
 Frame = +2

Query  158  KTTYNNQVYDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDD  337
            K++  N++Y TKYFTQILDHF F P+SYQ FQ RYLIND YWGG K  +PIFVY G E D
Sbjct  48   KSSGTNKLYKTKYFTQILDHFNFNPKSYQKFQHRYLINDTYWGGPKKNSPIFVYTGNEGD  107

Query  338  IEPFARETGSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKE-ATSSSKTLGYLSSTQALA  514
            IE FA+ TG + + APHF  L+VFIEHRFYGKS+PFGG K+ A S++ TLGYL+STQALA
Sbjct  108  IEWFAQNTGFMFDIAPHFQALLVFIEHRFYGKSIPFGGDKDVAYSNASTLGYLTSTQALA  167

Query  515  DYATLIIDL  541
            DYATLIIDL
Sbjct  168  DYATLIIDL  176



>gb|KJB16582.1| hypothetical protein B456_002G237800 [Gossypium raimondii]
Length=451

 Score =   187 bits (474),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 89/129 (69%), Positives = 104/129 (81%), Gaps = 1/129 (1%)
 Frame = +2

Query  158  KTTYNNQVYDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDD  337
            K++  N++Y TKYFTQILDHF F P+SYQ FQ RYLIND YWGG K  +PIFVY G E D
Sbjct  48   KSSGTNKLYKTKYFTQILDHFNFNPKSYQKFQHRYLINDTYWGGPKKNSPIFVYTGNEGD  107

Query  338  IEPFARETGSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKE-ATSSSKTLGYLSSTQALA  514
            IE FA+ TG + + APHF  L+VFIEHRFYGKS+PFGG K+ A S++ TLGYL+STQALA
Sbjct  108  IEWFAQNTGFMFDIAPHFQALLVFIEHRFYGKSIPFGGDKDVAYSNASTLGYLTSTQALA  167

Query  515  DYATLIIDL  541
            DYATLIIDL
Sbjct  168  DYATLIIDL  176



>emb|CDP10629.1| unnamed protein product [Coffea canephora]
Length=520

 Score =   188 bits (477),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 92/122 (75%), Positives = 104/122 (85%), Gaps = 1/122 (1%)
 Frame = +2

Query  179  VYDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFARE  358
            +Y+TKY+TQILDHFTFTPQSYQTFQQRYLI+ K+WGGAK  APIFVY G E DIE F + 
Sbjct  48   LYETKYYTQILDHFTFTPQSYQTFQQRYLISYKHWGGAKKNAPIFVYTGNEGDIEWFTQN  107

Query  359  TGSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKE-ATSSSKTLGYLSSTQALADYATLII  535
            TG + E APHF  L+VFIEHRFYGKS+PFGG K+ A ++S TLGYLSSTQALADYATLII
Sbjct  108  TGFMFENAPHFKALLVFIEHRFYGKSIPFGGNKDVAYANSSTLGYLSSTQALADYATLII  167

Query  536  DL  541
            DL
Sbjct  168  DL  169



>ref|XP_004494225.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Cicer arietinum]
Length=511

 Score =   187 bits (475),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 94/142 (66%), Positives = 111/142 (78%), Gaps = 5/142 (4%)
 Frame = +2

Query  119  IINEPDGFSAASTKTTYNNQVYDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKN  298
            +I      ++AS K    N++Y TK++TQILDHF + PQSYQTFQQRYLIND YWGGAK 
Sbjct  37   LIRPEQQLNSASVK----NKLYRTKFYTQILDHFNYNPQSYQTFQQRYLINDTYWGGAKK  92

Query  299  MAPIFVYMGGEDDIEPFARETGSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKE-ATSSS  475
             APIFVY G E +IE F + TG + E AP+FN L+VFIEHRFYGKS+PFGG K+ A ++S
Sbjct  93   KAPIFVYTGNEGNIEWFTQNTGFMFEKAPYFNALLVFIEHRFYGKSMPFGGNKKVAYANS  152

Query  476  KTLGYLSSTQALADYATLIIDL  541
             TLGYLSSTQALADYATLIIDL
Sbjct  153  STLGYLSSTQALADYATLIIDL  174



>emb|CBI30345.3| unnamed protein product [Vitis vinifera]
Length=485

 Score =   186 bits (473),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 92/141 (65%), Positives = 108/141 (77%), Gaps = 6/141 (4%)
 Frame = +2

Query  122  INEPDGFSAASTKTTYNNQVYDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNM  301
            I  P+  S +S       ++Y+ KYFTQ+LDHF + PQSY+TFQQRYLINDKYWGGA  +
Sbjct  14   IVRPEQLSVSS-----QTELYEAKYFTQLLDHFNYQPQSYRTFQQRYLINDKYWGGADKL  68

Query  302  APIFVYMGGEDDIEPFARETGSIIEFAPHFNGLVVFIEHRFYGKSVPFGG-VKEATSSSK  478
            APIFVY G E DIE FA+ TG + + APHF  L+VFIEHRFYGKS+PFGG    A S++ 
Sbjct  69   APIFVYTGNEGDIEWFAQNTGFMFDTAPHFQALLVFIEHRFYGKSIPFGGDTNVAYSNAS  128

Query  479  TLGYLSSTQALADYATLIIDL  541
            TLGYLSSTQALADYATLIIDL
Sbjct  129  TLGYLSSTQALADYATLIIDL  149



>emb|CAN61013.1| hypothetical protein VITISV_036738 [Vitis vinifera]
Length=554

 Score =   187 bits (476),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 93/141 (66%), Positives = 108/141 (77%), Gaps = 6/141 (4%)
 Frame = +2

Query  122  INEPDGFSAASTKTTYNNQVYDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNM  301
            I  P+  S +S       ++Y+ KYFTQILDHF + PQSY+TFQQRYLINDKYWGGA  +
Sbjct  36   IVRPEQLSVSS-----QTELYEAKYFTQILDHFNYQPQSYRTFQQRYLINDKYWGGADKL  90

Query  302  APIFVYMGGEDDIEPFARETGSIIEFAPHFNGLVVFIEHRFYGKSVPFGG-VKEATSSSK  478
            APIFVY G E DIE FA+ TG + + APHF  L+VFIEHRFYGKS+PFGG    A S++ 
Sbjct  91   APIFVYTGNEGDIEWFAQNTGFMFDTAPHFQALLVFIEHRFYGKSIPFGGDTNVAYSNAS  150

Query  479  TLGYLSSTQALADYATLIIDL  541
            TLGYLSSTQALADYATLIIDL
Sbjct  151  TLGYLSSTQALADYATLIIDL  171



>ref|XP_009624783.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Nicotiana tomentosiformis]
Length=508

 Score =   187 bits (474),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 90/124 (73%), Positives = 101/124 (81%), Gaps = 1/124 (1%)
 Frame = +2

Query  173  NQVYDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFA  352
            N++Y T YFTQILDHF + P SYQTFQQRYL NDK+WGGAKN APIFVY G E DIE F 
Sbjct  49   NKLYKTNYFTQILDHFNYNPDSYQTFQQRYLFNDKHWGGAKNNAPIFVYTGNEGDIEWFT  108

Query  353  RETGSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKE-ATSSSKTLGYLSSTQALADYATL  529
            + TG + E APHF  L+VFIEHRFYGKS+P+GG K  A S++ TLGYLSSTQALADYATL
Sbjct  109  QNTGFMFEIAPHFKALLVFIEHRFYGKSIPYGGDKVIAYSNTSTLGYLSSTQALADYATL  168

Query  530  IIDL  541
            IIDL
Sbjct  169  IIDL  172



>ref|XP_009372536.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Pyrus x bretschneideri]
Length=514

 Score =   187 bits (474),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 89/124 (72%), Positives = 104/124 (84%), Gaps = 1/124 (1%)
 Frame = +2

Query  173  NQVYDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFA  352
            NQ+Y T+YFTQILDHF F P+SYQTFQQRYLIND +WGGAK+ APIFVY G E +I+ FA
Sbjct  56   NQIYRTRYFTQILDHFNFYPKSYQTFQQRYLINDTHWGGAKSNAPIFVYTGNEGNIDWFA  115

Query  353  RETGSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKE-ATSSSKTLGYLSSTQALADYATL  529
            + TG + E APHF  L+VFIEHRFYGKS+P+GG KE A  ++ TLGYLSSTQALADYA+L
Sbjct  116  QNTGFLYETAPHFKALIVFIEHRFYGKSIPYGGNKEVAYGNATTLGYLSSTQALADYASL  175

Query  530  IIDL  541
            IIDL
Sbjct  176  IIDL  179



>ref|XP_002281618.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Vitis vinifera]
Length=507

 Score =   186 bits (473),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 92/141 (65%), Positives = 108/141 (77%), Gaps = 6/141 (4%)
 Frame = +2

Query  122  INEPDGFSAASTKTTYNNQVYDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNM  301
            I  P+  S +S       ++Y+ KYFTQ+LDHF + PQSY+TFQQRYLINDKYWGGA  +
Sbjct  36   IVRPEQLSVSS-----QTELYEAKYFTQLLDHFNYQPQSYRTFQQRYLINDKYWGGADKL  90

Query  302  APIFVYMGGEDDIEPFARETGSIIEFAPHFNGLVVFIEHRFYGKSVPFGG-VKEATSSSK  478
            APIFVY G E DIE FA+ TG + + APHF  L+VFIEHRFYGKS+PFGG    A S++ 
Sbjct  91   APIFVYTGNEGDIEWFAQNTGFMFDTAPHFQALLVFIEHRFYGKSIPFGGDTNVAYSNAS  150

Query  479  TLGYLSSTQALADYATLIIDL  541
            TLGYLSSTQALADYATLIIDL
Sbjct  151  TLGYLSSTQALADYATLIIDL  171



>ref|XP_008243494.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Prunus mume]
Length=504

 Score =   186 bits (473),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 101/158 (64%), Positives = 120/158 (76%), Gaps = 7/158 (4%)
 Frame = +2

Query  71   ISFAKttptfpfpfptIINEPDGFSAASTKTTYNNQVYDTKYFTQILDHFTFTPQSYQTF  250
            ISF+KTTP       ++I  P+  SA++      N++Y TKYFTQILDHF F P+SYQTF
Sbjct  18   ISFSKTTPAGARFPSSLIT-PEKVSAST-----QNKLYRTKYFTQILDHFNFYPKSYQTF  71

Query  251  QQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFARETGSIIEFAPHFNGLVVFIEHRFYG  430
            QQRYLIND +WGGAKN APIFVY G E +IE FA+  G + E APHF  LVVFIEHRFYG
Sbjct  72   QQRYLINDTFWGGAKNNAPIFVYTGNEGNIEWFAQNLGFLYETAPHFKSLVVFIEHRFYG  131

Query  431  KSVPFGGVKE-ATSSSKTLGYLSSTQALADYATLIIDL  541
            KS+P+GG K  A S++ TLG+LSSTQALADYA+LIIDL
Sbjct  132  KSIPYGGKKSVAYSNASTLGHLSSTQALADYASLIIDL  169



>gb|KJB16580.1| hypothetical protein B456_002G237800 [Gossypium raimondii]
Length=511

 Score =   186 bits (473),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 89/129 (69%), Positives = 104/129 (81%), Gaps = 1/129 (1%)
 Frame = +2

Query  158  KTTYNNQVYDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDD  337
            K++  N++Y TKYFTQILDHF F P+SYQ FQ RYLIND YWGG K  +PIFVY G E D
Sbjct  48   KSSGTNKLYKTKYFTQILDHFNFNPKSYQKFQHRYLINDTYWGGPKKNSPIFVYTGNEGD  107

Query  338  IEPFARETGSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKE-ATSSSKTLGYLSSTQALA  514
            IE FA+ TG + + APHF  L+VFIEHRFYGKS+PFGG K+ A S++ TLGYL+STQALA
Sbjct  108  IEWFAQNTGFMFDIAPHFQALLVFIEHRFYGKSIPFGGDKDVAYSNASTLGYLTSTQALA  167

Query  515  DYATLIIDL  541
            DYATLIIDL
Sbjct  168  DYATLIIDL  176



>gb|KJB16585.1| hypothetical protein B456_002G237800 [Gossypium raimondii]
Length=537

 Score =   187 bits (474),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 89/129 (69%), Positives = 104/129 (81%), Gaps = 1/129 (1%)
 Frame = +2

Query  158  KTTYNNQVYDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDD  337
            K++  N++Y TKYFTQILDHF F P+SYQ FQ RYLIND YWGG K  +PIFVY G E D
Sbjct  48   KSSGTNKLYKTKYFTQILDHFNFNPKSYQKFQHRYLINDTYWGGPKKNSPIFVYTGNEGD  107

Query  338  IEPFARETGSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKE-ATSSSKTLGYLSSTQALA  514
            IE FA+ TG + + APHF  L+VFIEHRFYGKS+PFGG K+ A S++ TLGYL+STQALA
Sbjct  108  IEWFAQNTGFMFDIAPHFQALLVFIEHRFYGKSIPFGGDKDVAYSNASTLGYLTSTQALA  167

Query  515  DYATLIIDL  541
            DYATLIIDL
Sbjct  168  DYATLIIDL  176



>gb|KHN33176.1| Lysosomal Pro-X carboxypeptidase [Glycine soja]
Length=420

 Score =   183 bits (465),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 88/124 (71%), Positives = 102/124 (82%), Gaps = 1/124 (1%)
 Frame = +2

Query  173  NQVYDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFA  352
            N +Y  K+FTQ LDHF + PQSYQTFQQRYLIND YWGGAKN APIFVYMG E DIE FA
Sbjct  15   NGLYTAKFFTQTLDHFNYNPQSYQTFQQRYLINDTYWGGAKNNAPIFVYMGNEGDIEWFA  74

Query  353  RETGSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKE-ATSSSKTLGYLSSTQALADYATL  529
            + TG + E AP+F  L+VFIEHR+YGKS PFGG +E A +++ T+GY+SSTQALADYATL
Sbjct  75   QNTGFMFETAPYFKALLVFIEHRYYGKSFPFGGNEEVADANTTTVGYMSSTQALADYATL  134

Query  530  IIDL  541
            IIDL
Sbjct  135  IIDL  138



>gb|KCW90503.1| hypothetical protein EUGRSUZ_A02623 [Eucalyptus grandis]
Length=465

 Score =   184 bits (467),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 88/125 (70%), Positives = 102/125 (82%), Gaps = 1/125 (1%)
 Frame = +2

Query  170  NNQVYDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPF  349
            NN +Y T+YFTQILDHF++ P+SYQTFQQRYLIN  +WGG +  APIFVY G E DIE F
Sbjct  13   NNGLYKTRYFTQILDHFSYRPESYQTFQQRYLINSTFWGGPRRNAPIFVYTGNEGDIEWF  72

Query  350  ARETGSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKE-ATSSSKTLGYLSSTQALADYAT  526
            A+ TG + E APHFN L+VFIEHR+YGKS+PFGG KE A S++  LGYLSSTQALADYAT
Sbjct  73   AQNTGFMFETAPHFNALLVFIEHRYYGKSMPFGGKKEVAYSNASMLGYLSSTQALADYAT  132

Query  527  LIIDL  541
            LI DL
Sbjct  133  LITDL  137



>ref|XP_010683638.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Beta vulgaris 
subsp. vulgaris]
Length=509

 Score =   185 bits (469),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 87/121 (72%), Positives = 100/121 (83%), Gaps = 1/121 (1%)
 Frame = +2

Query  182  YDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFARET  361
            Y TKY+TQILDHF + PQ YQTFQQRYLIND YWGGAKN +PIFVYMG E DIE FA+ T
Sbjct  52   YKTKYYTQILDHFNYNPQGYQTFQQRYLINDTYWGGAKNNSPIFVYMGNEGDIEWFAQNT  111

Query  362  GSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKE-ATSSSKTLGYLSSTQALADYATLIID  538
            G + E APHF  L+VF+EHRFYGKS+P+GG KE A  ++ T GYLSSTQALADYAT+I+D
Sbjct  112  GFMFENAPHFKALLVFVEHRFYGKSIPYGGDKEVAYKNATTQGYLSSTQALADYATIILD  171

Query  539  L  541
            L
Sbjct  172  L  172



>gb|KEH24168.1| lysosomal pro-X carboxypeptidase-like protein [Medicago truncatula]
Length=467

 Score =   184 bits (466),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 89/124 (72%), Positives = 101/124 (81%), Gaps = 1/124 (1%)
 Frame = +2

Query  173  NQVYDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFA  352
            N +Y TK+FTQILDHF + PQSYQ FQQRYLIND YWGGAK  APIFVY G E +IE F 
Sbjct  62   NGLYRTKFFTQILDHFNYNPQSYQKFQQRYLINDTYWGGAKKKAPIFVYTGNEGNIEWFT  121

Query  353  RETGSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKE-ATSSSKTLGYLSSTQALADYATL  529
            + TG + E AP+FN L+VFIEHRFYGKS+PFGG K+ A ++S TLGYLSS QALADYATL
Sbjct  122  QNTGFMFEQAPYFNALLVFIEHRFYGKSIPFGGKKKVAYANSSTLGYLSSAQALADYATL  181

Query  530  IIDL  541
            IIDL
Sbjct  182  IIDL  185



>ref|XP_010024706.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Eucalyptus 
grandis]
Length=515

 Score =   184 bits (468),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 90/142 (63%), Positives = 109/142 (77%), Gaps = 1/142 (1%)
 Frame = +2

Query  119  IINEPDGFSAASTKTTYNNQVYDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKN  298
            +I+  +   + S   + NN +Y T+YFTQILDHF++ P+SYQTFQQRYLIN  +WGG + 
Sbjct  41   LIHPENSQPSLSNDQSGNNGLYKTRYFTQILDHFSYRPESYQTFQQRYLINSTFWGGPRR  100

Query  299  MAPIFVYMGGEDDIEPFARETGSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKE-ATSSS  475
             APIFVY G E DIE FA+ TG + E APHFN L+VFIEHR+YGKS+PFGG KE A S++
Sbjct  101  NAPIFVYTGNEGDIEWFAQNTGFMFETAPHFNALLVFIEHRYYGKSMPFGGKKEVAYSNA  160

Query  476  KTLGYLSSTQALADYATLIIDL  541
              LGYLSSTQALADYATLI DL
Sbjct  161  SMLGYLSSTQALADYATLITDL  182



>gb|KEH24167.1| lysosomal pro-X carboxypeptidase-like protein [Medicago truncatula]
Length=501

 Score =   184 bits (466),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 89/124 (72%), Positives = 101/124 (81%), Gaps = 1/124 (1%)
 Frame = +2

Query  173  NQVYDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFA  352
            N +Y TK+FTQILDHF + PQSYQ FQQRYLIND YWGGAK  APIFVY G E +IE F 
Sbjct  44   NGLYRTKFFTQILDHFNYNPQSYQKFQQRYLINDTYWGGAKKKAPIFVYTGNEGNIEWFT  103

Query  353  RETGSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKE-ATSSSKTLGYLSSTQALADYATL  529
            + TG + E AP+FN L+VFIEHRFYGKS+PFGG K+ A ++S TLGYLSS QALADYATL
Sbjct  104  QNTGFMFEQAPYFNALLVFIEHRFYGKSIPFGGKKKVAYANSSTLGYLSSAQALADYATL  163

Query  530  IIDL  541
            IIDL
Sbjct  164  IIDL  167



>ref|XP_003521479.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Glycine max]
Length=504

 Score =   184 bits (466),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 88/124 (71%), Positives = 102/124 (82%), Gaps = 1/124 (1%)
 Frame = +2

Query  173  NQVYDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFA  352
            N +Y  K+FTQ LDHF + PQSYQTFQQRYLIND YWGGAKN APIFVYMG E DIE FA
Sbjct  49   NGLYTAKFFTQTLDHFNYNPQSYQTFQQRYLINDTYWGGAKNNAPIFVYMGNEGDIEWFA  108

Query  353  RETGSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKE-ATSSSKTLGYLSSTQALADYATL  529
            + TG + E AP+F  L+VFIEHR+YGKS PFGG +E A +++ T+GY+SSTQALADYATL
Sbjct  109  QNTGFMFETAPYFKALLVFIEHRYYGKSFPFGGNEEVADANTTTVGYMSSTQALADYATL  168

Query  530  IIDL  541
            IIDL
Sbjct  169  IIDL  172



>ref|XP_011467971.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Fragaria vesca 
subsp. vesca]
Length=509

 Score =   183 bits (465),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 89/124 (72%), Positives = 103/124 (83%), Gaps = 1/124 (1%)
 Frame = +2

Query  173  NQVYDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFA  352
            NQ+Y TKYFTQILDHF + P+SY TFQQRYLIND +WGGAK+ APIFVY G E  IE FA
Sbjct  51   NQLYRTKYFTQILDHFNYYPKSYDTFQQRYLINDTFWGGAKSNAPIFVYTGNEGIIEWFA  110

Query  353  RETGSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKE-ATSSSKTLGYLSSTQALADYATL  529
            + TG + E APHF  L++FIEHRFYGKS+PFGG K+ A S++ TLGYLSSTQALADYA+L
Sbjct  111  QNTGFLYETAPHFKALIIFIEHRFYGKSIPFGGKKDVAYSNATTLGYLSSTQALADYASL  170

Query  530  IIDL  541
            IIDL
Sbjct  171  IIDL  174



>gb|KCW90505.1| hypothetical protein EUGRSUZ_A02624 [Eucalyptus grandis]
Length=466

 Score =   181 bits (459),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 88/125 (70%), Positives = 101/125 (81%), Gaps = 1/125 (1%)
 Frame = +2

Query  170  NNQVYDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPF  349
            +N +Y+T+YFTQ+LDHF F P+SYQTFQQRYLIN  +WGG +  APIFVY G E DIE F
Sbjct  56   SNGLYETRYFTQVLDHFGFRPESYQTFQQRYLINSTFWGGPQRNAPIFVYTGNEGDIEWF  115

Query  350  ARETGSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKE-ATSSSKTLGYLSSTQALADYAT  526
             + TG + E AP FN L+VFIEHRFYGKS+PFGG KE A S+S TLGYLSSTQALADYAT
Sbjct  116  TQNTGFMFETAPRFNALLVFIEHRFYGKSIPFGGNKEVAYSNSSTLGYLSSTQALADYAT  175

Query  527  LIIDL  541
            LI DL
Sbjct  176  LITDL  180



>ref|XP_004167790.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Cucumis sativus]
Length=501

 Score =   181 bits (460),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 86/121 (71%), Positives = 100/121 (83%), Gaps = 1/121 (1%)
 Frame = +2

Query  182  YDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFARET  361
            Y T +FTQILDHF F PQSYQ+FQQRYLIND YWGGA + +PIFVY G E +IE FA+ T
Sbjct  49   YQTSFFTQILDHFNFNPQSYQSFQQRYLINDTYWGGAAHNSPIFVYTGNEGNIEWFAQNT  108

Query  362  GSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKE-ATSSSKTLGYLSSTQALADYATLIID  538
            G ++++APHF  LVVFIEHRFYGKS+PFGG ++ A S+S  LGYLSSTQALADYATLI D
Sbjct  109  GFLLQYAPHFRALVVFIEHRFYGKSIPFGGDEDVANSNSSMLGYLSSTQALADYATLITD  168

Query  539  L  541
            L
Sbjct  169  L  169



>ref|XP_004136495.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Cucumis sativus]
 gb|KGN59164.1| hypothetical protein Csa_3G778210 [Cucumis sativus]
Length=502

 Score =   181 bits (460),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 86/121 (71%), Positives = 100/121 (83%), Gaps = 1/121 (1%)
 Frame = +2

Query  182  YDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFARET  361
            Y T +FTQILDHF F PQSYQ+FQQRYLIND YWGGA + +PIFVY G E +IE FA+ T
Sbjct  49   YQTSFFTQILDHFNFNPQSYQSFQQRYLINDTYWGGAAHNSPIFVYTGNEGNIEWFAQNT  108

Query  362  GSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKE-ATSSSKTLGYLSSTQALADYATLIID  538
            G ++++APHF  LVVFIEHRFYGKS+PFGG ++ A S+S  LGYLSSTQALADYATLI D
Sbjct  109  GFLLQYAPHFRALVVFIEHRFYGKSIPFGGDEDVANSNSSMLGYLSSTQALADYATLITD  168

Query  539  L  541
            L
Sbjct  169  L  169



>ref|XP_006430124.1| hypothetical protein CICLE_v10011529mg [Citrus clementina]
 gb|ESR43364.1| hypothetical protein CICLE_v10011529mg [Citrus clementina]
Length=426

 Score =   180 bits (456),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 87/138 (63%), Positives = 106/138 (77%), Gaps = 1/138 (1%)
 Frame = +2

Query  131  PDGFSAASTKTTYNNQVYDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPI  310
            P+  S+  + +  +  +Y TKY TQILDHF + PQSYQTFQQRYLIND +WGG+KN API
Sbjct  36   PEKLSSLISNSKDSQGLYKTKYHTQILDHFNYNPQSYQTFQQRYLINDTHWGGSKNNAPI  95

Query  311  FVYMGGEDDIEPFARETGSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKE-ATSSSKTLG  487
            FVY G E DIE FA+ TG + + AP F  L+VFIEHR+YGKS+P+GG KE A  ++ T G
Sbjct  96   FVYTGNEGDIEWFAQNTGFMYDVAPKFKALLVFIEHRYYGKSIPYGGYKEIAYKNASTTG  155

Query  488  YLSSTQALADYATLIIDL  541
            YLSSTQALADYA+LIIDL
Sbjct  156  YLSSTQALADYASLIIDL  173



>ref|XP_010059402.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Eucalyptus 
grandis]
 gb|KCW90504.1| hypothetical protein EUGRSUZ_A02624 [Eucalyptus grandis]
Length=516

 Score =   181 bits (460),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 88/125 (70%), Positives = 101/125 (81%), Gaps = 1/125 (1%)
 Frame = +2

Query  170  NNQVYDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPF  349
            +N +Y+T+YFTQ+LDHF F P+SYQTFQQRYLIN  +WGG +  APIFVY G E DIE F
Sbjct  56   SNGLYETRYFTQVLDHFGFRPESYQTFQQRYLINSTFWGGPQRNAPIFVYTGNEGDIEWF  115

Query  350  ARETGSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKE-ATSSSKTLGYLSSTQALADYAT  526
             + TG + E AP FN L+VFIEHRFYGKS+PFGG KE A S+S TLGYLSSTQALADYAT
Sbjct  116  TQNTGFMFETAPRFNALLVFIEHRFYGKSIPFGGNKEVAYSNSSTLGYLSSTQALADYAT  175

Query  527  LIIDL  541
            LI DL
Sbjct  176  LITDL  180



>gb|KDO70542.1| hypothetical protein CISIN_1g0106561mg, partial [Citrus sinensis]
 gb|KDO70543.1| hypothetical protein CISIN_1g0106561mg, partial [Citrus sinensis]
 gb|KDO70544.1| hypothetical protein CISIN_1g0106561mg, partial [Citrus sinensis]
 gb|KDO70545.1| hypothetical protein CISIN_1g0106561mg, partial [Citrus sinensis]
Length=368

 Score =   177 bits (450),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 85/122 (70%), Positives = 99/122 (81%), Gaps = 1/122 (1%)
 Frame = +2

Query  179  VYDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFARE  358
            +Y TKY TQILDHF + PQSYQTFQQRYLIND +WGG+KN APIFVY G E DIE FA+ 
Sbjct  52   LYKTKYHTQILDHFNYNPQSYQTFQQRYLINDTHWGGSKNNAPIFVYTGNEGDIEWFAQN  111

Query  359  TGSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKE-ATSSSKTLGYLSSTQALADYATLII  535
            TG + + AP F  L+VFIEHR+YGKS+P+GG KE A  ++ T GYLSSTQALADYA+LII
Sbjct  112  TGFMYDVAPKFKALLVFIEHRYYGKSIPYGGNKEIAYKNASTTGYLSSTQALADYASLII  171

Query  536  DL  541
            DL
Sbjct  172  DL  173



>ref|XP_007027868.1| Alpha/beta-Hydrolases superfamily protein isoform 2 [Theobroma 
cacao]
 gb|EOY08370.1| Alpha/beta-Hydrolases superfamily protein isoform 2 [Theobroma 
cacao]
Length=387

 Score =   178 bits (451),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 87/139 (63%), Positives = 106/139 (76%), Gaps = 4/139 (3%)
 Frame = +2

Query  128  EPDGFSAASTKTTYNNQVYDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAP  307
             P+  S A+ + T   ++Y  +YFTQILDHF F P+SYQTFQ RYLIND YW G +  +P
Sbjct  38   RPEQLSLATKRGT---KLYKARYFTQILDHFNFNPKSYQTFQHRYLINDTYWSGPEKNSP  94

Query  308  IFVYMGGEDDIEPFARETGSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKE-ATSSSKTL  484
            IFVY G E DIE FA+ TG + + AP+F  L+VFIEHRFYGKS+PFGG K+ A S++ TL
Sbjct  95   IFVYTGNEGDIEWFAQNTGFMFDVAPYFKALLVFIEHRFYGKSIPFGGDKDIAYSNASTL  154

Query  485  GYLSSTQALADYATLIIDL  541
            GYL+STQALADYATLIIDL
Sbjct  155  GYLTSTQALADYATLIIDL  173



>ref|XP_006577089.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like isoform X2 [Glycine 
max]
Length=411

 Score =   178 bits (452),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 88/124 (71%), Positives = 99/124 (80%), Gaps = 1/124 (1%)
 Frame = +2

Query  173  NQVYDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFA  352
            N +Y TK+FTQILDHF F PQS  TFQQRYLIND +WGGAKN APIFVY G E +IE F 
Sbjct  50   NGLYRTKFFTQILDHFNFNPQSNHTFQQRYLINDTFWGGAKNNAPIFVYTGNEGNIEWFT  109

