BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001N16

Length=593
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009625475.1|  PREDICTED: 60S ribosomal protein L18-2-like        323   2e-109   Nicotiana tomentosiformis
ref|XP_009783807.1|  PREDICTED: 60S ribosomal protein L18-2-like        323   3e-109   Nicotiana sylvestris
ref|XP_009629074.1|  PREDICTED: 60S ribosomal protein L18-2             322   7e-109   Nicotiana tomentosiformis
gb|KDP28183.1|  hypothetical protein JCGZ_13954                         321   1e-108   Jatropha curcas
ref|XP_009630920.1|  PREDICTED: 60S ribosomal protein L18-2-like        321   1e-108   Nicotiana tomentosiformis
ref|XP_009772706.1|  PREDICTED: 60S ribosomal protein L18-2-like        319   7e-108   Nicotiana sylvestris
ref|XP_002301485.1|  60S ribosomal protein L18                          319   1e-107   Populus trichocarpa [western balsam poplar]
ref|XP_009796134.1|  PREDICTED: 60S ribosomal protein L18-2-like        317   5e-107   Nicotiana sylvestris
ref|NP_001237789.1|  uncharacterized protein LOC100500164               317   5e-107   Glycine max [soybeans]
gb|KJB45330.1|  hypothetical protein B456_007G301700                    317   5e-107   Gossypium raimondii
gb|KJB41867.1|  hypothetical protein B456_007G127300                    317   7e-107   Gossypium raimondii
ref|XP_010025256.1|  PREDICTED: 60S ribosomal protein L18-2             317   8e-107   Eucalyptus grandis [rose gum]
ref|XP_011042004.1|  PREDICTED: 60S ribosomal protein L18-2-like        316   2e-106   Populus euphratica
ref|XP_002523106.1|  60S ribosomal protein L18, putative                316   2e-106   Ricinus communis
ref|XP_010313195.1|  PREDICTED: 60S ribosomal protein L18-2-like        315   2e-106   Solanum lycopersicum
ref|XP_002320999.1|  60S ribosomal protein L18                          315   2e-106   Populus trichocarpa [western balsam poplar]
ref|XP_006344694.1|  PREDICTED: 60S ribosomal protein L18-2-like        315   2e-106   Solanum tuberosum [potatoes]
gb|KHN43503.1|  60S ribosomal protein L18-2                             315   3e-106   Glycine soja [wild soybean]
ref|NP_001236701.1|  uncharacterized protein LOC100306301               315   3e-106   
gb|KJB82632.1|  hypothetical protein B456_013G206100                    315   4e-106   Gossypium raimondii
ref|XP_007031040.1|  Ribosomal protein L18                              314   5e-106   Theobroma cacao [chocolate]
gb|KHF98574.1|  60S ribosomal L18-2 -like protein                       314   7e-106   Gossypium arboreum [tree cotton]
gb|KJB41866.1|  hypothetical protein B456_007G127300                    315   7e-106   Gossypium raimondii
gb|KHN20393.1|  60S ribosomal protein L18-2                             317   1e-105   Glycine soja [wild soybean]
ref|XP_006382454.1|  60S ribosomal protein L18                          313   1e-105   Populus trichocarpa [western balsam poplar]
ref|XP_011036896.1|  PREDICTED: 60S ribosomal protein L18-2             313   1e-105   Populus euphratica
gb|KJB23303.1|  hypothetical protein B456_004G091200                    313   1e-105   Gossypium raimondii
ref|XP_003556523.1|  PREDICTED: 60S ribosomal protein L18-2-like        313   2e-105   Glycine max [soybeans]
ref|XP_007163123.1|  hypothetical protein PHAVU_001G208200g             313   2e-105   Phaseolus vulgaris [French bean]
gb|KDP23459.1|  hypothetical protein JCGZ_23292                         313   2e-105   Jatropha curcas
ref|NP_001236071.1|  uncharacterized protein LOC100499789               312   3e-105   Glycine max [soybeans]
gb|KHG07157.1|  60S ribosomal L18-2 -like protein                       313   3e-105   Gossypium arboreum [tree cotton]
ref|XP_007050974.1|  Ribosomal protein L18 isoform 1                    312   4e-105   Theobroma cacao [chocolate]
ref|XP_008450608.1|  PREDICTED: 60S ribosomal protein L18-2             311   9e-105   Cucumis melo [Oriental melon]
gb|KHN20252.1|  60S ribosomal protein L18-3                             311   1e-104   Glycine soja [wild soybean]
ref|XP_010544997.1|  PREDICTED: 60S ribosomal protein L18-2-like        311   1e-104   Tarenaya hassleriana [spider flower]
ref|XP_002319502.1|  60S ribosomal protein L18                          310   2e-104   Populus trichocarpa [western balsam poplar]
emb|CDP17112.1|  unnamed protein product                                312   2e-104   Coffea canephora [robusta coffee]
gb|KGN66048.1|  hypothetical protein Csa_1G569250                       312   2e-104   Cucumis sativus [cucumbers]
gb|KHN03962.1|  60S ribosomal protein L18-2                             310   2e-104   Glycine soja [wild soybean]
ref|XP_010523956.1|  PREDICTED: 60S ribosomal protein L18-2-like        310   2e-104   Tarenaya hassleriana [spider flower]
ref|XP_008454015.1|  PREDICTED: 60S ribosomal protein L18-3             310   3e-104   Cucumis melo [Oriental melon]
ref|XP_006433453.1|  hypothetical protein CICLE_v10002597mg             310   3e-104   Citrus clementina [clementine]
ref|XP_007144959.1|  hypothetical protein PHAVU_007G197900g             310   3e-104   Phaseolus vulgaris [French bean]
ref|XP_010559185.1|  PREDICTED: 60S ribosomal protein L18-2-like        310   3e-104   Tarenaya hassleriana [spider flower]
ref|XP_009630742.1|  PREDICTED: 60S ribosomal protein L18-2-like        309   5e-104   Nicotiana tomentosiformis
ref|XP_010043043.1|  PREDICTED: 60S ribosomal protein L18-2             309   5e-104   Eucalyptus grandis [rose gum]
ref|XP_004144773.1|  PREDICTED: 60S ribosomal protein L18-3-like        309   6e-104   Cucumis sativus [cucumbers]
ref|XP_011023716.1|  PREDICTED: 60S ribosomal protein L18-2             309   6e-104   Populus euphratica
gb|AFK49563.1|  unknown                                                 309   6e-104   Lotus japonicus
ref|XP_010546736.1|  PREDICTED: 60S ribosomal protein L18-3             309   7e-104   Tarenaya hassleriana [spider flower]
emb|CDO98841.1|  unnamed protein product                                311   1e-103   Coffea canephora [robusta coffee]
ref|XP_007147006.1|  hypothetical protein PHAVU_006G088800g             308   1e-103   Phaseolus vulgaris [French bean]
gb|ABK92688.1|  unknown                                                 308   1e-103   Populus trichocarpa [western balsam poplar]
ref|XP_010088293.1|  60S ribosomal protein L18-3                        309   1e-103   
ref|XP_003554636.2|  PREDICTED: 60S ribosomal protein L18-2-like        309   1e-103   Glycine max [soybeans]
ref|XP_010528904.1|  PREDICTED: 60S ribosomal protein L18-2             308   1e-103   Tarenaya hassleriana [spider flower]
ref|XP_010659657.1|  PREDICTED: 60S ribosomal protein L18-2-like        308   2e-103   Vitis vinifera
ref|XP_010684349.1|  PREDICTED: 60S ribosomal protein L18-2-like        307   4e-103   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006386732.1|  hypothetical protein POPTR_0002s20400g             307   5e-103   
emb|CBI39539.3|  unnamed protein product                                309   5e-103   Vitis vinifera
ref|XP_010674074.1|  PREDICTED: 60S ribosomal protein L18-2             307   5e-103   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002270635.1|  PREDICTED: 60S ribosomal protein L18-2             306   6e-103   Vitis vinifera
ref|XP_004494383.1|  PREDICTED: 60S ribosomal protein L18-like          306   8e-103   Cicer arietinum [garbanzo]
ref|XP_008386678.1|  PREDICTED: 60S ribosomal protein L18-2-like        306   9e-103   
ref|XP_006359857.1|  PREDICTED: 60S ribosomal protein L18-2-like        306   1e-102   Solanum tuberosum [potatoes]
ref|XP_004135776.1|  PREDICTED: uncharacterized protein LOC101207642    313   1e-102   
ref|XP_008388515.1|  PREDICTED: 60S ribosomal protein L18-2-like        306   1e-102   Malus domestica [apple tree]
ref|XP_009338229.1|  PREDICTED: 60S ribosomal protein L18-2-like        306   1e-102   Pyrus x bretschneideri [bai li]
ref|XP_007050976.1|  Ribosomal protein L18 isoform 3                    305   3e-102   
ref|XP_007205962.1|  hypothetical protein PRUPE_ppa012012mg             305   3e-102   Prunus persica
ref|XP_010094463.1|  60S ribosomal protein L18-2                        305   4e-102   
ref|XP_009335702.1|  PREDICTED: 60S ribosomal protein L18-2             305   4e-102   Pyrus x bretschneideri [bai li]
ref|XP_008370417.1|  PREDICTED: 60S ribosomal protein L18-2             305   4e-102   Malus domestica [apple tree]
ref|XP_007201344.1|  hypothetical protein PRUPE_ppa012001mg             305   4e-102   Prunus persica
emb|CDX74138.1|  BnaA03g29090D                                          305   5e-102   
ref|NP_001235897.1|  uncharacterized protein LOC100527681               304   6e-102   
ref|XP_008369026.1|  PREDICTED: 60S ribosomal protein L18-2             304   6e-102   
ref|XP_010104147.1|  60S ribosomal protein L18-2                        305   7e-102   
gb|AFK45456.1|  unknown                                                 304   8e-102   Lotus japonicus
ref|XP_009134833.1|  PREDICTED: 60S ribosomal protein L18-2             303   9e-102   Brassica rapa
ref|NP_187210.1|  60S ribosomal protein L18-2                           303   9e-102   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010259492.1|  PREDICTED: 60S ribosomal protein L18-3             303   2e-101   Nelumbo nucifera [Indian lotus]
ref|XP_010938374.1|  PREDICTED: 60S ribosomal protein L18-2-like        303   2e-101   Elaeis guineensis
ref|XP_010273829.1|  PREDICTED: 60S ribosomal protein L18-2-like        303   2e-101   Nelumbo nucifera [Indian lotus]
gb|KFK26512.1|  hypothetical protein AALP_AA8G258600                    303   2e-101   Arabis alpina [alpine rockcress]
gb|KJB82634.1|  hypothetical protein B456_013G206100                    303   2e-101   Gossypium raimondii
ref|XP_011079632.1|  PREDICTED: 60S ribosomal protein L18-2             303   2e-101   Sesamum indicum [beniseed]
gb|AAA69928.1|  cytoplasmic ribosomal protein L18                       303   2e-101   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002882427.1|  hypothetical protein ARALYDRAFT_477850             303   2e-101   Arabidopsis lyrata subsp. lyrata
ref|XP_011079633.1|  PREDICTED: 60S ribosomal protein L18-2-like        302   3e-101   Sesamum indicum [beniseed]
ref|XP_002512455.1|  60S ribosomal protein L18, putative                310   4e-101   
ref|XP_002271179.1|  PREDICTED: 60S ribosomal protein L18-2             301   6e-101   Vitis vinifera
ref|XP_010931680.1|  PREDICTED: 60S ribosomal protein L18-2             301   7e-101   Elaeis guineensis
ref|XP_006444385.1|  hypothetical protein CICLE_v10022435mg             301   7e-101   Citrus clementina [clementine]
emb|CDY18813.1|  BnaAnng02780D                                          303   9e-101   Brassica napus [oilseed rape]
emb|CDY40718.1|  BnaC03g34340D                                          302   1e-100   Brassica napus [oilseed rape]
ref|XP_006408052.1|  hypothetical protein EUTSA_v10021598mg             300   2e-100   Eutrema salsugineum [saltwater cress]
ref|XP_009124870.1|  PREDICTED: 60S ribosomal protein L18-2-like        300   2e-100   Brassica rapa
ref|XP_002874343.1|  60S ribosomal protein L18                          300   2e-100   Arabidopsis lyrata subsp. lyrata
ref|XP_008775991.1|  PREDICTED: 60S ribosomal protein L18-2             300   3e-100   Phoenix dactylifera
ref|NP_198137.1|  60S ribosomal protein L18-3                           300   3e-100   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002465302.1|  hypothetical protein SORBIDRAFT_01g035860          299   8e-100   Sorghum bicolor [broomcorn]
ref|XP_009151179.1|  PREDICTED: 60S ribosomal protein L18-2             299   8e-100   Brassica rapa
ref|XP_004984437.1|  PREDICTED: 60S ribosomal protein L18-2-like        298   9e-100   
emb|CBI22977.3|  unnamed protein product                                301   1e-99    Vitis vinifera
ref|XP_004494578.1|  PREDICTED: 60S ribosomal protein L18-like          298   1e-99    
ref|XP_006298640.1|  hypothetical protein CARUB_v10014730mg             298   1e-99    Capsella rubella
emb|CBI36879.3|  unnamed protein product                                302   2e-99    Vitis vinifera
ref|XP_009129884.1|  PREDICTED: 60S ribosomal protein L18-2-like        299   3e-99    Brassica rapa
ref|XP_010269589.1|  PREDICTED: 60S ribosomal protein L18-3             297   3e-99    Nelumbo nucifera [Indian lotus]
emb|CDY66803.1|  BnaAnng22990D                                          298   3e-99    Brassica napus [oilseed rape]
ref|XP_009111741.1|  PREDICTED: 60S ribosomal protein L18-2-like        297   3e-99    Brassica rapa
ref|XP_003591163.1|  Ribosomal protein L18                              297   3e-99    Medicago truncatula
gb|KEH24393.1|  60S ribosomal protein L18-3                             297   4e-99    Medicago truncatula
gb|AFK34017.1|  unknown                                                 297   4e-99    Medicago truncatula
gb|ACJ85943.1|  unknown                                                 296   4e-99    Medicago truncatula
emb|CDY19736.1|  BnaA09g03890D                                          298   5e-99    Brassica napus [oilseed rape]
ref|XP_006394935.1|  hypothetical protein EUTSA_v10004865mg             298   5e-99    
ref|XP_009417724.1|  PREDICTED: 60S ribosomal protein L18-2             296   6e-99    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002461201.1|  hypothetical protein SORBIDRAFT_02g042750          296   8e-99    Sorghum bicolor [broomcorn]
emb|CDX99969.1|  BnaC09g03320D                                          297   1e-98    
gb|EMS45435.1|  60S ribosomal protein L18-2                             296   1e-98    Triticum urartu
ref|XP_008810211.1|  PREDICTED: 60S ribosomal protein L18-2-like        295   1e-98    Phoenix dactylifera
ref|XP_006288739.1|  hypothetical protein CARUB_v10002048mg             295   1e-98    Capsella rubella
ref|XP_010486014.1|  PREDICTED: 60S ribosomal protein L18-3             295   2e-98    Camelina sativa [gold-of-pleasure]
ref|XP_008784768.1|  PREDICTED: 60S ribosomal protein L18-2-like        295   2e-98    Phoenix dactylifera
ref|XP_010429374.1|  PREDICTED: 60S ribosomal protein L18-3-like        295   2e-98    Camelina sativa [gold-of-pleasure]
ref|XP_010455077.1|  PREDICTED: 60S ribosomal protein L18-3-like ...    295   2e-98    Camelina sativa [gold-of-pleasure]
ref|XP_010914484.1|  PREDICTED: 60S ribosomal protein L18-3             295   3e-98    Elaeis guineensis
ref|XP_009384409.1|  PREDICTED: 60S ribosomal protein L18-2             295   3e-98    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010464086.1|  PREDICTED: 60S ribosomal protein L18-3-like        295   3e-98    Camelina sativa [gold-of-pleasure]
ref|XP_009402513.1|  PREDICTED: 60S ribosomal protein L18-2-like        295   4e-98    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010421566.1|  PREDICTED: 60S ribosomal protein L18-2-like        294   4e-98    Camelina sativa [gold-of-pleasure]
ref|NP_001131538.1|  uncharacterized protein LOC100192878               294   6e-98    Zea mays [maize]
ref|XP_009411663.1|  PREDICTED: 60S ribosomal protein L18-3-like        293   1e-97    Musa acuminata subsp. malaccensis [pisang utan]
gb|EMT12638.1|  60S ribosomal protein L18-2                             293   1e-97    
emb|CDX80616.1|  BnaC07g28280D                                          295   1e-97    
gb|KFK37967.1|  hypothetical protein AALP_AA3G053100                    293   1e-97    Arabis alpina [alpine rockcress]
emb|CDY25018.1|  BnaC02g39900D                                          293   2e-97    Brassica napus [oilseed rape]
gb|ABK26318.1|  unknown                                                 293   2e-97    Picea sitchensis
ref|XP_007050975.1|  Ribosomal protein L18 isoform 2                    292   2e-97    
ref|XP_006855263.1|  hypothetical protein AMTR_s00183p00048560          291   5e-97    Amborella trichopoda
ref|XP_004495692.1|  PREDICTED: 60S ribosomal protein L18-like          291   5e-97    Cicer arietinum [garbanzo]
ref|XP_003626231.1|  60S ribosomal protein L18                          291   7e-97    Medicago truncatula
ref|NP_001050069.1|  Os03g0341100                                       291   1e-96    
ref|XP_009381102.1|  PREDICTED: 60S ribosomal protein L18-2-like        290   1e-96    
ref|XP_003562459.1|  PREDICTED: 60S ribosomal protein L18-3-like        290   2e-96    
gb|ABK21809.1|  unknown                                                 290   2e-96    Picea sitchensis
ref|XP_009629121.1|  PREDICTED: 60S ribosomal protein L18-2             290   3e-96    Nicotiana tomentosiformis