Query  353  RETGSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKE-ATSSSKTLGYLSSTQALADYATL  529
            + TG + E AP F  L+VFIEHRFYGKS+PFGG K  A +++ TLGYLSSTQALADYATL
Sbjct  110  QNTGFMFENAPSFQALLVFIEHRFYGKSIPFGGNKTVAYANTSTLGYLSSTQALADYATL  169

Query  530  IIDL  541
            IIDL
Sbjct  170  IIDL  173



>ref|XP_004246480.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Solanum lycopersicum]
Length=494

 Score =   180 bits (457),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 104/174 (60%), Positives = 120/174 (69%), Gaps = 17/174 (10%)
 Frame = +2

Query  26   MNSRILLLLLFSYFAISFAKttptfpfpfptIINEPDGFS-AASTKTTYNNQVYDTKYFT  202
            M  R++LL L  +  IS AK TP F          P  F     +K  +N   YDTKYFT
Sbjct  1    MKMRLILLFLVFFSPISLAKITPKF----------PSSFDDHLPSKGKFN---YDTKYFT  47

Query  203  QILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFARETGSIIEFA  382
            QILDHF F   + QTFQQRYL+NDKYWGG+KN APIFVY G E +IE F + TG + E A
Sbjct  48   QILDHFNF--NNPQTFQQRYLLNDKYWGGSKNNAPIFVYTGNEGNIEWFTQNTGFMFEIA  105

Query  383  PHFNGLVVFIEHRFYGKSVPFGGVKEATSSSK-TLGYLSSTQALADYATLIIDL  541
            PHFN L+VFIEHR+YGKS+P+GG K    S+K TLGYLSSTQALADYATLIIDL
Sbjct  106  PHFNALLVFIEHRYYGKSIPYGGDKTIAYSNKTTLGYLSSTQALADYATLIIDL  159



>ref|XP_006430123.1| hypothetical protein CICLE_v10011529mg [Citrus clementina]
 gb|ESR43363.1| hypothetical protein CICLE_v10011529mg [Citrus clementina]
Length=505

 Score =   180 bits (456),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 87/138 (63%), Positives = 106/138 (77%), Gaps = 1/138 (1%)
 Frame = +2

Query  131  PDGFSAASTKTTYNNQVYDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPI  310
            P+  S+  + +  +  +Y TKY TQILDHF + PQSYQTFQQRYLIND +WGG+KN API
Sbjct  36   PEKLSSLISNSKDSQGLYKTKYHTQILDHFNYNPQSYQTFQQRYLINDTHWGGSKNNAPI  95

Query  311  FVYMGGEDDIEPFARETGSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKE-ATSSSKTLG  487
            FVY G E DIE FA+ TG + + AP F  L+VFIEHR+YGKS+P+GG KE A  ++ T G
Sbjct  96   FVYTGNEGDIEWFAQNTGFMYDVAPKFKALLVFIEHRYYGKSIPYGGYKEIAYKNASTTG  155

Query  488  YLSSTQALADYATLIIDL  541
            YLSSTQALADYA+LIIDL
Sbjct  156  YLSSTQALADYASLIIDL  173



>ref|XP_004305645.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Fragaria vesca 
subsp. vesca]
Length=512

 Score =   180 bits (456),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 103/124 (83%), Gaps = 2/124 (2%)
 Frame = +2

Query  173  NQVYDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFA  352
            NQ+Y TKYFTQ+LDHF + P+SY+TFQ RYLIND YWGGAK+ +PIFVY G E +IE FA
Sbjct  55   NQLYTTKYFTQVLDHFNY-PKSYETFQHRYLINDTYWGGAKSNSPIFVYTGNEGNIEWFA  113

Query  353  RETGSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKE-ATSSSKTLGYLSSTQALADYATL  529
              TG + E APHF  L++FIEHRFYGKS+PFGG K+ A S++ TLGYLSSTQALADYA+L
Sbjct  114  ENTGFLYETAPHFKALIIFIEHRFYGKSLPFGGKKDVAYSNATTLGYLSSTQALADYASL  173

Query  530  IIDL  541
            IIDL
Sbjct  174  IIDL  177



>gb|KDP36180.1| hypothetical protein JCGZ_08824 [Jatropha curcas]
Length=499

 Score =   179 bits (454),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 84/131 (64%), Positives = 104/131 (79%), Gaps = 1/131 (1%)
 Frame = +2

Query  152  STKTTYNNQVYDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGE  331
            S  ++ +N +Y  K+FTQ+LDHF F P+SY TFQ+RYLIND +WGG K  APIF+Y G E
Sbjct  33   SLSSSTSNGLYKEKFFTQVLDHFNFNPESYHTFQERYLINDTFWGGPKKNAPIFLYTGNE  92

Query  332  DDIEPFARETGSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKE-ATSSSKTLGYLSSTQA  508
             DIE FA+ TG + + APHFN L+VFIEHRFYGKS+PFGG K+ A S++ TLGYL+STQA
Sbjct  93   GDIEWFAQNTGFMFDIAPHFNALLVFIEHRFYGKSIPFGGDKKVAYSNASTLGYLTSTQA  152

Query  509  LADYATLIIDL  541
            LADYATL+ DL
Sbjct  153  LADYATLMTDL  163



>ref|XP_007162943.1| hypothetical protein PHAVU_001G193200g [Phaseolus vulgaris]
 gb|ESW34937.1| hypothetical protein PHAVU_001G193200g [Phaseolus vulgaris]
Length=506

 Score =   179 bits (453),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 90/141 (64%), Positives = 106/141 (75%), Gaps = 4/141 (3%)
 Frame = +2

Query  131  PDGFSAASTKTTYN---NQVYDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNM  301
            P    +A  K + N   N +Y TK+FTQILDHF F PQS   FQQRYLIND +WGGAKN 
Sbjct  32   PSSAVSAELKQSSNSAPNSLYRTKFFTQILDHFNFNPQSNHVFQQRYLINDTFWGGAKNN  91

Query  302  APIFVYMGGEDDIEPFARETGSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKE-ATSSSK  478
            APIFVY G E +IE F + TG + E AP F+ L+VFIEHRFYGKS+PFGG ++ A +++ 
Sbjct  92   APIFVYTGNEGNIEWFTQNTGFMFENAPSFHALLVFIEHRFYGKSIPFGGNRKVAYANAS  151

Query  479  TLGYLSSTQALADYATLIIDL  541
            TLGYLSSTQALADYATLIIDL
Sbjct  152  TLGYLSSTQALADYATLIIDL  172



>ref|XP_006577088.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like isoform X1 [Glycine 
max]
Length=509

 Score =   179 bits (453),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 88/124 (71%), Positives = 99/124 (80%), Gaps = 1/124 (1%)
 Frame = +2

Query  173  NQVYDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFA  352
            N +Y TK+FTQILDHF F PQS  TFQQRYLIND +WGGAKN APIFVY G E +IE F 
Sbjct  50   NGLYRTKFFTQILDHFNFNPQSNHTFQQRYLINDTFWGGAKNNAPIFVYTGNEGNIEWFT  109

Query  353  RETGSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKE-ATSSSKTLGYLSSTQALADYATL  529
            + TG + E AP F  L+VFIEHRFYGKS+PFGG K  A +++ TLGYLSSTQALADYATL
Sbjct  110  QNTGFMFENAPSFQALLVFIEHRFYGKSIPFGGNKTVAYANTSTLGYLSSTQALADYATL  169

Query  530  IIDL  541
            IIDL
Sbjct  170  IIDL  173



>gb|KHN33177.1| Lysosomal Pro-X carboxypeptidase [Glycine soja]
Length=509

 Score =   178 bits (452),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 88/124 (71%), Positives = 99/124 (80%), Gaps = 1/124 (1%)
 Frame = +2

Query  173  NQVYDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFA  352
            N +Y TK+FTQILDHF F PQS  TFQQRYLIND +WGGAKN APIFVY G E +IE F 
Sbjct  50   NGLYRTKFFTQILDHFNFNPQSNHTFQQRYLINDTFWGGAKNNAPIFVYTGNEGNIEWFT  109

Query  353  RETGSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKE-ATSSSKTLGYLSSTQALADYATL  529
            + TG + E AP F  L+VFIEHRFYGKS+PFGG K  A +++ TLGYLSSTQALADYATL
Sbjct  110  QNTGFMFENAPSFQALLVFIEHRFYGKSIPFGGNKTVAYANTSTLGYLSSTQALADYATL  169

Query  530  IIDL  541
            IIDL
Sbjct  170  IIDL  173



>ref|XP_002530520.1| lysosomal pro-X carboxypeptidase, putative [Ricinus communis]
 gb|EEF31852.1| lysosomal pro-X carboxypeptidase, putative [Ricinus communis]
Length=508

 Score =   178 bits (451),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 85/128 (66%), Positives = 102/128 (80%), Gaps = 1/128 (1%)
 Frame = +2

Query  161  TTYNNQVYDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDI  340
            +T  N++Y  K+FTQ LDHF F P+SYQTFQQRYLIND YW G KN APIF+Y G E +I
Sbjct  45   STTPNKLYKEKFFTQTLDHFNFNPKSYQTFQQRYLINDTYWAGPKNNAPIFMYTGNEGEI  104

Query  341  EPFARETGSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKE-ATSSSKTLGYLSSTQALAD  517
            E FA+ TG + + AP FN L+VF+EHRFYGKS+PFGG KE A S++ TLGYL+STQ+LAD
Sbjct  105  EWFAQNTGFMFDNAPKFNALLVFVEHRFYGKSIPFGGNKEVAYSNASTLGYLTSTQSLAD  164

Query  518  YATLIIDL  541
            YATLI DL
Sbjct  165  YATLITDL  172



>ref|XP_007027867.1| Alpha/beta-Hydrolases superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOY08369.1| Alpha/beta-Hydrolases superfamily protein isoform 1 [Theobroma 
cacao]
Length=508

 Score =   177 bits (450),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 87/139 (63%), Positives = 106/139 (76%), Gaps = 4/139 (3%)
 Frame = +2

Query  128  EPDGFSAASTKTTYNNQVYDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAP  307
             P+  S A+ + T   ++Y  +YFTQILDHF F P+SYQTFQ RYLIND YW G +  +P
Sbjct  38   RPEQLSLATKRGT---KLYKARYFTQILDHFNFNPKSYQTFQHRYLINDTYWSGPEKNSP  94

Query  308  IFVYMGGEDDIEPFARETGSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKE-ATSSSKTL  484
            IFVY G E DIE FA+ TG + + AP+F  L+VFIEHRFYGKS+PFGG K+ A S++ TL
Sbjct  95   IFVYTGNEGDIEWFAQNTGFMFDVAPYFKALLVFIEHRFYGKSIPFGGDKDIAYSNASTL  154

Query  485  GYLSSTQALADYATLIIDL  541
            GYL+STQALADYATLIIDL
Sbjct  155  GYLTSTQALADYATLIIDL  173



>ref|XP_006341228.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Solanum tuberosum]
Length=493

 Score =   177 bits (449),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 97/172 (56%), Positives = 116/172 (67%), Gaps = 18/172 (10%)
 Frame = +2

Query  35   RILLLLLFSYFAISFAKttptfpfpfptIINEPDGFSAA--STKTTYNNQVYDTKYFTQI  208
            R++LL L  +  ISFAK               P  F ++     ++     Y+T YFTQI
Sbjct  2    RLILLFLVCFSPISFAKI-------------PPRLFPSSLDDQLSSKGKLSYETNYFTQI  48

Query  209  LDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFARETGSIIEFAPH  388
            LDHF +   + QTFQQRYL+NDKYWGG+KN APIFVY G E +IE F + TG + E APH
Sbjct  49   LDHFNY--NNPQTFQQRYLLNDKYWGGSKNNAPIFVYTGNEGNIEWFTQNTGFMFEIAPH  106

Query  389  FNGLVVFIEHRFYGKSVPFGGVKEATSSSK-TLGYLSSTQALADYATLIIDL  541
            FN L+VFIEHRFYGKS+P+GG K    S+K TLGYLSSTQALADYATLIIDL
Sbjct  107  FNALLVFIEHRFYGKSIPYGGDKTIAYSNKTTLGYLSSTQALADYATLIIDL  158



>gb|KHN02193.1| Lysosomal Pro-X carboxypeptidase [Glycine soja]
Length=506

 Score =   177 bits (449),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 98/124 (79%), Gaps = 1/124 (1%)
 Frame = +2

Query  173  NQVYDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFA  352
            N +Y TK+FTQILDHF F PQS  TFQQRYLIND +WGGAKN APIFVY G E +IE F 
Sbjct  49   NGLYRTKFFTQILDHFNFNPQSNHTFQQRYLINDTFWGGAKNNAPIFVYTGNEGNIEWFT  108

Query  353  RETGSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKE-ATSSSKTLGYLSSTQALADYATL  529
            + TG + E AP F  L+VFIEHRFYGKS+PFGG K  A +++ TLGYLSSTQALADYA L
Sbjct  109  QNTGFMFENAPSFQALLVFIEHRFYGKSIPFGGNKTVAYANTSTLGYLSSTQALADYAAL  168

Query  530  IIDL  541
            IIDL
Sbjct  169  IIDL  172



>ref|XP_006604647.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Glycine max]
Length=508

 Score =   177 bits (448),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 98/124 (79%), Gaps = 1/124 (1%)
 Frame = +2

Query  173  NQVYDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFA  352
            N +Y TK+FTQILDHF F PQS  TFQQRYLIND +WGGAKN APIFVY G E +IE F 
Sbjct  49   NGLYRTKFFTQILDHFNFNPQSNHTFQQRYLINDTFWGGAKNNAPIFVYTGNEGNIEWFT  108

Query  353  RETGSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKE-ATSSSKTLGYLSSTQALADYATL  529
            + TG + E AP F  L+VFIEHRFYGKS+PFGG K  A +++ TLGYLSSTQALADYA L
Sbjct  109  QNTGFMFENAPSFQALLVFIEHRFYGKSIPFGGNKTVAYANTSTLGYLSSTQALADYAAL  168

Query  530  IIDL  541
            IIDL
Sbjct  169  IIDL  172



>ref|XP_006481710.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Citrus sinensis]
Length=505

 Score =   177 bits (448),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 85/122 (70%), Positives = 99/122 (81%), Gaps = 1/122 (1%)
 Frame = +2

Query  179  VYDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFARE  358
            +Y TKY TQILDHF + PQSYQTFQQRYLIND +WGG+KN APIFVY G E DIE FA+ 
Sbjct  52   LYKTKYHTQILDHFNYNPQSYQTFQQRYLINDTHWGGSKNNAPIFVYTGNEGDIEWFAQN  111

Query  359  TGSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKE-ATSSSKTLGYLSSTQALADYATLII  535
            TG + + AP F  L+VFIEHR+YGKS+P+GG KE A  ++ T GYLSSTQALADYA+LII
Sbjct  112  TGFMYDVAPKFKALLVFIEHRYYGKSMPYGGNKEIAYKNASTTGYLSSTQALADYASLII  171

Query  536  DL  541
            DL
Sbjct  172  DL  173



>ref|XP_008442879.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Cucumis melo]
Length=502

 Score =   175 bits (444),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 85/121 (70%), Positives = 98/121 (81%), Gaps = 1/121 (1%)
 Frame = +2

Query  182  YDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFARET  361
            Y T +FTQILDHF F PQSYQ FQQRYLIND YWGGA + +PIFVY G E +IE FA+ T
Sbjct  49   YQTGFFTQILDHFNFNPQSYQYFQQRYLINDTYWGGAAHNSPIFVYTGNEGNIEWFAQNT  108

Query  362  GSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKE-ATSSSKTLGYLSSTQALADYATLIID  538
            G +++ AP F  LVVFIEHRFYGKS+PFGG ++ A S+S TLG+LSSTQALADYATLI D
Sbjct  109  GFLLQSAPRFRALVVFIEHRFYGKSIPFGGDEDVANSNSSTLGFLSSTQALADYATLITD  168

Query  539  L  541
            L
Sbjct  169  L  169



>ref|XP_011094280.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Sesamum indicum]
Length=510

 Score =   173 bits (439),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 85/125 (68%), Positives = 102/125 (82%), Gaps = 2/125 (2%)
 Frame = +2

Query  173  NQVYDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGG-AKNMAPIFVYMGGEDDIEPF  349
            +++Y+ K+FTQILDHF + PQSY+TFQQRYLIND YWGG A   APIFVY G E DIE F
Sbjct  46   HELYEEKFFTQILDHFNYNPQSYETFQQRYLINDNYWGGGADKNAPIFVYTGNEGDIEWF  105

Query  350  ARETGSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKE-ATSSSKTLGYLSSTQALADYAT  526
            A+ TG + E AP F  L++FIEHR+YGKS+PFGG KE A ++S TLGYLS+TQALADYAT
Sbjct  106  AQNTGFMFETAPIFKALLLFIEHRYYGKSMPFGGSKERAYANSSTLGYLSATQALADYAT  165

Query  527  LIIDL  541
            LI+DL
Sbjct  166  LILDL  170



>ref|XP_010931151.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Elaeis guineensis]
Length=500

 Score =   172 bits (435),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 81/121 (67%), Positives = 100/121 (83%), Gaps = 2/121 (2%)
 Frame = +2

Query  179  VYDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFARE  358
            +Y+T++FTQILDHF +TP+SY+TFQQRYL+ND +WGG    APIFVY G E +I  FAR 
Sbjct  51   LYETRFFTQILDHFDYTPRSYETFQQRYLVNDTHWGGKG--APIFVYTGNEGEIGWFARN  108

Query  359  TGSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALADYATLIID  538
            TG + E APHF  L+VFIEHR+YG+S+PFGG + A S++ TLGYLS+TQALADYATLIID
Sbjct  109  TGFMYEIAPHFKALLVFIEHRYYGESIPFGGKEIAYSNATTLGYLSTTQALADYATLIID  168

Query  539  L  541
            L
Sbjct  169  L  169



>gb|EYU18082.1| hypothetical protein MIMGU_mgv1a005183mg [Erythranthe guttata]
Length=494

 Score =   171 bits (434),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 84/125 (67%), Positives = 98/125 (78%), Gaps = 2/125 (2%)
 Frame = +2

Query  173  NQVY-DTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPF  349
            NQ+Y   K+FTQILDHF + PQSY TFQQRYLIND+YWGG    +PIFVY G E  I+ F
Sbjct  34   NQIYYKEKFFTQILDHFNYNPQSYHTFQQRYLINDEYWGGPTTNSPIFVYTGNEGRIDWF  93

Query  350  ARETGSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKE-ATSSSKTLGYLSSTQALADYAT  526
            A+ TG + E AP FN L+VFIEHR+YGKSVPFGG KE A ++S TLGYLSS QALADYA 
Sbjct  94   AQNTGFMFETAPRFNALLVFIEHRYYGKSVPFGGNKETAYANSSTLGYLSSAQALADYAA  153

Query  527  LIIDL  541
            +I+DL
Sbjct  154  VILDL  158



>ref|XP_008799734.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Phoenix dactylifera]
Length=501

 Score =   169 bits (429),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 83/121 (69%), Positives = 98/121 (81%), Gaps = 2/121 (2%)
 Frame = +2

Query  179  VYDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFARE  358
            +Y+T+YFTQ LDHF FTPQSY TFQQRYL+ND +WGG    APIFVY G E DI  FA+ 
Sbjct  50   LYETRYFTQGLDHFDFTPQSYGTFQQRYLVNDTHWGGKG--APIFVYTGNEGDIGWFAQN  107

Query  359  TGSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALADYATLIID  538
            TG + E AP+F  L+VFIEHR+YG+S+PFGG + A S++ TLGYLSSTQALADYATLIID
Sbjct  108  TGFMYEIAPYFRALLVFIEHRYYGESMPFGGEEVAYSNATTLGYLSSTQALADYATLIID  167

Query  539  L  541
            L
Sbjct  168  L  168



>gb|EPS74090.1| hypothetical protein M569_00662, partial [Genlisea aurea]
Length=490

 Score =   165 bits (417),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 78/122 (64%), Positives = 96/122 (79%), Gaps = 1/122 (1%)
 Frame = +2

Query  179  VYDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFARE  358
            +Y  K+ TQILDHF + PQSY+TFQQRYL+ND +WGGA   +PIFVY G E DIE FA+ 
Sbjct  38   LYTEKFCTQILDHFNYNPQSYRTFQQRYLVNDTHWGGAAAGSPIFVYTGNEGDIEWFAKN  97

Query  359  TGSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKE-ATSSSKTLGYLSSTQALADYATLII  535
            TG + E AP F  L+VFIEHRFYGKS+P+GG +  A S+S TLGYL++TQALADYAT+I+
Sbjct  98   TGFMYEIAPIFKALIVFIEHRFYGKSIPYGGNRTVAYSNSSTLGYLTATQALADYATVIL  157

Query  536  DL  541
             L
Sbjct  158  SL  159



>gb|ABR17682.1| unknown [Picea sitchensis]
Length=501

 Score =   163 bits (413),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 76/120 (63%), Positives = 91/120 (76%), Gaps = 0/120 (0%)
 Frame = +2

Query  182  YDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFARET  361
            YD +Y+TQILDHF+F P+SYQTFQQ+YLIN  +WGGA   +PIFVY G E  IE F   T
Sbjct  60   YDVRYYTQILDHFSFVPESYQTFQQKYLINSDHWGGASAKSPIFVYTGNEGFIEWFTENT  119

Query  362  GSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALADYATLIIDL  541
            G + + AP F  ++VFIEHRFYG S+PFG  K A S+S TLG+LSS QALAD+ATLI DL
Sbjct  120  GFMFDIAPQFKAMLVFIEHRFYGHSMPFGSQKAAYSNSSTLGFLSSAQALADFATLITDL  179



>ref|XP_006854747.1| hypothetical protein AMTR_s00030p00247420 [Amborella trichopoda]
 gb|ERN16214.1| hypothetical protein AMTR_s00030p00247420 [Amborella trichopoda]
Length=517

 Score =   160 bits (406),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 75/120 (63%), Positives = 91/120 (76%), Gaps = 0/120 (0%)
 Frame = +2

Query  182  YDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFARET  361
            Y+ KYFTQ LDHF + P  Y+TFQQRYLIN KYWGG  + APIFVY G E D+E FA+ T
Sbjct  68   YEIKYFTQTLDHFNYVPWGYETFQQRYLINSKYWGGPIDKAPIFVYTGNEGDVEWFAQNT  127

Query  362  GSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALADYATLIIDL  541
            G + E AP+F  L+VFIEHR+YG+S+P+G  + A  ++ T GYLSS QALADYA LIIDL
Sbjct  128  GFMFENAPYFKALLVFIEHRYYGESIPYGSEEIAYKNASTHGYLSSAQALADYAMLIIDL  187



>ref|XP_009383556.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Musa acuminata 
subsp. malaccensis]
Length=496

 Score =   158 bits (399),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 75/121 (62%), Positives = 91/121 (75%), Gaps = 2/121 (2%)
 Frame = +2

Query  179  VYDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFARE  358
            +Y+T+YFTQ LDHF F PQSY  FQQRYL+N  YWGG    +PIFVY G E  IE FA+ 
Sbjct  45   LYETRYFTQTLDHFNFNPQSYAKFQQRYLVNHTYWGGKG--SPIFVYTGNEGGIELFAKN  102

Query  359  TGSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALADYATLIID  538
            TG + + AP F  L+VFIEHR+YG+S+PFGG   A S++ TLGYL  TQA+AD+ATLIID
Sbjct  103  TGFMFDIAPSFKALLVFIEHRYYGESIPFGGEDVAYSNASTLGYLCVTQAIADFATLIID  162

Query  539  L  541
            L
Sbjct  163  L  163



>ref|XP_006841179.1| hypothetical protein AMTR_s00086p00173170 [Amborella trichopoda]
 gb|ERN02854.1| hypothetical protein AMTR_s00086p00173170 [Amborella trichopoda]
Length=511

 Score =   153 bits (386),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 76/124 (61%), Positives = 89/124 (72%), Gaps = 2/124 (2%)
 Frame = +2

Query  170  NNQVYDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPF  349
            N   Y   +F QILDHFTFTPQS + F Q+YL+N +YW G K  APIFVY G E DIE F
Sbjct  40   NKSDYKPHFFPQILDHFTFTPQSSKIFYQKYLLNSEYWDGPKKRAPIFVYTGNEGDIEWF  99

Query  350  ARETGSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALADYATL  529
            A  TG +++ AP F  L+VFIEHRFYG+S+PFG  K A  S+ TLGYL+S QALADYATL
Sbjct  100  AANTGFLLDIAPKFRALLVFIEHRFYGESMPFG--KGAYKSATTLGYLTSQQALADYATL  157

Query  530  IIDL  541
            I  L
Sbjct  158  ITSL  161



>ref|XP_010260171.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Nelumbo nucifera]
Length=506

 Score =   152 bits (384),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 70/118 (59%), Positives = 86/118 (73%), Gaps = 0/118 (0%)
 Frame = +2

Query  182  YDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFARET  361
            Y+  Y+ Q LDHF + P+SY TFQQ+Y+IN  YWGGA + APIFVY+G E  I+   R T
Sbjct  59   YNVYYYNQTLDHFNYRPESYTTFQQKYVINSNYWGGANSSAPIFVYLGDESAIDDDIRTT  118

Query  362  GSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALADYATLII  535
            G + E AP FN L+VFIEHR+YGKSVPFG   EA   + TLGY SS+QALADYA +I+
Sbjct  119  GFLSENAPKFNALIVFIEHRYYGKSVPFGSRDEAFRDASTLGYFSSSQALADYAEIIL  176



>gb|KEH38910.1| lysosomal pro-X carboxypeptidase-like protein [Medicago truncatula]
Length=510

 Score =   149 bits (377),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 69/119 (58%), Positives = 88/119 (74%), Gaps = 0/119 (0%)
 Frame = +2

Query  185  DTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFARETG  364
            +T Y+ Q+LDHF + P+SY TF QRYLIN KYWGGA + APIFVY G E  I+   +  G
Sbjct  56   ETFYYKQVLDHFNYNPESYNTFNQRYLINFKYWGGANSSAPIFVYFGPEQPIDGSPKSIG  115

Query  365  SIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALADYATLIIDL  541
             ++E AP F  L+V+IEHR+YGKSVPFG  +EA  ++ TLGY +S QALADYA +IID+
Sbjct  116  FMVEKAPTFKALLVYIEHRYYGKSVPFGSREEAFKNANTLGYFNSAQALADYAEVIIDI  174



>emb|CBI17114.3| unnamed protein product [Vitis vinifera]
Length=428

 Score =   146 bits (369),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 68/118 (58%), Positives = 87/118 (74%), Gaps = 0/118 (0%)
 Frame = +2

Query  188  TKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFARETGS  367
            T ++ Q LDHF + P+SY+TFQQRY++N +YWGGA + +PIFVY G E  I   A   G 
Sbjct  50   TYFYNQTLDHFNYKPESYRTFQQRYIMNSEYWGGANSSSPIFVYTGDEASITAVAAFAGF  109

Query  368  IIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALADYATLIIDL  541
            I+E A  FNGL+++IEHR+YG SVPFG   EA S++ TLGY +STQALADYA LI +L
Sbjct  110  IVELASRFNGLLLYIEHRYYGDSVPFGSKDEAFSNTSTLGYFTSTQALADYAELITNL  167



>ref|XP_002272152.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Vitis vinifera]
Length=493

 Score =   146 bits (369),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 68/118 (58%), Positives = 87/118 (74%), Gaps = 0/118 (0%)
 Frame = +2

Query  188  TKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFARETGS  367
            T ++ Q LDHF + P+SY+TFQQRY++N +YWGGA + +PIFVY G E  I   A   G 
Sbjct  50   TYFYNQTLDHFNYKPESYRTFQQRYIMNSEYWGGANSSSPIFVYTGDEASITAVAAFAGF  109

Query  368  IIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALADYATLIIDL  541
            I+E A  FNGL+++IEHR+YG SVPFG   EA S++ TLGY +STQALADYA LI +L
Sbjct  110  IVELASRFNGLLLYIEHRYYGDSVPFGSKDEAFSNTSTLGYFTSTQALADYAELITNL  167



>ref|XP_002450303.1| hypothetical protein SORBIDRAFT_05g003460 [Sorghum bicolor]
 gb|EES09291.1| hypothetical protein SORBIDRAFT_05g003460 [Sorghum bicolor]
Length=553

 Score =   146 bits (369),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 67/121 (55%), Positives = 86/121 (71%), Gaps = 1/121 (1%)
 Frame = +2

Query  182  YDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFARET  361
            Y+T+ +TQ LDHF   P SY TFQQRYLIND +WGG    APIF+Y G E DI+ F   T
Sbjct  74   YETRRYTQRLDHFNSLPSSYATFQQRYLINDTFWGGRSRTAPIFLYAGNEGDIDLFTNNT  133

Query  362  GSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEAT-SSSKTLGYLSSTQALADYATLIID  538
            G + E AP F  ++VF+EHR+YG+S+PFGG +EA    + T GYL+ TQALADYA+ ++ 
Sbjct  134  GFMWEAAPRFRAMLVFVEHRYYGESMPFGGTREAAFRDAATKGYLTVTQALADYASFVLS  193

Query  539  L  541
            L
Sbjct  194  L  194



>ref|XP_010267352.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Nelumbo nucifera]
Length=514

 Score =   146 bits (368),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 74/168 (44%), Positives = 109/168 (65%), Gaps = 5/168 (3%)
 Frame = +2

Query  38   ILLLLLFSYFAISFAKttptfpfpfptIINEPDGFSAASTKTTYNNQVYDTKYFTQILDH  217
            +LLL + ++   + +K      F    ++N     SAA   +T  + +  T ++TQ LDH
Sbjct  18   LLLLFVMAFLPATQSKMPNLDVFRKSRMVNP----SAAKPSSTSKDDL-QTFFYTQTLDH  72