emb|CDY05559.1|  BnaA02g31320D                                          300   4e-96    
ref|XP_010228645.1|  PREDICTED: 60S ribosomal protein L18-2-like        289   5e-96    Brachypodium distachyon [annual false brome]
ref|XP_004958675.1|  PREDICTED: 60S ribosomal protein L18-3-like        288   9e-96    Setaria italica
ref|XP_006650060.1|  PREDICTED: 60S ribosomal protein L18-3-like        288   1e-95    Oryza brachyantha
gb|ABK22247.1|  unknown                                                 288   1e-95    Picea sitchensis
ref|XP_010550997.1|  PREDICTED: 60S ribosomal protein L18-3-like ...    288   2e-95    Tarenaya hassleriana [spider flower]
ref|XP_010524859.1|  PREDICTED: 60S ribosomal protein L18-3             288   2e-95    Tarenaya hassleriana [spider flower]
gb|AGV54741.1|  60S ribosomal protein L18-3-like protein                288   3e-95    Phaseolus vulgaris [French bean]
gb|AAO46881.1|  60S ribosomal protein                                   285   9e-95    Medicago sativa [alfalfa]
ref|NP_001132852.1|  uncharacterized protein LOC100194344               286   9e-95    Zea mays [maize]
ref|XP_008656150.1|  PREDICTED: 60S ribosomal protein L18-3-like        287   1e-94    
emb|CDY05183.1|  BnaC05g46200D                                          287   1e-94    
ref|XP_002439318.1|  hypothetical protein SORBIDRAFT_09g004290          285   2e-94    Sorghum bicolor [broomcorn]
gb|EPS67068.1|  hypothetical protein M569_07709                         285   2e-94    Genlisea aurea
ref|XP_006658116.1|  PREDICTED: 60S ribosomal protein L18-3-like        285   3e-94    Oryza brachyantha
gb|AFC88838.1|  60S ribosomal protein L18-like protein                  284   4e-94    Miscanthus sinensis
ref|XP_004247404.1|  PREDICTED: 60S ribosomal protein L18-2             283   7e-94    Solanum lycopersicum
ref|XP_010921627.1|  PREDICTED: uncharacterized protein LOC105045157    291   9e-94    
pdb|3J61|Q  Chain Q, Localization Of The Large Subunit Ribosomal ...    283   2e-93    Triticum aestivum [Canadian hard winter wheat]
gb|EMT18368.1|  60S ribosomal protein L18-2                             282   2e-93    
dbj|BAJ90421.1|  predicted protein                                      282   3e-93    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003568896.1|  PREDICTED: 60S ribosomal protein L18-2-like        282   4e-93    Brachypodium distachyon [annual false brome]
ref|XP_006654064.1|  PREDICTED: 60S ribosomal protein L18-2-like        281   7e-93    Oryza brachyantha
ref|XP_004977069.1|  PREDICTED: 60S ribosomal protein L18-2-like        281   8e-93    Setaria italica
ref|NP_001060617.1|  Os07g0674700                                       281   1e-92    
ref|XP_001781485.1|  predicted protein                                  280   1e-92    
ref|XP_001760902.1|  predicted protein                                  280   2e-92    
gb|EYU46738.1|  hypothetical protein MIMGU_mgv1a014520mg                280   2e-92    Erythranthe guttata [common monkey flower]
ref|NP_001054688.1|  Os05g0155100                                       279   4e-92    
ref|XP_001751734.1|  predicted protein                                  278   7e-92    
ref|XP_009611670.1|  PREDICTED: 60S ribosomal protein L18-2-like        278   7e-92    Nicotiana tomentosiformis
ref|XP_008789961.1|  PREDICTED: uncharacterized protein LOC103707302    299   2e-91    
gb|EMS65848.1|  60S ribosomal protein L18-2                             279   2e-91    Triticum urartu
gb|KFK32338.1|  hypothetical protein AALP_AA6G228700                    276   1e-90    Arabis alpina [alpine rockcress]
sp|O65729.1|RL18_CICAR  RecName: Full=60S ribosomal protein L18         273   6e-90    Cicer arietinum [garbanzo]
emb|CEF99132.1|  Ribosomal protein L18e, conserved site                 272   2e-89    Ostreococcus tauri
ref|XP_001785869.1|  predicted protein                                  270   1e-88    
ref|XP_004290808.1|  PREDICTED: 60S ribosomal protein L18-2             270   2e-88    Fragaria vesca subsp. vesca
ref|XP_001690885.1|  ribosomal protein L18, component of cytosoli...    269   3e-88    Chlamydomonas reinhardtii
gb|KIZ05100.1|  60S ribosomal protein L18-3                             269   3e-88    Monoraphidium neglectum
sp|O22254.3|RL181_ARATH  RecName: Full=Putative 60S ribosomal pro...    269   3e-88    Arabidopsis thaliana [mouse-ear cress]
ref|XP_001419602.1|  Ribosomal protein L18, component of cytosoli...    269   4e-88    Ostreococcus lucimarinus CCE9901
ref|XP_001760959.1|  predicted protein                                  268   6e-88    
ref|XP_002948325.1|  component of cytosolic 80S ribosome and 60S ...    268   7e-88    Volvox carteri f. nagariensis
gb|KHG01788.1|  60S ribosomal L18-2 -like protein                       266   2e-87    Gossypium arboreum [tree cotton]
gb|AFC88843.1|  60S ribosomal protein L18-3-like protein                265   9e-87    Miscanthus sinensis
gb|EYU21621.1|  hypothetical protein MIMGU_mgv1a014504mg                265   9e-87    Erythranthe guttata [common monkey flower]
ref|XP_002985888.1|  hypothetical protein SELMODRAFT_181978             265   2e-86    Selaginella moellendorffii
ref|XP_002976425.1|  hypothetical protein SELMODRAFT_267976             265   2e-86    Selaginella moellendorffii
ref|XP_005843726.1|  hypothetical protein CHLNCDRAFT_37334              263   1e-85    Chlorella variabilis
ref|XP_007510670.1|  predicted protein                                  264   2e-85    Bathycoccus prasinos
gb|KJB26287.1|  hypothetical protein B456_004G239000                    260   3e-84    Gossypium raimondii
ref|XP_005643635.1|  ribosomal protein L18 component of cytosolic...    256   3e-83    Coccomyxa subellipsoidea C-169
ref|XP_009775352.1|  PREDICTED: 60S ribosomal protein L18-2             252   1e-81    Nicotiana sylvestris
ref|XP_011396696.1|  60S ribosomal protein L18-3                        253   1e-81    Auxenochlorella protothecoides
gb|ADD54595.1|  putative ribosomal protein L18                          251   1e-81    Linum usitatissimum
gb|KJB41868.1|  hypothetical protein B456_007G127300                    252   1e-81    Gossypium raimondii
gb|KJB45331.1|  hypothetical protein B456_007G301700                    252   3e-81    Gossypium raimondii
gb|KJB23304.1|  hypothetical protein B456_004G091200                    248   2e-80    Gossypium raimondii
ref|XP_006433452.1|  hypothetical protein CICLE_v10002597mg             245   5e-79    
ref|XP_010559184.1|  PREDICTED: 60S ribosomal protein L18-2-like        244   5e-79    Tarenaya hassleriana [spider flower]
dbj|BAJ93091.1|  predicted protein                                      245   2e-78    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003056676.1|  predicted protein                                  244   3e-78    Micromonas pusilla CCMP1545
gb|KDO39192.1|  hypothetical protein CISIN_1g030771mg                   238   2e-76    Citrus sinensis [apfelsine]
ref|XP_002506220.1|  ribosomal protein L18                              246   3e-76    Micromonas commoda
ref|XP_011255380.1|  PREDICTED: 60S ribosomal protein L18               238   5e-76    Camponotus floridanus
ref|XP_968042.1|  PREDICTED: 60S ribosomal protein L18                  237   1e-75    Tribolium castaneum [rust-red flour beetle]
ref|XP_011351685.1|  PREDICTED: 60S ribosomal protein L18               236   3e-75    Ooceraea biroi
ref|XP_003707499.1|  PREDICTED: 60S ribosomal protein L18-like          236   5e-75    
emb|CBK21900.2|  Ribosomal protein L18e                                 235   7e-75    Blastocystis hominis
ref|XP_001745439.1|  hypothetical protein                               234   1e-74    Monosiga brevicollis MX1
ref|XP_010277700.1|  PREDICTED: uncharacterized protein LOC104612082    244   1e-74    
ref|XP_006561192.1|  PREDICTED: 60S ribosomal protein L18-like          234   2e-74    Apis mellifera [bee]
ref|XP_003691391.1|  PREDICTED: 60S ribosomal protein L18-like          234   2e-74    Apis florea [dwarf honeybee]
ref|XP_006677675.1|  hypothetical protein BATDEDRAFT_87003              233   3e-74    Batrachochytrium dendrobatidis JAM81
gb|KFM61778.1|  60S ribosomal protein L18                               233   4e-74    Stegodyphus mimosarum
ref|XP_011497333.1|  PREDICTED: 60S ribosomal protein L18               233   7e-74    Ceratosolen solmsi marchali
ref|XP_011062886.1|  PREDICTED: 60S ribosomal protein L18               233   1e-73    Acromyrmex echinatior
emb|CBK22327.2|  unnamed protein product                                232   1e-73    Blastocystis hominis
ref|XP_011351645.1|  PREDICTED: 60S ribosomal protein L18-like          231   3e-73    Ooceraea biroi
gb|KDR14978.1|  60S ribosomal protein L18                               231   4e-73    Zootermopsis nevadensis
emb|CAJ17294.1|  ribosomal protein L18e                                 231   5e-73    Hister sp. APV-2005
ref|XP_008201914.1|  PREDICTED: 60S ribosomal protein L18               230   7e-73    Nasonia vitripennis
ref|XP_005312106.1|  PREDICTED: 60S ribosomal protein L18               230   7e-73    Chrysemys picta bellii
ref|XP_011135288.1|  PREDICTED: 60S ribosomal protein L18               229   1e-72    Harpegnathos saltator
gb|ELT99918.1|  hypothetical protein CAPTEDRAFT_159560                  229   1e-72    Capitella teleta
gb|KDD74971.1|  hypothetical protein H632_c955p1                        228   2e-72    Helicosporidium sp. ATCC 50920
ref|XP_005787945.1|  hypothetical protein EMIHUDRAFT_433854             229   2e-72    Emiliania huxleyi CCMP1516
gb|ABR23470.1|  60s ribosomal protein L18                               229   2e-72    Ornithodoros parkeri
ref|XP_008546759.1|  PREDICTED: 60S ribosomal protein L18               229   3e-72    Microplitis demolitor
ref|XP_006840598.1|  hypothetical protein AMTR_s00343p00015240          228   3e-72    
ref|XP_008843215.1|  PREDICTED: 60S ribosomal protein L18 isoform X2    228   5e-72    Nannospalax galili
ref|XP_002400316.1|  ribosomal protein L18, putative                    228   5e-72    Ixodes scapularis [blacklegged tick]
ref|XP_011313252.1|  PREDICTED: 60S ribosomal protein L18               228   6e-72    Fopius arisanus
sp|Q4PM04.1|RL18_IXOSC  RecName: Full=60S ribosomal protein L18         228   7e-72    Ixodes scapularis [blacklegged tick]
ref|XP_008843214.1|  PREDICTED: 60S ribosomal protein L18 isoform X1    228   7e-72    Nannospalax galili
ref|XP_011163555.1|  PREDICTED: LOW QUALITY PROTEIN: 60S ribosoma...    229   7e-72    
ref|XP_005336693.1|  PREDICTED: 60S ribosomal protein L18               228   7e-72    
ref|XP_004061142.1|  PREDICTED: 60S ribosomal protein L18               228   8e-72    
gb|EFZ15690.1|  hypothetical protein SINV_04174                         227   9e-72    
gb|EFN87206.1|  60S ribosomal protein L18                               227   1e-71    Harpegnathos saltator
ref|NP_112364.1|  60S ribosomal protein L18                             227   1e-71    Rattus norvegicus [brown rat]
emb|CBJ25909.1|  cytoplasmic ribosomal protein L18                      227   2e-71    Ectocarpus siliculosus
ref|XP_003393579.1|  PREDICTED: hypothetical protein LOC100643724       234   2e-71    
gb|ABW23172.1|  ribosomal protein rpl18                                 226   2e-71    Arenicola marina [rock worm]
ref|XP_003801570.1|  PREDICTED: ribosomal protein L18-like              226   2e-71    Otolemur garnettii
sp|Q4GXG7.1|RL18_TIMBA  RecName: Full=60S ribosomal protein L18         226   3e-71    Timarcha balearica
gb|ABW90395.1|  putative ribosomal protein L18                          226   3e-71    Barentsia elongata
ref|XP_003485273.1|  PREDICTED: hypothetical protein LOC100746406       233   3e-71    
gb|AAN73382.1|  ribosomal protein L18                                   226   3e-71    Petromyzon marinus [marine lamprey]
ref|XP_008567503.1|  PREDICTED: 60S ribosomal protein L18               226   3e-71    Galeopterus variegatus [Malayan flying lemur]
gb|AAX48850.1|  L18                                                     226   4e-71    Suberites domuncula
ref|XP_006160253.1|  PREDICTED: 60S ribosomal protein L18               226   4e-71    Tupaia chinensis
ref|XP_007074184.1|  PREDICTED: ribosomal protein L18-like              226   4e-71    Panthera tigris altaica
ref|XP_010385886.1|  PREDICTED: 60S ribosomal protein L18               225   5e-71    Rhinopithecus roxellana
ref|XP_004991895.1|  ribosomal protein l18                              225   6e-71    Salpingoeca rosetta
ref|XP_004089423.1|  PREDICTED: 60S ribosomal protein L18               225   6e-71    Nomascus leucogenys [White-cheeked Gibbon]
ref|XP_008547226.1|  PREDICTED: 60S ribosomal protein L18-like          225   6e-71    Microplitis demolitor
emb|CCQ18599.1|  60S ribosomal protein L18                              225   6e-71    Sycon ciliatum
ref|XP_008046837.1|  PREDICTED: 60S ribosomal protein L18 isoform X1    225   7e-71    Carlito syrichta
ref|NP_000970.1|  60S ribosomal protein L18 isoform 1                   225   7e-71    Homo sapiens [man]
ref|NP_001182442.1|  60S ribosomal protein L18                          225   9e-71    Equus caballus [domestic horse]
ref|XP_006229223.1|  PREDICTED: 60S ribosomal protein L18 isoform X1    225   9e-71    Rattus norvegicus [brown rat]
ref|XP_006868227.1|  PREDICTED: ribosomal protein L18-like              224   1e-70    Chrysochloris asiatica
ref|XP_004451162.1|  PREDICTED: ribosomal protein L18-like              224   1e-70    Dasypus novemcinctus
ref|XP_007536290.1|  PREDICTED: 60S ribosomal protein L18               224   1e-70    Erinaceus europaeus [common hedgehog]
ref|XP_004694311.1|  PREDICTED: 60S ribosomal protein L18               224   1e-70    Condylura cristata
gb|AFW77276.1|  hypothetical protein ZEAMMB73_917876                    223   1e-70    
dbj|BAN21088.1|  ribosomal protein L18                                  224   1e-70    Riptortus pedestris
ref|XP_006109734.1|  PREDICTED: LOW QUALITY PROTEIN: ribosomal pr...    224   2e-70    
ref|XP_010366954.1|  PREDICTED: 60S ribosomal protein L18               224   2e-70    
ref|NP_001011030.1|  60S ribosomal protein L18                          224   2e-70    
emb|CBK22442.2|  unnamed protein product                                224   2e-70    
gb|AAN73381.1|  ribosomal protein L18                                   223   3e-70    
ref|NP_001015556.1|  60S ribosomal protein L18                          223   3e-70    
gb|AAH21743.1|  Ribosomal protein L18                                   223   3e-70    
ref|XP_008152619.1|  PREDICTED: 60S ribosomal protein L18               223   4e-70    
ref|XP_003385450.1|  PREDICTED: 60S ribosomal protein L18-like          223   5e-70    
ref|XP_005822438.1|  large subunit ribosomal protein L18e, cytopl...    223   7e-70    
gb|EFB23978.1|  hypothetical protein PANDA_006316                       223   7e-70    
ref|XP_001640445.1|  predicted protein                                  223   7e-70    
ref|XP_005589842.1|  PREDICTED: uncharacterized LOC101867006 isof...    223   8e-70    
ref|NP_001082681.1|  60S ribosomal protein L18-A                        222   8e-70    
ref|XP_004271135.1|  PREDICTED: 60S ribosomal protein L18 isoform 1     222   8e-70    
ref|XP_002161036.1|  PREDICTED: 60S ribosomal protein L18-like          222   9e-70    
ref|XP_004345091.2|  ribosomal protein L18e                             222   1e-69    
ref|XP_006026818.1|  PREDICTED: 60S ribosomal protein L18               222   1e-69    
ref|XP_006266602.1|  PREDICTED: 60S ribosomal protein L18               224   1e-69    
ref|XP_003081305.1|  ribosomal protein L18 (ISS)                        221   1e-69    
sp|Q0PXY6.1|RL18_DIACI  RecName: Full=60S ribosomal protein L18         221   2e-69    
ref|XP_006894610.1|  PREDICTED: ribosomal protein L18-like              221   2e-69    
gb|ELR56635.1|  60S ribosomal protein L18                               221   2e-69    
gb|ESA23412.1|  hypothetical protein GLOINDRAFT_342179                  221   2e-69    
gb|KJE95959.1|  ribosomal protein L18e                                  222   2e-69    
gb|ACO51847.1|  60S ribosomal protein L18                               221   2e-69    
gb|EPZ37075.1|  60S ribosomal protein L18-2                             221   3e-69    
ref|XP_001082813.1|  PREDICTED: 60S ribosomal protein L18-like is...    221   3e-69    
ref|XP_001092745.1|  PREDICTED: 60S ribosomal protein L18-like          221   3e-69    
ref|XP_011372891.1|  PREDICTED: 60S ribosomal protein L18               221   3e-69    
ref|NP_001082683.1|  60S ribosomal protein L18-B                        221   3e-69    
ref|NP_001187045.1|  60S ribosomal protein L18                          221   4e-69    
ref|XP_009012591.1|  hypothetical protein HELRODRAFT_156470             221   4e-69    
ref|XP_010550998.1|  PREDICTED: 60S ribosomal protein L18-2-like ...    219   5e-69    
ref|XP_002595537.1|  hypothetical protein BRAFLDRAFT_275280             220   8e-69    
ref|XP_007550032.1|  PREDICTED: 60S ribosomal protein L18               219   1e-68    
gb|KJB82633.1|  hypothetical protein B456_013G206100                    218   1e-68    
ref|XP_004619784.1|  PREDICTED: 60S ribosomal protein L18               221   2e-68    
ref|XP_005561217.1|  PREDICTED: 60S ribosomal protein L18-like          219   2e-68    
sp|Q962Y8.1|RL18_SPOFR  RecName: Full=60S ribosomal protein L18         219   2e-68    
ref|XP_006138489.1|  PREDICTED: 60S ribosomal protein L18-like          219   2e-68    
gb|AGH70165.1|  60S ribosomal protein L18                               218   3e-68    
ref|XP_010883138.1|  PREDICTED: 60S ribosomal protein L18               218   3e-68    
sp|P02412.4|RL18B_XENLA  RecName: Full=60S ribosomal protein L18-...    218   3e-68    
gb|KJB22517.1|  hypothetical protein B456_004G052100                    216   4e-68    
gb|ABO26684.1|  ribosomal protein l18                                   218   4e-68    
gb|KJB23305.1|  hypothetical protein B456_004G091200                    216   5e-68    
gb|AEE61752.1|  unknown                                                 218   6e-68    
ref|XP_009834317.1|  hypothetical protein H257_09702                    217   8e-68    
ref|XP_005798872.1|  PREDICTED: 60S ribosomal protein L18-like          217   9e-68    
ref|XP_010786834.1|  PREDICTED: 60S ribosomal protein L18               217   9e-68    
ref|XP_008876054.1|  hypothetical protein H310_11242                    217   1e-67    
gb|ADV03016.1|  ribosomal protein L18                                   217   1e-67    
ref|XP_002733428.1|  PREDICTED: 60S ribosomal protein L18-like          217   1e-67    
ref|XP_004780465.1|  PREDICTED: ribosomal protein L18-like              217   1e-67    
ref|XP_011449585.1|  PREDICTED: 60S ribosomal protein L18-like          217   1e-67    
gb|EAW52359.1|  ribosomal protein L18, isoform CRA_b                    216   2e-67    
gb|ACD65168.1|  putative 60S ribosomal protein RPL18                    215   2e-67    
ref|XP_007722189.1|  large subunit ribosomal protein L18e               216   2e-67    
emb|CAB40827.1|  unnamed protein product                                216   2e-67    
gb|ADO33048.1|  ribosomal protein L18                                   216   2e-67    
gb|KCW85063.1|  hypothetical protein EUGRSUZ_B01908                     214   2e-67    
ref|XP_008607735.1|  60S ribosomal protein                              216   3e-67    
ref|XP_009036910.1|  hypothetical protein AURANDRAFT_37496              216   3e-67    
ref|XP_008429815.1|  PREDICTED: 60S ribosomal protein L18               216   3e-67    
ref|XP_002771969.1|  60S ribosomal protein L18, putative                216   3e-67    
ref|XP_003977661.1|  PREDICTED: 60S ribosomal protein L18-like          216   4e-67    
gb|EWM27599.1|  Ribosomal protein L18e/L15P                             216   4e-67    
ref|XP_002423194.1|  60S ribosomal protein L18, putative                215   4e-67    
sp|Q6F442.1|RL18_PLUXY  RecName: Full=60S ribosomal protein L18         215   5e-67    
gb|EHH30225.1|  hypothetical protein EGK_10844                          215   7e-67    
emb|CAA28689.1|  ribosomal protein L14                                  215   7e-67    
ref|NP_001003432.1|  60S ribosomal protein L18                          214   7e-67    
gb|EFX65754.1|  hypothetical protein DAPPUDRAFT_303528                  214   1e-66    
sp|A3F4S0.1|RL18_TAEAS  RecName: Full=60S ribosomal protein L18         214   1e-66    
dbj|BAM17683.1|  ribosomal protein L18                                  214   1e-66    
sp|P09897.2|RL18A_XENLA  RecName: Full=60S ribosomal protein L18-...    214   1e-66    
gb|EKC43150.1|  60S ribosomal protein L18                               214   1e-66    
ref|XP_755074.1|  60S ribosomal protein L18                             214   1e-66    
emb|CAX79061.1|  ribosomal protein L18                                  214   1e-66    
gb|AAW25981.1|  SJCHGC06655 protein                                     214   1e-66    
ref|XP_001260260.1|  60S ribosomal protein L18                          214   2e-66    
ref|XP_006903368.1|  PREDICTED: ribosomal protein L18-like              214   2e-66    
ref|XP_007067265.1|  PREDICTED: 60S ribosomal protein L18               214   2e-66    
dbj|BAM18933.1|  ribosomal protein L18                                  213   2e-66    
sp|Q56FG8.1|RL18_LYSTE  RecName: Full=60S ribosomal protein L18         214   2e-66    
gb|ACY95355.1|  ribosomal protein L18                                   213   2e-66    
ref|XP_009158973.1|  50S ribosomal protein L18e                         213   3e-66    
emb|CCD58684.1|  60S ribosomal protein L18, putative                    213   4e-66    
ref|XP_002130217.1|  PREDICTED: 60S ribosomal protein L18 isoform X1    213   4e-66    
ref|XP_004358287.1|  eukaryotic ribosomal protein L18, putative         213   4e-66    
gb|ABS57434.1|  ribosomal protein L18                                   213   4e-66    
ref|XP_007779084.1|  60S ribosomal protein L18-B                        213   4e-66    
gb|ADT80690.1|  ribosomal protein L18                                   213   5e-66    
emb|CAX72134.1|  ribosomal protein L18                                  213   5e-66    
ref|NP_001037217.1|  60S ribosomal protein L18                          212   6e-66    
gb|ELW47918.1|  60S ribosomal protein L18                               212   6e-66    
ref|XP_002109185.1|  expressed hypothetical protein                     212   7e-66    
emb|CAD91422.1|  ribosomal protein L18                                  212   7e-66    
emb|CDI96431.1|  60S ribosomal protein L18                              212   7e-66    
gb|AEE62646.1|  unknown                                                 213   8e-66    
ref|XP_001209532.1|  60S ribosomal protein L18                          211   1e-65    
emb|CDS17705.1|  60S ribosomal protein L18                              211   2e-65    
gb|EKG21215.1|  Ribosomal protein L18e                                  211   2e-65    
ref|XP_007833554.1|  60S ribosomal protein L18-B                        212   2e-65    
ref|XP_008085192.1|  Ribosomal proteins L15p and L18e                   211   2e-65    
ref|XP_004526749.1|  PREDICTED: 60S ribosomal protein L18-like          211   2e-65    
ref|NP_648091.1|  ribosomal protein L18, isoform A                      211   2e-65    
gb|ABZ04231.1|  ribosomal protein rpl18                                 211   2e-65    
ref|XP_005190752.1|  PREDICTED: 60S ribosomal protein L18               211   3e-65    
gb|EHH59750.1|  hypothetical protein EGM_09937                          211   3e-65    
gb|AAN73352.1|  ribosomal protein L18                                   209   3e-65    
ref|XP_007586342.1|  putative 60s ribosomal protein l18 protein         210   4e-65    
gb|AAS49555.1|  ribosomal protein L18                                   209   4e-65    
ref|XP_663404.1|  hypothetical protein AN5800.2                         210   5e-65    
ref|XP_002047296.1|  GJ13360                                            210   5e-65    
ref|XP_001267682.1|  60S ribosomal protein L18                          210   5e-65    
gb|KIN06517.1|  hypothetical protein OIDMADRAFT_24819                   210   5e-65    
ref|XP_002035667.1|  GM13785                                            210   6e-65    
gb|ETN74514.1|  eukaryotic ribosomal protein L18                        210   6e-65    
gb|EYC13586.1|  hypothetical protein Y032_0043g800                      210   6e-65    
ref|XP_001550924.1|  60S ribosomal protein L18                          209   7e-65    
emb|CDJ05472.1|  60S ribosomal protein L18                              209   8e-65    
gb|EPS29111.1|  hypothetical protein PDE_04060                          209   9e-65    
gb|EYE97298.1|  ribosomal protein L18e                                  210   9e-65    
ref|XP_002378206.1|  60S ribosomal protein L18                          209   1e-64    
ref|XP_002094010.1|  GE20435                                            209   1e-64    
ref|XP_011184309.1|  PREDICTED: 60S ribosomal protein L18               209   1e-64    
gb|KIW75160.1|  60S ribosomal protein L18-A                             209   1e-64    
gb|KIY03022.1|  60S ribosomal protein L18-A                             209   1e-64    
dbj|GAD98621.1|  60S ribosomal protein L18                              209   1e-64    
emb|CCU77907.1|  putative 60S ribosomal protein L18                     209   1e-64    
emb|CBN08626.1|  ribosomal protein L18                                  209   2e-64    
gb|KIW69267.1|  hypothetical protein PV04_05151                         209   2e-64    
gb|KIW89279.1|  60S ribosomal protein L18-A                             209   2e-64    
gb|KEF62683.1|  large subunit ribosomal protein L18e                    209   2e-64    
ref|XP_006157526.1|  PREDICTED: 60S ribosomal protein L18-like          210   2e-64    
emb|CEI89354.1|  Putative 60S ribosomal protein L18-A                   209   2e-64    
gb|ABD77159.1|  ribosomal protein L18                                   207   2e-64    
emb|CEG66137.1|  Putative 60S ribosomal protein L18-A                   208   2e-64    
ref|XP_003225100.1|  PREDICTED: 60S ribosomal protein L18               208   3e-64    
emb|CEJ01696.1|  Putative 50S ribosomal protein L18e                    208   3e-64    
ref|XP_003177852.1|  60S ribosomal protein L18                          208   3e-64    
gb|EJD73862.1|  hypothetical protein, variant                           208   4e-64    
ref|XP_002722941.1|  PREDICTED: 60S ribosomal protein L18               207   4e-64    
ref|XP_001971483.1|  GG14989                                            207   4e-64    
ref|XP_009176548.1|  hypothetical protein T265_11593                    207   5e-64    
ref|XP_006735598.1|  PREDICTED: ribosomal protein L18-like              210   5e-64    
ref|XP_003022831.1|  hypothetical protein TRV_03055                     207   5e-64    
gb|KIJ70376.1|  hypothetical protein HYDPIDRAFT_143674                  207   5e-64    
gb|EGD98734.1|  60S ribosomal protein L18                               207   5e-64    
ref|XP_008714847.1|  hypothetical protein HMPREF1541_02269              207   5e-64    
ref|XP_002371723.1|  60S ribosomal protein L18, putative                207   5e-64    
gb|KIV82136.1|  60S ribosomal protein L18-A                             207   5e-64    
gb|KIW11507.1|  60S ribosomal protein L18-A                             207   5e-64    
ref|XP_006754858.1|  PREDICTED: 60S ribosomal protein L18-like          207   5e-64    
ref|XP_001588139.1|  60S ribosomal protein L18                          207   6e-64    
gb|KIH62739.1|  eukaryotic ribosomal protein L18                        207   7e-64    
gb|KIL00482.1|  hypothetical protein PAXRUDRAFT_821678                  207   8e-64    
ref|XP_008727056.1|  hypothetical protein G647_04492                    207   8e-64    
gb|EGU80235.1|  hypothetical protein FOXB_09162                         207   8e-64    
gb|KIX00906.1|  60S ribosomal protein L18-A                             207   1e-63    
gb|KIW61527.1|  hypothetical protein PV05_01638                         207   1e-63    
ref|XP_003465581.1|  PREDICTED: 60S ribosomal protein L18               207   1e-63    
gb|KIW28110.1|  60S ribosomal protein L18-A                             207   1e-63    
ref|XP_008888411.1|  ribosomal protein RPL18                            206   1e-63    
gb|KHJ35313.1|  putative 60s ribosomal protein l18                      206   1e-63    
ref|XP_007756404.1|  60S ribosomal protein L18-B                        206   1e-63    
ref|XP_007804599.1|  hypothetical protein EPUS_07572                    216   1e-63    
gb|ABD77169.1|  ribosomal protein L18                                   206   1e-63    
gb|ABD77165.1|  ribosomal protein L18                                   206   2e-63    
ref|XP_003011118.1|  hypothetical protein ARB_02640                     206   2e-63    
ref|XP_005715661.1|  unnamed protein product                            206   2e-63    
gb|ABD77157.1|  ribosomal protein L18                                   205   2e-63    
ref|XP_006298641.1|  hypothetical protein CARUB_v10014730mg             204   2e-63    
dbj|BAE65378.1|  unnamed protein product                                207   2e-63    
ref|XP_007742086.1|  large subunit ribosomal protein L18e               206   2e-63    
ref|XP_008250645.1|  PREDICTED: 60S ribosomal protein L18               206   2e-63    
gb|ELR09673.1|  hypothetical protein GMDG_04159                         207   2e-63    
gb|KIO03112.1|  hypothetical protein M404DRAFT_15806                    206   2e-63    
gb|EFQ34059.1|  eukaryotic ribosomal protein L18                        206   3e-63    
ref|XP_004597070.1|  PREDICTED: 60S ribosomal protein L18               206   3e-63    
gb|KIW43484.1|  60S ribosomal protein L18-B                             207   3e-63    
dbj|GAA55611.1|  large subunit ribosomal protein L18e                   207   3e-63    
ref|XP_004672329.1|  PREDICTED: 60S ribosomal protein L18               206   3e-63    
gb|KIK20716.1|  hypothetical protein PISMIDRAFT_576002                  205   3e-63    
gb|KDN61013.1|  putative eukaryotic ribosomal protein L18               205   4e-63    
emb|CEP17694.1|  hypothetical protein                                   205   4e-63    
ref|NP_033103.2|  60S ribosomal protein L18                             205   4e-63    
gb|ABD77175.1|  ribosomal protein L18                                   204   4e-63    
gb|EFO21820.2|  hypothetical protein LOAG_06664                         206   5e-63    
ref|XP_001897286.1|  60S ribosomal protein L18                          205   5e-63    
ref|XP_007423078.1|  PREDICTED: 60S ribosomal protein L18               205   5e-63    
gb|ETE73081.1|  60S ribosomal protein L18                               205   6e-63    
gb|ABD77172.1|  ribosomal protein L18                                   204   6e-63    
ref|XP_003235591.1|  60S ribosomal protein L18                          205   6e-63    
ref|XP_009519518.1|  hypothetical protein PHYSODRAFT_284882             205   6e-63    
gb|EMR82472.1|  putative 60s ribosomal protein l18 protein              205   6e-63    
ref|XP_007797810.1|  putative 60s ribosomal protein l18 protein         204   7e-63    
ref|XP_007879935.1|  hypothetical protein PFL1_04221                    205   7e-63    
ref|XP_005084756.1|  PREDICTED: 60S ribosomal protein L18 isoform X1    204   7e-63    
ref|XP_005587036.1|  PREDICTED: 60S ribosomal protein L18-like          204   8e-63    
ref|XP_005704346.1|  60S ribosomal protein L18e                         204   8e-63    
ref|XP_004888751.1|  PREDICTED: 60S ribosomal protein L18               204   8e-63    
gb|ACR35483.1|  unknown                                                 202   9e-63    
ref|XP_007143771.1|  hypothetical protein PHAVU_007G100200g             203   9e-63    
emb|CCI45423.1|  unnamed protein product                                205   1e-62    
gb|ABD77171.1|  ribosomal protein L18                                   203   1e-62    
ref|XP_003766518.1|  PREDICTED: 60S ribosomal protein L18               204   1e-62    
dbj|BAB24923.1|  unnamed protein product                                204   1e-62    
gb|EJW88057.1|  50S ribosomal protein L18                               204   1e-62    
gb|ABD77168.1|  ribosomal protein L18                                   203   1e-62    
ref|XP_002762404.2|  PREDICTED: 60S ribosomal protein L18               204   1e-62    
ref|XP_003886070.1|  Ribosomal protein L18, related                     204   1e-62    
gb|KIV96156.1|  60S ribosomal protein L18-B                             204   2e-62    
emb|CCT68782.1|  probable ribosomal protein L18, cytosolic              205   2e-62    
ref|XP_008891573.1|  hypothetical protein PPTG_02269                    204   2e-62    
gb|ACO15258.1|  60S ribosomal protein L18                               203   2e-62    
ref|XP_005366833.1|  PREDICTED: 60S ribosomal protein L18               203   2e-62    
emb|CDJ88312.1|  Ribosomal protein L18e domain containing protein       203   2e-62    
ref|XP_010455078.1|  PREDICTED: 60S ribosomal protein L18-2-like ...    201   2e-62    