Query  218  FTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFARETGSIIEFAPHFNG  397
            F + P+SY TFQQRY+IN KYWGG  ++APIFV++G E  ++      G + + AP FN 
Sbjct  73   FNYRPESYTTFQQRYMINFKYWGGVNSIAPIFVFLGEESSLDDDIESIGFLTDHAPRFNA  132

Query  398  LVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALADYATLIIDL  541
            L+V+IEHR+YGKSVPF   +++  +++TLGY +S QALADYA +IIDL
Sbjct  133  LIVYIEHRYYGKSVPFESWEKSFQNTETLGYFNSAQALADYAEVIIDL  180



>ref|XP_010247711.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Nelumbo nucifera]
Length=505

 Score =   145 bits (367),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 66/129 (51%), Positives = 95/129 (74%), Gaps = 0/129 (0%)
 Frame = +2

Query  149  ASTKTTYNNQVYDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGG  328
            AS   +++++ +   ++ Q LDHF + P+SY TF+QRY+IN K+WGGA + APIFVY+G 
Sbjct  51   ASEPYSFSSEDFKDYFYEQTLDHFNYRPESYATFKQRYVINYKFWGGANSSAPIFVYLGE  110

Query  329  EDDIEPFARETGSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQA  508
            E  ++ +    G + + AP FN LVVFIEHR+YG+SVPFG ++EA  ++ TLGY SS+QA
Sbjct  111  ESPLDNYIDAIGFLTDHAPKFNALVVFIEHRYYGQSVPFGSMEEAFQNASTLGYFSSSQA  170

Query  509  LADYATLII  535
            LADYA +I+
Sbjct  171  LADYAEVIL  179



>ref|XP_010245642.1| PREDICTED: lysosomal Pro-X carboxypeptidase isoform X3 [Nelumbo 
nucifera]
Length=431

 Score =   144 bits (364),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 69/120 (58%), Positives = 88/120 (73%), Gaps = 2/120 (2%)
 Frame = +2

Query  182  YDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFARET  361
            Y+T+YFTQ+LDHF+F+  +  TFQQRYLIN  +W G  +MAPIF+Y G E DIE FA  T
Sbjct  64   YETRYFTQVLDHFSFS--NLPTFQQRYLINTDHWLGPNSMAPIFLYCGNEGDIEWFAVNT  121

Query  362  GSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALADYATLIIDL  541
            G + E AP FN +VVF EHR+YGKS+PFG    A  ++ +L YL++ QALAD+A LI DL
Sbjct  122  GFVWEIAPLFNAMVVFPEHRYYGKSMPFGSRDSAYKNAASLSYLTAEQALADFAALITDL  181



>ref|XP_010245641.1| PREDICTED: lysosomal Pro-X carboxypeptidase isoform X2 [Nelumbo 
nucifera]
Length=435

 Score =   144 bits (364),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 69/120 (58%), Positives = 88/120 (73%), Gaps = 2/120 (2%)
 Frame = +2

Query  182  YDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFARET  361
            Y+T+YFTQ+LDHF+F+  +  TFQQRYLIN  +W G  +MAPIF+Y G E DIE FA  T
Sbjct  64   YETRYFTQVLDHFSFS--NLPTFQQRYLINTDHWLGPNSMAPIFLYCGNEGDIEWFAVNT  121

Query  362  GSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALADYATLIIDL  541
            G + E AP FN +VVF EHR+YGKS+PFG    A  ++ +L YL++ QALAD+A LI DL
Sbjct  122  GFVWEIAPLFNAMVVFPEHRYYGKSMPFGSRDSAYKNAASLSYLTAEQALADFAALITDL  181



>gb|KDO44732.1| hypothetical protein CISIN_1g010487mg [Citrus sinensis]
Length=509

 Score =   145 bits (365),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 74/141 (52%), Positives = 94/141 (67%), Gaps = 6/141 (4%)
 Frame = +2

Query  119  IINEPDGFSAASTKTTYNNQVYDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKN  298
            I NEP   SA+ +K       Y T  +TQ LDHF + P SY+TFQQRYLIN KYW GA  
Sbjct  40   IQNEPILMSASESKD------YKTFLYTQPLDHFNYRPDSYKTFQQRYLINFKYWDGANT  93

Query  299  MAPIFVYMGGEDDIEPFARETGSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSK  478
             APIFV  GGE+ I+      G + E APHF  L+V+IEHR+YGKSVPFG  +EA  ++ 
Sbjct  94   SAPIFVLFGGEESIDYDRDINGFLPENAPHFKALLVYIEHRYYGKSVPFGTKEEAMKNAS  153

Query  479  TLGYLSSTQALADYATLIIDL  541
            TLGY +S QA+ADYA +++ +
Sbjct  154  TLGYCNSAQAIADYAAVLLHI  174



>ref|XP_008775539.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Phoenix dactylifera]
Length=381

 Score =   143 bits (360),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 70/121 (58%), Positives = 90/121 (74%), Gaps = 3/121 (2%)
 Frame = +2

Query  182  YDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWG-GAKNMAPIFVYMGGEDDIEPFARE  358
            + T +F Q LDHFTF P++Y+ F Q+YL+N  YW  G  + APIFVY G E +IE FA  
Sbjct  51   FTTHFFPQQLDHFTFQPKAYKVFSQKYLMNSTYWDQGPNHTAPIFVYTGNEGNIEWFAEN  110

Query  359  TGSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALADYATLIID  538
            TG +++ AP F+ L+VFIEHRFYG+S+PFG  KE+  S++TLGYL+STQALADYA LI  
Sbjct  111  TGFMLDIAPKFHALLVFIEHRFYGESMPFG--KESYESAETLGYLTSTQALADYAVLIRS  168

Query  539  L  541
            L
Sbjct  169  L  169



>ref|XP_010245640.1| PREDICTED: lysosomal Pro-X carboxypeptidase isoform X1 [Nelumbo 
nucifera]
Length=519

 Score =   144 bits (364),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 69/120 (58%), Positives = 88/120 (73%), Gaps = 2/120 (2%)
 Frame = +2

Query  182  YDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFARET  361
            Y+T+YFTQ+LDHF+F+  +  TFQQRYLIN  +W G  +MAPIF+Y G E DIE FA  T
Sbjct  64   YETRYFTQVLDHFSFS--NLPTFQQRYLINTDHWLGPNSMAPIFLYCGNEGDIEWFAVNT  121

Query  362  GSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALADYATLIIDL  541
            G + E AP FN +VVF EHR+YGKS+PFG    A  ++ +L YL++ QALAD+A LI DL
Sbjct  122  GFVWEIAPLFNAMVVFPEHRYYGKSMPFGSRDSAYKNAASLSYLTAEQALADFAALITDL  181



>ref|XP_007150130.1| hypothetical protein PHAVU_005G1292000g, partial [Phaseolus vulgaris]
 gb|ESW22124.1| hypothetical protein PHAVU_005G1292000g, partial [Phaseolus vulgaris]
Length=243

 Score =   139 bits (351),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 63/118 (53%), Positives = 85/118 (72%), Gaps = 0/118 (0%)
 Frame = +2

Query  188  TKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFARETGS  367
            T Y+ Q+LDHF + P+SY+TFQQRYL+N KYWGGA + +PI  Y+G E+ I+      G 
Sbjct  61   TLYYQQVLDHFNYRPESYKTFQQRYLMNSKYWGGAISNSPIIAYLGAEEPIDNSPESMGF  120

Query  368  IIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALADYATLIIDL  541
            + E A  F  L+V+IEHR+YGKSVPFG   EA  ++ T+GY +S QALADYA++II +
Sbjct  121  LNENAASFKALLVYIEHRYYGKSVPFGSRDEALQNASTIGYFNSAQALADYASVIIHI  178



>dbj|BAK05623.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=511

 Score =   143 bits (361),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 67/120 (56%), Positives = 85/120 (71%), Gaps = 2/120 (2%)
 Frame = +2

Query  182  YDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFARET  361
            Y+T+Y+TQ LDHF   P SY TF QRYL+N  YWGG    AP+FVY G E  IE F   T
Sbjct  59   YETRYYTQRLDHFNAAPVSYSTFPQRYLVNGTYWGG--KTAPVFVYAGNEGSIELFTNNT  116

Query  362  GSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALADYATLIIDL  541
            G + E AP F  ++VFIEHR+YG+SVPFG  + A  ++ T+GYLS+TQA+AD+ATL+  L
Sbjct  117  GFMWELAPRFRAMLVFIEHRYYGRSVPFGSEEAAFKNASTMGYLSTTQAVADFATLVQSL  176



>gb|KHN27695.1| Lysosomal Pro-X carboxypeptidase [Glycine soja]
Length=511

 Score =   143 bits (361),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 88/118 (75%), Gaps = 0/118 (0%)
 Frame = +2

Query  188  TKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFARETGS  367
            T Y+ Q+LDHF + P+SY+TFQQRYLIN KYWGGA + APIF Y+G E+ I+      G 
Sbjct  62   TFYYKQVLDHFNYRPESYKTFQQRYLINFKYWGGANSSAPIFAYLGAEEPIDGSPELIGF  121

Query  368  IIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALADYATLIIDL  541
            + + A  FN L+V+IEHR+YGKSVPFG  +EA  ++ T+GY +S QA+ADYA+++I +
Sbjct  122  LTDNAASFNALIVYIEHRYYGKSVPFGSREEALKNASTIGYFNSAQAIADYASVLIHI  179



>ref|XP_010932235.1| PREDICTED: lysosomal Pro-X carboxypeptidase isoform X1 [Elaeis 
guineensis]
Length=525

 Score =   143 bits (361),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 71/121 (59%), Positives = 89/121 (74%), Gaps = 3/121 (2%)
 Frame = +2

Query  182  YDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWG-GAKNMAPIFVYMGGEDDIEPFARE  358
            + T +F Q LDHFTF P++Y+ F Q+YL+N  YW  G  + APIFVY G E +IE FA  
Sbjct  75   FTTHFFPQQLDHFTFQPKAYKVFYQKYLMNSTYWDQGPNHTAPIFVYTGNEGNIEWFAEN  134

Query  359  TGSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALADYATLIID  538
            TG +++ AP FN L+VFIEHRFYG+S+PFG  KE+  S+ TLGYL+STQALADYA LI  
Sbjct  135  TGFMLDIAPKFNALLVFIEHRFYGESMPFG--KESYKSASTLGYLTSTQALADYAVLIRS  192

Query  539  L  541
            L
Sbjct  193  L  193



>ref|XP_010493391.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like isoform X1 [Camelina 
sativa]
Length=500

 Score =   143 bits (360),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 64/116 (55%), Positives = 84/116 (72%), Gaps = 0/116 (0%)
 Frame = +2

Query  194  YFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFARETGSII  373
            YF Q LDHFTFTP+SY TFQQRY I+ K+W GAK  API  ++G E  +E      G + 
Sbjct  58   YFNQTLDHFTFTPESYLTFQQRYAIDSKHWAGAKANAPILAFLGLESSLETDMSAFGFLR  117

Query  374  EFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALADYATLIIDL  541
            + APHF  L V+IEHR+YGK++PFG VKEA  ++ TLGYL++ QALADYA +++ +
Sbjct  118  DNAPHFKALCVYIEHRYYGKTIPFGSVKEAMKNASTLGYLNTAQALADYAAILLHI  173



>ref|XP_007153468.1| hypothetical protein PHAVU_003G038000g [Phaseolus vulgaris]
 gb|ESW25462.1| hypothetical protein PHAVU_003G038000g [Phaseolus vulgaris]
Length=496

 Score =   142 bits (359),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 65/113 (58%), Positives = 83/113 (73%), Gaps = 0/113 (0%)
 Frame = +2

Query  194  YFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFARETGSII  373
            +F Q LDHF + P+SY TFQQRYLIN KYWGGA + APIF Y+G E  I+      G +I
Sbjct  51   FFKQTLDHFNYRPESYTTFQQRYLINFKYWGGANSSAPIFAYLGAEAPIDNSPNTIGFLI  110

Query  374  EFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALADYATLI  532
            + AP FN L+V+IEHR+YGKSVPFG  +EA  ++ T+GY +S QALADYA ++
Sbjct  111  DNAPSFNALLVYIEHRYYGKSVPFGSREEALKNASTIGYFNSAQALADYAAVL  163



>ref|XP_010275727.1| PREDICTED: lysosomal Pro-X carboxypeptidase isoform X2 [Nelumbo 
nucifera]
Length=491

 Score =   142 bits (359),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 70/117 (60%), Positives = 89/117 (76%), Gaps = 5/117 (4%)
 Frame = +2

Query  182  YDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFARET  361
            Y T++F Q+LDHFTF PQS + F Q+YLIND YW   ++ APIFVY G E +IE FA  T
Sbjct  48   YKTQFFPQLLDHFTFQPQSSKIFYQKYLINDHYW---EHGAPIFVYTGNEGNIEWFAENT  104

Query  362  GSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALADYATLI  532
            G +++ AP F  L+VFIEHRFYG+S+PFG  K++  S+KTLGYL+S QALAD+A LI
Sbjct  105  GFMLDIAPKFRALLVFIEHRFYGESLPFG--KDSYKSAKTLGYLNSQQALADFAVLI  159



>ref|XP_010275726.1| PREDICTED: lysosomal Pro-X carboxypeptidase isoform X1 [Nelumbo 
nucifera]
Length=525

 Score =   143 bits (360),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 70/117 (60%), Positives = 89/117 (76%), Gaps = 5/117 (4%)
 Frame = +2

Query  182  YDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFARET  361
            Y T++F Q+LDHFTF PQS + F Q+YLIND YW   ++ APIFVY G E +IE FA  T
Sbjct  48   YKTQFFPQLLDHFTFQPQSSKIFYQKYLINDHYW---EHGAPIFVYTGNEGNIEWFAENT  104

Query  362  GSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALADYATLI  532
            G +++ AP F  L+VFIEHRFYG+S+PFG  K++  S+KTLGYL+S QALAD+A LI
Sbjct  105  GFMLDIAPKFRALLVFIEHRFYGESLPFG--KDSYKSAKTLGYLNSQQALADFAVLI  159



>ref|XP_006287573.1| hypothetical protein CARUB_v10000783mg [Capsella rubella]
 gb|EOA20471.1| hypothetical protein CARUB_v10000783mg [Capsella rubella]
Length=502

 Score =   142 bits (359),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 69/133 (52%), Positives = 90/133 (68%), Gaps = 2/133 (2%)
 Frame = +2

Query  143  SAASTKTTYNNQVYDTK--YFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFV  316
            +A     T  N   D K  YF Q LDHFTFTP+SY TFQQRY ++ K+W GAK  API V
Sbjct  40   NAPGDGPTQKNAESDLKFFYFNQTLDHFTFTPESYMTFQQRYAVDAKHWAGAKVNAPILV  99

Query  317  YMGGEDDIEPFARETGSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLS  496
            ++G E  +E      G + + APHF  L V+IEHR+YGK++PFG +KEA  +S TLGYL+
Sbjct  100  FLGMESSLETDMSAYGFLRDNAPHFKALNVYIEHRYYGKTIPFGSLKEAMKNSSTLGYLN  159

Query  497  STQALADYATLII  535
            + QALADYA +++
Sbjct  160  TAQALADYAAILL  172



>ref|XP_007047633.1| Serine carboxypeptidase S28 family protein isoform 2, partial 
[Theobroma cacao]
 gb|EOX91790.1| Serine carboxypeptidase S28 family protein isoform 2, partial 
[Theobroma cacao]
Length=382

 Score =   141 bits (355),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 67/135 (50%), Positives = 93/135 (69%), Gaps = 2/135 (1%)
 Frame = +2

Query  137  GFSAASTKTTYNNQVYDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFV  316
            G  + S KT +    Y+T+YF+Q LDHF+F+      F+QRYLIN ++W GA  + PIF+
Sbjct  48   GKHSHSIKTNHQQYRYETRYFSQRLDHFSFS--DLPNFRQRYLINTEHWVGASRLGPIFL  105

Query  317  YMGGEDDIEPFARETGSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLS  496
            Y G E DIE FA  TG + + APHF  +V+F EHR+YG+S+P+G  +EA  ++ TL YL+
Sbjct  106  YCGNEGDIEWFAVNTGFVWDIAPHFGAMVLFPEHRYYGESMPYGSKEEAYKNATTLSYLT  165

Query  497  STQALADYATLIIDL  541
            + QALAD+A LI DL
Sbjct  166  TEQALADFAVLITDL  180



>gb|ABR17702.1| unknown [Picea sitchensis]
Length=509

 Score =   142 bits (359),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 68/120 (57%), Positives = 84/120 (70%), Gaps = 0/120 (0%)
 Frame = +2

Query  182  YDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFARET  361
            Y+TKYFTQ LDHF+F      TFQQRYLINDKYW GA+ M PIF Y G E  I+ FA  T
Sbjct  54   YETKYFTQRLDHFSFKNHKNSTFQQRYLINDKYWLGAERMGPIFYYCGNEGYIDWFAVNT  113

Query  362  GSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALADYATLIIDL  541
            G + + AP F  L+VF EHR+YG+S+P+G    A     +L YL++ QALAD+ATLI+DL
Sbjct  114  GFMWDIAPQFGALLVFPEHRYYGESMPYGSQSMAYKDGDSLSYLTAEQALADFATLIVDL  173



>ref|XP_003539445.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Glycine max]
 gb|KHN27694.1| Lysosomal Pro-X carboxypeptidase [Glycine soja]
Length=509

 Score =   142 bits (359),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 62/116 (53%), Positives = 85/116 (73%), Gaps = 0/116 (0%)
 Frame = +2

Query  194  YFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFARETGSII  373
            Y+TQ LDHF + P SY TFQQRY++N KYWGGAK+ APIF + G E  ++  A+  G + 
Sbjct  59   YYTQRLDHFNYRPDSYHTFQQRYMVNFKYWGGAKSSAPIFAFFGAEGPVDEDAKYIGFLR  118

Query  374  EFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALADYATLIIDL  541
            + AP FN L+VFIEHR+YGKS+PFG  +EA  ++ T GY +S QA+ADYA +++ +
Sbjct  119  DNAPQFNALIVFIEHRYYGKSIPFGSSEEAMRNASTRGYFNSAQAIADYAAVLLHI  174



>ref|XP_008680725.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Zea mays]
 gb|AFW64865.1| putative serine peptidase S28 family protein [Zea mays]
Length=534

 Score =   142 bits (359),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 65/121 (54%), Positives = 87/121 (72%), Gaps = 3/121 (2%)
 Frame = +2

Query  182  YDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFARET  361
            Y+T+++TQ LDHF   P SY TFQQRYL+ND +WGG    APIF+Y G E D++ F   T
Sbjct  63   YETRWYTQRLDHFNSAPASYATFQQRYLVNDTFWGGP--TAPIFLYAGNEGDVDLFTNNT  120

Query  362  GSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEAT-SSSKTLGYLSSTQALADYATLIID  538
            G + E AP F  L+VF+EHR+YG+S+PFGG + A    ++T GYL+ TQALADYA+ ++ 
Sbjct  121  GFMWESAPRFRALLVFVEHRYYGESMPFGGTRAAAFRDARTKGYLTVTQALADYASFVLS  180

Query  539  L  541
            L
Sbjct  181  L  181



>gb|KDP43937.1| hypothetical protein JCGZ_05404 [Jatropha curcas]
Length=491

 Score =   142 bits (358),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 64/120 (53%), Positives = 87/120 (73%), Gaps = 3/120 (3%)
 Frame = +2

Query  182  YDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFARET  361
            ++  Y+TQ LDHF + P+SY TFQQRY++N KYWGGA N +PIFVY G EDD+     + 
Sbjct  51   FEIHYYTQTLDHFNYKPESYDTFQQRYILNYKYWGGANNSSPIFVYTGEEDDV---TYDV  107

Query  362  GSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALADYATLIIDL  541
             +I + A  F GL+++IEHR+YG+S+PFG   +A  +S TLGY SS QALADYA ++ D+
Sbjct  108  DAITDLAARFKGLLLYIEHRYYGESMPFGSEDQAFQNSSTLGYFSSEQALADYAQVVTDV  167



>gb|AAM15096.1| putative prolylcarboxypeptidase [Arabidopsis thaliana]
Length=476

 Score =   142 bits (357),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 68/120 (57%), Positives = 89/120 (74%), Gaps = 5/120 (4%)
 Frame = +2

Query  182  YDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFARET  361
            ++T+YF Q LDHF+FTP SY+ F Q+YLIN+++W   +   PIFVY G E DI+ FA  T
Sbjct  46   FETRYFPQNLDHFSFTPDSYKVFHQKYLINNRFW---RKGGPIFVYTGNEGDIDWFASNT  102

Query  362  GSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALADYATLIIDL  541
            G +++ AP F  L+VFIEHRFYG+S PFG  K++  S++TLGYL+S QALADYA LI  L
Sbjct  103  GFMLDIAPKFRALLVFIEHRFYGESTPFG--KKSHKSAETLGYLNSQQALADYAILIRSL  160



>ref|NP_850050.1| alpha/beta-Hydrolases superfamily protein [Arabidopsis thaliana]
 gb|AAL25591.1| At2g24280/F27D4.19 [Arabidopsis thaliana]
 gb|AAM98275.1| At2g24280/F27D4.19 [Arabidopsis thaliana]
 gb|AEC07556.1| alpha/beta-Hydrolases superfamily protein [Arabidopsis thaliana]
Length=494

 Score =   142 bits (358),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 68/120 (57%), Positives = 89/120 (74%), Gaps = 5/120 (4%)
 Frame = +2

Query  182  YDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFARET  361
            ++T+YF Q LDHF+FTP SY+ F Q+YLIN+++W   +   PIFVY G E DI+ FA  T
Sbjct  46   FETRYFPQNLDHFSFTPDSYKVFHQKYLINNRFW---RKGGPIFVYTGNEGDIDWFASNT  102

Query  362  GSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALADYATLIIDL  541
            G +++ AP F  L+VFIEHRFYG+S PFG  K++  S++TLGYL+S QALADYA LI  L
Sbjct  103  GFMLDIAPKFRALLVFIEHRFYGESTPFG--KKSHKSAETLGYLNSQQALADYAILIRSL  160



>ref|XP_006369373.1| hypothetical protein POPTR_0001s221002g, partial [Populus trichocarpa]
 gb|ERP65942.1| hypothetical protein POPTR_0001s221002g, partial [Populus trichocarpa]
Length=330

 Score =   139 bits (351),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 69/138 (50%), Positives = 97/138 (70%), Gaps = 6/138 (4%)
 Frame = +2

Query  128  EPDGFSAASTKTTYNNQVYDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAP  307
            EP   S +S+K         T Y+TQ LDHF + P+SY TF+QRY+I+ +YWGGA   AP
Sbjct  41   EPQTSSKSSSKDLV------TFYYTQTLDHFNYKPESYTTFRQRYVIDFRYWGGANTSAP  94

Query  308  IFVYMGGEDDIEPFARETGSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLG  487
            IFV+ G E+D++      GS+ + APHF  L+++IEHR+YG+S+PFG  KEA  +++TLG
Sbjct  95   IFVFFGAEEDLDDDLDAIGSLSDNAPHFKALLIYIEHRYYGRSIPFGSRKEALKNAETLG  154

Query  488  YLSSTQALADYATLIIDL  541
            YL+S QA+ADYA +I+ L
Sbjct  155  YLNSAQAMADYAAVIMHL  172



>emb|CDP10200.1| unnamed protein product [Coffea canephora]
Length=496

 Score =   142 bits (357),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 71/120 (59%), Positives = 87/120 (73%), Gaps = 5/120 (4%)
 Frame = +2

Query  182  YDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFARET  361
            Y+  YF Q+LDHFTF P+SY+ F Q+YL+N +YW      APIFVY G E DIE FA  T
Sbjct  49   YEAHYFPQVLDHFTFRPRSYKIFYQKYLMNSQYWHEG---APIFVYTGNEGDIEWFAANT  105

Query  362  GSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALADYATLIIDL  541
            G +++ AP F  L+VFIEHRFYG+S+PF   K+  +S+KTLGYLSS QALADYA LI  L
Sbjct  106  GFMLDIAPKFRALLVFIEHRFYGESLPFH--KKDLNSAKTLGYLSSQQALADYAVLIRSL  163



>ref|XP_002523751.1| lysosomal pro-X carboxypeptidase, putative [Ricinus communis]
 gb|EEF38691.1| lysosomal pro-X carboxypeptidase, putative [Ricinus communis]
Length=489

 Score =   142 bits (357),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 65/120 (54%), Positives = 88/120 (73%), Gaps = 2/120 (2%)
 Frame = +2

Query  182  YDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFARET  361
            Y+  Y+TQ LDHF + P+SY TFQQRY++N KYWGGA   +PIF+Y G E+++       
Sbjct  53   YEIHYYTQTLDHFNYKPESYATFQQRYILNFKYWGGANTSSPIFLYTGAEENL--IYHVD  110

Query  362  GSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALADYATLIIDL  541
             SI+E A  F GL+++IEHR+YG+S+PFG  ++A  +S TLGYLSS QALADYA +I D+
Sbjct  111  RSIVELAARFRGLLLYIEHRYYGESMPFGSEEQALQNSSTLGYLSSEQALADYAQVITDV  170



>ref|XP_004139280.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Cucumis sativus]
 ref|XP_004159394.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Cucumis sativus]
 gb|KGN60732.1| hypothetical protein Csa_2G008720 [Cucumis sativus]
Length=499

 Score =   142 bits (357),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 69/120 (58%), Positives = 92/120 (77%), Gaps = 5/120 (4%)
 Frame = +2

Query  182  YDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFARET  361
            ++T+++ Q+LDHFTFTP+S + F Q+YLIN++YW   +N APIFVY G E DIE FA  T
Sbjct  49   FETRFYPQLLDHFTFTPKSSKIFYQKYLINEEYW---RNGAPIFVYTGNEGDIEWFAANT  105

Query  362  GSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALADYATLIIDL  541
            G + + AP F+ L+VFIEHRFYG+S PFG   ++ +S++TLGYL+S QALADYA LI  L
Sbjct  106  GFLPDIAPEFHALLVFIEHRFYGESTPFGN--DSYNSAETLGYLTSQQALADYAVLIRSL  163



>gb|KHN44803.1| Lysosomal Pro-X carboxypeptidase [Glycine soja]
Length=471

 Score =   141 bits (356),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 66/121 (55%), Positives = 85/121 (70%), Gaps = 0/121 (0%)
 Frame = +2

Query  170  NNQVYDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPF  349
            N +   T YF Q+LDHF + P+SY TFQQRYLIN KYWGGA + APIF Y G E  I+  
Sbjct  18   NTEEVKTFYFKQVLDHFNYRPESYTTFQQRYLINFKYWGGANSSAPIFAYFGAESPIDNS  77

Query  350  ARETGSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALADYATL  529
                G + + A  FN L+V+IEHR+YGKSVPFG  +EA  ++ T+GY +S QALADYA++
Sbjct  78   PNGVGFLTDNAASFNALLVYIEHRYYGKSVPFGSREEALKNASTIGYFNSAQALADYASI  137

Query  530  I  532
            +
Sbjct  138  L  138



>ref|XP_007047632.1| Serine carboxypeptidase S28 family protein isoform 1 [Theobroma 
cacao]
 gb|EOX91789.1| Serine carboxypeptidase S28 family protein isoform 1 [Theobroma 
cacao]
Length=510

 Score =   141 bits (356),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 67/135 (50%), Positives = 93/135 (69%), Gaps = 2/135 (1%)
 Frame = +2

Query  137  GFSAASTKTTYNNQVYDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFV  316
            G  + S KT +    Y+T+YF+Q LDHF+F+      F+QRYLIN ++W GA  + PIF+
Sbjct  43   GKHSHSIKTNHQQYRYETRYFSQRLDHFSFS--DLPNFRQRYLINTEHWVGASRLGPIFL  100

Query  317  YMGGEDDIEPFARETGSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLS  496
            Y G E DIE FA  TG + + APHF  +V+F EHR+YG+S+P+G  +EA  ++ TL YL+
Sbjct  101  YCGNEGDIEWFAVNTGFVWDIAPHFGAMVLFPEHRYYGESMPYGSKEEAYKNATTLSYLT  160

Query  497  STQALADYATLIIDL  541
            + QALAD+A LI DL
Sbjct  161  TEQALADFAVLITDL  175



>ref|XP_006485140.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Citrus sinensis]
Length=463

 Score =   141 bits (355),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 67/120 (56%), Positives = 85/120 (71%), Gaps = 0/120 (0%)
 Frame = +2

Query  182  YDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFARET  361
            Y T  +TQ LDHF + P SY+TFQQRYLIN KYW GA   APIFV  GGE+ I+      
Sbjct  9    YKTFLYTQPLDHFNYRPDSYKTFQQRYLINFKYWDGANTSAPIFVLFGGEESIDYDRDIN  68

Query  362  GSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALADYATLIIDL  541
            G + E APHF  L+V+IEHR+YGKSVPFG  +EA  ++ TLGY +S QA+ADYA +++ +
Sbjct  69   GFLPENAPHFKALLVYIEHRYYGKSVPFGSKEEAMKNASTLGYCNSAQAIADYAAVLLHI  128



>gb|KHN29944.1| Lysosomal Pro-X carboxypeptidase [Glycine soja]
Length=348

 Score =   139 bits (350),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 64/115 (56%), Positives = 82/115 (71%), Gaps = 0/115 (0%)
 Frame = +2

Query  188  TKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFARETGS  367
            T YF Q+LDHF + P+SY TFQQRYL+N KYWGGA + APIF Y G E  I+      G 
Sbjct  25   TFYFKQVLDHFNYRPESYTTFQQRYLVNFKYWGGANSSAPIFAYFGAESPIDNSPNGIGF  84