>ref|XP_009625475.1| PREDICTED: 60S ribosomal protein L18-2-like [Nicotiana tomentosiformis]
Length=187

 Score =   323 bits (828),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 157/168 (93%), Positives = 165/168 (98%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDLKAGGKSK+TKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLSLSRLIS+  GKEDKIAV+VGTITDDVRAY+VP LKVCAL+FTKTARARIEKAGGECL
Sbjct  61   PLSLSRLISYAKGKEDKIAVIVGTITDDVRAYDVPTLKVCALKFTKTARARIEKAGGECL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLALRAPLGQNT+LLRGPKN+REAVKHFGPAPGVPHSHTKPYVR+
Sbjct  121  TFDQLALRAPLGQNTLLLRGPKNAREAVKHFGPAPGVPHSHTKPYVRS  168



>ref|XP_009783807.1| PREDICTED: 60S ribosomal protein L18-2-like [Nicotiana sylvestris]
Length=187

 Score =   323 bits (827),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 156/168 (93%), Positives = 165/168 (98%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDLKAGGK+K+TKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP
Sbjct  1    MGIDLKAGGKNKKTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLSLSRLIS+T GKEDKIAV+VG++TDDVRAYEVP L VCALRFTKTARARIEKAGGECL
Sbjct  61   PLSLSRLISYTKGKEDKIAVIVGSVTDDVRAYEVPTLMVCALRFTKTARARIEKAGGECL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLALRAPLGQNTVLLRGPKN+REAV+HFGPAPGVPHSHTKPYVR+
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNAREAVRHFGPAPGVPHSHTKPYVRS  168



>ref|XP_009629074.1| PREDICTED: 60S ribosomal protein L18-2 [Nicotiana tomentosiformis]
 ref|XP_009788537.1| PREDICTED: 60S ribosomal protein L18-2 [Nicotiana sylvestris]
Length=187

 Score =   322 bits (824),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 156/168 (93%), Positives = 164/168 (98%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDLKAGGKSK+TKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK NKP
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKINKP  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLSLSRLIS+  GKEDK+ V+VGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL
Sbjct  61   PLSLSRLISYAKGKEDKVVVIVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLALRAPLGQNT+LLRGPKN+REAVKHFGPAPGVPHSHTKP+VR+
Sbjct  121  TFDQLALRAPLGQNTLLLRGPKNAREAVKHFGPAPGVPHSHTKPFVRS  168



>gb|KDP28183.1| hypothetical protein JCGZ_13954 [Jatropha curcas]
Length=187

 Score =   321 bits (823),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 156/168 (93%), Positives = 164/168 (98%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDLKAGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK NKP
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKINKP  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLSLSRLISFT GKEDKIAV+VGT+TDD+R YEVPALKV ALRFT+TARARIEKAGGECL
Sbjct  61   PLSLSRLISFTKGKEDKIAVVVGTVTDDIRVYEVPALKVTALRFTETARARIEKAGGECL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPAPGVPHSHTKPYVR+
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPAPGVPHSHTKPYVRS  168



>ref|XP_009630920.1| PREDICTED: 60S ribosomal protein L18-2-like [Nicotiana tomentosiformis]
Length=187

 Score =   321 bits (823),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 155/168 (92%), Positives = 164/168 (98%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDLKAGGK+K+TKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFN VILKRLFMSKTNKP
Sbjct  1    MGIDLKAGGKNKKTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNTVILKRLFMSKTNKP  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLSLSRLIS+T GKEDKIAV+VG++TDDVRAYEVP L VCALRFTKTARARIEKAGGECL
Sbjct  61   PLSLSRLISYTKGKEDKIAVIVGSVTDDVRAYEVPTLMVCALRFTKTARARIEKAGGECL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLALRAPLGQNTVLLRGPKN+REAV+HFGPAPGVPHSHTKPYVR+
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNAREAVRHFGPAPGVPHSHTKPYVRS  168



>ref|XP_009772706.1| PREDICTED: 60S ribosomal protein L18-2-like [Nicotiana sylvestris]
 ref|XP_009772708.1| PREDICTED: 60S ribosomal protein L18-2-like [Nicotiana sylvestris]
Length=187

 Score =   319 bits (818),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 156/168 (93%), Positives = 163/168 (97%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDLKAGGKSK+TKRTAPKSDDVYLKLLVKLYRFLVRRTG KFNAVILKRLFMSKTNKP
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSDDVYLKLLVKLYRFLVRRTGCKFNAVILKRLFMSKTNKP  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLSLSRLIS+  GKE KIAV+VGTITDDVRAY+VP LKVCALRFTKTARARIEKAGGECL
Sbjct  61   PLSLSRLISYAKGKEGKIAVIVGTITDDVRAYDVPTLKVCALRFTKTARARIEKAGGECL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLALRAPLGQNT+LLRGPKN+REAVKHFGPAPGVPHSHTKPYVR+
Sbjct  121  TFDQLALRAPLGQNTLLLRGPKNAREAVKHFGPAPGVPHSHTKPYVRS  168



>ref|XP_002301485.1| 60S ribosomal protein L18 [Populus trichocarpa]
 gb|EEE80758.1| 60S ribosomal protein L18 [Populus trichocarpa]
Length=187

 Score =   319 bits (817),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 154/168 (92%), Positives = 163/168 (97%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDLKAGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK NKP
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKINKP  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLSLSRLI+F  GKEDKIAV+VGTITDD+R YEVPALKV ALRFT+TARARIEKAGGECL
Sbjct  61   PLSLSRLITFMKGKEDKIAVVVGTITDDIRVYEVPALKVTALRFTETARARIEKAGGECL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPAPGVPHSHTKPY+R+
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPAPGVPHSHTKPYIRS  168



>ref|XP_009796134.1| PREDICTED: 60S ribosomal protein L18-2-like [Nicotiana sylvestris]
Length=187

 Score =   317 bits (812),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 153/168 (91%), Positives = 162/168 (96%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDLKAGGKSK+TKRTAPKSDDVYLKL+VKLYRFLV+RTGSKFN VILK LFMSKTNKP
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSDDVYLKLIVKLYRFLVQRTGSKFNTVILKWLFMSKTNKP  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLSLSRLIS+  GKEDKI V+VGTITDDVRAY+VP LKVCALRFTKTARARIEKAGGECL
Sbjct  61   PLSLSRLISYAKGKEDKIVVIVGTITDDVRAYDVPTLKVCALRFTKTARARIEKAGGECL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLALRAPLGQNT+LLRGPKN+REAVKHFGPAPGVPHSHTKPYVR+
Sbjct  121  TFDQLALRAPLGQNTILLRGPKNAREAVKHFGPAPGVPHSHTKPYVRS  168



>ref|NP_001237789.1| uncharacterized protein LOC100500164 [Glycine max]
 gb|ACU15099.1| unknown [Glycine max]
 gb|KHN16096.1| 60S ribosomal protein L18-2 [Glycine soja]
Length=187

 Score =   317 bits (812),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 154/168 (92%), Positives = 162/168 (96%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDLKAGGKSK+TKRTAPKS+D+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK NKP
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSNDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKVNKP  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLSLSRLI +T GKEDKIAV+VG ITDD+R YEVPALKV ALRFT+TARARIEKAGGECL
Sbjct  61   PLSLSRLIKYTKGKEDKIAVVVGNITDDIRVYEVPALKVTALRFTETARARIEKAGGECL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPAPGVPHSHTKPYVRA
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPAPGVPHSHTKPYVRA  168



>gb|KJB45330.1| hypothetical protein B456_007G301700 [Gossypium raimondii]
Length=187

 Score =   317 bits (812),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 154/168 (92%), Positives = 161/168 (96%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK NKP
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKVNKP  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLSLSRLI F  GKEDKIAV+VGT+TDD+R YEVPALKV ALRFT+TARARIEKAGGECL
Sbjct  61   PLSLSRLIEFMKGKEDKIAVVVGTVTDDIRVYEVPALKVTALRFTETARARIEKAGGECL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVR+
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRS  168



>gb|KJB41867.1| hypothetical protein B456_007G127300 [Gossypium raimondii]
Length=187

 Score =   317 bits (811),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 154/168 (92%), Positives = 161/168 (96%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLSLSRLI F  GKEDKIAV+VG +TDD+R YEVPALKV ALRFT+TARARIEKAGGECL
Sbjct  61   PLSLSRLIQFMKGKEDKIAVVVGAVTDDIRVYEVPALKVTALRFTETARARIEKAGGECL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPAPGVPHSHTKPYVRA
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPAPGVPHSHTKPYVRA  168



>ref|XP_010025256.1| PREDICTED: 60S ribosomal protein L18-2 [Eucalyptus grandis]
 gb|KCW61872.1| hypothetical protein EUGRSUZ_H04551 [Eucalyptus grandis]
Length=187

 Score =   317 bits (811),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 153/168 (91%), Positives = 163/168 (97%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDLKAGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRTGSKFNAV+LKRLFMSK NKP
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTGSKFNAVVLKRLFMSKVNKP  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLSLSRLI +T GKEDKIAV+VGTITDD+R +EVPALKV ALRFT+TARARIEKAGGECL
Sbjct  61   PLSLSRLIRYTQGKEDKIAVVVGTITDDIRVHEVPALKVTALRFTETARARIEKAGGECL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPAPGVPHSHTKPYVR+
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPAPGVPHSHTKPYVRS  168



>ref|XP_011042004.1| PREDICTED: 60S ribosomal protein L18-2-like [Populus euphratica]
Length=187

 Score =   316 bits (809),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 152/168 (90%), Positives = 163/168 (97%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDLKAGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLSLSRLI++  GKE KIAV+VGTITDD+R YEVPA+KV ALRFT+TARARIEKAGGECL
Sbjct  61   PLSLSRLITYMKGKEGKIAVVVGTITDDIRVYEVPAIKVTALRFTETARARIEKAGGECL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPAPGVPHSHTKPY+R+
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPAPGVPHSHTKPYIRS  168



>ref|XP_002523106.1| 60S ribosomal protein L18, putative [Ricinus communis]
 gb|EEF39291.1| 60S ribosomal protein L18, putative [Ricinus communis]
Length=187

 Score =   316 bits (809),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 153/168 (91%), Positives = 162/168 (96%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDLKAGGKSK+TKRTAPKSDD+YLKL+VKLYRFLVRRTGSKFNAVILKRLFMSK NK 
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSDDIYLKLIVKLYRFLVRRTGSKFNAVILKRLFMSKINKA  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLSLSRLI+F  GKE+KIAV+VGT+TDDVR YEVPALKV ALRFT+TARARIEKAGGECL
Sbjct  61   PLSLSRLITFMKGKENKIAVIVGTVTDDVRVYEVPALKVTALRFTETARARIEKAGGECL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPAPGVPHSHTKPYVRA
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPAPGVPHSHTKPYVRA  168



>ref|XP_010313195.1| PREDICTED: 60S ribosomal protein L18-2-like [Solanum lycopersicum]
Length=187

 Score =   315 bits (808),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 154/168 (92%), Positives = 160/168 (95%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDLKAGGKSK+TKRTAPKSDDVYLKLLVKLYRFL RRTGSKFNAVILKRLFMSK NKP
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSDDVYLKLLVKLYRFLARRTGSKFNAVILKRLFMSKINKP  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLSLSRLIS+  GK DK  VLVGT+TDDVRAYEVP LKVCAL+FTKTARARIEKAGGECL
Sbjct  61   PLSLSRLISYAEGKGDKTVVLVGTVTDDVRAYEVPKLKVCALKFTKTARARIEKAGGECL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLALRAPLGQNT+LLRGPKN+REAVKHFGPAPGVPHSHTKPYVRA
Sbjct  121  TFDQLALRAPLGQNTLLLRGPKNAREAVKHFGPAPGVPHSHTKPYVRA  168



>ref|XP_002320999.1| 60S ribosomal protein L18 [Populus trichocarpa]
 gb|ABK93820.1| unknown [Populus trichocarpa]
 gb|EEE99314.1| 60S ribosomal protein L18 [Populus trichocarpa]
Length=187

 Score =   315 bits (808),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 152/168 (90%), Positives = 163/168 (97%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDLKAGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PL+LSRLI++  GKE KIAV+VGTITDD+R YEVPALKV ALRFT+TARARIEKAGGECL
Sbjct  61   PLALSRLITYMKGKEGKIAVVVGTITDDIRVYEVPALKVTALRFTETARARIEKAGGECL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPAPGVPHSHTKPY+R+
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPAPGVPHSHTKPYIRS  168



>ref|XP_006344694.1| PREDICTED: 60S ribosomal protein L18-2-like [Solanum tuberosum]
Length=187

 Score =   315 bits (808),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 154/168 (92%), Positives = 160/168 (95%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDLKAGGKSK+TKRTAPKSDDVYLKLLVKLYRFL RRTGSKFNAVILKRLFMSK NKP
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSDDVYLKLLVKLYRFLARRTGSKFNAVILKRLFMSKINKP  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLSLSRLIS+  GK DK  VLVGT+TDDVRAYEVP LKVCAL+FTKTARARIEKAGGECL
Sbjct  61   PLSLSRLISYAEGKGDKTVVLVGTVTDDVRAYEVPKLKVCALKFTKTARARIEKAGGECL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLALRAPLGQNT+LLRGPKN+REAVKHFGPAPGVPHSHTKPYVRA
Sbjct  121  TFDQLALRAPLGQNTLLLRGPKNAREAVKHFGPAPGVPHSHTKPYVRA  168



>gb|KHN43503.1| 60S ribosomal protein L18-2 [Glycine soja]
Length=187

 Score =   315 bits (807),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 152/168 (90%), Positives = 161/168 (96%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDLKAGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRTGS FNAV+LKRLFMSK NKP
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTGSNFNAVVLKRLFMSKVNKP  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLSLSRLI +T GKEDKIAV+VG +TDD+R YEVPALKV ALRFT+TARARIEKAGGECL
Sbjct  61   PLSLSRLIRYTKGKEDKIAVVVGAVTDDIRVYEVPALKVTALRFTETARARIEKAGGECL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPAPGVPHSHTKPYVRA
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPAPGVPHSHTKPYVRA  168



>ref|NP_001236701.1| uncharacterized protein LOC100306301 [Glycine max]
 gb|ACU14418.1| unknown [Glycine max]
Length=187

 Score =   315 bits (807),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 152/168 (90%), Positives = 161/168 (96%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDLKAGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRTGS FNAV+LKRLFMSK NKP
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTGSNFNAVVLKRLFMSKVNKP  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLSLSRLI +T GKEDKIAV+VG +TDD+R YEVPALKV ALRFT+TARARIEKAGGECL
Sbjct  61   PLSLSRLIRYTKGKEDKIAVVVGAVTDDIRVYEVPALKVTALRFTETARARIEKAGGECL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPAPGVPHSHTKPYVRA
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPAPGVPHSHTKPYVRA  168



>gb|KJB82632.1| hypothetical protein B456_013G206100 [Gossypium raimondii]
Length=187

 Score =   315 bits (806),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 152/168 (90%), Positives = 161/168 (96%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK+TKRTAPKSDD+YLKLLVK+YRFLVRRTGSKFNAVILKRLFMSK NKP
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSDDIYLKLLVKIYRFLVRRTGSKFNAVILKRLFMSKVNKP  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLSLSRLI F  GKEDKIAV+VGT+TDD+R YEVPALKV ALRFT+TARARIEKAGGECL
Sbjct  61   PLSLSRLIEFMKGKEDKIAVVVGTVTDDIRVYEVPALKVTALRFTETARARIEKAGGECL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPAPGVPHSHTKPYVR+
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPAPGVPHSHTKPYVRS  168



>ref|XP_007031040.1| Ribosomal protein L18 [Theobroma cacao]
 gb|EOY11542.1| Ribosomal protein L18 [Theobroma cacao]
Length=187

 Score =   314 bits (805),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 152/168 (90%), Positives = 161/168 (96%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK++KRTAPKSDD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK NKP
Sbjct  1    MGIDLVAGGKSKKSKRTAPKSDDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKVNKP  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLSLSRLI F  GKEDKIAV+VGT+TDD+R YEVPALKV ALRFT+TARARIEKAGGECL
Sbjct  61   PLSLSRLIEFMKGKEDKIAVVVGTVTDDIRVYEVPALKVTALRFTETARARIEKAGGECL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPAPGVPHSHTKPYVR+
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPAPGVPHSHTKPYVRS  168



>gb|KHF98574.1| 60S ribosomal L18-2 -like protein [Gossypium arboreum]
 gb|KJB22518.1| hypothetical protein B456_004G052100 [Gossypium raimondii]
Length=187

 Score =   314 bits (805),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 152/168 (90%), Positives = 161/168 (96%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK NKP
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKVNKP  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLSLSRLI +  GKEDKIAV+VGT+TDD+R YEVPALKV ALRFT+TARARIEKAGGECL
Sbjct  61   PLSLSRLIQYMKGKEDKIAVVVGTVTDDIRVYEVPALKVTALRFTETARARIEKAGGECL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPAPGVPHSHTKPYVR+
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPAPGVPHSHTKPYVRS  168



>gb|KJB41866.1| hypothetical protein B456_007G127300, partial [Gossypium raimondii]
Length=227

 Score =   315 bits (808),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 153/167 (92%), Positives = 160/167 (96%), Gaps = 0/167 (0%)
 Frame = +3

Query  93   GIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPP  272
            GIDL AGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPP
Sbjct  42   GIDLVAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPP  101

Query  273  LSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLT  452
            LSLSRLI F  GKEDKIAV+VG +TDD+R YEVPALKV ALRFT+TARARIEKAGGECLT
Sbjct  102  LSLSRLIQFMKGKEDKIAVVVGAVTDDIRVYEVPALKVTALRFTETARARIEKAGGECLT  161

Query  453  FDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            FDQLALRAPLGQNTVLLRGPKN+REAVKHFGPAPGVPHSHTKPYVRA
Sbjct  162  FDQLALRAPLGQNTVLLRGPKNAREAVKHFGPAPGVPHSHTKPYVRA  208



>gb|KHN20393.1| 60S ribosomal protein L18-2 [Glycine soja]
Length=274

 Score =   317 bits (812),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 152/168 (90%), Positives = 161/168 (96%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDLKAGGKSK+TKRTAPKS+D+YLKLLVKLYRFLVRRTGS FNAVILKRLFMSK NKP
Sbjct  88   MGIDLKAGGKSKKTKRTAPKSNDIYLKLLVKLYRFLVRRTGSNFNAVILKRLFMSKVNKP  147

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLSLSRLI +T GKEDKIAV+VG +TDD+R YEVPALKV ALRFT+TARARIEKAGGECL
Sbjct  148  PLSLSRLIRYTKGKEDKIAVVVGAVTDDIRVYEVPALKVTALRFTETARARIEKAGGECL  207

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPAPGVPHSHTKPYVRA
Sbjct  208  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPAPGVPHSHTKPYVRA  255



>ref|XP_006382454.1| 60S ribosomal protein L18 [Populus trichocarpa]
 gb|ABK93398.1| unknown [Populus trichocarpa]
 gb|ABK93783.1| unknown [Populus trichocarpa]
 gb|ERP60251.1| 60S ribosomal protein L18 [Populus trichocarpa]
Length=187

 Score =   313 bits (803),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 152/168 (90%), Positives = 161/168 (96%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDLK GGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRTGS+FNAVILKRLFMSK NK 
Sbjct  1    MGIDLKRGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTGSRFNAVILKRLFMSKINKA  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLSLSRLI+F  GKEDKIAVLVGT+TDD+R YEVPALKV ALRFT+TARARIEKAGGECL
Sbjct  61   PLSLSRLITFMKGKEDKIAVLVGTVTDDIRVYEVPALKVTALRFTETARARIEKAGGECL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPAPGVPHSHTKP+VRA
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPAPGVPHSHTKPFVRA  168



>ref|XP_011036896.1| PREDICTED: 60S ribosomal protein L18-2 [Populus euphratica]
Length=187

 Score =   313 bits (803),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 152/168 (90%), Positives = 161/168 (96%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDLK GGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRTGS+FNAVILKRLFMSK NK 
Sbjct  1    MGIDLKRGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTGSRFNAVILKRLFMSKINKA  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLSLSRLI+F  GKEDKIAVLVGT+TDD+R YEVPALKV ALRFT+TARARIEKAGGECL
Sbjct  61   PLSLSRLITFMKGKEDKIAVLVGTVTDDIRVYEVPALKVTALRFTETARARIEKAGGECL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPAPGVPHSHTKP+VRA
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPAPGVPHSHTKPFVRA  168



>gb|KJB23303.1| hypothetical protein B456_004G091200 [Gossypium raimondii]
Length=187

 Score =   313 bits (803),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 151/168 (90%), Positives = 161/168 (96%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK+TKRTAPKSDD+YLKL+VKLYRFLVRRTGSKFNAVILKRLFMSK NKP
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSDDIYLKLIVKLYRFLVRRTGSKFNAVILKRLFMSKVNKP  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLSLSRLI F  GKEDKIAV+VGT+TDD+R YEVPALKV ALRFT+TARARI+KAGGECL
Sbjct  61   PLSLSRLIEFMKGKEDKIAVVVGTVTDDIRVYEVPALKVTALRFTETARARIDKAGGECL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPAPGVPHSHTKPYVR+
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPAPGVPHSHTKPYVRS  168



>ref|XP_003556523.1| PREDICTED: 60S ribosomal protein L18-2-like [Glycine max]
Length=187

 Score =   313 bits (802),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 152/168 (90%), Positives = 161/168 (96%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDLKAGGKSK+TKRTAPKS+D+YLKLLVKLYRFLVRRTGS FNAVILKRLFMSK NKP
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSNDIYLKLLVKLYRFLVRRTGSNFNAVILKRLFMSKVNKP  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLSLSRLI +T GKEDKIAV+VG+ITDD+R YEVP LKV ALRFT+TARARIEKAGGECL
Sbjct  61   PLSLSRLIKYTKGKEDKIAVVVGSITDDIRVYEVPPLKVTALRFTETARARIEKAGGECL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPAPGVPHSHTKPYVRA
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPAPGVPHSHTKPYVRA  168



>ref|XP_007163123.1| hypothetical protein PHAVU_001G208200g [Phaseolus vulgaris]
 gb|ESW35117.1| hypothetical protein PHAVU_001G208200g [Phaseolus vulgaris]
Length=187

 Score =   313 bits (802),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 151/168 (90%), Positives = 161/168 (96%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDLKAGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRTGS FNAVILKRLFMSK NKP
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTGSNFNAVILKRLFMSKVNKP  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLSLSRLI +T GKE+KIAV+VG +TDD+R YEVPALKV ALRFT+TARARIEKAGGECL
Sbjct  61   PLSLSRLIRYTKGKENKIAVVVGAVTDDIRVYEVPALKVTALRFTETARARIEKAGGECL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPAPGVPHSH+KPYVRA
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPAPGVPHSHSKPYVRA  168



>gb|KDP23459.1| hypothetical protein JCGZ_23292 [Jatropha curcas]
Length=187

 Score =   313 bits (801),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 152/168 (90%), Positives = 160/168 (95%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDLKAGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK NK 
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKVNKT  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLSLSRLI F  GKE KIAV+VGT+TDD+R YEVPALKV ALRFT+TARARIEKAGGECL
Sbjct  61   PLSLSRLIRFMKGKESKIAVVVGTVTDDIRVYEVPALKVTALRFTETARARIEKAGGECL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPAPGVPHSHTKPYVR+
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPAPGVPHSHTKPYVRS  168



>ref|NP_001236071.1| uncharacterized protein LOC100499789 [Glycine max]
 gb|ACU13660.1| unknown [Glycine max]
Length=187

 Score =   312 bits (800),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 151/168 (90%), Positives = 160/168 (95%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDLKAGGKSK+TKRTAPKS+D+YLKLLVKLYRFLVRRTGS FNAVILKRLFMSK NKP
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSNDIYLKLLVKLYRFLVRRTGSNFNAVILKRLFMSKVNKP  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLSLSRLI +  GKEDKIAV+VG +TDD+R YEVPALKV ALRFT+TARARIEKAGGECL
Sbjct  61   PLSLSRLIRYAKGKEDKIAVVVGAVTDDIRVYEVPALKVTALRFTETARARIEKAGGECL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPAPGVPHSHTKPYVRA
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPAPGVPHSHTKPYVRA  168



>gb|KHG07157.1| 60S ribosomal L18-2 -like protein [Gossypium arboreum]
Length=207

 Score =   313 bits (802),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 151/168 (90%), Positives = 160/168 (95%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK+TKRTAPKSDD+YLKL+VKLYRFLVRRTGSKFNAVILKRLFM K NKP
Sbjct  21   MGIDLVAGGKSKKTKRTAPKSDDIYLKLIVKLYRFLVRRTGSKFNAVILKRLFMCKVNKP  80

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLSLSRLI F  GKEDKIAV+VGT+TDD+R YEVPALKV ALRFTKTARARI+KAGGECL
Sbjct  81   PLSLSRLIEFMKGKEDKIAVVVGTVTDDIRIYEVPALKVTALRFTKTARARIDKAGGECL  140

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPAPGVPHSHTKPYVR+
Sbjct  141  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPAPGVPHSHTKPYVRS  188



>ref|XP_007050974.1| Ribosomal protein L18 isoform 1 [Theobroma cacao]
 gb|EOX95131.1| Ribosomal protein L18 isoform 1 [Theobroma cacao]
Length=187

 Score =   312 bits (800),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 152/168 (90%), Positives = 160/168 (95%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK++KRTAPKSDD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK NKP
Sbjct  1    MGIDLVAGGKSKKSKRTAPKSDDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKVNKP  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLSLSRLI F   KEDKIAV+VGT+TDD+R YEVPALKV ALRFT+TARARIEKAGGECL
Sbjct  61   PLSLSRLIEFMKCKEDKIAVVVGTVTDDIRVYEVPALKVTALRFTETARARIEKAGGECL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVR+
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRS  168



>ref|XP_008450608.1| PREDICTED: 60S ribosomal protein L18-2 [Cucumis melo]
Length=187

 Score =   311 bits (797),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 151/168 (90%), Positives = 158/168 (94%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK+TKR APKSDD+YLKLLVKLYRFLVRRTGS FNAVILKRLFMSK NKP
Sbjct  1    MGIDLVAGGKSKKTKRVAPKSDDIYLKLLVKLYRFLVRRTGSNFNAVILKRLFMSKVNKP  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLSLSRLI F  GKE KIAV+VGTITDD+R YEVPALKV ALRFT+TARARIEKAGGECL
Sbjct  61   PLSLSRLIQFMKGKESKIAVVVGTITDDIRVYEVPALKVAALRFTETARARIEKAGGECL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSH+KPYVR+
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHSKPYVRS  168



>gb|KHN20252.1| 60S ribosomal protein L18-3, partial [Glycine soja]
Length=187

 Score =   311 bits (796),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 151/168 (90%), Positives = 160/168 (95%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
             GIDLKAGGKSK+TKRTAPKS+D+YLKLLVKLYRFLVRRTGS FNAVILKRLFMSK NKP
Sbjct  1    QGIDLKAGGKSKKTKRTAPKSNDIYLKLLVKLYRFLVRRTGSNFNAVILKRLFMSKVNKP  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLSLSRLI +T GKEDKIAV+VG+ITDD+R YEVP LKV ALRFT+TARARIEKAGGECL
Sbjct  61   PLSLSRLIKYTKGKEDKIAVVVGSITDDIRVYEVPPLKVTALRFTETARARIEKAGGECL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPAPGVPHSHTKPYVRA
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPAPGVPHSHTKPYVRA  168



>ref|XP_010544997.1| PREDICTED: 60S ribosomal protein L18-2-like [Tarenaya hassleriana]
Length=187

 Score =   311 bits (796),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 150/168 (89%), Positives = 159/168 (95%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDLKAGGKSK+TKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK NKP
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKVNKP  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLSLSRLI +  GKED+I V+VGT+TDD R YEVPALK+ ALRFT+ ARARIEKAGGECL
Sbjct  61   PLSLSRLIRYMQGKEDQIGVIVGTVTDDARVYEVPALKITALRFTERARARIEKAGGECL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPAPGVPHSHTKPYVR+
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPAPGVPHSHTKPYVRS  168



>ref|XP_002319502.1| 60S ribosomal protein L18 [Populus trichocarpa]
 gb|EEE95425.1| 60S ribosomal protein L18 [Populus trichocarpa]
Length=187

 Score =   310 bits (795),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 151/168 (90%), Positives = 160/168 (95%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDLKAGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRT SKFNAVILKRLFMSK NK 
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTQSKFNAVILKRLFMSKINKA  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLSLSRLI++T GKE KIAV+VGT+TDD+R YEVP LKV ALRFT+TARARIEKAGGECL
Sbjct  61   PLSLSRLITYTKGKEGKIAVVVGTVTDDIRVYEVPTLKVTALRFTETARARIEKAGGECL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPAPGVPHSHTKPYVRA
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPAPGVPHSHTKPYVRA  168



>emb|CDP17112.1| unnamed protein product [Coffea canephora]
Length=234

 Score =   312 bits (799),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 151/168 (90%), Positives = 161/168 (96%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDLKAGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRTGSKFN VILKRLFMSK NKP
Sbjct  48   MGIDLKAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTGSKFNVVILKRLFMSKINKP  107

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
             LSLSRLI++T GKEDKIAV+VGT+TDD R YEVP+LKV ALRFT+TARARIEKAGGECL
Sbjct  108  ALSLSRLITYTKGKEDKIAVVVGTVTDDTRVYEVPSLKVTALRFTETARARIEKAGGECL  167

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHS+TKPYVR+
Sbjct  168  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSNTKPYVRS  215



>gb|KGN66048.1| hypothetical protein Csa_1G569250 [Cucumis sativus]
Length=244

 Score =   312 bits (800),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 152/169 (90%), Positives = 159/169 (94%), Gaps = 0/169 (0%)
 Frame = +3

Query  87   TMGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNK  266
             MGIDL AGGKSK+TKR APKSDD+YLKLLVKLYRFLVRRTGS FNAVILKRLFMSK NK
Sbjct  57   VMGIDLVAGGKSKKTKRVAPKSDDIYLKLLVKLYRFLVRRTGSNFNAVILKRLFMSKVNK  116

Query  267  PPLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGEC  446
            PPLSLSRLI FT GKE KIAV+VGTITDD+R YEVPALKV ALRFT+TARARIEKAGGEC
Sbjct  117  PPLSLSRLIQFTKGKESKIAVVVGTITDDIRVYEVPALKVAALRFTETARARIEKAGGEC  176

Query  447  LTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            LTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSH+KPYVR+
Sbjct  177  LTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHSKPYVRS  225



>gb|KHN03962.1| 60S ribosomal protein L18-2 [Glycine soja]
Length=187

 Score =   310 bits (795),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 148/168 (88%), Positives = 161/168 (96%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDLKAGGKSK+TKRTAPKS+D+YLKLLVKLYRFLVRRTGS FNAVILKRLFMSK NKP
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSNDIYLKLLVKLYRFLVRRTGSNFNAVILKRLFMSKVNKP  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            P+SLSRLI +T GKEDKIAV+VGT+TDD+R YEVPALK+ AL+FT+ ARARIEKAGGECL
Sbjct  61   PISLSRLIKYTKGKEDKIAVIVGTVTDDIRVYEVPALKITALKFTERARARIEKAGGECL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFD+LALRAPLGQNTVLLRGPKN+REAVKHFGPAPGVPHSHTKPYVRA
Sbjct  121  TFDELALRAPLGQNTVLLRGPKNAREAVKHFGPAPGVPHSHTKPYVRA  168



>ref|XP_010523956.1| PREDICTED: 60S ribosomal protein L18-2-like [Tarenaya hassleriana]
Length=187

 Score =   310 bits (795),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 150/168 (89%), Positives = 158/168 (94%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDLKAGGKSK+TKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK NKP
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKVNKP  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLSLSRLI +  GKED I V+VGT+TDD R YEVPALK+ ALRFT+ ARARIEKAGGECL
Sbjct  61   PLSLSRLIRYMEGKEDNIGVIVGTVTDDARVYEVPALKITALRFTERARARIEKAGGECL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPAPGVPHSHTKPYVR+
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPAPGVPHSHTKPYVRS  168



>ref|XP_008454015.1| PREDICTED: 60S ribosomal protein L18-3 [Cucumis melo]
Length=187

 Score =   310 bits (794),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 150/168 (89%), Positives = 159/168 (95%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRTGS FNAVILKRLFMSK NKP
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTGSNFNAVILKRLFMSKVNKP  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            P+SLSRLI +  GKE KIAV+VGT+TDD+R YEVPALKV ALRFT+TARARIEKAGGECL
Sbjct  61   PISLSRLIKYMKGKEAKIAVVVGTVTDDIRVYEVPALKVTALRFTETARARIEKAGGECL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVR+
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRS  168



>ref|XP_006433453.1| hypothetical protein CICLE_v10002597mg [Citrus clementina]
 ref|XP_006472133.1| PREDICTED: 60S ribosomal protein L18-3-like [Citrus sinensis]
 gb|ESR46693.1| hypothetical protein CICLE_v10002597mg [Citrus clementina]
Length=187

 Score =   310 bits (794),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 150/168 (89%), Positives = 160/168 (95%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK++KRTAPKSDD+YLKLLVKLYRFLVRRT S FN VILKRLFMSK NKP
Sbjct  1    MGIDLVAGGKSKKSKRTAPKSDDIYLKLLVKLYRFLVRRTDSNFNKVILKRLFMSKVNKP  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLSLSRLI+F  GKEDKIAV+VGT+TDD+RAYEVPALKV ALRFT+TARARIEKAGGECL
Sbjct  61   PLSLSRLINFMKGKEDKIAVVVGTVTDDIRAYEVPALKVTALRFTETARARIEKAGGECL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPAPGVPHSHTKPYVR+
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPAPGVPHSHTKPYVRS  168



>ref|XP_007144959.1| hypothetical protein PHAVU_007G197900g [Phaseolus vulgaris]
 gb|ESW16953.1| hypothetical protein PHAVU_007G197900g [Phaseolus vulgaris]
Length=187

 Score =   310 bits (794),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 150/168 (89%), Positives = 161/168 (96%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDLKAGGKSK+TKRTAPKS+D+YLKLLVKLYRFLVRRTGS FNAVILKRLFMSK NKP
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSNDIYLKLLVKLYRFLVRRTGSNFNAVILKRLFMSKVNKP  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLSLSRLI +T GKE KIAV+VGTITDD+R YEVP+LKV ALRFT+TARARIEKAGGECL
Sbjct  61   PLSLSRLIKYTKGKEGKIAVVVGTITDDIRVYEVPSLKVTALRFTETARARIEKAGGECL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPAPGVPHS+TKPYVR+
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPAPGVPHSNTKPYVRS  168



>ref|XP_010559185.1| PREDICTED: 60S ribosomal protein L18-2-like [Tarenaya hassleriana]
Length=187

 Score =   310 bits (793),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 150/168 (89%), Positives = 159/168 (95%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDLKAGGKSK+TKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK NKP
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKVNKP  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLSLSRLI +  GK+DKI V+VGT+TDD R YEVPALK+ ALRFT+ ARARIEKAGGECL
Sbjct  61   PLSLSRLIRYMQGKKDKIGVIVGTVTDDARVYEVPALKITALRFTERARARIEKAGGECL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPAPGVPHSHTKPYVR+
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPAPGVPHSHTKPYVRS  168



>ref|XP_009630742.1| PREDICTED: 60S ribosomal protein L18-2-like [Nicotiana tomentosiformis]
Length=187

 Score =   309 bits (792),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 149/168 (89%), Positives = 160/168 (95%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MG+DLK GGKSK+TKRT PKSDDVYLKLLVKLYRF VRRT SKFNAVILKRLFMSKTNKP
Sbjct  1    MGVDLKVGGKSKKTKRTTPKSDDVYLKLLVKLYRFFVRRTESKFNAVILKRLFMSKTNKP  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLSLSRLIS+  GKE+KIAV+VGTITDDVRAY+VP LKVCALRFTKTARARIEKAGGECL
Sbjct  61   PLSLSRLISYVKGKENKIAVIVGTITDDVRAYDVPTLKVCALRFTKTARARIEKAGGECL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLALRAPLGQNT+LL+GPKN+REAVKHFGPAPGVPHSHTKPY+ +
Sbjct  121  TFDQLALRAPLGQNTLLLKGPKNAREAVKHFGPAPGVPHSHTKPYMHS  168