Query  368  IIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALADYATLI  532
            + + A  FN L+V+IEHR+YGKSVPFG  +EA  ++ T+GY +S QALADYA ++
Sbjct  85   LTDNAASFNALLVYIEHRYYGKSVPFGSREEALKNASTIGYFNSAQALADYAAIL  139



>gb|KDO44734.1| hypothetical protein CISIN_1g0127111mg, partial [Citrus sinensis]
Length=194

 Score =   135 bits (339),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 61/120 (51%), Positives = 86/120 (72%), Gaps = 0/120 (0%)
 Frame = +2

Query  182  YDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFARET  361
            + T ++TQ LDHF + P SY TFQQRY+IN K+WGG+ + APIFVY+G E  ++      
Sbjct  10   FKTFFYTQTLDHFNYRPDSYATFQQRYVINFKHWGGSNSSAPIFVYLGAEGSLDEDLDVA  69

Query  362  GSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALADYATLIIDL  541
            G + + AP F  L+V+IEHR+YGKSVPFG  +EA  ++ TLGY +S QA+ADYA +++ +
Sbjct  70   GFLPDNAPRFKALLVYIEHRYYGKSVPFGSREEAMKNASTLGYFNSAQAIADYADVLLHI  129



>ref|XP_009617834.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Nicotiana tomentosiformis]
Length=497

 Score =   140 bits (354),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 70/120 (58%), Positives = 87/120 (73%), Gaps = 5/120 (4%)
 Frame = +2

Query  182  YDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFARET  361
            +   YF QILDHFTF P+S + F+Q+YLINDKYW   +   PIFVY G E +I+ FA  T
Sbjct  50   FKAHYFPQILDHFTFLPKSSKVFKQKYLINDKYW---QKGGPIFVYTGNEGNIDWFAANT  106

Query  362  GSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALADYATLIIDL  541
            G +++ AP F+ L+VFIEHRFYG S+PFG  K++  S KTLGYL+S QALADYA LI  L
Sbjct  107  GFMLDIAPKFHALLVFIEHRFYGNSMPFG--KKSYKSPKTLGYLNSQQALADYAVLIRSL  164



>ref|XP_007150131.1| hypothetical protein PHAVU_005G129300g, partial [Phaseolus vulgaris]
 gb|ESW22125.1| hypothetical protein PHAVU_005G129300g, partial [Phaseolus vulgaris]
Length=202

 Score =   135 bits (340),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 59/118 (50%), Positives = 86/118 (73%), Gaps = 0/118 (0%)
 Frame = +2

Query  188  TKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFARETGS  367
            T Y+ Q+LDHF + P+SY+TF+QRY++N KYWGGA + +PI  Y+G E+ I+      G 
Sbjct  21   TLYYEQVLDHFNYRPESYKTFRQRYMMNSKYWGGAISNSPIIAYLGAEEPIDNSPESMGF  80

Query  368  IIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALADYATLIIDL  541
            + + A  F  L+V+IEHR+YGKSVPFG  +EA  ++ T+GY +S QALADYA+++I +
Sbjct  81   LNDNAASFKALLVYIEHRYYGKSVPFGSREEALQNASTIGYFNSAQALADYASVLIHI  138



>gb|KDP38645.1| hypothetical protein JCGZ_03998 [Jatropha curcas]
Length=501

 Score =   140 bits (354),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 70/120 (58%), Positives = 89/120 (74%), Gaps = 5/120 (4%)
 Frame = +2

Query  182  YDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFARET  361
            Y T YF QILDHFTF P+SY+ F Q+YLIN +YW      APIFVY G E DI+ FA  T
Sbjct  50   YKTHYFPQILDHFTFQPKSYEIFYQKYLINGQYW---HRGAPIFVYTGNEGDIDWFAANT  106

Query  362  GSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALADYATLIIDL  541
            G +++ AP F  L+VFIEHRFYG+S+PFG  K++ +S++TLGYL+S QALAD++ LI  L
Sbjct  107  GFLLDIAPKFRALLVFIEHRFYGESLPFG--KDSYNSAETLGYLNSQQALADFSVLIRSL  164



>ref|XP_002523506.1| lysosomal pro-X carboxypeptidase, putative [Ricinus communis]
 gb|EEF38845.1| lysosomal pro-X carboxypeptidase, putative [Ricinus communis]
Length=501

 Score =   140 bits (353),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 71/128 (55%), Positives = 89/128 (70%), Gaps = 5/128 (4%)
 Frame = +2

Query  158  KTTYNNQVYDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDD  337
            K T     Y T+YF Q+LDHFTF P  Y+ F Q+YLI+ +YW      APIFVY G E D
Sbjct  42   KVTKPKIPYKTRYFPQLLDHFTFQPNGYKIFYQKYLISSQYW---HKEAPIFVYTGNEGD  98

Query  338  IEPFARETGSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALAD  517
            IE FA  TG +++ AP F  L+VFIEHRFYG+S+PFG  K++  S++TLGYL+S QALAD
Sbjct  99   IEWFAANTGFLLDIAPKFRALLVFIEHRFYGESMPFG--KDSYKSAETLGYLNSQQALAD  156

Query  518  YATLIIDL  541
            +A LI  L
Sbjct  157  FAVLIRSL  164



>ref|XP_010247724.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Nelumbo nucifera]
Length=501

 Score =   140 bits (353),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 68/129 (53%), Positives = 91/129 (71%), Gaps = 2/129 (2%)
 Frame = +2

Query  161  TTYNNQVYDTK--YFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGED  334
            TT  +  +D K  Y+TQ LDHF + P+SY+TFQQ+Y+++ KYWGGA   APIF Y+G E 
Sbjct  48   TTKTSSTWDFKKFYYTQTLDHFNYRPESYRTFQQKYVVSFKYWGGANASAPIFAYLGYEA  107

Query  335  DIEPFARETGSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALA  514
             +   +  TG I++ AP F+ LV+ IEHRFYG+S+PF    EA  +S TLGY +S QALA
Sbjct  108  PLYDQSPATGLILDNAPRFHALVIHIEHRFYGESIPFESRDEALRNSSTLGYFNSAQALA  167

Query  515  DYATLIIDL  541
            DYA +I+DL
Sbjct  168  DYAEIILDL  176



>emb|CDY46135.1| BnaA04g14230D [Brassica napus]
Length=494

 Score =   140 bits (353),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 68/120 (57%), Positives = 88/120 (73%), Gaps = 5/120 (4%)
 Frame = +2

Query  182  YDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFARET  361
            ++T+YF Q LDHF+F P+SY+ FQQ+YLIN ++W   +   PIFVY G E DI+ FA  T
Sbjct  46   FETRYFPQNLDHFSFRPESYKVFQQKYLINRRFW---RKGGPIFVYTGNEGDIDWFASNT  102

Query  362  GSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALADYATLIIDL  541
            G + + AP F  L+VFIEHRFYG+S PFG  K++  +++TLGYLSS QALADYA LI  L
Sbjct  103  GFMSDIAPKFRALLVFIEHRFYGESTPFG--KKSHKTAETLGYLSSQQALADYAILIRSL  160



>ref|XP_009140531.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Brassica rapa]
Length=526

 Score =   140 bits (353),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 68/120 (57%), Positives = 88/120 (73%), Gaps = 5/120 (4%)
 Frame = +2

Query  182  YDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFARET  361
            ++T+YF Q LDHF+F P+SY+ FQQ+YLIN ++W   +   PIFVY G E DI+ FA  T
Sbjct  78   FETRYFPQNLDHFSFRPESYKVFQQKYLINRRFW---RKGGPIFVYTGNEGDIDWFASNT  134

Query  362  GSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALADYATLIIDL  541
            G + + AP F  L+VFIEHRFYG+S PFG  K++  +++TLGYLSS QALADYA LI  L
Sbjct  135  GFMSDIAPKFRALLVFIEHRFYGESTPFG--KKSHKTAETLGYLSSQQALADYAILIRSL  192



>ref|XP_008457347.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Cucumis melo]
Length=499

 Score =   140 bits (353),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 68/120 (57%), Positives = 92/120 (77%), Gaps = 5/120 (4%)
 Frame = +2

Query  182  YDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFARET  361
            ++T+++ Q+LDHFTFTP+S + F Q+YLIN++YW   +N APIFVY G E DIE F   T
Sbjct  49   FETRFYPQLLDHFTFTPKSSKIFYQKYLINEEYW---RNGAPIFVYTGNEGDIEWFTANT  105

Query  362  GSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALADYATLIIDL  541
            G + + AP F+ L+VFIEHRFYG+S+PFG   ++ +S++TLGYL+S QALADYA LI  L
Sbjct  106  GFLPDIAPKFHALLVFIEHRFYGESMPFGN--DSYNSAETLGYLTSQQALADYAVLIRSL  163



>ref|XP_010254368.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Nelumbo nucifera]
Length=508

 Score =   140 bits (352),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 66/120 (55%), Positives = 89/120 (74%), Gaps = 5/120 (4%)
 Frame = +2

Query  182  YDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFARET  361
            + T ++TQ LDHF + P+SY TFQQRY+IN KYWGGAK+ API VY+G E  ++    + 
Sbjct  59   FKTYFYTQTLDHFNYRPESYTTFQQRYVINFKYWGGAKSGAPILVYLGAEQSLDNINFD-  117

Query  362  GSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALADYATLIIDL  541
            G + + AP FN L+V+IEHR+YG+SVPFG V+ A+    TLGY SS+QAL DYA +I+D+
Sbjct  118  GFLTDHAPQFNALIVYIEHRYYGESVPFGKVQNAS----TLGYFSSSQALEDYAEIILDI  173



>ref|XP_009767201.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Nicotiana sylvestris]
Length=497

 Score =   140 bits (352),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 70/120 (58%), Positives = 86/120 (72%), Gaps = 5/120 (4%)
 Frame = +2

Query  182  YDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFARET  361
            +   YF QILDHFTF P+S + F+Q+YLIND YW   K   PIFVY G E +I+ FA  T
Sbjct  50   FKVHYFPQILDHFTFLPKSSKVFKQKYLINDNYW---KQGGPIFVYTGNEGNIDWFAANT  106

Query  362  GSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALADYATLIIDL  541
            G +++ AP F+ L+VFIEHRFYG S+PFG  K++  S KTLGYL+S QALADYA LI  L
Sbjct  107  GFMLDIAPKFHALLVFIEHRFYGDSMPFG--KKSYKSPKTLGYLNSQQALADYAVLIRSL  164



>ref|XP_002878742.1| serine carboxypeptidase S28 family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH55001.1| serine carboxypeptidase S28 family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=495

 Score =   139 bits (351),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 69/120 (58%), Positives = 86/120 (72%), Gaps = 5/120 (4%)
 Frame = +2

Query  182  YDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFARET  361
            ++T+YF Q LDHF FTP+SY  F Q+YLIN ++W   +   PIFVY G E DI+ FA  T
Sbjct  46   FETRYFPQNLDHFGFTPESYTVFHQKYLINSRFW---RKGGPIFVYTGNEGDIDWFASNT  102

Query  362  GSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALADYATLIIDL  541
            G + + AP F  L+VFIEHRFYG+S PFG  K++  S++TLGYLSS QALADYA LI  L
Sbjct  103  GFMSDIAPKFQALLVFIEHRFYGESTPFG--KKSHKSAETLGYLSSQQALADYAILIRSL  160



>ref|XP_007150133.1| hypothetical protein PHAVU_005G129500g [Phaseolus vulgaris]
 gb|ESW22127.1| hypothetical protein PHAVU_005G129500g [Phaseolus vulgaris]
Length=440

 Score =   139 bits (350),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 66/132 (50%), Positives = 92/132 (70%), Gaps = 1/132 (1%)
 Frame = +2

Query  146  AASTKTTYNNQVYDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMG  325
            A S   TY + +  T Y+ Q+LDHF + P+SY+TF QRYLIN KYWGGA + +PIF Y+G
Sbjct  48   ATSDAKTYADNI-QTFYYEQVLDHFNYRPESYKTFLQRYLINFKYWGGANSSSPIFAYLG  106

Query  326  GEDDIEPFARETGSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQ  505
             E+ I+        + + A  FN L+V+IEHR+YGKSVPFG  +EA  ++ T+GY +S Q
Sbjct  107  AEEPIDNSPEGIAFLTDNAASFNALLVYIEHRYYGKSVPFGSREEALQNASTIGYFNSAQ  166

Query  506  ALADYATLIIDL  541
            ALADYA+++I +
Sbjct  167  ALADYASVLIHI  178



>ref|XP_007011978.1| Alpha/beta-Hydrolases superfamily protein isoform 2, partial 
[Theobroma cacao]
 gb|EOY29597.1| Alpha/beta-Hydrolases superfamily protein isoform 2, partial 
[Theobroma cacao]
Length=420

 Score =   139 bits (349),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 72/128 (56%), Positives = 86/128 (67%), Gaps = 5/128 (4%)
 Frame = +2

Query  158  KTTYNNQVYDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDD  337
            KT      +   YF Q LDHFTF P+S + F Q+YLIN  YW      APIFVY G E D
Sbjct  43   KTPKPKLPFKVHYFPQTLDHFTFQPKSSKIFYQKYLINSHYWHKG---APIFVYTGNEGD  99

Query  338  IEPFARETGSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALAD  517
            IE FA  TG +++ AP F  L+VFIEHRFYG+S PFG  KE+  S+KTLGYL+S QALAD
Sbjct  100  IEWFAANTGFMLDIAPKFKALLVFIEHRFYGESTPFG--KESYKSAKTLGYLNSQQALAD  157

Query  518  YATLIIDL  541
            +A LI +L
Sbjct  158  FAVLIRNL  165



>emb|CDY09173.1| BnaA02g05990D [Brassica napus]
Length=517

 Score =   139 bits (351),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 75/170 (44%), Positives = 104/170 (61%), Gaps = 9/170 (5%)
 Frame = +2

Query  38   ILLLLLFS---YFAISFAKttptfpfpfptII-NEPDGFSAASTKTTYNNQVYDTKYFTQ  205
            ILLLL+FS    F I+ A          P ++ NEPD     S     N+      YF Q
Sbjct  7    ILLLLIFSTSSSFFITLAHCKIPRLGISPKMLKNEPD-----SPTQKLNDPDLKMFYFNQ  61

Query  206  ILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFARETGSIIEFAP  385
             LDHFTFTP+SY TFQQRY I+ K+W GAK+ API  ++G E  ++      G + +  P
Sbjct  62   NLDHFTFTPKSYMTFQQRYAIDSKHWAGAKDNAPILAFLGEESSLDSDLSAIGFLRDNGP  121

Query  386  HFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALADYATLII  535
                L+V+IEHR+YGK++PFG  +EA  ++ TLGYL++ QALADYA++++
Sbjct  122  RLKALLVYIEHRYYGKTMPFGSAEEALKNASTLGYLNAAQALADYASILL  171



>ref|XP_009126572.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Brassica rapa]
Length=502

 Score =   139 bits (351),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 75/170 (44%), Positives = 104/170 (61%), Gaps = 9/170 (5%)
 Frame = +2

Query  38   ILLLLLFS---YFAISFAKttptfpfpfptII-NEPDGFSAASTKTTYNNQVYDTKYFTQ  205
            ILLLL+FS    F I+ A          P ++ NEPD     S     N+      YF Q
Sbjct  7    ILLLLIFSTSSSFFITLAHCKIPRLGISPKMLKNEPD-----SPTQKLNDPDLKMFYFNQ  61

Query  206  ILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFARETGSIIEFAP  385
             LDHFTFTP+SY TFQQRY I+ K+W GAK+ API  ++G E  ++      G + +  P
Sbjct  62   NLDHFTFTPKSYMTFQQRYAIDSKHWAGAKDNAPILAFLGEESSLDSDLSAIGFLRDNGP  121

Query  386  HFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALADYATLII  535
                L+V+IEHR+YGK++PFG  +EA  ++ TLGYL++ QALADYA++++
Sbjct  122  RLKALLVYIEHRYYGKTMPFGSAEEALKNASTLGYLNAAQALADYASILL  171



>ref|XP_010525816.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Tarenaya hassleriana]
Length=502

 Score =   139 bits (351),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 71/120 (59%), Positives = 87/120 (73%), Gaps = 9/120 (8%)
 Frame = +2

Query  188  TKYFTQILDHFTFTPQSYQTFQQRYLINDKYW--GGAKNMAPIFVYMGGEDDIEPFARET  361
            T+YF QILDHF+F P SY+TF Q+YLIN  +W  GG     PIFVY G E DIE FA  T
Sbjct  57   TRYFPQILDHFSFRPDSYRTFHQKYLINSHFWHIGG-----PIFVYTGNEGDIEWFASNT  111

Query  362  GSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALADYATLIIDL  541
            G + + AP F  L+VFIEHRFYG+S+PFG  K++  S++TLGYL+S QALAD+A LI  L
Sbjct  112  GFMFDIAPKFRALLVFIEHRFYGESLPFG--KKSYKSAETLGYLNSQQALADFAVLIRSL  169



>ref|XP_010421084.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like isoform X2 [Camelina 
sativa]
Length=437

 Score =   139 bits (349),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 63/116 (54%), Positives = 83/116 (72%), Gaps = 0/116 (0%)
 Frame = +2

Query  194  YFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFARETGSII  373
            YF Q LDHFTFTP+SY TFQQRY I+ K+W GAK  API  ++G E  +E      G + 
Sbjct  58   YFNQTLDHFTFTPESYLTFQQRYAIDSKHWAGAKANAPILAFLGLESSLETDFSAFGFLR  117

Query  374  EFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALADYATLIIDL  541
            + APHF  L V+IEH +YGK++PFG VKEA  ++ TLGYL++ QALADYA +++ +
Sbjct  118  DNAPHFKALCVYIEHTYYGKTIPFGSVKEAMKNASTLGYLNTAQALADYAAILLHV  173



>gb|KJB07579.1| hypothetical protein B456_001G030800 [Gossypium raimondii]
Length=492

 Score =   139 bits (350),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 70/120 (58%), Positives = 86/120 (72%), Gaps = 5/120 (4%)
 Frame = +2

Query  182  YDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFARET  361
            + T YF Q LDHFTF P+S + F Q+YLIN  YW   +  APIFVY G E +IE FA  T
Sbjct  48   FKTHYFPQTLDHFTFQPKSSKLFYQKYLINSDYW---RKGAPIFVYTGNEGNIEWFAANT  104

Query  362  GSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALADYATLIIDL  541
            G +++ AP F  L+VFIEHRFYGKS+PFG  K++  S+KTLGYL+S QALAD+A LI  L
Sbjct  105  GFMLDIAPKFKALLVFIEHRFYGKSMPFG--KDSYQSAKTLGYLNSQQALADFAVLITSL  162



>gb|KJB07578.1| hypothetical protein B456_001G030800 [Gossypium raimondii]
Length=484

 Score =   139 bits (350),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 70/120 (58%), Positives = 86/120 (72%), Gaps = 5/120 (4%)
 Frame = +2

Query  182  YDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFARET  361
            + T YF Q LDHFTF P+S + F Q+YLIN  YW   +  APIFVY G E +IE FA  T
Sbjct  48   FKTHYFPQTLDHFTFQPKSSKLFYQKYLINSDYW---RKGAPIFVYTGNEGNIEWFAANT  104

Query  362  GSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALADYATLIIDL  541
            G +++ AP F  L+VFIEHRFYGKS+PFG  K++  S+KTLGYL+S QALAD+A LI  L
Sbjct  105  GFMLDIAPKFKALLVFIEHRFYGKSMPFG--KDSYQSAKTLGYLNSQQALADFAVLITSL  162



>gb|KHG29529.1| Lysosomal Pro-X carboxypeptidase [Gossypium arboreum]
Length=492

 Score =   139 bits (350),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 70/120 (58%), Positives = 86/120 (72%), Gaps = 5/120 (4%)
 Frame = +2

Query  182  YDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFARET  361
            + T YF Q LDHFTF P+S + F Q+YLIN  YW   +  APIFVY G E +IE FA  T
Sbjct  48   FKTHYFPQTLDHFTFQPKSSKLFYQKYLINSDYW---RKGAPIFVYTGNEGNIEWFAANT  104

Query  362  GSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALADYATLIIDL  541
            G +++ AP F  L+VFIEHRFYGKS+PFG  K++  S+KTLGYL+S QALAD+A LI  L
Sbjct  105  GFMLDIAPKFKALLVFIEHRFYGKSMPFG--KDSYQSAKTLGYLNSQQALADFAVLITSL  162



>ref|XP_006343677.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Solanum tuberosum]
Length=498

 Score =   139 bits (350),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 72/123 (59%), Positives = 87/123 (71%), Gaps = 9/123 (7%)
 Frame = +2

Query  182  YDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYW---GGAKNMAPIFVYMGGEDDIEPFA  352
            + T YF QILDHFTF P+S + F Q+YLIND+YW   GG     PIFVY G E +I+ FA
Sbjct  49   FKTHYFPQILDHFTFLPKSSKVFYQKYLINDQYWHKEGGG----PIFVYTGNEGNIDWFA  104

Query  353  RETGSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALADYATLI  532
              TG +++ AP FN L+VFIEHRFYG S+PFG    +  S+KTLGYL+S QALADYA LI
Sbjct  105  VNTGFMVDIAPKFNALLVFIEHRFYGDSMPFGN--NSYKSAKTLGYLNSQQALADYAVLI  162

Query  533  IDL  541
              L
Sbjct  163  RSL  165



>ref|XP_010421083.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like isoform X1 [Camelina 
sativa]
Length=500

 Score =   139 bits (350),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 82/114 (72%), Gaps = 0/114 (0%)
 Frame = +2

Query  194  YFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFARETGSII  373
            YF Q LDHFTFTP+SY TFQQRY I+ K+W GAK  API  ++G E  +E      G + 
Sbjct  58   YFNQTLDHFTFTPESYLTFQQRYAIDSKHWAGAKANAPILAFLGLESSLETDFSAFGFLR  117

Query  374  EFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALADYATLII  535
            + APHF  L V+IEH +YGK++PFG VKEA  ++ TLGYL++ QALADYA +++
Sbjct  118  DNAPHFKALCVYIEHTYYGKTIPFGSVKEAMKNASTLGYLNTAQALADYAAILL  171



>gb|EPS59259.1| hypothetical protein M569_15548, partial [Genlisea aurea]
Length=465

 Score =   139 bits (349),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 65/120 (54%), Positives = 86/120 (72%), Gaps = 2/120 (2%)
 Frame = +2

Query  182  YDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFARET  361
            Y+T+YF QILDHF+F+    + F+QRYLI+ ++W G     PIF+Y G E DIE FA  T
Sbjct  23   YETRYFDQILDHFSFS--GPERFRQRYLISTEHWTGPDRQGPIFLYCGNEGDIEWFAENT  80

Query  362  GSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALADYATLIIDL  541
            G + E AP F  +VVF EHR+YGKS+P+GG +EA  ++ TL +L+S QALAD+A LI DL
Sbjct  81   GFVWEIAPRFGAMVVFTEHRYYGKSMPYGGEEEAYKNATTLAHLTSEQALADFAILITDL  140



>ref|XP_004242567.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Solanum lycopersicum]
Length=498

 Score =   139 bits (349),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 71/123 (58%), Positives = 87/123 (71%), Gaps = 9/123 (7%)
 Frame = +2

Query  182  YDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYW---GGAKNMAPIFVYMGGEDDIEPFA  352
            + T YF QILDHFTF P+S + F Q+YLIND+YW   GG     PIFVY G E +I+ FA
Sbjct  49   FKTHYFPQILDHFTFLPKSCKVFYQKYLINDQYWNKDGGG----PIFVYTGNEGNIDWFA  104

Query  353  RETGSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALADYATLI  532
              TG +I+  P+FN L++FIEHRFYG S+PFG    +  S+KTLGYL+S QALADYA LI
Sbjct  105  ANTGFMIDIVPNFNALLIFIEHRFYGDSMPFGN--NSYKSAKTLGYLNSQQALADYAVLI  162

Query  533  IDL  541
              L
Sbjct  163  RSL  165



>emb|CDY20293.1| BnaC04g36630D [Brassica napus]
Length=492

 Score =   139 bits (349),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 67/120 (56%), Positives = 87/120 (73%), Gaps = 5/120 (4%)
 Frame = +2

Query  182  YDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFARET  361
            ++T+YF Q LDHF+F P+SY+ F Q+YLIN ++W   +   PIFVY G E DI+ FA  T
Sbjct  46   FETRYFPQNLDHFSFRPESYKVFHQKYLINSRFW---RKGGPIFVYTGNEGDIDWFASNT  102

Query  362  GSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALADYATLIIDL  541
            G + + AP F  L+VFIEHRFYG+S PFG  K++  S++TLGYL+S QALADYA LI  L
Sbjct  103  GFMSDIAPKFRALLVFIEHRFYGESTPFG--KKSHKSAETLGYLNSQQALADYAILIRSL  160



>ref|XP_002523750.1| Lysosomal Pro-X carboxypeptidase, putative [Ricinus communis]
 gb|EEF38690.1| Lysosomal Pro-X carboxypeptidase, putative [Ricinus communis]
Length=491

 Score =   138 bits (348),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 64/120 (53%), Positives = 85/120 (71%), Gaps = 3/120 (3%)
 Frame = +2

Query  182  YDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFARET  361
            Y+  Y+TQ LDHF + PQSY TFQQRY++N KYWGGA   +PIFVY G E D+     + 
Sbjct  53   YEIHYYTQTLDHFNYNPQSYATFQQRYILNFKYWGGANTSSPIFVYTGEEVDV---TYDV  109

Query  362  GSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALADYATLIIDL  541
             +I+  A  F  L+++IEHR+YG+S+PFG   +A  +S TLGYLSS QALADYA ++ D+
Sbjct  110  DTILHLAARFKALLLYIEHRYYGESMPFGSEDQAFQNSSTLGYLSSEQALADYAQVVTDV  169



>ref|XP_007011977.1| Alpha/beta-Hydrolases superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOY29596.1| Alpha/beta-Hydrolases superfamily protein isoform 1 [Theobroma 
cacao]
Length=498

 Score =   138 bits (348),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 72/128 (56%), Positives = 86/128 (67%), Gaps = 5/128 (4%)
 Frame = +2

Query  158  KTTYNNQVYDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDD  337
            KT      +   YF Q LDHFTF P+S + F Q+YLIN  YW      APIFVY G E D
Sbjct  43   KTPKPKLPFKVHYFPQTLDHFTFQPKSSKIFYQKYLINSHYWHKG---APIFVYTGNEGD  99

Query  338  IEPFARETGSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALAD  517
            IE FA  TG +++ AP F  L+VFIEHRFYG+S PFG  KE+  S+KTLGYL+S QALAD
Sbjct  100  IEWFAANTGFMLDIAPKFKALLVFIEHRFYGESTPFG--KESYKSAKTLGYLNSQQALAD  157

Query  518  YATLIIDL  541
            +A LI +L
Sbjct  158  FAVLIRNL  165



>ref|XP_007155791.1| hypothetical protein PHAVU_003G232100g [Phaseolus vulgaris]
 gb|ESW27785.1| hypothetical protein PHAVU_003G232100g [Phaseolus vulgaris]
Length=444

 Score =   138 bits (347),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 67/134 (50%), Positives = 89/134 (66%), Gaps = 2/134 (1%)
 Frame = +2

Query  140  FSAASTKTTYNNQVYDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVY  319
            F+A  T       +Y+T+YF Q LDHF+F+     TF QRYLI+  +W G + + PIF+Y
Sbjct  40   FAATGTHFEPPQFLYETRYFQQRLDHFSFS--ELPTFPQRYLISTDHWVGPQRLGPIFLY  97

Query  320  MGGEDDIEPFARETGSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSS  499
             G E DIE FA+ TG + E AP F  +VVF EHR+YG+S+PFG  KEA   + TL YL++
Sbjct  98   CGNEGDIEWFAQNTGFVWEIAPQFGAMVVFPEHRYYGESIPFGSAKEAYKDATTLSYLTA  157

Query  500  TQALADYATLIIDL  541
             QALAD++ LI DL
Sbjct  158  EQALADFSVLITDL  171



>gb|EMT30656.1| Lysosomal Pro-X carboxypeptidase [Aegilops tauschii]
Length=485

 Score =   138 bits (347),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 65/120 (54%), Positives = 84/120 (70%), Gaps = 2/120 (2%)
 Frame = +2

Query  182  YDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFARET  361
            Y+T+  TQ LDHF   P SY+TF QRYL+N  YWGG    AP+FVY G E +IE F   T
Sbjct  4    YETRSHTQRLDHFNAAPASYRTFPQRYLVNGTYWGG--KTAPVFVYAGNEGNIELFTNNT  61

Query  362  GSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALADYATLIIDL  541
            G + E AP F  ++VFIEHR+YG+SVPFG  + A  ++ T GYL++TQA+AD+ATL+  L
Sbjct  62   GFMWELAPRFRAMLVFIEHRYYGRSVPFGSEEAAFRNTSTAGYLTTTQAVADFATLVQSL  121



>gb|AGV54352.1| lysosomal Pro-X carboxypeptidase-like protein [Phaseolus vulgaris]
Length=506

 Score =   138 bits (347),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 67/134 (50%), Positives = 89/134 (66%), Gaps = 2/134 (1%)
 Frame = +2

Query  140  FSAASTKTTYNNQVYDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVY  319
            F+A  T       +Y+T+YF Q LDHF+F+     TF QRYLI+  +W G + + PIF+Y
Sbjct  40   FAATGTHFEPPQFLYETRYFQQRLDHFSFS--ELPTFPQRYLISTDHWVGPQRLGPIFLY  97

Query  320  MGGEDDIEPFARETGSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSS  499
             G E DIE FA+ TG + E AP F  +VVF EHR+YG+S+PFG  KEA   + TL YL++
Sbjct  98   CGNEGDIEWFAQNTGFVWEIAPQFGAMVVFPEHRYYGESIPFGSAKEAYKDATTLSYLTA  157

Query  500  TQALADYATLIIDL  541
             QALAD++ LI DL
Sbjct  158  EQALADFSVLITDL  171



>ref|XP_002313554.2| hypothetical protein POPTR_0009s00750g [Populus trichocarpa]
 gb|EEE87509.2| hypothetical protein POPTR_0009s00750g [Populus trichocarpa]
Length=494

 Score =   138 bits (347),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 65/120 (54%), Positives = 85/120 (71%), Gaps = 2/120 (2%)
 Frame = +2

Query  182  YDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFARET  361
            ++   +TQ LDHF F P+SY TFQQRY++N KYWGGA   +PIFVY+G E D+       
Sbjct  52   FEVHNYTQSLDHFNFKPESYATFQQRYILNYKYWGGANTSSPIFVYLGAEIDVT--QNLD  109

Query  362  GSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALADYATLIIDL  541
             SI++ A  F GL+++IEHR+YG S+PFG   EA  +S T GYLSS QALADYA +I+D+
Sbjct  110  LSIVDLAARFKGLLLYIEHRYYGVSMPFGSEDEAFQNSSTFGYLSSEQALADYAQVIVDV  169



>ref|XP_007155790.1| hypothetical protein PHAVU_003G232100g [Phaseolus vulgaris]
 gb|ESW27784.1| hypothetical protein PHAVU_003G232100g [Phaseolus vulgaris]
Length=506

 Score =   138 bits (347),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 67/134 (50%), Positives = 89/134 (66%), Gaps = 2/134 (1%)
 Frame = +2

Query  140  FSAASTKTTYNNQVYDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVY  319
            F+A  T       +Y+T+YF Q LDHF+F+     TF QRYLI+  +W G + + PIF+Y
Sbjct  40   FAATGTHFEPPQFLYETRYFQQRLDHFSFS--ELPTFPQRYLISTDHWVGPQRLGPIFLY  97

Query  320  MGGEDDIEPFARETGSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSS  499
             G E DIE FA+ TG + E AP F  +VVF EHR+YG+S+PFG  KEA   + TL YL++
Sbjct  98   CGNEGDIEWFAQNTGFVWEIAPQFGAMVVFPEHRYYGESIPFGSAKEAYKDATTLSYLTA  157

Query  500  TQALADYATLIIDL  541
             QALAD++ LI DL
Sbjct  158  EQALADFSVLITDL  171



>ref|XP_003517871.2| PREDICTED: lysosomal Pro-X carboxypeptidase-like isoform X1 [Glycine 
max]
Length=503

 Score =   138 bits (347),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 65/121 (54%), Positives = 84/121 (69%), Gaps = 0/121 (0%)
 Frame = +2

Query  170  NNQVYDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPF  349
            N +   T YF Q+LDHF + P+SY TFQQRYLIN KYWGGA + APIF Y G E  I+  
Sbjct  50   NTEEVKTFYFKQVLDHFNYRPESYTTFQQRYLINFKYWGGANSSAPIFAYFGAESPIDNS  109

Query  350  ARETGSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALADYATL  529
                G + + A  FN L+V+IEHR+YGKSV FG  +EA  ++ T+GY +S QALADYA++
Sbjct  110  PNGVGFLTDNAASFNALLVYIEHRYYGKSVQFGSREEALKNASTIGYFNSAQALADYASI  169

Query  530  I  532
            +
Sbjct  170  L  170



>ref|XP_006388622.1| hypothetical protein POPTR_0135s002102g, partial [Populus trichocarpa]
 gb|ERP47536.1| hypothetical protein POPTR_0135s002102g, partial [Populus trichocarpa]
Length=357

 Score =   136 bits (342),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 62/116 (53%), Positives = 88/116 (76%), Gaps = 0/116 (0%)
 Frame = +2

Query  194  YFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFARETGSII  373
            Y+TQ LDHF + P+SY TF+QRY+I+ +YWGGA   APIFV+ G E+D++      G + 
Sbjct  57   YYTQTLDHFNYKPESYTTFRQRYVIDFRYWGGANTSAPIFVFFGAEEDLDDDLDAIGFLS  116

Query  374  EFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALADYATLIIDL  541
            + APHF  L+++IEHR+YG+S+PFG  KEA  +++TLGYL+S QA+ADYA +I+ L
Sbjct  117  DNAPHFKALLIYIEHRYYGRSIPFGSRKEALKNAETLGYLNSAQAMADYAAVIMHL  172



>emb|CBI18675.3| unnamed protein product [Vitis vinifera]
Length=502

 Score =   137 bits (346),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 69/118 (58%), Positives = 87/118 (74%), Gaps = 5/118 (4%)
 Frame = +2

Query  188  TKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFARETGS  367
            T+YF Q+LDHFTFTP+S   F Q+YLIN +YW    + APIFVY G E DI+ FA  TG 
Sbjct  58   TQYFPQLLDHFTFTPKSSTIFYQKYLINTQYW---THGAPIFVYTGNEGDIDWFASNTGF  114

Query  368  IIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALADYATLIIDL  541
            +++ AP F  ++VFIEHRFYG+S+PFG  KE+  S +TLGYL+S QALAD+A LI  L
Sbjct  115  LLDIAPSFRAMLVFIEHRFYGESMPFG--KESYKSPETLGYLNSQQALADFAVLIRSL  170



>ref|XP_009631310.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Nicotiana tomentosiformis]
Length=523

 Score =   137 bits (346),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 59/122 (48%), Positives = 85/122 (70%), Gaps = 0/122 (0%)
 Frame = +2

Query  176  QVYDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFAR  355
            + ++T Y+TQ LDHF + P+SY TF+QRY+IN  YWGG+ + +PIF Y+G E  I+    
Sbjct  73   KAFETYYYTQTLDHFNYGPKSYSTFKQRYIINSNYWGGSNSNSPIFAYLGAESSIDSDPL  132

Query  356  ETGSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALADYATLII  535
              G + +FAP F  L+V+IEHR+YGKS+PFG ++EA       GY +S QA+ADYA L++
Sbjct  133  GIGFLTDFAPRFKALLVYIEHRYYGKSIPFGTMEEALKDEDRRGYFNSAQAIADYAELLL  192

Query  536  DL  541
             +
Sbjct  193  HV  194



>ref|XP_003633162.2| PREDICTED: lysosomal Pro-X carboxypeptidase [Vitis vinifera]
Length=488

 Score =   137 bits (345),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 69/118 (58%), Positives = 87/118 (74%), Gaps = 5/118 (4%)
 Frame = +2

Query  188  TKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFARETGS  367
            T+YF Q+LDHFTFTP+S   F Q+YLIN +YW    + APIFVY G E DI+ FA  TG 
Sbjct  44   TQYFPQLLDHFTFTPKSSTIFYQKYLINTQYW---THGAPIFVYTGNEGDIDWFASNTGF  100

Query  368  IIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALADYATLIIDL  541
            +++ AP F  ++VFIEHRFYG+S+PFG  KE+  S +TLGYL+S QALAD+A LI  L
Sbjct  101  LLDIAPSFRAMLVFIEHRFYGESMPFG--KESYKSPETLGYLNSQQALADFAVLIRSL  156



>ref|XP_011073662.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Sesamum indicum]
Length=518

 Score =   137 bits (346),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/120 (52%), Positives = 86/120 (72%), Gaps = 2/120 (2%)
 Frame = +2

Query  182  YDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFARET  361
            Y+T+YF Q LDHF+F+     TF+QRYLIN +YWGG   + PIF+Y G E DIE FA  T
Sbjct  66   YETRYFDQNLDHFSFS--DLPTFRQRYLINTEYWGGPTKLGPIFLYCGNEGDIEWFAANT  123

Query  362  GSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALADYATLIIDL  541
            G + E AP F  +++F EHR+YG+S+P+G  +EA  ++ TL +L++ QALAD+A LI +L
Sbjct  124  GFVWELAPRFRAMIIFPEHRYYGESMPYGSWEEAYKNASTLAHLTAEQALADFAVLITEL  183



>ref|XP_004487553.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Cicer arietinum]
Length=506

 Score =   137 bits (345),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 61/119 (51%), Positives = 85/119 (71%), Gaps = 0/119 (0%)
 Frame = +2

Query  185  DTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFARETG  364
            +T Y+ Q+LDHF + P+SY  F+QRY +N KYWGGA + APIF Y+G ED I+ +    G
Sbjct  59   ETFYYKQVLDHFNYRPESYHKFEQRYFMNFKYWGGANSSAPIFAYLGAEDSIDTYPTGIG  118

Query  365  SIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALADYATLIIDL  541
             + + A  F  L+V+IEHR+YGKSVPFG  K+A  ++ TLGY +S QA+ADYA ++I +
Sbjct  119  FMTDNAATFKALLVYIEHRYYGKSVPFGSRKKAFRNASTLGYFNSAQAIADYAAVLIHI  177



>gb|KJB54926.1| hypothetical protein B456_009G054400 [Gossypium raimondii]
Length=446

 Score =   137 bits (344),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 69/128 (54%), Positives = 89/128 (70%), Gaps = 5/128 (4%)
 Frame = +2

Query  158  KTTYNNQVYDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDD  337
            KT      + T+YF Q LDHF+F P+S + F Q+YLIN +YW      APIFVY G E D
Sbjct  46   KTPKPKLPFKTRYFPQTLDHFSFHPKSSKIFYQKYLINTQYWHKG---APIFVYTGNEGD  102

Query  338  IEPFARETGSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALAD  517
            IE FA  TG +++ AP F  L++FIEHRFYG+S+PFG  K++  S+KT+GYL+S QALAD
Sbjct  103  IEWFAANTGFMLDIAPKFRALLLFIEHRFYGESMPFG--KDSYQSAKTMGYLNSQQALAD  160

Query  518  YATLIIDL  541
            +A LI  L
Sbjct  161  FAVLIRSL  168



>ref|XP_010493397.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like isoform X3 [Camelina 
sativa]
Length=439

 Score =   136 bits (343),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 60/116 (52%), Positives = 83/116 (72%), Gaps = 0/116 (0%)
 Frame = +2

Query  194  YFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFARETGSII  373
            YF Q LDHFTFTP+SY TFQQRY I+  +WGGAK  API  ++G E  ++      G + 
Sbjct  58   YFNQTLDHFTFTPKSYMTFQQRYAIDSTHWGGAKANAPILAFLGEESSLDSDLSAVGFLR  117

Query  374  EFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALADYATLIIDL  541
            +  P F  L+V+IEHR+YGK++PFG  +EA  ++ TLGYL++ QALADYAT+++ +
Sbjct  118  DNGPRFKALLVYIEHRYYGKTMPFGSAEEALKNASTLGYLNAAQALADYATILLHV  173



>ref|XP_010316042.1| PREDICTED: lysosomal Pro-X carboxypeptidase isoform X2 [Solanum 
lycopersicum]
Length=489

 Score =   137 bits (344),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 65/120 (54%), Positives = 84/120 (70%), Gaps = 2/120 (2%)
 Frame = +2

Query  182  YDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFARET  361
            Y+TKYF Q LDHF+F      +F QRYLIN ++W G    APIF+Y G E DIE FA  T
Sbjct  36   YETKYFQQKLDHFSFA--DLPSFSQRYLINTQHWEGPSRSAPIFLYCGNEGDIEWFADNT  93

Query  362  GSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALADYATLIIDL  541
            G + E AP F  +V+F EHR+YG+S+P+G  +EA  ++ TL YL++ QALADYA LII+L
Sbjct  94   GFVWEIAPRFGAMVIFPEHRYYGESMPYGSKEEAYKNATTLSYLTAEQALADYAVLIIEL  153



>ref|XP_004231954.1| PREDICTED: lysosomal Pro-X carboxypeptidase isoform X1 [Solanum 
lycopersicum]
Length=505

 Score =   137 bits (344),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 65/120 (54%), Positives = 84/120 (70%), Gaps = 2/120 (2%)
 Frame = +2

Query  182  YDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFARET  361
            Y+TKYF Q LDHF+F      +F QRYLIN ++W G    APIF+Y G E DIE FA  T
Sbjct  52   YETKYFQQKLDHFSFA--DLPSFSQRYLINTQHWEGPSRSAPIFLYCGNEGDIEWFADNT  109

Query  362  GSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALADYATLIIDL  541
            G + E AP F  +V+F EHR+YG+S+P+G  +EA  ++ TL YL++ QALADYA LII+L
Sbjct  110  GFVWEIAPRFGAMVIFPEHRYYGESMPYGSKEEAYKNATTLSYLTAEQALADYAVLIIEL  169



>ref|XP_010493394.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like isoform X1 [Camelina 
sativa]
 ref|XP_010493396.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like isoform X2 [Camelina 
sativa]
Length=501

 Score =   137 bits (344),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 60/116 (52%), Positives = 83/116 (72%), Gaps = 0/116 (0%)
 Frame = +2

Query  194  YFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFARETGSII  373
            YF Q LDHFTFTP+SY TFQQRY I+  +WGGAK  API  ++G E  ++      G + 
Sbjct  58   YFNQTLDHFTFTPKSYMTFQQRYAIDSTHWGGAKANAPILAFLGEESSLDSDLSAVGFLR  117

Query  374  EFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALADYATLIIDL  541
            +  P F  L+V+IEHR+YGK++PFG  +EA  ++ TLGYL++ QALADYAT+++ +
Sbjct  118  DNGPRFKALLVYIEHRYYGKTMPFGSAEEALKNASTLGYLNAAQALADYATILLHV  173



>ref|XP_004980174.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Setaria italica]
Length=520

 Score =   137 bits (344),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 64/120 (53%), Positives = 83/120 (69%), Gaps = 2/120 (2%)
 Frame = +2

Query  182  YDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFARET  361
            Y+T+++TQ LDHF   P SY TFQQRYLIN  +W G    +PIF+Y G E D+E F   T
Sbjct  66   YETRHYTQRLDHFNSAPSSYATFQQRYLINGTFWRG--KTSPIFLYAGNEGDVELFTNNT  123

Query  362  GSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALADYATLIIDL  541
            G + E AP F  ++VFIEHR+YGKS+PFGG + A   + T GYL+  QALADYA+ ++ L
Sbjct  124  GFMWEAAPRFGAMLVFIEHRYYGKSMPFGGKEAAYRDAATKGYLTVPQALADYASFVLSL  183



>ref|XP_006294084.1| hypothetical protein CARUB_v10023078mg [Capsella rubella]
 gb|EOA26982.1| hypothetical protein CARUB_v10023078mg [Capsella rubella]
Length=495

 Score =   137 bits (344),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 67/120 (56%), Positives = 86/120 (72%), Gaps = 5/120 (4%)
 Frame = +2

Query  182  YDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFARET  361
            ++T+YF Q LDHF+FTP SY+ F Q+YLIN  +W   +   PIFVY G E DI+ FA  T
Sbjct  47   FETRYFPQNLDHFSFTPDSYKVFHQKYLINSHFW---RKGGPIFVYTGNEGDIDWFATNT  103

Query  362  GSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALADYATLIIDL  541
            G + + AP F  L+VFIEHRFYG+S PFG  K++  S++TLGYL+S QALAD+A LI  L
Sbjct  104  GFMSDIAPKFRALLVFIEHRFYGESTPFG--KKSHKSAETLGYLNSQQALADFAILIRSL  161



>ref|XP_010419296.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Camelina sativa]
Length=463

 Score =   136 bits (343),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 66/120 (55%), Positives = 87/120 (73%), Gaps = 5/120 (4%)
 Frame = +2

Query  182  YDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFARET  361
            ++T+YF Q LDHF+FTP+SY+ F Q+YLIN ++W   +   PIFVY G E DI+ FA  T
Sbjct  54   FETRYFPQNLDHFSFTPESYKVFHQKYLINCRFW---RKGGPIFVYTGNEGDIDWFASNT  110

Query  362  GSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALADYATLIIDL  541
            G + + AP F  L+VFIEHRFYG+S P G  K++  S++TLGYL+S QALAD+A LI  L
Sbjct  111  GFMSDIAPKFRALLVFIEHRFYGESTPIG--KKSHKSAETLGYLNSQQALADFAILIRSL  168



>ref|XP_009785587.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Nicotiana sylvestris]
Length=504

 Score =   137 bits (344),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 60/134 (45%), Positives = 92/134 (69%), Gaps = 1/134 (1%)
 Frame = +2

Query  134  DGFSAASTKTTYNNQVYDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIF  313
            D  + +++ T   N+ ++T ++TQ LDHF + P+SY TF+QRY+IN KYWGG+ + +PIF
Sbjct  45   DSNTLSNSSTNLPNE-FETYFYTQTLDHFNYGPKSYSTFKQRYIINSKYWGGSNSSSPIF  103

Query  314  VYMGGEDDIEPFARETGSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYL  493
             Y+G E  I+      G + +FAP F  L+V++EHR+YG+S+P G ++EA     T GY 
Sbjct  104  AYLGAESSIDNDPLNIGFLTDFAPRFKALLVYMEHRYYGQSIPLGKIEEALKDQDTRGYF  163

Query  494  SSTQALADYATLII  535
            +S QA+ADYA L++
Sbjct  164  NSAQAIADYAELLL  177



>ref|XP_004145825.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Cucumis sativus]
 gb|KGN46899.1| hypothetical protein Csa_6G149400 [Cucumis sativus]
Length=491

 Score =   136 bits (343),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 64/120 (53%), Positives = 83/120 (69%), Gaps = 0/120 (0%)
 Frame = +2

Query  182  YDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFARET  361
            + T YF Q LDHF + P+SY TF QRY+IN KYWGGA + API  Y+G E  I+      
Sbjct  50   FKTFYFNQTLDHFNYRPESYTTFPQRYIINFKYWGGANSSAPILAYLGPEAPIDSAMNVI  109

Query  362  GSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALADYATLIIDL  541
            G + + A  FN L+V+IEHR+YGKS+PFG  KEA  ++ TLGY +S QALADYA ++I +
Sbjct  110  GFMTDNAVKFNALLVYIEHRYYGKSIPFGSRKEALRNASTLGYFNSAQALADYAAILIHV  169



>ref|XP_011017985.1| PREDICTED: lysosomal Pro-X carboxypeptidase isoform X1 [Populus 
euphratica]
Length=500

 Score =   136 bits (343),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 70/132 (53%), Positives = 88/132 (67%), Gaps = 5/132 (4%)
 Frame = +2

Query  146  AASTKTTYNNQVYDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMG  325
            A   K +     Y T YF Q+LDHFTF P+S + F Q+YL+N  YW      APIFVY G
Sbjct  38   AKQPKASKPKIPYKTHYFPQVLDHFTFQPKSSKIFYQKYLVNSHYW---HRGAPIFVYTG  94

Query  326  GEDDIEPFARETGSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQ  505
             E DIE FA  TG +++ AP F  L+VFIEHRFYG+S+PFG   ++  S++TLGYL+S Q
Sbjct  95   NEGDIEWFAANTGFLLDIAPKFRALLVFIEHRFYGESMPFGN--KSYKSAETLGYLNSQQ  152

Query  506  ALADYATLIIDL  541
            ALAD+A LI  L
Sbjct  153  ALADFALLIRSL  164



>ref|XP_008458662.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Cucumis melo]
Length=495

 Score =   136 bits (343),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 63/120 (53%), Positives = 83/120 (69%), Gaps = 0/120 (0%)
 Frame = +2

Query  182  YDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFARET  361
            + T YF Q LDHF + P+SY TF QRY+IN KYWGGA + API  Y+G E  I+      
Sbjct  54   FKTFYFNQTLDHFNYRPESYTTFPQRYIINFKYWGGANSSAPILAYLGPEAPIDSAMNAI  113

Query  362  GSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALADYATLIIDL  541
            G + + A  FN L+V+IEHR+YGKS+PFG  KEA  ++ TLGY +S QA+ADYA ++I +
Sbjct  114  GFMTDNAVKFNALLVYIEHRYYGKSIPFGSRKEALRNASTLGYFNSAQAIADYAAILIHV  173



>ref|XP_006404933.1| hypothetical protein EUTSA_v10000143mg [Eutrema salsugineum]
 dbj|BAJ33970.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ46386.1| hypothetical protein EUTSA_v10000143mg [Eutrema salsugineum]
Length=494

 Score =   136 bits (343),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 67/120 (56%), Positives = 86/120 (72%), Gaps = 5/120 (4%)
 Frame = +2

Query  182  YDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFARET  361
            ++T YF Q LDHF+F P+SY+ F Q+YLIN ++W   +   PIFVY G E DI+ FA  T
Sbjct  46   FETLYFPQNLDHFSFRPESYKVFHQKYLINSRFW---RKGGPIFVYTGNEGDIDWFASNT  102

Query  362  GSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALADYATLIIDL  541
            G + + AP F  L+VFIEHRFYG+S PFG  K++  S++TLGYL+S QALADYA LI  L
Sbjct  103  GFMSDIAPKFGALLVFIEHRFYGESTPFG--KKSHKSAETLGYLNSQQALADYAILIRSL  160



>ref|XP_002324555.2| serine carboxypeptidase S28 family protein [Populus trichocarpa]
 gb|ABK95724.1| unknown [Populus trichocarpa]
 gb|EEF03120.2| serine carboxypeptidase S28 family protein [Populus trichocarpa]
Length=500

 Score =   136 bits (343),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 70/132 (53%), Positives = 88/132 (67%), Gaps = 5/132 (4%)
 Frame = +2

Query  146  AASTKTTYNNQVYDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMG  325
            A   K +     Y T YF Q+LDHFTF P+S + F Q+YL+N  YW      APIFVY G
Sbjct  38   AKQPKASKPKIPYKTHYFPQVLDHFTFQPKSSKIFYQKYLVNSHYW---HRGAPIFVYTG  94

Query  326  GEDDIEPFARETGSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQ  505
             E DIE FA  TG +++ AP F  L+VFIEHRFYG+S+PFG   ++  S++TLGYL+S Q
Sbjct  95   NEGDIEWFAANTGFLLDIAPKFRALLVFIEHRFYGESMPFGN--KSYKSAETLGYLNSQQ  152

Query  506  ALADYATLIIDL  541
            ALAD+A LI  L
Sbjct  153  ALADFALLIRSL  164



>gb|KJB54925.1| hypothetical protein B456_009G054400 [Gossypium raimondii]
Length=501

 Score =   136 bits (343),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 69/128 (54%), Positives = 89/128 (70%), Gaps = 5/128 (4%)
 Frame = +2

Query  158  KTTYNNQVYDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDD  337
            KT      + T+YF Q LDHF+F P+S + F Q+YLIN +YW      APIFVY G E D
Sbjct  46   KTPKPKLPFKTRYFPQTLDHFSFHPKSSKIFYQKYLINTQYWHKG---APIFVYTGNEGD  102

Query  338  IEPFARETGSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALAD  517
            IE FA  TG +++ AP F  L++FIEHRFYG+S+PFG  K++  S+KT+GYL+S QALAD
Sbjct  103  IEWFAANTGFMLDIAPKFRALLLFIEHRFYGESMPFG--KDSYQSAKTMGYLNSQQALAD  160

Query  518  YATLIIDL  541
            +A LI  L
Sbjct  161  FAVLIRSL  168



>ref|XP_010472431.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Camelina sativa]
Length=495

 Score =   136 bits (342),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 66/120 (55%), Positives = 87/120 (73%), Gaps = 5/120 (4%)
 Frame = +2

Query  182  YDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFARET  361
            ++T+YF Q LDHF+FTP+SY+ F Q+YLIN++ W   +   PIFVY G E DI+ FA  T
Sbjct  47   FETRYFPQNLDHFSFTPESYKVFHQKYLINNRSW---RKGGPIFVYTGNEGDIDWFASNT  103

Query  362  GSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALADYATLIIDL  541
            G + + AP F  L+VFIEHRFYG+S P G  K++  S++TLGYL+S QALAD+A LI  L
Sbjct  104  GFMSDIAPKFRALLVFIEHRFYGESTPIG--KKSHKSAETLGYLNSQQALADFAILIRSL  161



>gb|EYU25337.1| hypothetical protein MIMGU_mgv1a004964mg [Erythranthe guttata]
Length=502

 Score =   136 bits (342),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 68/120 (57%), Positives = 86/120 (72%), Gaps = 5/120 (4%)
 Frame = +2

Query  182  YDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFARET  361
            Y+T YF Q LDHFTF PQSY+ F Q+YLIN  +W   +  APIFVY G E DI+ FA  T
Sbjct  54   YETHYFPQNLDHFTFLPQSYRIFNQKYLINRDFW---QKGAPIFVYTGNEGDIDWFAANT  110

Query  362  GSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALADYATLIIDL  541
            G +++ AP F  L+VFIEHR+YG+S PFG  K++  S+K LGYL+S QA+AD+A LI  L
Sbjct  111  GFLLDVAPRFRALLVFIEHRYYGESKPFG--KDSYKSAKKLGYLNSQQAMADFALLIRSL  168



>ref|XP_006424403.1| hypothetical protein CICLE_v10028401mg [Citrus clementina]
 gb|ESR37643.1| hypothetical protein CICLE_v10028401mg [Citrus clementina]
Length=458

 Score =   135 bits (341),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 62/124 (50%), Positives = 88/124 (71%), Gaps = 0/124 (0%)
 Frame = +2

Query  170  NNQVYDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPF  349
             +Q + T ++TQ LDHF + P SY TFQQRY+IN K+WGG+ + APIFVY+G E  ++  
Sbjct  6    QSQDFKTFFYTQTLDHFNYRPDSYATFQQRYVINFKHWGGSNSSAPIFVYLGAEGSLDED  65

Query  350  ARETGSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALADYATL  529
                G + + AP F  L+V+IEHR+YGKSVPFG  +EA  ++ TLGY +S QA+ADYA +
Sbjct  66   LDVAGFLPDNAPRFKALLVYIEHRYYGKSVPFGSREEAMKNASTLGYFNSAQAIADYAGV  125

Query  530  IIDL  541
            ++ +
Sbjct  126  LLHI  129



>ref|XP_006484933.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Citrus sinensis]
Length=502

 Score =   135 bits (341),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 67/141 (48%), Positives = 93/141 (66%), Gaps = 9/141 (6%)
 Frame = +2

Query  125  NEPDGFSAASTKTTYNNQVYDTK--YFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKN  298
            NEP   S +       +Q  D K  ++TQ LDHF + P SY TFQQRY+IN K+WGG+ +
Sbjct  40   NEPKAMSPS-------DQFKDFKTFFYTQTLDHFNYRPDSYATFQQRYVINFKHWGGSNS  92

Query  299  MAPIFVYMGGEDDIEPFARETGSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSK  478
             APIFVY+G E  ++      G + + AP F  L+V+IEHR+YGKSVPFG  +EA  ++ 
Sbjct  93   SAPIFVYLGAEGSLDEDLDVAGFLPDNAPRFKALLVYIEHRYYGKSVPFGSREEAMKNAS  152

Query  479  TLGYLSSTQALADYATLIIDL  541
            TLGY +S QA+ADYA +++ +
Sbjct  153  TLGYFNSAQAIADYADVLLHI  173



>ref|XP_001776094.1| predicted protein [Physcomitrella patens]
 gb|EDQ59139.1| predicted protein [Physcomitrella patens]
Length=505

 Score =   135 bits (341),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 63/137 (46%), Positives = 90/137 (66%), Gaps = 2/137 (1%)
 Frame = +2

Query  131  PDGFSAASTKTTYNNQVYDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPI  310
            P G          ++  Y   YFTQ++DHF+F  ++  +FQQRYLI  +YW GA +  PI
Sbjct  22   PIGLLGGRKNVGQSSVTYAVDYFTQVIDHFSFRREA--SFQQRYLIEKRYWKGAADRGPI  79

Query  311  FVYMGGEDDIEPFARETGSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGY  490
            F+Y G E D+E FA+ TG + E AP F  L++F EHR+YGKS+P+G ++ +   + +L  
Sbjct  80   FMYCGNEGDVEWFAKNTGFLWEIAPSFGALILFPEHRYYGKSMPYGTMEASYKDADSLST  139

Query  491  LSSTQALADYATLIIDL  541
            L+S QALAD+ATL+IDL
Sbjct  140  LTSEQALADFATLVIDL  156



>gb|KJB35194.1| hypothetical protein B456_006G103600 [Gossypium raimondii]
Length=502

 Score =   135 bits (341),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 67/141 (48%), Positives = 91/141 (65%), Gaps = 6/141 (4%)
 Frame = +2

Query  119  IINEPDGFSAASTKTTYNNQVYDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKN  298
            II  PD  S+A+           T Y+ Q LDHF + PQSY TFQQRY++N KYWGGAK 
Sbjct  43   IIEHPDFLSSATVSDL------RTFYYPQTLDHFNYQPQSYATFQQRYVMNFKYWGGAKK  96

Query  299  MAPIFVYMGGEDDIEPFARETGSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSK  478
             AP+  Y+G E  ++      G + + A  FN L+V+IEHR+YGKS+PFG  +EA  ++ 
Sbjct  97   SAPVLAYLGAEGPLDGDLTVIGFLNDNAVRFNALLVYIEHRYYGKSIPFGSREEAFKNAS  156

Query  479  TLGYLSSTQALADYATLIIDL  541
            TLGY +S QA+ADYA +I+ +
Sbjct  157  TLGYFNSAQAIADYAEIIMHI  177



>ref|XP_009773191.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Nicotiana sylvestris]
Length=511

 Score =   135 bits (341),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 64/120 (53%), Positives = 84/120 (70%), Gaps = 2/120 (2%)
 Frame = +2

Query  182  YDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFARET  361
            Y+TKYF Q LDHF+F      +FQQRYLIN ++W G   + PIF+Y G E DIE FA  T
Sbjct  59   YETKYFQQKLDHFSFA--DLPSFQQRYLINTQHWVGPSRLGPIFLYCGNEGDIEWFAANT  116