>ref|XP_010043043.1| PREDICTED: 60S ribosomal protein L18-2 [Eucalyptus grandis]
 gb|KCW85064.1| hypothetical protein EUGRSUZ_B01908 [Eucalyptus grandis]
Length=187

 Score =   309 bits (792),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 149/168 (89%), Positives = 160/168 (95%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK NK 
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKVNKA  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLSLSRLI +T GKEDKIAV+VGT+TDD+R Y+VPALKV ALRFT+T RARIEKAGGECL
Sbjct  61   PLSLSRLIRYTQGKEDKIAVVVGTVTDDIRVYDVPALKVTALRFTETVRARIEKAGGECL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLALRAPLGQNT+LLRGPKN+REAVKHFGPAPGVPHSHTKPYVR+
Sbjct  121  TFDQLALRAPLGQNTILLRGPKNAREAVKHFGPAPGVPHSHTKPYVRS  168



>ref|XP_004144773.1| PREDICTED: 60S ribosomal protein L18-3-like [Cucumis sativus]
 ref|XP_004158733.1| PREDICTED: 60S ribosomal protein L18-3-like [Cucumis sativus]
 gb|KGN60965.1| hypothetical protein Csa_2G032220 [Cucumis sativus]
Length=187

 Score =   309 bits (792),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 149/168 (89%), Positives = 159/168 (95%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRTGS FNAVILKRLFMSK NKP
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTGSNFNAVILKRLFMSKVNKP  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            P+SLSRLI +  GKE +IAV+VGT+TDD+R YEVPALKV ALRFT+TARARIEKAGGECL
Sbjct  61   PISLSRLIKYMNGKEGRIAVIVGTVTDDIRVYEVPALKVTALRFTETARARIEKAGGECL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVR+
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRS  168



>ref|XP_011023716.1| PREDICTED: 60S ribosomal protein L18-2 [Populus euphratica]
Length=187

 Score =   309 bits (792),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 151/168 (90%), Positives = 160/168 (95%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDLKAGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRT SKFNAVILKRLFMSK NK 
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTQSKFNAVILKRLFMSKINKA  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLSLSRLI++T GKE KIAV+VGT+TDD+R YEVPALKV ALRFT+TARARIEKAGGECL
Sbjct  61   PLSLSRLITYTKGKEGKIAVVVGTVTDDIRVYEVPALKVTALRFTETARARIEKAGGECL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFG APGVPHSHTKPYVRA
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGRAPGVPHSHTKPYVRA  168



>gb|AFK49563.1| unknown [Lotus japonicus]
Length=187

 Score =   309 bits (792),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 147/168 (88%), Positives = 159/168 (95%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDLKAGGKSK+TKR APKS+D+YLKLLVKLYRFLVRRTGS FNAVILKRLFMSK NKP
Sbjct  1    MGIDLKAGGKSKKTKRIAPKSNDIYLKLLVKLYRFLVRRTGSNFNAVILKRLFMSKVNKP  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            P+SLSRLI +  GKEDK+ V+VGT+TDD+R YEVPALKV ALRFT+TARARIEKAGGECL
Sbjct  61   PISLSRLIKYAKGKEDKVVVIVGTVTDDIRVYEVPALKVTALRFTETARARIEKAGGECL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPAPGVPHSHTKPYVR+
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPAPGVPHSHTKPYVRS  168



>ref|XP_010546736.1| PREDICTED: 60S ribosomal protein L18-3 [Tarenaya hassleriana]
Length=187

 Score =   309 bits (791),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 150/168 (89%), Positives = 158/168 (94%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK+TKRTAPKSDDVYLKLLVKLYRFLVRRTGS FNAVILKRLFMSK NK 
Sbjct  1    MGIDLIAGGKSKKTKRTAPKSDDVYLKLLVKLYRFLVRRTGSNFNAVILKRLFMSKVNKA  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLSLSRL+ F  GKED+I V+VGT+TDDVR YEVPALKV ALRFT+TARARIEKAGGECL
Sbjct  61   PLSLSRLVRFMQGKEDQIGVIVGTVTDDVRVYEVPALKVTALRFTETARARIEKAGGECL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPAPGVPHSHTKPYVR+
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPAPGVPHSHTKPYVRS  168



>emb|CDO98841.1| unnamed protein product [Coffea canephora]
Length=243

 Score =   311 bits (796),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 150/168 (89%), Positives = 158/168 (94%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDLKAGGK K+TKRTAPKS D+YLKLLVKLYRFLVRRTGS+FNAV+LKRLFMSKTNKP
Sbjct  57   MGIDLKAGGKVKKTKRTAPKSHDIYLKLLVKLYRFLVRRTGSRFNAVLLKRLFMSKTNKP  116

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLSLSRL+ F  GKEDKIAVLVGT+TDD R YEVP LKV ALRFT+ ARARIEKAGGECL
Sbjct  117  PLSLSRLVKFMEGKEDKIAVLVGTVTDDTRVYEVPTLKVAALRFTERARARIEKAGGECL  176

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPAPGVPHSHTKPYVRA
Sbjct  177  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPAPGVPHSHTKPYVRA  224



>ref|XP_007147006.1| hypothetical protein PHAVU_006G088800g [Phaseolus vulgaris]
 gb|ESW19000.1| hypothetical protein PHAVU_006G088800g [Phaseolus vulgaris]
Length=187

 Score =   308 bits (790),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 148/168 (88%), Positives = 160/168 (95%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDLKAGGKSK+TKRTAPKS+D+YLKLLVKLYRFLVRRTGS FNAVILKRLFMSK NKP
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSNDIYLKLLVKLYRFLVRRTGSNFNAVILKRLFMSKVNKP  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLSLSRLI +T GKEDKIAV+VGTITDD+R YEVP LK+ AL+FT+ ARARIEKAGGECL
Sbjct  61   PLSLSRLIRYTKGKEDKIAVVVGTITDDIRVYEVPQLKITALKFTERARARIEKAGGECL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPAPGVPHSH+KPYVR+
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPAPGVPHSHSKPYVRS  168



>gb|ABK92688.1| unknown [Populus trichocarpa]
Length=187

 Score =   308 bits (790),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 150/168 (89%), Positives = 159/168 (95%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDLKAGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRT SKFNAVILKRLFMSK NK 
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTQSKFNAVILKRLFMSKINKA  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLSLSRLI++T GKE KIAV+VGT+TDD+R YEVP LKV ALRFT+TARARIEKAGGECL
Sbjct  61   PLSLSRLITYTKGKEGKIAVVVGTVTDDIRVYEVPTLKVTALRFTETARARIEKAGGECL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPAPGVPH HTKPYVRA
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPAPGVPHGHTKPYVRA  168



>ref|XP_010088293.1| 60S ribosomal protein L18-3 [Morus notabilis]
 gb|EXB33518.1| 60S ribosomal protein L18-3 [Morus notabilis]
Length=197

 Score =   309 bits (791),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 148/167 (89%), Positives = 159/167 (95%), Gaps = 0/167 (0%)
 Frame = +3

Query  93   GIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPP  272
            GIDL AGGKSK++KRTAPKSDD+YLKLLVKLYRFLVRRTGS FNAV+LKRLFMSK NKPP
Sbjct  12   GIDLVAGGKSKKSKRTAPKSDDIYLKLLVKLYRFLVRRTGSNFNAVVLKRLFMSKVNKPP  71

Query  273  LSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLT  452
            LSLSRLI F  GKEDK+AV+VGT+TDD+R YEVPALKV ALRFT+TARARIEKAGGECLT
Sbjct  72   LSLSRLIRFMKGKEDKVAVVVGTVTDDIRVYEVPALKVTALRFTETARARIEKAGGECLT  131

Query  453  FDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            FDQLALRAPLGQNTVLLRGPKN+REAVKHFGPAPGVPHSHTKPYVR+
Sbjct  132  FDQLALRAPLGQNTVLLRGPKNAREAVKHFGPAPGVPHSHTKPYVRS  178



>ref|XP_003554636.2| PREDICTED: 60S ribosomal protein L18-2-like [Glycine max]
 gb|KHN43312.1| 60S ribosomal protein L18-2 [Glycine soja]
Length=214

 Score =   309 bits (792),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 148/168 (88%), Positives = 160/168 (95%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDLKAGGKSK+TKRTAPKS+D+YLKLLVKLYRFLVRRT S FNAVILKRLFMSK NKP
Sbjct  28   MGIDLKAGGKSKKTKRTAPKSNDIYLKLLVKLYRFLVRRTDSNFNAVILKRLFMSKVNKP  87

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            P+SLSRLI +T GKEDKIAV+VGT+TDD+R YEVPALK+ AL+FT+ ARARIEKAGGECL
Sbjct  88   PISLSRLIKYTKGKEDKIAVVVGTVTDDIRVYEVPALKITALKFTERARARIEKAGGECL  147

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPAPGVPHSHTKPYVRA
Sbjct  148  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPAPGVPHSHTKPYVRA  195



>ref|XP_010528904.1| PREDICTED: 60S ribosomal protein L18-2 [Tarenaya hassleriana]
Length=187

 Score =   308 bits (789),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 149/168 (89%), Positives = 158/168 (94%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK+TKR APKSDDVYLKLLVKLYRFLVRRTGS FNAVILKRLFMSK NK 
Sbjct  1    MGIDLIAGGKSKKTKRVAPKSDDVYLKLLVKLYRFLVRRTGSSFNAVILKRLFMSKVNKA  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            P+SLSRL+ F  GKEDK+AV+VGT+TDD+R YEVPALKV ALRFT+TARARIEKAGGECL
Sbjct  61   PISLSRLVRFMQGKEDKVAVIVGTVTDDLRVYEVPALKVTALRFTETARARIEKAGGECL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPAPGVPHSHTKPYVRA
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPAPGVPHSHTKPYVRA  168



>ref|XP_010659657.1| PREDICTED: 60S ribosomal protein L18-2-like [Vitis vinifera]
 emb|CAN65685.1| hypothetical protein VITISV_022459 [Vitis vinifera]
Length=187

 Score =   308 bits (789),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 150/168 (89%), Positives = 159/168 (95%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK NKP
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKVNKP  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLSLSRL+ +  GKE KIAV+VGT+TDD+R YEVPALKV ALRFT+TARARIEKAGGECL
Sbjct  61   PLSLSRLVRYMGGKEGKIAVVVGTVTDDIRVYEVPALKVTALRFTETARARIEKAGGECL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLALRAPLGQNTVLLRGPKNSREAVKHFG APGVPHSHTKPYVR+
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGKAPGVPHSHTKPYVRS  168



>ref|XP_010684349.1| PREDICTED: 60S ribosomal protein L18-2-like [Beta vulgaris subsp. 
vulgaris]
Length=187

 Score =   307 bits (786),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 147/168 (88%), Positives = 159/168 (95%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDLKAGGKSK+TKRTAPKS+DVYLKLLVKLYRFLVRRTGSKFNAV+LKRLFMSK NK 
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSNDVYLKLLVKLYRFLVRRTGSKFNAVVLKRLFMSKINKA  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLSLSRL+ +  GK+ +IAVLVGTITDD+R YEVP +KVCALRFT+TARARIEKAGGEC+
Sbjct  61   PLSLSRLVKYMEGKDGRIAVLVGTITDDIRVYEVPTMKVCALRFTETARARIEKAGGECI  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFG APGVPHSHTKPYVRA
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGKAPGVPHSHTKPYVRA  168



>ref|XP_006386732.1| hypothetical protein POPTR_0002s20400g [Populus trichocarpa]
 gb|ERP64529.1| hypothetical protein POPTR_0002s20400g [Populus trichocarpa]
Length=184

 Score =   307 bits (786),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 151/168 (90%), Positives = 160/168 (95%), Gaps = 3/168 (2%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDLKAGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK NKP
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKINKP  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLSLSRLI+F  GK   IAV+VGTITDD+R YEVPALKV ALRFT+TARARIEKAGGECL
Sbjct  61   PLSLSRLITFMKGK---IAVVVGTITDDIRVYEVPALKVTALRFTETARARIEKAGGECL  117

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPAPGVPHSHTKPY+R+
Sbjct  118  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPAPGVPHSHTKPYIRS  165



>emb|CBI39539.3| unnamed protein product [Vitis vinifera]
Length=249

 Score =   309 bits (792),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 151/169 (89%), Positives = 160/169 (95%), Gaps = 0/169 (0%)
 Frame = +3

Query  87   TMGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNK  266
            TMGIDL AGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK NK
Sbjct  62   TMGIDLVAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKVNK  121

Query  267  PPLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGEC  446
            PPLSLSRL+ +  GKE KIAV+VGT+TDD+R YEVPALKV ALRFT+TARARIEKAGGEC
Sbjct  122  PPLSLSRLVRYMGGKEGKIAVVVGTVTDDIRVYEVPALKVTALRFTETARARIEKAGGEC  181

Query  447  LTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            LTFDQLALRAPLGQNTVLLRGPKNSREAVKHFG APGVPHSHTKPYVR+
Sbjct  182  LTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGKAPGVPHSHTKPYVRS  230



>ref|XP_010674074.1| PREDICTED: 60S ribosomal protein L18-2 [Beta vulgaris subsp. 
vulgaris]
Length=187

 Score =   307 bits (786),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 148/168 (88%), Positives = 158/168 (94%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDLKAGGKSK+TKRTAPKS+DVYLKLLVKLYRFLVRRTGS FN V+LKRLFMSK NK 
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSNDVYLKLLVKLYRFLVRRTGSSFNGVVLKRLFMSKINKA  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLSLSRLI++  GKEDKIAV+VG +TDD+R YEVPALKV ALRFT+TARARIEKAGGECL
Sbjct  61   PLSLSRLITYMKGKEDKIAVIVGAVTDDIRVYEVPALKVTALRFTETARARIEKAGGECL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFG APGVPHSHTKPYVRA
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGKAPGVPHSHTKPYVRA  168



>ref|XP_002270635.1| PREDICTED: 60S ribosomal protein L18-2 [Vitis vinifera]
Length=187

 Score =   306 bits (785),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 149/168 (89%), Positives = 158/168 (94%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK NKP
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKINKP  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            P+SLSRLI +  GKEDKIAVLVGT+TDD+R YEVP LKV ALRFT+ ARARIEKAGGECL
Sbjct  61   PMSLSRLIRYMQGKEDKIAVLVGTVTDDLRVYEVPTLKVTALRFTERARARIEKAGGECL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFG APGVPHSHTKPYVR+
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGKAPGVPHSHTKPYVRS  168



>ref|XP_004494383.1| PREDICTED: 60S ribosomal protein L18-like [Cicer arietinum]
Length=187

 Score =   306 bits (784),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 148/168 (88%), Positives = 158/168 (94%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDLKAGGKSK+TKRTAPKS+D+YLKLLVKLYRFLVRRT S FNAVILKRLFMSK NKP
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSNDIYLKLLVKLYRFLVRRTESSFNAVILKRLFMSKVNKP  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLSLSRLI F  GKE KIAV+VG +TDD+R YEVPA+KV ALRFT+TARARIEKAGGECL
Sbjct  61   PLSLSRLIRFMKGKEGKIAVVVGAVTDDIRVYEVPAIKVTALRFTETARARIEKAGGECL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPAPGVPHSHTKPYVR+
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPAPGVPHSHTKPYVRS  168



>ref|XP_008386678.1| PREDICTED: 60S ribosomal protein L18-2-like [Malus domestica]
Length=187

 Score =   306 bits (784),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 148/168 (88%), Positives = 158/168 (94%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK NK 
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKVNKA  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLSLSRLI +  GKE KIAV+VGT+TDD+R YEVP LKV ALRFT+TARARIEKAGGECL
Sbjct  61   PLSLSRLIKYMTGKEGKIAVVVGTVTDDIRVYEVPCLKVTALRFTETARARIEKAGGECL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLALRAPLGQNT+LLRGPKN+REAVKHFGPAPGVPHSHTKPYVR+
Sbjct  121  TFDQLALRAPLGQNTILLRGPKNAREAVKHFGPAPGVPHSHTKPYVRS  168



>ref|XP_006359857.1| PREDICTED: 60S ribosomal protein L18-2-like [Solanum tuberosum]
Length=187

 Score =   306 bits (784),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 149/168 (89%), Positives = 157/168 (93%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK+TKR APKSDDVYLKLLVKLYRFL RRTGSKFNAVILKRLFMSK NK 
Sbjct  1    MGIDLVAGGKSKKTKRIAPKSDDVYLKLLVKLYRFLARRTGSKFNAVILKRLFMSKINKA  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLSLSRL+++  GKED IAV+VGT+TDDVRAYEVP +KV ALRFT+TARARIEKAGGECL
Sbjct  61   PLSLSRLVTYMTGKEDNIAVIVGTVTDDVRAYEVPKIKVTALRFTETARARIEKAGGECL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLALRAPLGQNTVLLRGPKNSREAVKHFG APGVPHSHTKPYVRA
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGKAPGVPHSHTKPYVRA  168



>ref|XP_004135776.1| PREDICTED: uncharacterized protein LOC101207642 [Cucumis sativus]
 ref|XP_004169487.1| PREDICTED: uncharacterized protein LOC101228164 [Cucumis sativus]
Length=389

 Score =   313 bits (802),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 152/169 (90%), Positives = 159/169 (94%), Gaps = 0/169 (0%)
 Frame = +3

Query  87   TMGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNK  266
             MGIDL AGGKSK+TKR APKSDD+YLKLLVKLYRFLVRRTGS FNAVILKRLFMSK NK
Sbjct  202  VMGIDLVAGGKSKKTKRVAPKSDDIYLKLLVKLYRFLVRRTGSNFNAVILKRLFMSKVNK  261

Query  267  PPLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGEC  446
            PPLSLSRLI FT GKE KIAV+VGTITDD+R YEVPALKV ALRFT+TARARIEKAGGEC
Sbjct  262  PPLSLSRLIQFTKGKESKIAVVVGTITDDIRVYEVPALKVAALRFTETARARIEKAGGEC  321