Query  362  GSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALADYATLIIDL  541
            G + E AP F  LV+F EHR+YG+S+P+G  +EA  ++ TL YL++ QALAD+A LI +L
Sbjct  117  GFVWEIAPRFGALVIFPEHRYYGESMPYGSKEEAYKNATTLSYLTAEQALADFAVLITEL  176



>gb|ABR16397.1| unknown [Picea sitchensis]
Length=508

 Score =   135 bits (341),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 64/120 (53%), Positives = 82/120 (68%), Gaps = 0/120 (0%)
 Frame = +2

Query  182  YDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFARET  361
            Y T  + Q LDHFTF P  Y+TF QRYL+N  YWGG +N +PIFV +G E+DI       
Sbjct  78   YTTNQYMQTLDHFTFRPDGYRTFPQRYLVNKTYWGGPQNNSPIFVCLGNEEDIITQLPYF  137

Query  362  GSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALADYATLIIDL  541
            G + E A  F  L+VFIEHR+YG S+PFG   E+ +++ TLGY S++QALADYA +I DL
Sbjct  138  GIMTEHAADFRALIVFIEHRYYGTSMPFGSQDESYANASTLGYYSASQALADYAIVITDL  197



>ref|XP_010454563.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Camelina sativa]
Length=502

 Score =   135 bits (339),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 59/116 (51%), Positives = 82/116 (71%), Gaps = 0/116 (0%)
 Frame = +2

Query  194  YFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFARETGSII  373
            YF Q LDHFTFTP+SY TFQQRY I+  +WGGAK  API  ++G E  ++      G + 
Sbjct  58   YFNQTLDHFTFTPKSYMTFQQRYAIDSTHWGGAKANAPILAFLGEESSLDSDLSAVGFLR  117

Query  374  EFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALADYATLIIDL  541
            +  P F  L+V+IEHR+YGK++PFG  +EA  ++ TLGYL++ QALADYA +++ +
Sbjct  118  DNGPRFKALLVYIEHRYYGKTMPFGSAEEALKNASTLGYLNAAQALADYAKILLHV  173



>ref|XP_010419297.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Camelina sativa]
Length=810

 Score =   137 bits (345),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 66/120 (55%), Positives = 87/120 (73%), Gaps = 5/120 (4%)
 Frame = +2

Query  182  YDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFARET  361
            ++T+YF Q LDHF+FTP+SY+ F Q+YLIN ++W   +   PIFVY G E DI+ FA  T
Sbjct  47   FETRYFPQNLDHFSFTPESYKVFHQKYLINSRFW---RKGGPIFVYTGNEGDIDWFASNT  103

Query  362  GSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALADYATLIIDL  541
            G + + AP F  L+VFIEHRFYG+S P G  K++  S++TLGYL+S QALAD+A LI  L
Sbjct  104  GFMSDIAPKFRALLVFIEHRFYGESTPIG--KKSHKSAETLGYLNSQQALADFAILIRSL  161



>gb|KHG27095.1| Lysosomal Pro-X carboxypeptidase [Gossypium arboreum]
Length=537

 Score =   135 bits (339),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 66/141 (47%), Positives = 91/141 (65%), Gaps = 5/141 (4%)
 Frame = +2

Query  119  IINEPDGFSAASTKTTYNNQVYDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKN  298
            I+ +PD  S+A+           T Y+ Q LDHF + PQSY TFQQRY++N KYWGGA N
Sbjct  77   IMEDPDLLSSAAVSDDLQ-----TFYYPQTLDHFNYQPQSYATFQQRYVMNFKYWGGANN  131

Query  299  MAPIFVYMGGEDDIEPFARETGSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSK  478
             API  Y+G E  ++      G + + A  F  L+V+IEHR+YGKS+PFG  +EA  ++ 
Sbjct  132  NAPILAYLGAEAPLDGSPTAIGFLNDNAVSFTALLVYIEHRYYGKSIPFGSREEAFKNAS  191

Query  479  TLGYLSSTQALADYATLIIDL  541
            TLGY +S QA+ADYA +I+ +
Sbjct  192  TLGYFNSAQAIADYAEIIMHI  212



>ref|XP_010267351.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Nelumbo nucifera]
Length=468

 Score =   134 bits (338),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 66/132 (50%), Positives = 90/132 (68%), Gaps = 3/132 (2%)
 Frame = +2

Query  146  AASTKTTYNNQVYDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMG  325
            A ST    + +VY   Y  Q LDHF + P+SY TF+QRY++N KYWGGA   APIFVY+G
Sbjct  18   AESTSQWADYKVY---YHNQTLDHFNYRPESYTTFRQRYVMNAKYWGGANTSAPIFVYLG  74

Query  326  GEDDIEPFARETGSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQ  505
             E  ++      G + + AP F  L+V+IEHR+YGKS+PF   +EA S++ TLGY SS+Q
Sbjct  75   DEAALDFQIGSAGFLSDNAPKFKALLVYIEHRYYGKSIPFSSREEAFSNASTLGYFSSSQ  134

Query  506  ALADYATLIIDL  541
            A+ADYA +I+ +
Sbjct  135  AIADYAEIILHI  146



>ref|XP_010047139.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Eucalyptus grandis]
 gb|KCW78947.1| hypothetical protein EUGRSUZ_C00378 [Eucalyptus grandis]
Length=502

 Score =   135 bits (339),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 66/120 (55%), Positives = 90/120 (75%), Gaps = 5/120 (4%)
 Frame = +2

Query  182  YDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFARET  361
            + T++F QILDHFT+ P+SY  F Q+YLIN ++W    + APIFVY G E +IE FA  T
Sbjct  56   FKTQFFPQILDHFTYNPKSYIIFYQKYLINSQFW---HHGAPIFVYTGNEGNIEWFAANT  112

Query  362  GSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALADYATLIIDL  541
            G +++ AP F  L+VFIEHR+YG+S+PFG  K++ +S++T+GYL+S QALADYA LI  L
Sbjct  113  GFLLDIAPKFRALLVFIEHRYYGESLPFG--KDSYNSAETVGYLNSQQALADYAVLIRSL  170



>ref|XP_007150128.1| hypothetical protein PHAVU_005G129100g [Phaseolus vulgaris]
 gb|ESW22122.1| hypothetical protein PHAVU_005G129100g [Phaseolus vulgaris]
Length=511

 Score =   135 bits (339),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 62/134 (46%), Positives = 90/134 (67%), Gaps = 0/134 (0%)
 Frame = +2

Query  140  FSAASTKTTYNNQVYDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVY  319
             S++S+    N+    T Y+TQ LDHF + P SY TFQQRY+I+ KYWGG K+ APIF +
Sbjct  43   MSSSSSDLGDNHDHLKTFYYTQRLDHFNYRPDSYHTFQQRYIIDFKYWGGPKSSAPIFAF  102

Query  320  MGGEDDIEPFARETGSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSS  499
             G E  ++      G + + AP F+ L+V+IEHR+YGKS+PFG  +EA  ++ T GY +S
Sbjct  103  FGAEGPVDDDIHYVGFLRDNAPQFSALIVYIEHRYYGKSIPFGSREEAMRNASTRGYFNS  162

Query  500  TQALADYATLIIDL  541
             QA+ADYA +++ +
Sbjct  163  AQAIADYAAVLLHI  176



>ref|XP_004160099.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Cucumis sativus]
Length=491

 Score =   134 bits (338),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/120 (53%), Positives = 83/120 (69%), Gaps = 0/120 (0%)
 Frame = +2

Query  182  YDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFARET  361
            + T YF Q LDHF + P+SY TF QRY+IN KYWGGA + API  Y+G E  I+      
Sbjct  50   FKTFYFNQTLDHFNYRPESYTTFPQRYIINFKYWGGAYSSAPILAYLGPEAPIDSAMNVI  109

Query  362  GSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALADYATLIIDL  541
            G + + A  FN L+V+IEHR+YGKS+PFG  KEA  ++ TLGY +S QA+ADYA ++I +
Sbjct  110  GFMTDNAVKFNALLVYIEHRYYGKSIPFGSRKEALRNASTLGYFNSAQAIADYAAILIHV  169



>emb|CDY28234.1| BnaA01g06150D [Brassica napus]
Length=285

 Score =   131 bits (330),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 65/120 (54%), Positives = 81/120 (68%), Gaps = 10/120 (8%)
 Frame = +2

Query  182  YDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFARET  361
            ++T+YF Q LDHF+F P+SYQ F Q+YLIN +YW   +   PIFVY G E DIE FA  T
Sbjct  48   FETRYFPQNLDHFSFQPESYQVFHQKYLINSRYW---RKGGPIFVYTGNEGDIEWFASNT  104

Query  362  GSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALADYATLIIDL  541
            G +++ AP F  L+VFIEHRFYG+S P          + TLG+L+S QALADYA LI  L
Sbjct  105  GFMLDIAPKFQALLVFIEHRFYGESKPH-------KLANTLGFLNSQQALADYAILIRSL  157



>gb|KHG26338.1| Lysosomal Pro-X carboxypeptidase [Gossypium arboreum]
Length=501

 Score =   134 bits (338),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 69/128 (54%), Positives = 88/128 (69%), Gaps = 5/128 (4%)
 Frame = +2

Query  158  KTTYNNQVYDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDD  337
            KT      + T+YF Q LDHF+F P+S + F Q+YLIN +YW      +PIFVY G E D
Sbjct  46   KTPKPKLPFKTRYFPQTLDHFSFHPKSSKIFYQKYLINTQYWHKG---SPIFVYTGNEGD  102

Query  338  IEPFARETGSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALAD  517
            IE FA  TG +++ AP F  L++FIEHRFYG+S+PFG  K++  S+KTLGYL+S QALAD
Sbjct  103  IEWFAANTGFMLDIAPKFRALLLFIEHRFYGESMPFG--KDSYQSAKTLGYLNSQQALAD  160

Query  518  YATLIIDL  541
             A LI  L
Sbjct  161  LAVLIRSL  168



>ref|XP_006363792.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Solanum tuberosum]
Length=521

 Score =   134 bits (338),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/120 (53%), Positives = 84/120 (70%), Gaps = 2/120 (2%)
 Frame = +2

Query  182  YDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFARET  361
            Y+TKYF Q LDHF+F      +F QRYLIN ++W G  + APIF+Y G E DIE FA  T
Sbjct  68   YETKYFQQKLDHFSFA--DLPSFSQRYLINTQHWEGPSHSAPIFLYCGNEGDIEWFAANT  125

Query  362  GSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALADYATLIIDL  541
            G + E AP F  +V+F EHR+YG+S+P+G  +EA  ++ TL YL++ QALADYA LI ++
Sbjct  126  GFVWEIAPRFGAMVIFPEHRYYGESMPYGSKEEAYKNATTLSYLTAEQALADYAVLITEI  185



>ref|XP_011005419.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Populus euphratica]
Length=500

 Score =   134 bits (338),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 68/138 (49%), Positives = 96/138 (70%), Gaps = 6/138 (4%)
 Frame = +2

Query  128  EPDGFSAASTKTTYNNQVYDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAP  307
            EP   S +S+K         T Y+TQ LDHF++ P+SY TF+QRY+I+ +YWGGA   AP
Sbjct  41   EPQTSSKSSSKDLV------TFYYTQTLDHFSYKPESYTTFRQRYVIDFRYWGGANTSAP  94

Query  308  IFVYMGGEDDIEPFARETGSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLG  487
            IFV+ G E+D++      G + + APHF  L+++IEHR+YGKS+PFG  KEA  +++TLG
Sbjct  95   IFVFFGAEEDLDDDLDAIGFLSDNAPHFKALLIYIEHRYYGKSIPFGSRKEALKNAETLG  154

Query  488  YLSSTQALADYATLIIDL  541
            YL+S QA+AD A +I+ L
Sbjct  155  YLNSAQAIADCAAVIMHL  172



>ref|XP_006494707.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Citrus sinensis]
Length=362

 Score =   133 bits (334),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 60/120 (50%), Positives = 83/120 (69%), Gaps = 2/120 (2%)
 Frame = +2

Query  182  YDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNM--APIFVYMGGEDDIEPFAR  355
            + T Y+ Q LDHF + P+SY TFQQRY+IN KYWGG  +   APIF Y+G E  ++    
Sbjct  57   FQTFYYNQTLDHFNYRPESYSTFQQRYIINFKYWGGGADQSNAPIFAYLGAESPLDNAPS  116

Query  356  ETGSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALADYATLII  535
              G + + AP F  L+V+IEHR+YGKS+PFG  +EA  ++ TLGY +S QA+ADYA +++
Sbjct  117  VIGFLTDNAPQFKALLVYIEHRYYGKSIPFGSREEALKNASTLGYFNSAQAIADYAEILL  176



>ref|XP_010026544.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Eucalyptus 
grandis]
Length=515

 Score =   134 bits (338),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/120 (53%), Positives = 83/120 (69%), Gaps = 2/120 (2%)
 Frame = +2

Query  182  YDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFARET  361
            Y+T+YF Q LDHF+F+      F QRYLI+ ++W G K + PIFVY G E DIE FA  T
Sbjct  65   YETRYFEQRLDHFSFS--KLPKFSQRYLISSEHWSGPKRLGPIFVYCGNEGDIEWFAANT  122

Query  362  GSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALADYATLIIDL  541
            G + E AP F  +VVF EHR+YGKS+PFG  ++A  ++ TL YL++ QALAD+  LI+ L
Sbjct  123  GFVWEIAPSFGAMVVFPEHRYYGKSMPFGSTEKAYKNAATLSYLTTEQALADFTELIMSL  182



>ref|XP_011089978.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Sesamum indicum]
Length=501

 Score =   134 bits (337),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 62/141 (44%), Positives = 92/141 (65%), Gaps = 4/141 (3%)
 Frame = +2

Query  119  IINEPDGFSAASTKTTYNNQVYDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKN  298
            I+  PD   + S  +    + + T +++Q LDHF + PQSY TF+QRY++N KYWGG  +
Sbjct  40   ILRNPDDVISTSAIS----KDFKTHFYSQTLDHFNYAPQSYATFRQRYVVNSKYWGGPTS  95

Query  299  MAPIFVYMGGEDDIEPFARETGSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSK  478
             +PIF Y+G E  ++      G + + APHF  L V+IEHRFYGKSVPFG +++A  ++ 
Sbjct  96   NSPIFAYLGAEAPLDEDQEVIGFLNDNAPHFKSLSVYIEHRFYGKSVPFGKMEDAMKNAT  155

Query  479  TLGYLSSTQALADYATLIIDL  541
              GY SS QA+ADYA +++ +
Sbjct  156  LRGYFSSAQAIADYAEILLHV  176



>gb|KCW59597.1| hypothetical protein EUGRSUZ_H02342 [Eucalyptus grandis]
Length=550

 Score =   134 bits (338),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/120 (53%), Positives = 83/120 (69%), Gaps = 2/120 (2%)
 Frame = +2

Query  182  YDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFARET  361
            Y+T+YF Q LDHF+F+      F QRYLI+ ++W G K + PIFVY G E DIE FA  T
Sbjct  100  YETRYFEQRLDHFSFS--KLPKFSQRYLISSEHWSGPKRLGPIFVYCGNEGDIEWFAANT  157

Query  362  GSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALADYATLIIDL  541
            G + E AP F  +VVF EHR+YGKS+PFG  ++A  ++ TL YL++ QALAD+  LI+ L
Sbjct  158  GFVWEIAPSFGAMVVFPEHRYYGKSMPFGSTEKAYKNAATLSYLTTEQALADFTELIMSL  217



>ref|XP_009592890.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Nicotiana tomentosiformis]
Length=511

 Score =   134 bits (337),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 64/120 (53%), Positives = 83/120 (69%), Gaps = 2/120 (2%)
 Frame = +2

Query  182  YDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFARET  361
            Y+TKYF Q LDHF+F      +F QRYLIN ++W G   +APIF+Y G E  IE FA  T
Sbjct  59   YETKYFQQKLDHFSFA--DLPSFPQRYLINTQHWMGPSRLAPIFLYCGNEGGIEWFAANT  116

Query  362  GSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALADYATLIIDL  541
            G + E AP F  +V+F EHR+YG+S+PFG  +EA  ++ TL YL++ QALADYA LI +L
Sbjct  117  GFVWEIAPRFGAMVIFPEHRYYGESMPFGSKEEAYKNATTLSYLTAEQALADYAVLITEL  176



>ref|XP_003576298.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Brachypodium 
distachyon]
Length=517

 Score =   134 bits (337),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 62/120 (52%), Positives = 84/120 (70%), Gaps = 2/120 (2%)
 Frame = +2

Query  182  YDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFARET  361
            Y+TKY+ Q LDHF   P SY+TF QRYL+N  YWGG    +P+F+Y G E ++E F   T
Sbjct  64   YETKYYEQRLDHFDALPASYRTFPQRYLVNGTYWGG--KTSPVFLYAGNEGNVELFTNNT  121

Query  362  GSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALADYATLIIDL  541
            G + E AP F  L++F+EHR+YGKS PFG  + A  ++ T+GYL++TQA+AD ATL+  L
Sbjct  122  GFMWELAPRFRALLLFVEHRYYGKSFPFGSEEAAFRNTSTVGYLTTTQAVADLATLVQSL  181



>ref|XP_010429398.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Camelina sativa]
Length=495

 Score =   134 bits (337),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 65/120 (54%), Positives = 86/120 (72%), Gaps = 5/120 (4%)
 Frame = +2

Query  182  YDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFARET  361
            ++T+YF Q LDHF+FTP+SY+ F Q+YLIN ++W   +   PIFVY G E DI+ FA  T
Sbjct  47   FETRYFPQNLDHFSFTPESYKVFHQKYLINSRFW---RKGGPIFVYTGNEGDIDWFASNT  103

Query  362  GSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALADYATLIIDL  541
            G + + AP F  L+VFIEHRFYG+S P    K++  S++TLGYL+S QALAD+A LI  L
Sbjct  104  GFMSDIAPKFRALLVFIEHRFYGESTPI--RKKSHKSAETLGYLNSQQALADFAILIRSL  161



>ref|XP_006494702.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Citrus sinensis]
Length=364

 Score =   132 bits (333),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 60/120 (50%), Positives = 83/120 (69%), Gaps = 2/120 (2%)
 Frame = +2

Query  182  YDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNM--APIFVYMGGEDDIEPFAR  355
            + T Y+ Q LDHF + P+SY TFQQRY+IN KYWGG  +   APIF Y+G E  ++    
Sbjct  57   FQTFYYNQTLDHFNYRPESYSTFQQRYIINFKYWGGGADQSNAPIFAYLGAESPLDNAPS  116

Query  356  ETGSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALADYATLII  535
              G + + AP F  L+V+IEHR+YGKS+PFG  +EA  ++ TLGY +S QA+ADYA +++
Sbjct  117  VIGFLTDNAPQFKALLVYIEHRYYGKSIPFGSREEALKNASTLGYFNSAQAIADYAEILL  176



>gb|KFK32665.1| serine carboxypeptidase s28 family protein [Arabis alpina]
Length=496

 Score =   134 bits (337),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 65/120 (54%), Positives = 85/120 (71%), Gaps = 5/120 (4%)
 Frame = +2

Query  182  YDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFARET  361
            ++T+YF Q LDHF+F P+SY+ F Q+YLIN  +W   +   PIFVY G E DI+ FA  T
Sbjct  48   FETRYFPQNLDHFSFKPESYKVFHQKYLINGSFW---RKGGPIFVYTGNEGDIDWFASNT  104

Query  362  GSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALADYATLIIDL  541
            G + + AP F  L+VFIEHRFYG+S P G  K++  +++TLGYL+S QALADYA LI  L
Sbjct  105  GFMSDIAPKFKALLVFIEHRFYGESTPLG--KKSPKTAETLGYLNSQQALADYAILIRSL  162



>ref|XP_009150668.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Brassica rapa]
Length=506

 Score =   134 bits (337),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 64/124 (52%), Positives = 84/124 (68%), Gaps = 2/124 (2%)
 Frame = +2

Query  170  NNQVYDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPF  349
            N+  Y+TKYF+Q LDHF+F       F QRYLIN  +W GA  + PIF+Y G E DIE F
Sbjct  45   NDYQYETKYFSQQLDHFSFA--DLPKFSQRYLINSAHWTGASELGPIFLYCGNEGDIEWF  102

Query  350  ARETGSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALADYATL  529
            A  +G I E AP F  L+VF EHR+YG+S+P+G  +EA  ++ TL YL++ QALAD+A  
Sbjct  103  ATNSGFIWEIAPKFGALLVFPEHRYYGESMPYGSREEAYKNATTLSYLTTEQALADFAVF  162

Query  530  IIDL  541
            + DL
Sbjct  163  VTDL  166



>ref|XP_006494706.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Citrus sinensis]
Length=364

 Score =   132 bits (333),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 60/120 (50%), Positives = 83/120 (69%), Gaps = 2/120 (2%)
 Frame = +2

Query  182  YDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNM--APIFVYMGGEDDIEPFAR  355
            + T Y+ Q LDHF + P+SY TFQQRY+IN KYWGG  +   APIF Y+G E  ++    
Sbjct  57   FQTFYYNQTLDHFNYRPESYSTFQQRYIINFKYWGGGADQSNAPIFAYLGAESPLDNAPS  116

Query  356  ETGSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALADYATLII  535
              G + + AP F  L+V+IEHR+YGKS+PFG  +EA  ++ TLGY +S QA+ADYA +++
Sbjct  117  VIGFLTDNAPQFKALLVYIEHRYYGKSIPFGSREEALKNASTLGYFNSAQAIADYAEILL  176



>emb|CDY08753.1| BnaA06g24710D [Brassica napus]
Length=506

 Score =   134 bits (336),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 64/124 (52%), Positives = 84/124 (68%), Gaps = 2/124 (2%)
 Frame = +2

Query  170  NNQVYDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPF  349
            N+  Y+TKYF+Q LDHF+F       F QRYLIN  +W GA  + PIF+Y G E DIE F
Sbjct  45   NDYQYETKYFSQQLDHFSFA--DLPKFSQRYLINSAHWTGASELGPIFLYCGNEGDIEWF  102

Query  350  ARETGSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALADYATL  529
            A  +G I E AP F  L+VF EHR+YG+S+P+G  +EA  ++ TL YL++ QALAD+A  
Sbjct  103  ATNSGFIWEIAPKFGALLVFPEHRYYGESMPYGSKEEAYKNATTLSYLTTEQALADFAVF  162

Query  530  IIDL  541
            + DL
Sbjct  163  VTDL  166



>gb|KFK28424.1| hypothetical protein AALP_AA8G512800 [Arabis alpina]
Length=513

 Score =   134 bits (336),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 64/124 (52%), Positives = 84/124 (68%), Gaps = 2/124 (2%)
 Frame = +2

Query  170  NNQVYDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPF  349
            N   Y+TKYFTQ LDHF+F       F QRYLIN  +W GA  + PIF+Y G E DI+ F
Sbjct  52   NEYRYETKYFTQQLDHFSFA--DLPKFSQRYLINSDHWLGASALGPIFLYCGNEGDIDWF  109

Query  350  ARETGSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALADYATL  529
            A  +G I + AP F  L+VF EHR+YG+S+P+G +KEA  ++ TL YL++ QALAD+A  
Sbjct  110  ATNSGFIWDIAPKFGALLVFPEHRYYGESMPYGSMKEAYKNATTLAYLTTEQALADFAVF  169

Query  530  IIDL  541
            + DL
Sbjct  170  VTDL  173



>ref|XP_006657192.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Oryza brachyantha]
Length=532

 Score =   134 bits (336),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 67/125 (54%), Positives = 83/125 (66%), Gaps = 7/125 (6%)
 Frame = +2

Query  182  YDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYW-----GGAKNMAPIFVYMGGEDDIEP  346
            +  +YF Q LDHFTFTP S   F Q+YL+ND +W      G     PIFVY G E DIE 
Sbjct  75   FTARYFPQELDHFTFTPNSSALFYQKYLVNDTFWRRSSGAGGDTAGPIFVYTGNEGDIEW  134

Query  347  FARETGSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALADYAT  526
            FA  TG + + AP F  ++VFIEHRFYG+S PFG   ++ SS++ LGYL+STQALAD+A 
Sbjct  135  FATNTGFMFDIAPRFGAMLVFIEHRFYGESKPFG--NDSNSSAEKLGYLTSTQALADFAV  192

Query  527  LIIDL  541
            LI  L
Sbjct  193  LITSL  197



>ref|XP_009591854.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like, partial [Nicotiana 
tomentosiformis]
Length=412

 Score =   133 bits (334),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 59/132 (45%), Positives = 89/132 (67%), Gaps = 0/132 (0%)
 Frame = +2

Query  140  FSAASTKTTYNNQVYDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVY  319
            F+  S  +T   + ++T ++TQ LDHF + P+SY TF+QRY+IN KYWGG+ + +PIF Y
Sbjct  46   FNTLSNSSTTLPKEFETYFYTQTLDHFNYGPKSYSTFKQRYIINSKYWGGSNSSSPIFAY  105

Query  320  MGGEDDIEPFARETGSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSS  499
            +G E  I+      G + +FAP F  L+V++EHR+YG+S+PF  ++EA       GY +S
Sbjct  106  LGAESYIDNDPLSIGFLTDFAPRFKALLVYLEHRYYGQSIPFEKIEEALKDEDRRGYFNS  165

Query  500  TQALADYATLII  535
             QA+ADYA L++
Sbjct  166  AQAIADYAELLL  177



>ref|XP_007016018.1| Serine carboxypeptidase S28 family protein [Theobroma cacao]
 gb|EOY33637.1| Serine carboxypeptidase S28 family protein [Theobroma cacao]
Length=500

 Score =   134 bits (336),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 64/141 (45%), Positives = 91/141 (65%), Gaps = 6/141 (4%)
 Frame = +2

Query  119  IINEPDGFSAASTKTTYNNQVYDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKN  298
            I+ +P+  SA  ++         T Y+TQ LDHF + P+SY TFQQRY++N KYWGGA  
Sbjct  39   ILEQPEILSAPVSEDL------RTFYYTQTLDHFNYNPESYTTFQQRYVMNSKYWGGANV  92

Query  299  MAPIFVYMGGEDDIEPFARETGSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSK  478
             API  Y+G E  ++      G + + A  F  L+V+IEHR+YGKS+PFG  +EA  ++ 
Sbjct  93   SAPILAYLGAESPLDGTPAAIGFLNDNAIRFKALIVYIEHRYYGKSIPFGSREEAFQNAS  152

Query  479  TLGYLSSTQALADYATLIIDL  541
            TLGY +S QA+ADYA +I+ +
Sbjct  153  TLGYFNSAQAIADYAAIIMHI  173



>ref|XP_009779688.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Nicotiana sylvestris]
Length=509

 Score =   134 bits (336),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 58/120 (48%), Positives = 84/120 (70%), Gaps = 0/120 (0%)
 Frame = +2

Query  182  YDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFARET  361
            ++T Y+TQ LDHF + P+SY TF+QRY+IN KYWGG+ + + IF Y+G E  I+      
Sbjct  61   FETYYYTQTLDHFNYGPKSYSTFKQRYIINSKYWGGSNSSSTIFAYLGAESSIDGDPLGI  120

Query  362  GSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALADYATLIIDL  541
            G + +FAP F  L+V++EHR+YGKS+PFG ++EA       GY +S QA+ADYA L++ +
Sbjct  121  GFLTDFAPRFKALLVYMEHRYYGKSIPFGTMEEALKDEDRRGYFNSAQAIADYAELLLHV  180



>ref|XP_006408695.1| hypothetical protein EUTSA_v10001967mg [Eutrema salsugineum]
 gb|ESQ50148.1| hypothetical protein EUTSA_v10001967mg [Eutrema salsugineum]
Length=502

 Score =   134 bits (336),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 65/142 (46%), Positives = 91/142 (64%), Gaps = 7/142 (5%)
 Frame = +2

Query  137  GFSAASTKTTYN--NQVYDTK-----YFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAK  295
            G S+   K T++   Q  D       YF Q LDHFTFTP+SY TFQQRY+I+ ++W GAK
Sbjct  32   GMSSTKLKNTHDALTQKVDKSDLEIFYFNQDLDHFTFTPKSYMTFQQRYVIDSQHWAGAK  91

Query  296  NMAPIFVYMGGEDDIEPFARETGSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSS  475
              API  ++G E  ++      G + +  P    L+V+IEHR+YGKS+PFG  +EA  ++
Sbjct  92   VNAPILAFLGEESSLDSDLSAIGFLRDNGPRLKALLVYIEHRYYGKSMPFGSAEEALKNA  151

Query  476  KTLGYLSSTQALADYATLIIDL  541
             TLGYL+S QALADYA +++ +
Sbjct  152  STLGYLNSAQALADYAAILLHI  173



>ref|XP_006349129.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Solanum tuberosum]
Length=453

 Score =   133 bits (335),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 57/120 (48%), Positives = 84/120 (70%), Gaps = 0/120 (0%)
 Frame = +2

Query  182  YDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFARET  361
            ++T Y+ Q LDHF + P+SY TF+QRY+IN KYWGG+ + +PIF Y+G E  I+      
Sbjct  7    FETYYYKQTLDHFNYGPKSYSTFKQRYIINSKYWGGSNSSSPIFAYLGAESSIDGDPLGV  66

Query  362  GSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALADYATLIIDL  541
            G + +FAP F  L+V++EHR+YG+S PF  ++EA +   T GY +S QA+ADYA L++ +
Sbjct  67   GFLTDFAPQFKALLVYMEHRYYGESTPFKTMEEAVNDEDTRGYFNSAQAIADYAELLLHI  126