Query  447  LTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            LTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSH+KPYVR+
Sbjct  322  LTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHSKPYVRS  370



>ref|XP_008388515.1| PREDICTED: 60S ribosomal protein L18-2-like [Malus domestica]
Length=187

 Score =   306 bits (783),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 148/168 (88%), Positives = 157/168 (93%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK NK 
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKVNKA  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLSLSRLI +  GK+ KIAV+VGT+TDD+R YEVP LKV ALRFT+TARARIEKAGGECL
Sbjct  61   PLSLSRLIKYMQGKDSKIAVVVGTVTDDIRVYEVPQLKVTALRFTETARARIEKAGGECL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLALRAPLGQN VLLRGPKNSREAVKHFGPAPGVPHSHTKPYVR+
Sbjct  121  TFDQLALRAPLGQNVVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRS  168



>ref|XP_009338229.1| PREDICTED: 60S ribosomal protein L18-2-like [Pyrus x bretschneideri]
Length=187

 Score =   306 bits (783),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 147/168 (88%), Positives = 158/168 (94%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK NK 
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKVNKA  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLSLSRLI +  GK++KIAV+VGT+TDD+R YEVP +KV ALRFT+TARARIEKAGGECL
Sbjct  61   PLSLSRLIKYMQGKDNKIAVVVGTVTDDIRVYEVPQMKVTALRFTETARARIEKAGGECL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLALRAPLGQN VLLRGPKNSREAVKHFGPAPGVPHSHTKPYVR+
Sbjct  121  TFDQLALRAPLGQNVVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRS  168



>ref|XP_007050976.1| Ribosomal protein L18 isoform 3 [Theobroma cacao]
 gb|EOX95133.1| Ribosomal protein L18 isoform 3 [Theobroma cacao]
Length=186

 Score =   305 bits (781),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 150/168 (89%), Positives = 159/168 (95%), Gaps = 1/168 (1%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK++KRTAPKSDD+YLKLL +LYRFLVRRTGSKFNAVILKRLFMSK NKP
Sbjct  1    MGIDLVAGGKSKKSKRTAPKSDDIYLKLL-QLYRFLVRRTGSKFNAVILKRLFMSKVNKP  59

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLSLSRLI F   KEDKIAV+VGT+TDD+R YEVPALKV ALRFT+TARARIEKAGGECL
Sbjct  60   PLSLSRLIEFMKCKEDKIAVVVGTVTDDIRVYEVPALKVTALRFTETARARIEKAGGECL  119

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVR+
Sbjct  120  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRS  167



>ref|XP_007205962.1| hypothetical protein PRUPE_ppa012012mg [Prunus persica]
 ref|XP_008245548.1| PREDICTED: 60S ribosomal protein L18-2 [Prunus mume]
 gb|EMJ07161.1| hypothetical protein PRUPE_ppa012012mg [Prunus persica]
Length=187

 Score =   305 bits (780),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 147/168 (88%), Positives = 158/168 (94%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK NK 
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKVNKA  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLSLSRLI +  GK++KIAV+VGT+TDD+R YEVP LKV ALRFT+TARARIEKAGGECL
Sbjct  61   PLSLSRLIRYMQGKDNKIAVVVGTVTDDIRVYEVPQLKVTALRFTETARARIEKAGGECL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLALRAPLGQN VLLRGPKN+REAVKHFGPAPGVPHSHTKPYVR+
Sbjct  121  TFDQLALRAPLGQNVVLLRGPKNAREAVKHFGPAPGVPHSHTKPYVRS  168



>ref|XP_010094463.1| 60S ribosomal protein L18-2 [Morus notabilis]
 gb|EXB56096.1| 60S ribosomal protein L18-2 [Morus notabilis]
Length=198

 Score =   305 bits (781),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 147/168 (88%), Positives = 159/168 (95%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
             GID+ AGGKSK++KRTAPKSDD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK NKP
Sbjct  12   QGIDIVAGGKSKKSKRTAPKSDDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKVNKP  71

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLSLSRLI F  GKE KIAV+VGT+TDD+R Y+VPALKV ALRFT+TARARIEKAGGECL
Sbjct  72   PLSLSRLIRFMQGKESKIAVVVGTVTDDIRVYDVPALKVTALRFTETARARIEKAGGECL  131

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLAL+APLGQNTVLLRGPKN+REAVKHFGPAPGVPHSHTKPYVR+
Sbjct  132  TFDQLALKAPLGQNTVLLRGPKNAREAVKHFGPAPGVPHSHTKPYVRS  179



>ref|XP_009335702.1| PREDICTED: 60S ribosomal protein L18-2 [Pyrus x bretschneideri]
 ref|XP_009335725.1| PREDICTED: 60S ribosomal protein L18-2 [Pyrus x bretschneideri]
Length=187

 Score =   305 bits (780),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 147/168 (88%), Positives = 158/168 (94%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK NK 
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKVNKA  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLSLSRLI +  GKE KIAV+VGT+TDD+R Y+VP LKV ALRFT+TARARIEKAGGECL
Sbjct  61   PLSLSRLIKYMTGKEGKIAVVVGTVTDDIRVYDVPCLKVTALRFTETARARIEKAGGECL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLALRAPLGQNT+LLRGPKN+REAVKHFGPAPGVPHSHTKPYVR+
Sbjct  121  TFDQLALRAPLGQNTILLRGPKNAREAVKHFGPAPGVPHSHTKPYVRS  168



>ref|XP_008370417.1| PREDICTED: 60S ribosomal protein L18-2 [Malus domestica]
Length=187

 Score =   305 bits (780),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 147/168 (88%), Positives = 157/168 (93%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRT SKFNAVILKRLFMSK NK 
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTASKFNAVILKRLFMSKVNKA  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLSLSRLI +  GK++KIAV+VGTITDD+R YEVP +KV ALRFT+TARARIEKAGGECL
Sbjct  61   PLSLSRLIKYMQGKDNKIAVVVGTITDDIRVYEVPQMKVTALRFTETARARIEKAGGECL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLALRAPLGQN VLLRGPKNSREAVKHFGPAPGVPHSHTKPYVR+
Sbjct  121  TFDQLALRAPLGQNVVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRS  168



>ref|XP_007201344.1| hypothetical protein PRUPE_ppa012001mg [Prunus persica]
 ref|XP_008235116.1| PREDICTED: 60S ribosomal protein L18-2 [Prunus mume]
 gb|EMJ02543.1| hypothetical protein PRUPE_ppa012001mg [Prunus persica]
Length=187

 Score =   305 bits (780),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 148/168 (88%), Positives = 159/168 (95%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRTGSKF+AVILKRLFMSK NK 
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTGSKFSAVILKRLFMSKVNKA  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLSLSRLI +  GK+ KIAV+VGT+TDD+R YEVPALKV ALRFT+TARARIEKAGGECL
Sbjct  61   PLSLSRLIRYMNGKDGKIAVVVGTVTDDIRVYEVPALKVTALRFTETARARIEKAGGECL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPAPGVPHSHTKPYVR+
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPAPGVPHSHTKPYVRS  168



>emb|CDX74138.1| BnaA03g29090D [Brassica napus]
Length=213

 Score =   305 bits (781),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 149/169 (88%), Positives = 158/169 (93%), Gaps = 0/169 (0%)
 Frame = +3

Query  87   TMGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNK  266
            TMGIDL AGGKSK+TKRTAPKSDDVYLKL VKLYRFLVRRT SKFNAVILKRLFMSK NK
Sbjct  26   TMGIDLIAGGKSKKTKRTAPKSDDVYLKLTVKLYRFLVRRTQSKFNAVILKRLFMSKVNK  85

Query  267  PPLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGEC  446
             PLSLSRL+ F  GKEDKIAVLVGTITDD+R +E+PA+KV ALRFT+ ARARIEKAGGEC
Sbjct  86   APLSLSRLVEFMTGKEDKIAVLVGTITDDLRVHEIPAIKVTALRFTERARARIEKAGGEC  145

Query  447  LTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            LTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSH+KPYVR+
Sbjct  146  LTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHSKPYVRS  194



>ref|NP_001235897.1| uncharacterized protein LOC100527681 [Glycine max]
 gb|ACU16823.1| unknown [Glycine max]
Length=187

 Score =   304 bits (778),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 146/168 (87%), Positives = 159/168 (95%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDLKAGGKSK+TKRTAPKS+D+YLKLLVKLYR LVRRTGS FNAVILKRLFMSK NKP
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSNDIYLKLLVKLYRSLVRRTGSNFNAVILKRLFMSKVNKP  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            P+SLSRLI +T GKEDKIAV+VGT+TDD+R YEVPALK+ AL+ T+ ARARIEKAGGECL
Sbjct  61   PISLSRLIKYTKGKEDKIAVIVGTVTDDIRVYEVPALKITALKSTERARARIEKAGGECL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFD+LALRAPLGQNTVLLRGPKN+REAVKHFGPAPGVPHSHTKPYVRA
Sbjct  121  TFDELALRAPLGQNTVLLRGPKNAREAVKHFGPAPGVPHSHTKPYVRA  168



>ref|XP_008369026.1| PREDICTED: 60S ribosomal protein L18-2 [Malus domestica]
 ref|XP_008345218.1| PREDICTED: 60S ribosomal protein L18-2 [Malus domestica]
 ref|XP_008355492.1| PREDICTED: 60S ribosomal protein L18-2 [Malus domestica]
Length=187

 Score =   304 bits (778),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 147/168 (88%), Positives = 157/168 (93%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRT SKFNAVILKRLFMSK NK 
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTSSKFNAVILKRLFMSKVNKA  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLSLSRLI +  GKE KIAV+VGT+TDD+R YEVP LKV ALRFT+TARARIEKAGGECL
Sbjct  61   PLSLSRLIKYMTGKEGKIAVVVGTVTDDIRVYEVPCLKVTALRFTETARARIEKAGGECL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLALRAPLGQNT+LLRGPKN+REAVKHFGPAPGVPHSHTKPYVR+
Sbjct  121  TFDQLALRAPLGQNTILLRGPKNAREAVKHFGPAPGVPHSHTKPYVRS  168



>ref|XP_010104147.1| 60S ribosomal protein L18-2 [Morus notabilis]
 gb|EXB98712.1| 60S ribosomal protein L18-2 [Morus notabilis]
Length=209

 Score =   305 bits (780),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 147/167 (88%), Positives = 159/167 (95%), Gaps = 0/167 (0%)
 Frame = +3

Query  93   GIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPP  272
            GID+ AGGKSK++KRTAPKSDD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK NKPP
Sbjct  24   GIDIVAGGKSKKSKRTAPKSDDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKVNKPP  83

Query  273  LSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLT  452
            LSLSRLI F  GKE KIAV+VGT+TDD+R Y+VPALKV ALRFT+TARARIEKAGGECLT
Sbjct  84   LSLSRLIRFMQGKESKIAVVVGTVTDDIRVYDVPALKVTALRFTETARARIEKAGGECLT  143

Query  453  FDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            FDQLAL+APLGQNTVLLRGPKN+REAVKHFGPAPGVPHSHTKPYVR+
Sbjct  144  FDQLALKAPLGQNTVLLRGPKNAREAVKHFGPAPGVPHSHTKPYVRS  190



>gb|AFK45456.1| unknown [Lotus japonicus]
Length=187

 Score =   304 bits (778),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 147/168 (88%), Positives = 158/168 (94%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDLKAGGKSK+TKRTAPKS+D+YLKLLVKLYRFLVRRTGS FN+VILKRLFMSK NK 
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSNDIYLKLLVKLYRFLVRRTGSNFNSVILKRLFMSKVNKA  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLSLSRLI +T GKE KIAV+VG +TDD+R YEVPALKV ALRFT+TARARIEKAGGECL
Sbjct  61   PLSLSRLIRYTKGKEGKIAVVVGAVTDDIRVYEVPALKVAALRFTETARARIEKAGGECL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLAL APLGQNTVLLRGPKN+REAVKHFGPAPGVPHSHTKPYVR+
Sbjct  121  TFDQLALIAPLGQNTVLLRGPKNAREAVKHFGPAPGVPHSHTKPYVRS  168



>ref|XP_009134833.1| PREDICTED: 60S ribosomal protein L18-2 [Brassica rapa]
Length=187

 Score =   303 bits (777),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 148/168 (88%), Positives = 157/168 (93%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK+TKRTAPKSDDVYLKL VKLYRFLVRRT SKFNAVILKRLFMSK NK 
Sbjct  1    MGIDLIAGGKSKKTKRTAPKSDDVYLKLTVKLYRFLVRRTQSKFNAVILKRLFMSKVNKA  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLSLSRL+ F  GKEDKIAVLVGTITDD+R +E+PA+KV ALRFT+ ARARIEKAGGECL
Sbjct  61   PLSLSRLVEFMTGKEDKIAVLVGTITDDLRVHEIPAIKVTALRFTERARARIEKAGGECL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSH+KPYVR+
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHSKPYVRS  168



>ref|NP_187210.1| 60S ribosomal protein L18-2 [Arabidopsis thaliana]
 sp|P42791.2|RL182_ARATH RecName: Full=60S ribosomal protein L18-2 [Arabidopsis thaliana]
 gb|AAF26138.1|AC011620_14 putative 60S ribosomal protein L18 [Arabidopsis thaliana]
 gb|AAK59824.1| AT3g05590/F18C1_14 [Arabidopsis thaliana]
 gb|AAL31164.1| AT3g05590/F18C1_14 [Arabidopsis thaliana]
 gb|AEE74263.1| 60S ribosomal protein L18-2 [Arabidopsis thaliana]
Length=187

 Score =   303 bits (777),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 148/168 (88%), Positives = 156/168 (93%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK+TKRTAPKSDDVYLKL VKLYRFLVRRT SKFN VILKRLFMSK NK 
Sbjct  1    MGIDLIAGGKSKKTKRTAPKSDDVYLKLTVKLYRFLVRRTNSKFNGVILKRLFMSKVNKA  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLSLSRL+ F  GKEDKIAVLVGTITDD+R +E+PA+KV ALRFT+ ARARIEKAGGECL
Sbjct  61   PLSLSRLVEFMTGKEDKIAVLVGTITDDLRVHEIPAMKVTALRFTERARARIEKAGGECL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSH+KPYVRA
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHSKPYVRA  168



>ref|XP_010259492.1| PREDICTED: 60S ribosomal protein L18-3 [Nelumbo nucifera]
Length=187

 Score =   303 bits (776),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 147/168 (88%), Positives = 157/168 (93%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK+TKRTAPKS+D+YLKLLVKLYRFLVRRTGS FNAVILKRLFMS+ NK 
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSNDIYLKLLVKLYRFLVRRTGSNFNAVILKRLFMSRVNKA  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            P+SLSRLISF  GKEDKIAV+VGT+TDD R YEVPALKV ALRFT+TARARI KAGGECL
Sbjct  61   PMSLSRLISFMKGKEDKIAVIVGTVTDDTRVYEVPALKVTALRFTETARARILKAGGECL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFG APGVPHSHTKPYVR+
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGKAPGVPHSHTKPYVRS  168



>ref|XP_010938374.1| PREDICTED: 60S ribosomal protein L18-2-like [Elaeis guineensis]
Length=187

 Score =   303 bits (776),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 145/168 (86%), Positives = 158/168 (94%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDLKAGG+SK+ +RTAPKSDDVYLKLLVKLYRFLVRRTGS+FNAVIL+RLFMSK NKP
Sbjct  1    MGIDLKAGGRSKKARRTAPKSDDVYLKLLVKLYRFLVRRTGSRFNAVILRRLFMSKVNKP  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLSL RL++F  GKEDKIAV+VGT+TDD R YEVPA+KV ALRFT+TARARI KAGGECL
Sbjct  61   PLSLKRLVTFMQGKEDKIAVIVGTVTDDKRVYEVPAMKVTALRFTETARARIVKAGGECL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFG APGVPHSHTKPYVR+
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGKAPGVPHSHTKPYVRS  168



>ref|XP_010273829.1| PREDICTED: 60S ribosomal protein L18-2-like [Nelumbo nucifera]
Length=187

 Score =   303 bits (776),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 147/168 (88%), Positives = 157/168 (93%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMS+ NKP
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSRVNKP  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            P+SLSRLI F  GKEDKIAV+VG +TDD R YE+PALKV ALRFT+TARARI KAGGECL
Sbjct  61   PISLSRLIKFMKGKEDKIAVVVGAVTDDTRVYELPALKVTALRFTETARARILKAGGECL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFG APGVPHSHTKPYVR+
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGKAPGVPHSHTKPYVRS  168



>gb|KFK26512.1| hypothetical protein AALP_AA8G258600 [Arabis alpina]
Length=187

 Score =   303 bits (776),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 149/168 (89%), Positives = 157/168 (93%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK+TKRTAPKSDDVYLKLLVKLYRFLVRR+ SKFNAVILKRLFMSK NK 
Sbjct  1    MGIDLIAGGKSKKTKRTAPKSDDVYLKLLVKLYRFLVRRSDSKFNAVILKRLFMSKVNKA  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLSLSRL  F  GKEDKIAVLVGTITDD+R +E+PALKV ALRFT+ ARARIEKAGGECL
Sbjct  61   PLSLSRLAEFLKGKEDKIAVLVGTITDDLRVHEIPALKVTALRFTERARARIEKAGGECL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSH+KPYVR+
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHSKPYVRS  168



>gb|KJB82634.1| hypothetical protein B456_013G206100 [Gossypium raimondii]
Length=184

 Score =   303 bits (775),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 149/168 (89%), Positives = 158/168 (94%), Gaps = 3/168 (2%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK+TKRTAPKSDD+YLKLLVK+YRFLVRRTGSKFNAVILKRLFMSK NKP
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSDDIYLKLLVKIYRFLVRRTGSKFNAVILKRLFMSKVNKP  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLSLSRLI F  GK   IAV+VGT+TDD+R YEVPALKV ALRFT+TARARIEKAGGECL
Sbjct  61   PLSLSRLIEFMKGK---IAVVVGTVTDDIRVYEVPALKVTALRFTETARARIEKAGGECL  117