>ref|XP_010254367.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like isoform X2 [Nelumbo 
nucifera]
Length=476

 Score =   133 bits (335),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 60/129 (47%), Positives = 90/129 (70%), Gaps = 0/129 (0%)
 Frame = +2

Query  155  TKTTYNNQVYDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGED  334
            T  ++ ++ ++T ++TQ LDHF +  +S  TFQQ+Y+IN K+WGGA + APIFVY+G   
Sbjct  18   TPFSFPSRDFNTYFYTQKLDHFNYRAESQATFQQKYVINSKFWGGANSSAPIFVYLGANA  77

Query  335  DIEPFARETGSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALA  514
             ++   R  G + + AP FN L+V+IEHRFYG+S PFG  +EA  + +TL YL+ +Q L 
Sbjct  78   PLDDQIRRIGFMTDNAPQFNALLVYIEHRFYGQSTPFGSSEEAYQNDRTLDYLNLSQTLE  137

Query  515  DYATLIIDL  541
            DYA +I+D+
Sbjct  138  DYAEVILDI  146



>ref|XP_010254366.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like isoform X1 [Nelumbo 
nucifera]
Length=478

 Score =   133 bits (335),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 60/129 (47%), Positives = 90/129 (70%), Gaps = 0/129 (0%)
 Frame = +2

Query  155  TKTTYNNQVYDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGED  334
            T  ++ ++ ++T ++TQ LDHF +  +S  TFQQ+Y+IN K+WGGA + APIFVY+G   
Sbjct  18   TPFSFPSRDFNTYFYTQKLDHFNYRAESQATFQQKYVINSKFWGGANSSAPIFVYLGANA  77

Query  335  DIEPFARETGSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALA  514
             ++   R  G + + AP FN L+V+IEHRFYG+S PFG  +EA  + +TL YL+ +Q L 
Sbjct  78   PLDDQIRRIGFMTDNAPQFNALLVYIEHRFYGQSTPFGSSEEAYQNDRTLDYLNLSQTLE  137

Query  515  DYATLIIDL  541
            DYA +I+D+
Sbjct  138  DYAEVILDI  146



>ref|XP_010023342.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Eucalyptus 
grandis]
 ref|XP_010023343.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Eucalyptus 
grandis]
 gb|KCW59598.1| hypothetical protein EUGRSUZ_H02343 [Eucalyptus grandis]
Length=532

 Score =   133 bits (335),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 63/120 (53%), Positives = 83/120 (69%), Gaps = 2/120 (2%)
 Frame = +2

Query  182  YDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFARET  361
            Y+T+YF Q LDHF+F      TF QRYLI+ ++W G   + PIFVY G E DIE FA  T
Sbjct  69   YETRYFEQRLDHFSFL--ELPTFNQRYLISSEHWSGPSQLGPIFVYCGNEGDIEWFAANT  126

Query  362  GSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALADYATLIIDL  541
            G + E AP F  +VVF EHR+YG+S+PFG  +EA  ++ TL YL++ QALAD++ LI +L
Sbjct  127  GFVWEMAPSFGAMVVFPEHRYYGESMPFGSQEEAYKNAATLSYLTADQALADFSVLITNL  186



>ref|XP_010444594.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Camelina sativa]
Length=509

 Score =   133 bits (335),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 64/124 (52%), Positives = 85/124 (69%), Gaps = 2/124 (2%)
 Frame = +2

Query  170  NNQVYDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPF  349
            N   Y+TK+F+Q LDHF+F       FQQRYLIN  +W GA ++APIF+Y G E DIE F
Sbjct  48   NEYRYETKFFSQQLDHFSFA--DLPKFQQRYLINSDHWLGASSLAPIFLYCGNEGDIEWF  105

Query  350  ARETGSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALADYATL  529
            A  +G I + AP F  L+VF EHR+YG+S+P+G   EA  ++ TL YL++ QALAD+A  
Sbjct  106  ATNSGFIWDIAPKFGALLVFPEHRYYGESMPYGSRDEAYKNATTLSYLTTEQALADFAVF  165

Query  530  IIDL  541
            + DL
Sbjct  166  VTDL  169



>ref|XP_007207893.1| hypothetical protein PRUPE_ppa021011mg [Prunus persica]
 gb|EMJ09092.1| hypothetical protein PRUPE_ppa021011mg [Prunus persica]
Length=503

 Score =   133 bits (335),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 82/118 (69%), Gaps = 0/118 (0%)
 Frame = +2

Query  182  YDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFARET  361
            ++T Y+ Q LDHF F P S+ TFQQRYLIN K+WGG+   APIF Y+G E+ I+      
Sbjct  59   FETFYYNQTLDHFNFRPDSFNTFQQRYLINFKHWGGSNVSAPIFAYLGEEEAIDVDLSIV  118

Query  362  GSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALADYATLII  535
            G + E A  F  L +FIEHR+YGKSVPFG  +EA  ++ TLGY +S QALADYA ++I
Sbjct  119  GFLSENAHQFQALQIFIEHRYYGKSVPFGSREEAFQNADTLGYFNSAQALADYAEVLI  176



>ref|XP_010463531.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Camelina sativa]
Length=505

 Score =   133 bits (334),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 64/124 (52%), Positives = 85/124 (69%), Gaps = 2/124 (2%)
 Frame = +2

Query  170  NNQVYDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPF  349
            N   Y+TK+F+Q LDHF+F       FQQRYLIN  +W GA ++APIF+Y G E DIE F
Sbjct  44   NEYRYETKFFSQQLDHFSFA--DLPKFQQRYLINSDHWLGASSLAPIFLYCGNEGDIEWF  101

Query  350  ARETGSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALADYATL  529
            A  +G I + AP F  L+VF EHR+YG+S+P+G   EA  ++ TL YL++ QALAD+A  
Sbjct  102  ATNSGFIWDIAPKFGALLVFPEHRYYGESMPYGSRDEAYKNATTLSYLTTEQALADFAVF  161

Query  530  IIDL  541
            + DL
Sbjct  162  VTDL  165



>ref|XP_006349128.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Solanum tuberosum]
Length=504

 Score =   133 bits (334),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 57/120 (48%), Positives = 83/120 (69%), Gaps = 0/120 (0%)
 Frame = +2

Query  182  YDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFARET  361
            ++T Y+ Q LDHF + P+SY TF+QRY+IN KYWGG+ + +PIF Y+G E  I+      
Sbjct  58   FETYYYKQTLDHFNYGPKSYSTFKQRYIINSKYWGGSNSSSPIFAYLGAESSIDGDPLGV  117

Query  362  GSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALADYATLIIDL  541
            G + +FAP F  L+V++EHR+YG+S PF  ++EA     T GY +S QA+ADYA L++ +
Sbjct  118  GFLTDFAPQFKALLVYMEHRYYGESTPFKTMEEAVKDEDTRGYFNSAQAIADYAELLLHI  177



>ref|XP_008228032.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Prunus mume]
Length=503

 Score =   133 bits (334),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 64/120 (53%), Positives = 83/120 (69%), Gaps = 0/120 (0%)
 Frame = +2

Query  182  YDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFARET  361
            ++T Y+ Q LDHF F P S+ TFQQRYLIN K+WGG+   APIF Y+G E+ I+      
Sbjct  59   FETFYYNQTLDHFNFRPDSFNTFQQRYLINFKHWGGSNVSAPIFAYLGEEEAIDDDLSII  118

Query  362  GSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALADYATLIIDL  541
            G + E A  F  L +FIEHR+YGKSVPFG  +EA  ++ TLGY +S QALADYA ++I +
Sbjct  119  GFLSENAHQFQALQIFIEHRYYGKSVPFGSREEAFQNADTLGYFNSAQALADYAEVLIHV  178



>ref|XP_002271961.1| PREDICTED: lysosomal Pro-X carboxypeptidase isoform X1 [Vitis 
vinifera]
Length=505

 Score =   133 bits (334),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 64/138 (46%), Positives = 91/138 (66%), Gaps = 6/138 (4%)
 Frame = +2

Query  122  INEPDGFSAASTKTTYNNQVYDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNM  301
            + EP  FS + ++       + T Y+ Q LDHF + P+SY TFQQRY++N KYWGGA   
Sbjct  46   LREPATFSESVSEE------FQTFYYNQTLDHFNYRPESYITFQQRYVVNFKYWGGANAS  99

Query  302  APIFVYMGGEDDIEPFARETGSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKT  481
            APIF Y+G E D++      G + + A  F  L+V+IEHR+YGKS+P+G  +EA  ++ T
Sbjct  100  APIFAYLGAEADLDYDLSGIGFLTDNAHQFKALLVYIEHRYYGKSIPYGSREEAFKNAST  159

Query  482  LGYLSSTQALADYATLII  535
            LGY +S QA+ADYA ++I
Sbjct  160  LGYFNSAQAIADYAEVLI  177



>gb|KJB09004.1| hypothetical protein B456_001G118300 [Gossypium raimondii]
Length=492

 Score =   133 bits (334),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 61/118 (52%), Positives = 84/118 (71%), Gaps = 0/118 (0%)
 Frame = +2

Query  188  TKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFARETGS  367
            T ++TQ LDHF + P+SY TFQQRY+IN KYWGG    APIFV +G E  +E   +  G 
Sbjct  53   TYFYTQTLDHFNYKPESYATFQQRYVINYKYWGGGAVTAPIFVCLGAEQALETDLQTIGF  112

Query  368  IIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALADYATLIIDL  541
            + + A  FN L+V+IEHR+YG+S+PFG  +EA  ++  +GYL+S QALADYA ++ D+
Sbjct  113  LDDNAARFNALIVYIEHRYYGESLPFGSREEAFRNAYRMGYLNSAQALADYAEIMADI  170



>ref|XP_010651746.1| PREDICTED: lysosomal Pro-X carboxypeptidase isoform X2 [Vitis 
vinifera]
Length=465

 Score =   132 bits (333),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 64/138 (46%), Positives = 91/138 (66%), Gaps = 6/138 (4%)
 Frame = +2

Query  122  INEPDGFSAASTKTTYNNQVYDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNM  301
            + EP  FS + ++       + T Y+ Q LDHF + P+SY TFQQRY++N KYWGGA   
Sbjct  46   LREPATFSESVSEE------FQTFYYNQTLDHFNYRPESYITFQQRYVVNFKYWGGANAS  99

Query  302  APIFVYMGGEDDIEPFARETGSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKT  481
            APIF Y+G E D++      G + + A  F  L+V+IEHR+YGKS+P+G  +EA  ++ T
Sbjct  100  APIFAYLGAEADLDYDLSGIGFLTDNAHQFKALLVYIEHRYYGKSIPYGSREEAFKNAST  159

Query  482  LGYLSSTQALADYATLII  535
            LGY +S QA+ADYA ++I
Sbjct  160  LGYFNSAQAIADYAEVLI  177



>ref|XP_007205160.1| hypothetical protein PRUPE_ppa005445mg [Prunus persica]
 gb|EMJ06359.1| hypothetical protein PRUPE_ppa005445mg [Prunus persica]
Length=351

 Score =   131 bits (330),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 60/120 (50%), Positives = 83/120 (69%), Gaps = 2/120 (2%)
 Frame = +2

Query  182  YDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFARET  361
            Y+T+YF Q LDHF+F+      FQQRYLIN ++W G + + PIF Y G E DIE FA  T
Sbjct  70   YETRYFAQRLDHFSFSDSP--RFQQRYLINTEHWVGPQRLGPIFFYCGNEGDIEWFAENT  127

Query  362  GSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALADYATLIIDL  541
            G + E AP F  +++F EHR+YG+S+P+G   EA  ++ TL +L++ QALAD+A LI +L
Sbjct  128  GFVWEVAPQFGAMILFPEHRYYGESMPYGSKDEAYKNASTLSFLTAEQALADFAVLIAEL  187



>emb|CDY45627.1| BnaCnng13350D [Brassica napus]
Length=506

 Score =   133 bits (334),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 64/124 (52%), Positives = 83/124 (67%), Gaps = 2/124 (2%)
 Frame = +2

Query  170  NNQVYDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPF  349
            N+  Y+TKYF+Q LDHF+F       F QRYLIN  +W GA  + PIF+Y G E DIE F
Sbjct  45   NSYQYETKYFSQQLDHFSFA--DLPKFSQRYLINSDHWTGASELGPIFLYCGNEGDIEWF  102

Query  350  ARETGSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALADYATL  529
            A  +G I E AP F  L+VF EHR+YG+S+P+G   EA  ++ TL YL++ QALAD+A  
Sbjct  103  ATNSGFIWEIAPKFGALLVFPEHRYYGESMPYGSRDEAYKNATTLSYLTTEQALADFAVF  162

Query  530  IIDL  541
            + DL
Sbjct  163  VTDL  166



>ref|XP_010680789.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010680790.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Beta vulgaris 
subsp. vulgaris]
Length=498

 Score =   132 bits (333),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 63/120 (53%), Positives = 83/120 (69%), Gaps = 2/120 (2%)
 Frame = +2

Query  182  YDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFARET  361
            Y+T+YFTQ LDHF+F    Y  F QRYLIN   W GA+   PIF+Y G E DIE FA  +
Sbjct  42   YETQYFTQKLDHFSF--HEYGNFSQRYLINTDDWVGAQRRGPIFMYCGNEGDIEWFASNS  99

Query  362  GSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALADYATLIIDL  541
            G + + APHF  L++F EHR+YG+S+P+G  +EA   S TL YL++ QA+ADYA L+ +L
Sbjct  100  GFLWDIAPHFGALLLFPEHRYYGESMPYGSKEEAYKDSTTLSYLTAEQAIADYAVLLREL  159



>ref|XP_002324914.2| hypothetical protein POPTR_0018s02600g [Populus trichocarpa]
 gb|EEF03479.2| hypothetical protein POPTR_0018s02600g [Populus trichocarpa]
Length=510

 Score =   132 bits (333),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 67/133 (50%), Positives = 87/133 (65%), Gaps = 3/133 (2%)
 Frame = +2

Query  143  SAASTKTTYNNQVYDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYM  322
            S A++   +N Q +   Y+ Q LDHF + P S+  FQQRY+IN KYWGGA + APIFVY 
Sbjct  54   SFAASSIYHNLQTF---YYNQTLDHFNYRPDSFDMFQQRYVINSKYWGGANSNAPIFVYF  110

Query  323  GGEDDIEPFARETGSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSST  502
            G E  +E    + G + E A  F  L V+IEHR+YGKS+PFG   EA  ++ TLGY +S 
Sbjct  111  GEEAPLENDFGDIGILAENAHRFKALQVYIEHRYYGKSIPFGSRNEAFKNASTLGYFNSA  170

Query  503  QALADYATLIIDL  541
            QALADYA +II +
Sbjct  171  QALADYAEIIIHV  183



>ref|XP_010518734.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Tarenaya hassleriana]
Length=515

 Score =   133 bits (334),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 64/120 (53%), Positives = 83/120 (69%), Gaps = 2/120 (2%)
 Frame = +2

Query  182  YDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFARET  361
            Y+T+YF+Q LDHF+F      TF QRYLIN  +W G   + PIF+Y G E DIE FA  +
Sbjct  63   YETRYFSQRLDHFSFA--DLPTFSQRYLINFDHWLGPARLGPIFLYCGNEGDIEWFATNS  120

Query  362  GSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALADYATLIIDL  541
            G + E AP F  L+VF EHR+YG+S+PFGG +EA  ++ TL YL++ QALAD+A  I DL
Sbjct  121  GFMWEIAPKFGALLVFPEHRYYGESMPFGGREEAYKNASTLSYLTTEQALADFAVFITDL  180



>ref|XP_003563318.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Brachypodium distachyon]
Length=536

 Score =   133 bits (334),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 70/143 (49%), Positives = 87/143 (61%), Gaps = 10/143 (7%)
 Frame = +2

Query  137  GFSAASTKTTYNNQVYDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYW--------GGA  292
            G  AA          +   YF Q LDHFTFTP + + F Q+YL+ND +W        G A
Sbjct  61   GGKAAPEPEKKTKNPFRAHYFPQELDHFTFTPNASRIFYQKYLVNDTFWRKPTGKGRGAA  120

Query  293  KNMAPIFVYMGGEDDIEPFARETGSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSS  472
                P+FVY G E DIE FA  +G + + AP F+ L+VFIEHRFYG+S PFG   E+  S
Sbjct  121  AAPGPVFVYTGNEGDIEWFATNSGFLFDIAPKFSALLVFIEHRFYGESKPFG--NESYGS  178

Query  473  SKTLGYLSSTQALADYATLIIDL  541
            + TLGYL+STQALAD+A LI  L
Sbjct  179  AATLGYLTSTQALADFAVLITSL  201



>ref|XP_004295648.2| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Fragaria vesca 
subsp. vesca]
Length=512

 Score =   132 bits (333),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 59/120 (49%), Positives = 83/120 (69%), Gaps = 0/120 (0%)
 Frame = +2

Query  182  YDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFARET  361
            Y+T Y+ Q LDHF F P S+ TFQQ+Y+IN KYWGG+   APIF Y+G E  ++     T
Sbjct  55   YETFYYNQTLDHFNFRPDSFSTFQQKYVINSKYWGGSNISAPIFAYLGAEVSLDSVISYT  114

Query  362  GSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALADYATLIIDL  541
            G + E A  F  L+++I+HR+YG+S+PFG   EA  ++ TLGY +S QALADYA +++ +
Sbjct  115  GFLPENANQFQALLIYIQHRYYGESIPFGSRTEAFQNASTLGYFNSAQALADYAEILVHV  174



>ref|XP_009390988.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Musa acuminata subsp. 
malaccensis]
Length=506

 Score =   132 bits (333),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 66/117 (56%), Positives = 84/117 (72%), Gaps = 3/117 (3%)
 Frame = +2

Query  194  YFTQILDHFTFTPQSYQTFQQRYLINDKYWG-GAKNMAPIFVYMGGEDDIEPFARETGSI  370
            +F Q LDHFTF P++Y  F Q+YLIN  YW  G  + APIFVY G E +IE FA  TG +
Sbjct  60   FFPQQLDHFTFRPKAYHVFYQKYLINSTYWDQGPVHTAPIFVYTGNEGNIEWFAANTGFM  119

Query  371  IEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALADYATLIIDL  541
            ++ AP F  L+VFIEHRFYG+S+PFG   ++  S++ LGYL+STQA+ADYA LI  L
Sbjct  120  LDIAPKFKALLVFIEHRFYGESMPFG--NDSYESAEELGYLTSTQAMADYAILIRSL  174



>ref|XP_002438750.1| hypothetical protein SORBIDRAFT_10g025520 [Sorghum bicolor]
 gb|EER90117.1| hypothetical protein SORBIDRAFT_10g025520 [Sorghum bicolor]
Length=558

 Score =   133 bits (334),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 71/143 (50%), Positives = 90/143 (63%), Gaps = 11/143 (8%)
 Frame = +2

Query  140  FSAASTKTTYN----NQVYDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYW-----GGA  292
            F AA+   T N     + +   YF Q LDHFTFTP +   F+Q+YL+ND +W     G  
Sbjct  83   FVAAAADGTANGTAAKKPFTVHYFAQELDHFTFTPNASMVFRQKYLLNDTFWRRPSAGDG  142

Query  293  KNMAPIFVYMGGEDDIEPFARETGSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSS  472
                P+FVY G E DIE FA  TG + + AP F  L+VFIEHRFYG+S PFG   ++  S
Sbjct  143  DGAGPLFVYTGNEGDIEWFATNTGFMFDIAPKFGALLVFIEHRFYGESKPFG--NDSYKS  200

Query  473  SKTLGYLSSTQALADYATLIIDL  541
            ++TLGYL+STQALAD+A LI  L
Sbjct  201  AETLGYLTSTQALADFAILIRSL  223



>ref|XP_004250994.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Solanum lycopersicum]
Length=504

 Score =   132 bits (333),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 56/120 (47%), Positives = 84/120 (70%), Gaps = 0/120 (0%)
 Frame = +2

Query  182  YDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFARET  361
            ++T Y+ Q LDHF + P+SY TF+QRY+IN KYWGG+ + +PIF Y+G E  I+      
Sbjct  58   FETYYYKQTLDHFNYGPKSYSTFKQRYIINSKYWGGSNSNSPIFAYLGAESSIDRDPLGI  117

Query  362  GSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALADYATLIIDL  541
            G + +FAP F  L+V++EHR+YG+S+PF  ++EA     + GY +S QA+ADYA L++ +
Sbjct  118  GFLTDFAPQFKALLVYMEHRYYGESIPFKTMEEALKDEDSRGYFNSAQAIADYAELLLHI  177



>ref|XP_006488629.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Citrus sinensis]
Length=494

 Score =   132 bits (332),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 60/120 (50%), Positives = 83/120 (69%), Gaps = 2/120 (2%)
 Frame = +2

Query  182  YDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNM--APIFVYMGGEDDIEPFAR  355
            + T Y+ Q LDHF + P+SY TFQQRY+IN KYWGG  +   APIF Y+G E  ++    
Sbjct  57   FQTFYYNQTLDHFNYRPESYSTFQQRYIINFKYWGGGADQSNAPIFAYLGAESPLDNAPS  116

Query  356  ETGSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALADYATLII  535
              G + + AP F  L+V+IEHR+YGKS+PFG  +EA  ++ TLGY +S QA+ADYA +++
Sbjct  117  VIGFLTDNAPQFKALLVYIEHRYYGKSIPFGSREEALKNASTLGYFNSAQAIADYAEILL  176



>gb|KJB35187.1| hypothetical protein B456_006G103400 [Gossypium raimondii]
Length=510

 Score =   132 bits (332),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 65/141 (46%), Positives = 90/141 (64%), Gaps = 5/141 (4%)
 Frame = +2

Query  119  IINEPDGFSAASTKTTYNNQVYDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKN  298
            I+ +PD  S+A+    +      T Y+ Q LDHF + PQS  TFQQRY++N KYWGGA N
Sbjct  43   IMEDPDLLSSAAVSDDF-----QTFYYPQTLDHFNYQPQSNATFQQRYVMNFKYWGGANN  97

Query  299  MAPIFVYMGGEDDIEPFARETGSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSK  478
             API  Y+G E  +       G + + A  FN L+V+IEHR+YG S+PFG  +EA  ++ 
Sbjct  98   SAPILAYLGAESHLNVSLTSIGFLNDNAVSFNALLVYIEHRYYGISIPFGSREEAFKNAS  157

Query  479  TLGYLSSTQALADYATLIIDL  541
            TLGY +S QA+ADYA +I+ +
Sbjct  158  TLGYFNSAQAIADYAEIIMHI  178



>ref|NP_001065793.1| Os11g0156200 [Oryza sativa Japonica Group]
 gb|AAX92949.1| At2g24280/F27D4.19 [Oryza sativa Japonica Group]
 gb|ABA91540.1| Serine carboxypeptidase S28 family protein, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF27638.1| Os11g0156200 [Oryza sativa Japonica Group]
Length=511

 Score =   132 bits (332),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 64/121 (53%), Positives = 85/121 (70%), Gaps = 3/121 (2%)
 Frame = +2

Query  182  YDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFARET  361
            Y+T+YFTQ LDHF   P S  TF+QRYL+N  +WGGA   AP+FVY G E D+  FA  T
Sbjct  53   YETRYFTQRLDHFNELPASNGTFRQRYLVNGTFWGGAA--APVFVYAGNEGDVALFASNT  110

Query  362  GSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVK-EATSSSKTLGYLSSTQALADYATLIID  538
            G + E AP F  ++VF+EHR+YG+S+PFGG +  A + +   GYL++ QALAD+A LI+ 
Sbjct  111  GFMWEAAPRFRAMLVFVEHRYYGESLPFGGTRAAAFADASAAGYLTTAQALADFAELILS  170

Query  539  L  541
            L
Sbjct  171  L  171



>dbj|BAJ92142.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=535

 Score =   132 bits (332),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 65/116 (56%), Positives = 79/116 (68%), Gaps = 2/116 (2%)
 Frame = +2

Query  194  YFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFARETGSII  373
            YF Q LDHFTFTP +   F Q+YL+ND +W       P+FVY G E DIE FA  TG + 
Sbjct  89   YFQQELDHFTFTPNASNLFSQKYLLNDTFWRRKPAAGPLFVYTGNEGDIEWFATNTGFLF  148

Query  374  EFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALADYATLIIDL  541
            + AP F  L+VFIEHRFYG+S PFG   ++  S+ TLGYL+STQALAD+A LI  L
Sbjct  149  DIAPDFGALLVFIEHRFYGESKPFG--NDSYKSADTLGYLTSTQALADFAVLITSL  202



>ref|XP_004251370.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Solanum lycopersicum]
Length=504

 Score =   132 bits (331),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 56/120 (47%), Positives = 83/120 (69%), Gaps = 0/120 (0%)
 Frame = +2

Query  182  YDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFARET  361
            ++T Y+ Q LDHF + P+SY TF+QRY+IN KYWGG+ + +PIF Y+G E  I+      
Sbjct  58   FETCYYKQTLDHFNYGPKSYSTFKQRYIINSKYWGGSNSSSPIFAYLGAESSIDSDPLGI  117

Query  362  GSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALADYATLIIDL  541
            G + +FAP F  L+V++EHR+YG+S PF  ++EA     + GY +S QA+ADYA L++ +
Sbjct  118  GFLTDFAPQFKALLVYMEHRYYGESTPFKTMEEALKDEDSRGYFNSAQAIADYAELLLHI  177



>ref|XP_010099406.1| Lysosomal Pro-X carboxypeptidase [Morus notabilis]
 gb|EXB78251.1| Lysosomal Pro-X carboxypeptidase [Morus notabilis]
Length=514

 Score =   132 bits (331),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 61/120 (51%), Positives = 85/120 (71%), Gaps = 2/120 (2%)
 Frame = +2

Query  182  YDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFARET  361
            Y+T+YF+Q LDHF+F+   +  F QRYLI+ ++W G   + PIFVY G E DI+ FA  T
Sbjct  63   YETRYFSQRLDHFSFS--EHPRFSQRYLISTEHWVGPNRLGPIFVYCGNEGDIDWFAANT  120

Query  362  GSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALADYATLIIDL  541
            G + E AP F  +V+F EHR+YG+S+PFG  +EA  ++ TL YL++ QALAD+A LI +L
Sbjct  121  GFVWEIAPQFGAMVLFPEHRYYGESIPFGSREEAYRNASTLSYLTAEQALADFAVLITEL  180



>dbj|BAJ86079.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=526

 Score =   132 bits (331),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 65/116 (56%), Positives = 79/116 (68%), Gaps = 2/116 (2%)
 Frame = +2

Query  194  YFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFARETGSII  373
            YF Q LDHFTFTP +   F Q+YL+ND +W       P+FVY G E DIE FA  TG + 
Sbjct  80   YFQQELDHFTFTPNASNLFSQKYLLNDTFWRRKPAAGPLFVYTGNEGDIEWFATNTGFMF  139

Query  374  EFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALADYATLIIDL  541
            + AP F  L+VFIEHRFYG+S PFG   ++  S+ TLGYL+STQALAD+A LI  L
Sbjct  140  DIAPDFGALLVFIEHRFYGESKPFG--NDSYKSADTLGYLTSTQALADFAVLITSL  193



>gb|KDP32459.1| hypothetical protein JCGZ_13384 [Jatropha curcas]
Length=503

 Score =   132 bits (331),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 64/119 (54%), Positives = 82/119 (69%), Gaps = 3/119 (3%)
 Frame = +2

Query  188  TKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFARETGS  367
            T Y+TQ LDHF + P+SY+TFQQRY++N KYWGG    +PIFVY G E +I       G 
Sbjct  44   TLYYTQTLDHFNYKPESYETFQQRYILNSKYWGGPNTSSPIFVYAGAECNITLVIPPGGG  103

Query  368  II-EFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALADYATLIIDL  541
             +   A  FN L+++IEHRFYG+S PFG    +  ++ TLGYLSS QALADYA LI+D+
Sbjct  104  FMAHLASRFNALLLYIEHRFYGESNPFG--PSSLQNATTLGYLSSAQALADYAQLILDV  160



>ref|NP_001058206.1| Os06g0647400 [Oryza sativa Japonica Group]
 dbj|BAD37324.1| putative prolylcarboxypeptidase isoform 1 [Oryza sativa Japonica 
Group]
 dbj|BAF20120.1| Os06g0647400 [Oryza sativa Japonica Group]
 dbj|BAG95990.1| unnamed protein product [Oryza sativa Japonica Group]
Length=539

 Score =   132 bits (331),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 68/125 (54%), Positives = 81/125 (65%), Gaps = 7/125 (6%)
 Frame = +2

Query  182  YDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYW-----GGAKNMAPIFVYMGGEDDIEP  346
            +   YF Q LDHFTFTP +   F Q+YL+ND +W      G     PIFVY G E DIE 
Sbjct  82   FTAHYFPQELDHFTFTPNASAVFYQKYLVNDTFWRRSAAAGETPAGPIFVYTGNEGDIEW  141

Query  347  FARETGSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALADYAT  526
            FA  TG + + AP F  L+VFIEHRFYG+S PFG   E+ SS + LGYL+STQALAD+A 
Sbjct  142  FATNTGFMFDIAPSFGALLVFIEHRFYGESKPFG--NESNSSPEKLGYLTSTQALADFAV  199

Query  527  LIIDL  541
            LI  L
Sbjct  200  LITSL  204



>ref|XP_008344907.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like, partial [Malus 
domestica]
Length=355

 Score =   130 bits (327),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 61/120 (51%), Positives = 82/120 (68%), Gaps = 0/120 (0%)
 Frame = +2

Query  182  YDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFARET  361
            ++T Y+TQ LDHF F   S+ TFQQRYLIN KYWGG+   API  Y+G E+ I+      
Sbjct  62   FETFYYTQTLDHFNFRXDSFTTFQQRYLINSKYWGGSNVSAPILAYLGAEESIDTDLAII  121

Query  362  GSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALADYATLIIDL  541
            G + E A  F  L +FIEHR+YGKS+PFG  +EA  ++ T+GY +S QA+ADYA ++I +
Sbjct  122  GFLSENANQFQALQIFIEHRYYGKSIPFGSREEAFKNASTIGYFNSAQAIADYAEILIHV  181



>dbj|BAJ87416.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=524

 Score =   132 bits (331),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 65/116 (56%), Positives = 79/116 (68%), Gaps = 2/116 (2%)
 Frame = +2

Query  194  YFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFARETGSII  373
            YF Q LDHFTFTP +   F Q+YL+ND +W       P+FVY G E DIE FA  TG + 
Sbjct  78   YFQQELDHFTFTPNASNLFSQKYLLNDTFWRRKPAAGPLFVYTGNEGDIEWFATNTGFLF  137

Query  374  EFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALADYATLIIDL  541
            + AP F  L+VFIEHRFYG+S PFG   ++  S+ TLGYL+STQALAD+A LI  L
Sbjct  138  DIAPDFGALLVFIEHRFYGESKPFG--NDSYKSADTLGYLTSTQALADFAVLITSL  191



>emb|CBI17112.3| unnamed protein product [Vitis vinifera]
Length=624

 Score =   132 bits (333),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 64/138 (46%), Positives = 91/138 (66%), Gaps = 6/138 (4%)
 Frame = +2

Query  122  INEPDGFSAASTKTTYNNQVYDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNM  301
            + EP  FS + ++       + T Y+ Q LDHF + P+SY TFQQRY++N KYWGGA   
Sbjct  165  LREPATFSESVSEE------FQTFYYNQTLDHFNYRPESYITFQQRYVVNFKYWGGANAS  218

Query  302  APIFVYMGGEDDIEPFARETGSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKT  481
            APIF Y+G E D++      G + + A  F  L+V+IEHR+YGKS+P+G  +EA  ++ T
Sbjct  219  APIFAYLGAEADLDYDLSGIGFLTDNAHQFKALLVYIEHRYYGKSIPYGSREEAFKNAST  278

Query  482  LGYLSSTQALADYATLII  535
            LGY +S QA+ADYA ++I
Sbjct  279  LGYFNSAQAIADYAEVLI  296



>ref|XP_008360152.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Malus domestica]
Length=287

 Score =   129 bits (323),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 61/120 (51%), Positives = 80/120 (67%), Gaps = 0/120 (0%)
 Frame = +2

Query  182  YDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFARET  361
            ++T Y+TQ LDHF F   S+ TFQQRYLIN KYWGG+   API  Y+G E+ I+      
Sbjct  62   FETFYYTQTLDHFNFRXDSFTTFQQRYLINSKYWGGSNVSAPILAYLGAEESIDTDLAII  121

Query  362  GSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALADYATLIIDL  541
            G + E A  F  L +FIEHR+YGKS+PFG   EA  +  T+GY +S QA+ADYA ++I +
Sbjct  122  GFLSENANQFQALQIFIEHRYYGKSIPFGSRXEAFKNXSTIGYFNSAQAIADYAEILIHV  181



>gb|KCW59601.1| hypothetical protein EUGRSUZ_H023452, partial [Eucalyptus grandis]
Length=425

 Score =   131 bits (329),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 61/120 (51%), Positives = 83/120 (69%), Gaps = 2/120 (2%)
 Frame = +2

Query  182  YDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFARET  361
            Y+T+YF Q LDHF+F      TF+QRYLI+ ++W G   + PIF+Y G E DIE FA  +
Sbjct  65   YETRYFEQQLDHFSFA--ELPTFRQRYLISSEHWVGPDRLGPIFLYCGNEGDIEWFAANS  122

Query  362  GSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALADYATLIIDL  541
            G + E AP F  +VVF EHR+YG+S+P+G  +EA  +  +L YL++ QALAD+A LI DL
Sbjct  123  GFVWEIAPSFGAMVVFPEHRYYGESMPYGSQEEAYKNGASLSYLTAEQALADFAVLITDL  182



>ref|XP_006408697.1| hypothetical protein EUTSA_v10002179mg, partial [Eutrema salsugineum]
 gb|ESQ50150.1| hypothetical protein EUTSA_v10002179mg, partial [Eutrema salsugineum]
Length=418

 Score =   131 bits (329),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 60/116 (52%), Positives = 81/116 (70%), Gaps = 0/116 (0%)
 Frame = +2

Query  194  YFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFARETGSII  373
            YF Q LDHFTFTP+SY TFQQRY I+ K+W GAK  API  ++G E  ++      G + 
Sbjct  58   YFNQDLDHFTFTPKSYMTFQQRYAIDFKHWAGAKANAPILAFLGEEASLDHDLAVVGFLG  117

Query  374  EFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALADYATLIIDL  541
            +  P    L+V+IEHR+YGKS+PFG  +EA  ++ TLGYL+S QALADYA +++ +
Sbjct  118  DNGPRLKALLVYIEHRYYGKSMPFGSAEEALKNASTLGYLNSAQALADYAAILLHI  173



>ref|XP_007205161.1| hypothetical protein PRUPE_ppa005445mg [Prunus persica]
 gb|EMJ06360.1| hypothetical protein PRUPE_ppa005445mg [Prunus persica]
Length=382

 Score =   130 bits (327),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 60/120 (50%), Positives = 83/120 (69%), Gaps = 2/120 (2%)
 Frame = +2

Query  182  YDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFARET  361
            Y+T+YF Q LDHF+F+      FQQRYLIN ++W G + + PIF Y G E DIE FA  T
Sbjct  70   YETRYFAQRLDHFSFSDSP--RFQQRYLINTEHWVGPQRLGPIFFYCGNEGDIEWFAENT  127

Query  362  GSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALADYATLIIDL  541
            G + E AP F  +++F EHR+YG+S+P+G   EA  ++ TL +L++ QALAD+A LI +L
Sbjct  128  GFVWEVAPQFGAMILFPEHRYYGESMPYGSKDEAYKNASTLSFLTAEQALADFAVLIAEL  187



>gb|EAY80009.1| hypothetical protein OsI_35177 [Oryza sativa Indica Group]
Length=511

 Score =   131 bits (330),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 64/121 (53%), Positives = 84/121 (69%), Gaps = 3/121 (2%)
 Frame = +2

Query  182  YDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFARET  361
            Y+T+YFTQ LDHF   P S  TF+QRYL+N  +WGGA   AP+FVY G E D+  FA  T
Sbjct  53   YETRYFTQRLDHFNELPASNGTFRQRYLVNGTFWGGAA--APVFVYAGNEGDVALFASNT  110

Query  362  GSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVK-EATSSSKTLGYLSSTQALADYATLIID  538
            G + E AP F  ++VF+EHR+YG+S+PFGG +  A + +   GYL+  QALAD+A LI+ 
Sbjct  111  GFMWEAAPRFRAMLVFVEHRYYGESLPFGGTRAAAFADASAAGYLTPAQALADFAELILS  170

Query  539  L  541
            L
Sbjct  171  L  171



>gb|KHN38601.1| Lysosomal Pro-X carboxypeptidase [Glycine soja]
Length=440

 Score =   131 bits (329),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 61/120 (51%), Positives = 83/120 (69%), Gaps = 2/120 (2%)
 Frame = +2

Query  182  YDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFARET  361
            Y+T+   Q LDHF+F+     TF QRYLI+ ++W G + + P+F Y G EDDIE FA+ T
Sbjct  184  YETRCIQQSLDHFSFS--ELPTFPQRYLISTEHWVGPRRLGPVFFYSGNEDDIEWFAQNT  241

Query  362  GSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALADYATLIIDL  541
            G + E AP F  +VVF EH++YG+SVP+G  +EA  +  TL YL+S QALAD++ LI DL
Sbjct  242  GVVWEIAPRFGAMVVFPEHQYYGESVPYGSAEEAYKNVTTLSYLTSEQALADFSVLIADL  301



>gb|EYU36116.1| hypothetical protein MIMGU_mgv1a004675mg [Erythranthe guttata]
Length=515

 Score =   131 bits (330),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 60/118 (51%), Positives = 82/118 (69%), Gaps = 1/118 (1%)
 Frame = +2

Query  182  YDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAK-NMAPIFVYMGGEDDIEPFARE  358
            + T ++ Q LDHF + PQSY TF+QRY++N KYWGG   N +PIF Y+G E  I+     
Sbjct  68   FKTYFYRQTLDHFNYAPQSYATFRQRYVVNSKYWGGQSFNNSPIFAYLGAEAPIDNDLSV  127

Query  359  TGSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALADYATLI  532
             G + + AP FN L+VFIEHR+YGKS+PFG ++EA  +  T GY +S QA+ADYA ++
Sbjct  128  VGFLNDNAPSFNSLIVFIEHRYYGKSIPFGTMEEAMKNETTRGYFNSAQAIADYAAIL  185



>gb|KCW59600.1| hypothetical protein EUGRSUZ_H023452, partial [Eucalyptus grandis]
Length=428

 Score =   131 bits (329),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 61/120 (51%), Positives = 83/120 (69%), Gaps = 2/120 (2%)
 Frame = +2

Query  182  YDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFARET  361
            Y+T+YF Q LDHF+F      TF+QRYLI+ ++W G   + PIF+Y G E DIE FA  +
Sbjct  65   YETRYFEQQLDHFSFA--ELPTFRQRYLISSEHWVGPDRLGPIFLYCGNEGDIEWFAANS  122

Query  362  GSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALADYATLIIDL  541
            G + E AP F  +VVF EHR+YG+S+P+G  +EA  +  +L YL++ QALAD+A LI DL
Sbjct  123  GFVWEIAPSFGAMVVFPEHRYYGESMPYGSQEEAYKNGASLSYLTAEQALADFAVLITDL  182



>ref|XP_006280309.1| hypothetical protein CARUB_v10026232mg [Capsella rubella]
 gb|EOA13207.1| hypothetical protein CARUB_v10026232mg [Capsella rubella]
Length=518

 Score =   131 bits (330),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 64/128 (50%), Positives = 84/128 (66%), Gaps = 2/128 (2%)
 Frame = +2

Query  158  KTTYNNQVYDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDD  337
            +   N   Y+TK+F+Q LDHF+F       F QRYLIN  +W GA  +APIF+Y G E D
Sbjct  53   RGVRNEYRYETKFFSQQLDHFSFA--DLPKFPQRYLINSDHWLGASALAPIFLYCGNEGD  110

Query  338  IEPFARETGSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALAD  517
            IE FA  +G I E AP F  L+VF EHR+YG+S+P+G   EA  ++ TL YL++ QALAD
Sbjct  111  IEWFATNSGFIWEIAPKFGALLVFPEHRYYGESMPYGSRDEAYKNATTLSYLTTEQALAD  170

Query  518  YATLIIDL  541
            +A  + DL
Sbjct  171  FAVFVTDL  178



>ref|XP_008344905.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Malus domestica]
Length=381

 Score =   130 bits (326),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 61/120 (51%), Positives = 82/120 (68%), Gaps = 0/120 (0%)
 Frame = +2

Query  182  YDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFARET  361
            ++T Y+TQ LDHF F   S+ TFQQRYLIN KYWGG+   API  Y+G E+ I+      
Sbjct  62   FETFYYTQTLDHFNFRXDSFTTFQQRYLINSKYWGGSNVSAPILAYLGAEESIDTDLAII  121

Query  362  GSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALADYATLIIDL  541
            G + E A  F  L +FIEHR+YGKS+PFG  +EA  ++ T+GY +S QA+ADYA ++I +
Sbjct  122  GFLSENANQFQALQIFIEHRYYGKSIPFGSREEAFKNASTIGYFNSAQAIADYAEILIHV  181



>ref|XP_007205162.1| hypothetical protein PRUPE_ppa005445mg [Prunus persica]
 gb|EMJ06361.1| hypothetical protein PRUPE_ppa005445mg [Prunus persica]
Length=461

 Score =   131 bits (329),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 60/120 (50%), Positives = 83/120 (69%), Gaps = 2/120 (2%)
 Frame = +2

Query  182  YDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFARET  361
            Y+T+YF Q LDHF+F+      FQQRYLIN ++W G + + PIF Y G E DIE FA  T
Sbjct  70   YETRYFAQRLDHFSFSDSP--RFQQRYLINTEHWVGPQRLGPIFFYCGNEGDIEWFAENT  127

Query  362  GSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALADYATLIIDL  541
            G + E AP F  +++F EHR+YG+S+P+G   EA  ++ TL +L++ QALAD+A LI +L
Sbjct  128  GFVWEVAPQFGAMILFPEHRYYGESMPYGSKDEAYKNASTLSFLTAEQALADFAVLIAEL  187



>ref|XP_004965729.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Setaria italica]
Length=544

 Score =   131 bits (329),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 70/122 (57%), Positives = 84/122 (69%), Gaps = 8/122 (7%)
 Frame = +2

Query  194  YFTQILDHFTFTPQSYQTFQQRYLINDKYW----GGAKNMA--PIFVYMGGEDDIEPFAR  355
            YF Q LDHFTFTP +   F Q+YL+ND YW    GG K  A  P+FVY G E DIE FA 
Sbjct  90   YFPQELDHFTFTPNASMVFYQKYLVNDTYWRRPSGGRKGGAAGPLFVYTGNEGDIEWFAT  149

Query  356  ETGSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALADYATLII  535
             TG + + AP F  L+VFIEHRFYG+S PFG   ++  S++TLGYL+STQALAD+A LI 
Sbjct  150  NTGFMFDIAPKFGALLVFIEHRFYGESKPFG--NDSYKSAETLGYLTSTQALADFAILIG  207

Query  536  DL  541
             L
Sbjct  208  SL  209



>emb|CAN63232.1| hypothetical protein VITISV_004830 [Vitis vinifera]
Length=468

 Score =   130 bits (328),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 64/138 (46%), Positives = 90/138 (65%), Gaps = 6/138 (4%)
 Frame = +2

Query  122  INEPDGFSAASTKTTYNNQVYDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNM  301
            + EP  FS + ++       + T Y+ Q LDHF + P+SY TFQQRY++N KYWGGA   
Sbjct  46   LREPATFSESVSEE------FQTFYYNQTLDHFNYRPESYITFQQRYVVNFKYWGGANAS  99

Query  302  APIFVYMGGEDDIEPFARETGSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKT  481
            APIF Y+G E D++      G + + A  F  L+V+IEHR+YGKS+P G  +EA  ++ T
Sbjct  100  APIFAYLGXEADLDYDLSGIGFLTDNAHQFKALLVYIEHRYYGKSIPXGSREEAFKNAST  159

Query  482  LGYLSSTQALADYATLII  535
            LGY +S QA+ADYA ++I
Sbjct  160  LGYFNSAQAIADYAEVLI  177



>ref|XP_008385547.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Malus domestica]
Length=286

 Score =   128 bits (321),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 60/120 (50%), Positives = 82/120 (68%), Gaps = 0/120 (0%)
 Frame = +2

Query  182  YDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFARET  361
            ++T Y+ Q LDHF F P S+  FQQRYLIN K+WGG+   APIF Y+G E+ I+      
Sbjct  63   FETFYYNQTLDHFNFRPDSFNIFQQRYLINFKHWGGSNISAPIFAYLGEEEAIDADLSII  122

Query  362  GSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALADYATLIIDL  541
            G + E A  F  L +FIEHR+YG+SVPFG  +EA  ++ T+GY +S QA+ADYA ++I +
Sbjct  123  GFLSENANQFQALQIFIEHRYYGQSVPFGSREEAFKNASTIGYFNSAQAMADYAEILIHV  182



>ref|XP_011036743.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Populus euphratica]
Length=514

 Score =   131 bits (329),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 67/133 (50%), Positives = 87/133 (65%), Gaps = 3/133 (2%)
 Frame = +2

Query  143  SAASTKTTYNNQVYDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYM  322
            S A++   +N Q +   Y+ Q LDHF + P S+  FQQRY+IN KYWGGA + APIFVY 
Sbjct  58   SFAASSIYHNLQTF---YYNQTLDHFNYRPDSFDMFQQRYVINSKYWGGAISNAPIFVYF  114

Query  323  GGEDDIEPFARETGSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSST  502
            G E  +E    + G + E A  F  L V+IEHR+YGKS+PFG   EA  ++ TLGY +S 
Sbjct  115  GEEAPLEYDFGDIGILAENAHRFKALQVYIEHRYYGKSIPFGSRNEAFKNASTLGYFNSA  174

Query  503  QALADYATLIIDL  541
            QALADYA +II +
Sbjct  175  QALADYAEIIIHV  187



>ref|XP_010023346.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Eucalyptus 
grandis]
Length=528

 Score =   131 bits (329),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 61/120 (51%), Positives = 83/120 (69%), Gaps = 2/120 (2%)
 Frame = +2

Query  182  YDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFARET  361
            Y+T+YF Q LDHF+F      TF+QRYLI+ ++W G   + PIF+Y G E DIE FA  +
Sbjct  65   YETRYFEQQLDHFSFA--ELPTFRQRYLISSEHWVGPDRLGPIFLYCGNEGDIEWFAANS  122

Query  362  GSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALADYATLIIDL  541
            G + E AP F  +VVF EHR+YG+S+P+G  +EA  +  +L YL++ QALAD+A LI DL
Sbjct  123  GFVWEIAPSFGAMVVFPEHRYYGESMPYGSQEEAYKNGASLSYLTAEQALADFAVLITDL  182



>ref|XP_004145770.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Cucumis sativus]
 ref|XP_004160074.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Cucumis sativus]
 gb|KGN46900.1| hypothetical protein Csa_6G149410 [Cucumis sativus]
Length=499

 Score =   130 bits (328),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 60/120 (50%), Positives = 81/120 (68%), Gaps = 0/120 (0%)
 Frame = +2

Query  182  YDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFARET  361
            + T Y+ Q LDHF + P+SY  F  RY+IN KYWGGA + API  Y+G E  +E      
Sbjct  55   FKTFYYNQTLDHFNYRPESYTCFPHRYIINFKYWGGANSSAPILAYLGAEGPLEGDLNAI  114

Query  362  GSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALADYATLIIDL  541
            G + + A  F+ L+V+IEHR+YGKS+PFG  +EA  ++ TLGY SS QA+ADYA ++I L
Sbjct  115  GFMTDNAARFDALLVYIEHRYYGKSMPFGSREEALKNASTLGYFSSAQAIADYAAVLIHL  174



>gb|KCW84338.1| hypothetical protein EUGRSUZ_B01187, partial [Eucalyptus grandis]
Length=478

 Score =   130 bits (328),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 62/118 (53%), Positives = 81/118 (69%), Gaps = 1/118 (1%)
 Frame = +2

Query  182  YDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFARET  361
            + T YF Q LDHF + P+SY TF+QRYLIN +YWGGA + APIF+Y+G E  IE      
Sbjct  52   FTTFYFNQTLDHFNYQPKSYTTFRQRYLINSRYWGGANSSAPIFIYLGAEAPIENDLNGI  111

Query  362  GSIIEFAPHFNGLVVFIEHRFYGKSVPFG-GVKEATSSSKTLGYLSSTQALADYATLI  532
            G + E A  F   +V+IEHR+YG+S+PFG  ++EA +     GY SS+QALADYA +I
Sbjct  112  GFLTENAAQFKAFLVYIEHRYYGRSIPFGMSLEEALNDPIARGYFSSSQALADYAAII  169



>gb|EEC81080.1| hypothetical protein OsI_23902 [Oryza sativa Indica Group]
Length=539

 Score =   130 bits (328),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 68/125 (54%), Positives = 80/125 (64%), Gaps = 7/125 (6%)
 Frame = +2

Query  182  YDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYW-----GGAKNMAPIFVYMGGEDDIEP  346
            +   YF Q LDHFTFTP +   F Q+YL+ND +W      G     PIFVY G E DIE 
Sbjct  82   FTAHYFPQELDHFTFTPNASALFYQKYLVNDTFWRRSAAAGETPAGPIFVYTGNEGDIEW  141

Query  347  FARETGSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALADYAT  526
            FA  TG +   AP F  L+VFIEHRFYG+S PFG   E+ SS + LGYL+STQALAD+A 
Sbjct  142  FATNTGFMFHIAPSFGALLVFIEHRFYGESKPFG--NESNSSPEKLGYLTSTQALADFAV  199

Query  527  LIIDL  541
            LI  L
Sbjct  200  LITSL  204



>gb|KCW50724.1| hypothetical protein EUGRSUZ_J00402 [Eucalyptus grandis]
Length=408

 Score =   130 bits (326),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 64/137 (47%), Positives = 90/137 (66%), Gaps = 4/137 (3%)
 Frame = +2

Query  134  DGFSAASTKTTYNNQVYDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIF  313
            D   A S  TT +   ++T +F Q LDHF++ PQSY TF+QRY IN  YWGGAK+ APIF
Sbjct  39   DPERAVSASTTDD---FETFFFDQTLDHFSYRPQSYATFKQRYFINSSYWGGAKSSAPIF  95

Query  314  VYMGGEDDIEPFARETGSIIEFAPHFNGLVVFIEHRFYGKSVPFG-GVKEATSSSKTLGY  490
            VY+G E +++    + G + + A  F  L+V+IEHR+YG+S+P G   +EA  ++   GY
Sbjct  96   VYLGAESNLDKAPTDIGFLRDNAAQFQALLVYIEHRYYGQSIPLGMSFEEALENADIRGY  155

Query  491  LSSTQALADYATLIIDL  541
             SS QALADY  +I+ +
Sbjct  156  FSSAQALADYVAIIMHV  172



>ref|XP_008659849.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Zea mays]
Length=533

 Score =   130 bits (328),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 70/138 (51%), Positives = 90/138 (65%), Gaps = 7/138 (5%)
 Frame = +2

Query  143  SAASTKTTYNNQVYDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAP-----  307
            SAA+  T    Q + T YF Q LDHFTFTP +   F+Q+YL+ND +W   +         
Sbjct  60   SAAADGTNSTAQPFTTHYFPQELDHFTFTPNASMLFRQKYLVNDTFWRRPRRGGGGGAGP  119

Query  308  IFVYMGGEDDIEPFARETGSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLG  487
            +FVY G E DIE FA  TG + + AP F  L+VFIEHRFYG+S+PFG   ++ SS++T G
Sbjct  120  LFVYTGNEGDIEWFATNTGFMFDIAPKFGALLVFIEHRFYGESLPFG--DDSYSSAETEG  177

Query  488  YLSSTQALADYATLIIDL  541
            YL+STQALAD+A LI  L
Sbjct  178  YLTSTQALADFAILITGL  195



>ref|XP_010036093.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Eucalyptus 
grandis]
Length=509

 Score =   130 bits (328),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 62/118 (53%), Positives = 81/118 (69%), Gaps = 1/118 (1%)
 Frame = +2

Query  182  YDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFARET  361
            + T YF Q LDHF + P+SY TF+QRYLIN +YWGGA + APIF+Y+G E  IE      
Sbjct  52   FTTFYFNQTLDHFNYQPKSYTTFRQRYLINSRYWGGANSSAPIFIYLGAEAPIENDLNGI  111

Query  362  GSIIEFAPHFNGLVVFIEHRFYGKSVPFG-GVKEATSSSKTLGYLSSTQALADYATLI  532
            G + E A  F   +V+IEHR+YG+S+PFG  ++EA +     GY SS+QALADYA +I
Sbjct  112  GFLTENAAQFKAFLVYIEHRYYGRSIPFGMSLEEALNDPIARGYFSSSQALADYAAII  169



>ref|XP_008237071.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Prunus mume]
Length=517

 Score =   130 bits (327),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 60/120 (50%), Positives = 83/120 (69%), Gaps = 2/120 (2%)
 Frame = +2

Query  182  YDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFARET  361
            Y+T+YF Q LDHF+F+      FQQRYLIN ++W G + + PIF Y G E DIE FA  T
Sbjct  64   YETRYFAQRLDHFSFSDSP--RFQQRYLINTEHWVGPQRVGPIFFYCGNEGDIEWFAENT  121

Query  362  GSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALADYATLIIDL  541
            G + E AP F  +++F EHR+YG+S+P+G   EA  ++ TL +L++ QALAD+A LI +L
Sbjct  122  GFVWEVAPQFGAMILFPEHRYYGESMPYGSKAEAYKNASTLSFLTAEQALADFAVLITEL  181



>gb|AFW87519.1| putative serine peptidase S28 family protein [Zea mays]
Length=552

 Score =   130 bits (328),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 70/138 (51%), Positives = 90/138 (65%), Gaps = 7/138 (5%)
 Frame = +2

Query  143  SAASTKTTYNNQVYDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAP-----  307
            SAA+  T    Q + T YF Q LDHFTFTP +   F+Q+YL+ND +W   +         
Sbjct  60   SAAADGTNSTAQPFTTHYFPQELDHFTFTPNASMLFRQKYLVNDTFWRRPRRGGGGGAGP  119

Query  308  IFVYMGGEDDIEPFARETGSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLG  487
            +FVY G E DIE FA  TG + + AP F  L+VFIEHRFYG+S+PFG   ++ SS++T G
Sbjct  120  LFVYTGNEGDIEWFATNTGFMFDIAPKFGALLVFIEHRFYGESLPFG--DDSYSSAETEG  177

Query  488  YLSSTQALADYATLIIDL  541
            YL+STQALAD+A LI  L
Sbjct  178  YLTSTQALADFAILITGL  195



>ref|XP_007208680.1| hypothetical protein PRUPE_ppa025450mg [Prunus persica]
 gb|EMJ09879.1| hypothetical protein PRUPE_ppa025450mg [Prunus persica]
Length=521

 Score =   130 bits (327),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 60/120 (50%), Positives = 80/120 (67%), Gaps = 0/120 (0%)
 Frame = +2

Query  182  YDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFARET  361
            ++T Y+ Q LDHF F P S+ TFQQRYLIN KYWGG+   API  Y+G ED ++      
Sbjct  62   FETFYYKQTLDHFNFRPDSFSTFQQRYLINSKYWGGSNVSAPILAYLGAEDAVDNSLSSI  121

Query  362  GSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALADYATLIIDL  541
            G + E A     L +FIEHR+YGKS+PF   +EA  ++ TLGY +S QA+ADYA ++I +
Sbjct  122  GFLSENANQLQALQIFIEHRYYGKSIPFRSREEAFQNASTLGYFNSAQAIADYAEILIHV  181



>ref|XP_009342192.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Pyrus x bretschneideri]
Length=521

 Score =   130 bits (327),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 61/120 (51%), Positives = 83/120 (69%), Gaps = 2/120 (2%)
 Frame = +2

Query  182  YDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPIFVYMGGEDDIEPFARET  361
            Y+T+YF Q LDHF+FT      FQQRYLIN ++W GA+ + PIF Y G E  IE FA  T
Sbjct  69   YETRYFAQRLDHFSFT--DTPKFQQRYLINTEHWVGAQRLGPIFFYCGNEGGIEWFAENT  126

Query  362  GSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGYLSSTQALADYATLIIDL  541
            G + E AP F  +V+F EHR+YG+S+P+G  +EA  ++ TL +L++ Q LAD+A LI +L
Sbjct  127  GFVWELAPRFGAMVLFPEHRYYGESMPYGSEEEAYKNASTLSFLTAGQTLADFAVLITEL  186



>ref|XP_002271733.2| PREDICTED: lysosomal Pro-X carboxypeptidase [Vitis vinifera]
Length=505

 Score =   130 bits (326),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 62/141 (44%), Positives = 95/141 (67%), Gaps = 4/141 (3%)
 Frame = +2

Query  119  IINEPDGFSAASTKTTYNNQVYDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKN  298
            I+  P+   AA +++ Y +    T ++ Q LDHF + P+SY+TF+QRY++N K+WGGAK 
Sbjct  45   ILRNPE--PAAVSESFYKD--LKTFFYAQTLDHFNYRPESYKTFRQRYVMNFKHWGGAKA  100

Query  299  MAPIFVYMGGEDDIEPFARETGSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSK  478
             APIF Y+G E  ++      G + + A  FN L+++IEHR+YGKS+PFG  K A  ++ 
Sbjct  101  GAPIFAYLGAEAPLDGDLVNIGFVNDNAARFNALLIYIEHRYYGKSIPFGSTKVALKNAS  160

Query  479  TLGYLSSTQALADYATLIIDL  541
            TLGY +S QA+ADYA +++ +
Sbjct  161  TLGYFNSAQAIADYAAVLMHV  181



>ref|XP_003549991.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Glycine max]
 gb|KHN01721.1| Lysosomal Pro-X carboxypeptidase [Glycine soja]
Length=513

 Score =   130 bits (326),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 64/134 (48%), Positives = 89/134 (66%), Gaps = 7/134 (5%)
 Frame = +2

Query  146  AASTKTTYNNQV-----YDTKYFTQILDHFTFTPQSYQTFQQRYLINDKYWGGAKNMAPI  310
            AA+ +T  N++      Y+ +YF Q LDHF+F+     TF QRYLI+ ++W G   + PI
Sbjct  44   AATARTHSNSEPPPQFHYEKRYFQQRLDHFSFS--ELPTFPQRYLISTEHWVGPHRLGPI  101

Query  311  FVYMGGEDDIEPFARETGSIIEFAPHFNGLVVFIEHRFYGKSVPFGGVKEATSSSKTLGY  490
            F Y G E DIE FA+ TG + E AP F  +VVF EHR+YG+SVP+G  +EA  ++ TL Y
Sbjct  102  FFYCGNEGDIEWFAQNTGFVWEIAPRFGAMVVFPEHRYYGESVPYGSAEEAYKNATTLSY  161

Query  491  LSSTQALADYATLI  532
            L++ QALAD++ LI
Sbjct  162  LTAEQALADFSVLI  175



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 579015689490