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPAPGVPHSHTKPYVR+
Sbjct  118  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPAPGVPHSHTKPYVRS  165



>ref|XP_011079632.1| PREDICTED: 60S ribosomal protein L18-2 [Sesamum indicum]
 ref|XP_011084062.1| PREDICTED: 60S ribosomal protein L18-2 [Sesamum indicum]
Length=187

 Score =   303 bits (775),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 145/168 (86%), Positives = 159/168 (95%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK+TKRTAPKS+D+YLKLLVKLYRFLVRRTGS+FNAV+LKRLFMS+ N+P
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSNDIYLKLLVKLYRFLVRRTGSRFNAVVLKRLFMSRVNRP  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLSLSRLIS   GKEDKIAVLVG++TDD+R +EVPALKV ALRFT+TARARIEKAGGECL
Sbjct  61   PLSLSRLISLMNGKEDKIAVLVGSVTDDIRVHEVPALKVTALRFTETARARIEKAGGECL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLALRAPLGQNTVLLRG + +REAVKHFGPAPGVPHSHTKPYVRA
Sbjct  121  TFDQLALRAPLGQNTVLLRGSRKAREAVKHFGPAPGVPHSHTKPYVRA  168



>gb|AAA69928.1| cytoplasmic ribosomal protein L18 [Arabidopsis thaliana]
Length=187

 Score =   303 bits (775),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 147/168 (88%), Positives = 156/168 (93%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK+TKRTAPKSDDVYLKL VKLYRFLVRRT SKFN VILKRLFMSK N+ 
Sbjct  1    MGIDLIAGGKSKKTKRTAPKSDDVYLKLTVKLYRFLVRRTNSKFNGVILKRLFMSKVNRA  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLSLSRL+ F  GKEDKIAVLVGTITDD+R +E+PA+KV ALRFT+ ARARIEKAGGECL
Sbjct  61   PLSLSRLVEFMTGKEDKIAVLVGTITDDLRVHEIPAMKVTALRFTERARARIEKAGGECL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSH+KPYVRA
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHSKPYVRA  168



>ref|XP_002882427.1| hypothetical protein ARALYDRAFT_477850 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58686.1| hypothetical protein ARALYDRAFT_477850 [Arabidopsis lyrata subsp. 
lyrata]
Length=187

 Score =   303 bits (775),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 147/168 (88%), Positives = 156/168 (93%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK+TKRTAPKSDDVYLKL VKLYRFLVRRT SKFNAVILKRLFMSK NK 
Sbjct  1    MGIDLIAGGKSKKTKRTAPKSDDVYLKLTVKLYRFLVRRTQSKFNAVILKRLFMSKVNKA  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLSLSRL+ F  GKEDKIAVLVGT+TDD+R +E+PA+KV ALRFT+ ARARIEKAGGECL
Sbjct  61   PLSLSRLVEFMTGKEDKIAVLVGTVTDDLRVHEIPAMKVTALRFTERARARIEKAGGECL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSH+KPYVR 
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHSKPYVRG  168



>ref|XP_011079633.1| PREDICTED: 60S ribosomal protein L18-2-like [Sesamum indicum]
Length=187

 Score =   302 bits (774),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 145/168 (86%), Positives = 159/168 (95%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK+TKRTAPKS+D+YLKLLVKLYRFLVRRTGS+FNAV+LKRLFMS+ N+P
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSNDIYLKLLVKLYRFLVRRTGSRFNAVVLKRLFMSRVNRP  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLSLSRLIS   GKEDKIAVLVG++TDD+R +EVPALKV ALRFT+TARARIEKAGGECL
Sbjct  61   PLSLSRLISLMNGKEDKIAVLVGSVTDDMRVHEVPALKVTALRFTETARARIEKAGGECL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLALRAPLGQNTVLLRG + +REAVKHFGPAPGVPHSHTKPYVRA
Sbjct  121  TFDQLALRAPLGQNTVLLRGSRKAREAVKHFGPAPGVPHSHTKPYVRA  168



>ref|XP_002512455.1| 60S ribosomal protein L18, putative [Ricinus communis]
 gb|EEF49907.1| 60S ribosomal protein L18, putative [Ricinus communis]
Length=403

 Score =   310 bits (793),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 149/169 (88%), Positives = 161/169 (95%), Gaps = 0/169 (0%)
 Frame = +3

Query  87   TMGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNK  266
            +MGIDLKAGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK NK
Sbjct  216  SMGIDLKAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKINK  275

Query  267  PPLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGEC  446
             PLSLSRLI+F  GKE K AV+VGT+TDD+R YEVPALKV AL+FT+TARARIEKAGGEC
Sbjct  276  APLSLSRLITFMKGKESKTAVVVGTVTDDIRVYEVPALKVTALKFTETARARIEKAGGEC  335

Query  447  LTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            LTFDQLA+RAPLGQNTVLLRGPKN+REAVKHFGPAPGVPHSHTKPYVR+
Sbjct  336  LTFDQLAMRAPLGQNTVLLRGPKNAREAVKHFGPAPGVPHSHTKPYVRS  384



>ref|XP_002271179.1| PREDICTED: 60S ribosomal protein L18-2 [Vitis vinifera]
Length=187

 Score =   301 bits (772),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 147/168 (88%), Positives = 157/168 (93%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK NKP
Sbjct  1    MGIDLVAGGKSKRTKRTAPKSDDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKVNKP  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLSLSRL+ +  GKE KIAV+VGT+TDD+R YEVP LKV ALRFT+ ARARIEKAGGECL
Sbjct  61   PLSLSRLVRYMDGKEGKIAVVVGTVTDDLRVYEVPCLKVTALRFTERARARIEKAGGECL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFG APGVPHSHTKPYVR+
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGKAPGVPHSHTKPYVRS  168



>ref|XP_010931680.1| PREDICTED: 60S ribosomal protein L18-2 [Elaeis guineensis]
Length=187

 Score =   301 bits (772),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 145/168 (86%), Positives = 157/168 (93%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGG+SK+ +RTAP+SDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK NKP
Sbjct  1    MGIDLVAGGRSKKARRTAPRSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKINKP  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            P+SL RLI F  GKEDKIAV+VGT+TDD R YEVPA+KV ALRFT+TARARI +AGGECL
Sbjct  61   PISLKRLIRFMEGKEDKIAVIVGTVTDDKRVYEVPAMKVTALRFTETARARILQAGGECL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPAPGVPHSHTKPYVR+
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPAPGVPHSHTKPYVRS  168



>ref|XP_006444385.1| hypothetical protein CICLE_v10022435mg [Citrus clementina]
 ref|XP_006479993.1| PREDICTED: 60S ribosomal protein L18-3-like [Citrus sinensis]
 gb|ESR57625.1| hypothetical protein CICLE_v10022435mg [Citrus clementina]
 gb|KDO87175.1| hypothetical protein CISIN_1g029841mg [Citrus sinensis]
 gb|KDO87176.1| hypothetical protein CISIN_1g029841mg [Citrus sinensis]
Length=187

 Score =   301 bits (771),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 145/168 (86%), Positives = 157/168 (93%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK++KRTAPKS+D+YLKLLVKLYRFLVRRT S F+ VILKRLFMSK NKP
Sbjct  1    MGIDLIAGGKSKKSKRTAPKSNDIYLKLLVKLYRFLVRRTDSNFDKVILKRLFMSKVNKP  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            P+SLSRL  F  GKEDKIAV+VGT+TDD+R YEVPALKV ALRFT+TARARIEKAGGECL
Sbjct  61   PMSLSRLTKFMKGKEDKIAVVVGTVTDDIRVYEVPALKVTALRFTETARARIEKAGGECL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPAPGVPHSHTKPYVR+
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPAPGVPHSHTKPYVRS  168



>emb|CDY18813.1| BnaAnng02780D [Brassica napus]
Length=249

 Score =   303 bits (777),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 148/168 (88%), Positives = 157/168 (93%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK+TKRTAPKSDDVYLKL VKLYRFLVRRT SKFNAVILKRLFMSK NK 
Sbjct  63   MGIDLIAGGKSKKTKRTAPKSDDVYLKLTVKLYRFLVRRTQSKFNAVILKRLFMSKVNKA  122

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLSLSRL+ F  GKEDKIAVLVGTITDD+R +E+PA+KV ALRFT+ ARARIEKAGGECL
Sbjct  123  PLSLSRLVEFMTGKEDKIAVLVGTITDDLRVHEIPAIKVTALRFTERARARIEKAGGECL  182

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSH+KPYVR+
Sbjct  183  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHSKPYVRS  230



>emb|CDY40718.1| BnaC03g34340D [Brassica napus]
Length=227

 Score =   302 bits (774),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 148/169 (88%), Positives = 157/169 (93%), Gaps = 0/169 (0%)
 Frame = +3

Query  87   TMGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNK  266
            TMGIDL AGGKSK+TKRTAPKSDDVYLKL VKLYRFLVRRT SKFNAVILKRLFMSK NK
Sbjct  40   TMGIDLIAGGKSKKTKRTAPKSDDVYLKLTVKLYRFLVRRTQSKFNAVILKRLFMSKVNK  99

Query  267  PPLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGEC  446
             PLSLSRL+ F  GKEDKIAVLVGTITDD+R +E+PA+KV ALRFT+ ARARIEKAGGEC
Sbjct  100  APLSLSRLVEFMTGKEDKIAVLVGTITDDLRVHEIPAIKVTALRFTERARARIEKAGGEC  159

Query  447  LTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            LTFDQLALRAPLGQNTVLLRGPKNSREAVKHFG APGVPHSH+KPYVR+
Sbjct  160  LTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGRAPGVPHSHSKPYVRS  208



>ref|XP_006408052.1| hypothetical protein EUTSA_v10021598mg [Eutrema salsugineum]
 gb|ESQ49505.1| hypothetical protein EUTSA_v10021598mg [Eutrema salsugineum]
Length=187

 Score =   300 bits (769),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 146/168 (87%), Positives = 155/168 (92%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK+TKRTAPKSDDVYLKL VKLYRFL RRT SKFN VILKRLFMSK NK 
Sbjct  1    MGIDLIAGGKSKKTKRTAPKSDDVYLKLTVKLYRFLFRRTNSKFNGVILKRLFMSKVNKA  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLSLSRL+ F  GKEDKIAVLVGTITDD+R +E+PA+KV ALRFT+ ARARIEKAGGECL
Sbjct  61   PLSLSRLVEFMTGKEDKIAVLVGTITDDLRVHEIPAIKVTALRFTERARARIEKAGGECL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSH+KPYVR+
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHSKPYVRS  168



>ref|XP_009124870.1| PREDICTED: 60S ribosomal protein L18-2-like [Brassica rapa]
Length=187

 Score =   300 bits (768),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 146/168 (87%), Positives = 156/168 (93%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK+TKRTAPKSDDVYLKL VKLYRFLVRRT SKFNAVILKRLFMSK NK 
Sbjct  1    MGIDLIAGGKSKKTKRTAPKSDDVYLKLTVKLYRFLVRRTQSKFNAVILKRLFMSKVNKA  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLSLSRL+ F  GKEDKIAVLVGTITDD+R +E+PA+KV ALRFT+ ARARIEKAGGECL
Sbjct  61   PLSLSRLVEFMTGKEDKIAVLVGTITDDLRVHEIPAIKVTALRFTERARARIEKAGGECL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLAL +PLGQNTVLLRGPKNSREAVKHFGPAPGVPHSH+KPYVR+
Sbjct  121  TFDQLALSSPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHSKPYVRS  168



>ref|XP_002874343.1| 60S ribosomal protein L18 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50602.1| 60S ribosomal protein L18 [Arabidopsis lyrata subsp. lyrata]
Length=187

 Score =   300 bits (768),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 147/167 (88%), Positives = 156/167 (93%), Gaps = 0/167 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK+TKRTAPKSDDVYLKLLVKLYRFLVRR+ SKFNAVILKRLFMSK NK 
Sbjct  1    MGIDLIAGGKSKKTKRTAPKSDDVYLKLLVKLYRFLVRRSESKFNAVILKRLFMSKVNKA  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLSLSRL+ F  GKEDKIAVLVGTITDD+R +E+PA+KV ALRFT+ ARARIEKAGGECL
Sbjct  61   PLSLSRLVEFMTGKEDKIAVLVGTITDDLRVHEIPAIKVTALRFTERARARIEKAGGECL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVR  590
            TFDQLAL+APLGQNTVLLRGPKNSREAVKHFGPAPGVPHS TKPYVR
Sbjct  121  TFDQLALKAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSSTKPYVR  167



>ref|XP_008775991.1| PREDICTED: 60S ribosomal protein L18-2 [Phoenix dactylifera]
Length=187

 Score =   300 bits (768),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 145/168 (86%), Positives = 156/168 (93%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGG+SK+ KRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK N+P
Sbjct  1    MGIDLVAGGRSKKAKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKINRP  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            P+SL +LI+F  GKEDKIAVLVGT+TDD R YEVPA+ V ALRFT+TARARI KAGGEC 
Sbjct  61   PISLKKLITFMEGKEDKIAVLVGTVTDDKRVYEVPAMTVTALRFTETARARILKAGGECW  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPAPGVPHSHTKPYVR+
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPAPGVPHSHTKPYVRS  168



>ref|NP_198137.1| 60S ribosomal protein L18-3 [Arabidopsis thaliana]
 sp|Q940B0.1|RL183_ARATH RecName: Full=60S ribosomal protein L18-3 [Arabidopsis thaliana]
 gb|AAL07220.1| putative 60S ribosomal protein [Arabidopsis thaliana]
 gb|AAM67529.1| putative 60S ribosomal protein [Arabidopsis thaliana]
 gb|AAN31854.1| putative 60S ribosomal protein [Arabidopsis thaliana]
 gb|AED93736.1| 60S ribosomal protein L18-3 [Arabidopsis thaliana]
Length=187

 Score =   300 bits (767),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 146/167 (87%), Positives = 156/167 (93%), Gaps = 0/167 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK+TKRTAPKSDDVYLKLLVKLYRFLVRR+ S FNAVILKRLFMSK NK 
Sbjct  1    MGIDLIAGGKSKKTKRTAPKSDDVYLKLLVKLYRFLVRRSNSNFNAVILKRLFMSKVNKA  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLSLSRL+ F  GK+DKIAVLVGTITDD+R +E+PA+KV ALRFT+ ARARIEKAGGECL
Sbjct  61   PLSLSRLVEFMTGKDDKIAVLVGTITDDLRVHEIPAMKVTALRFTERARARIEKAGGECL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVR  590
            TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHS+TKPYVR
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSNTKPYVR  167



>ref|XP_002465302.1| hypothetical protein SORBIDRAFT_01g035860 [Sorghum bicolor]
 gb|EER92300.1| hypothetical protein SORBIDRAFT_01g035860 [Sorghum bicolor]
Length=187

 Score =   299 bits (765),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 143/168 (85%), Positives = 157/168 (93%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGG++K+TKRTAPKSDDVYLKLLVKLYRFLVRRT S FNAVILKRLFMSKTN+P
Sbjct  1    MGIDLVAGGRNKKTKRTAPKSDDVYLKLLVKLYRFLVRRTKSNFNAVILKRLFMSKTNRP  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLSL RL++F  GKE++IAV+VGT+TDD R YEVPA+KV ALRFT+TARARI  AGGECL
Sbjct  61   PLSLRRLVNFMEGKENQIAVIVGTVTDDKRVYEVPAMKVAALRFTETARARIVNAGGECL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPAPGVPHSHTKPYVR+
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPAPGVPHSHTKPYVRS  168



>ref|XP_009151179.1| PREDICTED: 60S ribosomal protein L18-2 [Brassica rapa]
Length=187

 Score =   299 bits (765),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 146/168 (87%), Positives = 157/168 (93%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK+TKRTAPKSDDVYLKLLVKLYRFLVRRTGSKF+AVILKRLFMSK NK 
Sbjct  1    MGIDLIAGGKSKKTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFDAVILKRLFMSKVNKA  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLSLS+L+ F  GK+ KIAVLVGTITDD+R +E+PA+KV ALRFT+ ARARIEKAGGECL
Sbjct  61   PLSLSKLVEFMKGKDGKIAVLVGTITDDLRVHEIPAMKVTALRFTERARARIEKAGGECL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLAL APLGQNTVLLRGPKNSREAVKHFGPAPGVPHSH+KPYVRA
Sbjct  121  TFDQLALVAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHSKPYVRA  168



>ref|XP_004984437.1| PREDICTED: 60S ribosomal protein L18-2-like [Setaria italica]
Length=187

 Score =   298 bits (764),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 144/168 (86%), Positives = 157/168 (93%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGG++K+TKRTAPKSDDVYLKLLVKLYRFLVRRT S FNAVILKRLFMSKTN+P
Sbjct  1    MGIDLVAGGRNKKTKRTAPKSDDVYLKLLVKLYRFLVRRTKSDFNAVILKRLFMSKTNRP  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLSL RL++F  GKE++IAV+VGT+TDD R YEVPA+KV ALRFT+TARARI  AGGECL
Sbjct  61   PLSLRRLVNFMKGKENQIAVIVGTVTDDKRVYEVPAMKVAALRFTETARARIVNAGGECL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPAPGVPHSHTKPYVRA
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPAPGVPHSHTKPYVRA  168



>emb|CBI22977.3| unnamed protein product [Vitis vinifera]
Length=254

 Score =   301 bits (770),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 147/166 (89%), Positives = 156/166 (94%), Gaps = 0/166 (0%)
 Frame = +3

Query  96   IDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPL  275
            IDL AGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK NKPP+
Sbjct  70   IDLVAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKINKPPM  129

Query  276  SLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTF  455
            SLSRLI +  GKEDKIAVLVGT+TDD+R YEVP LKV ALRFT+ ARARIEKAGGECLTF
Sbjct  130  SLSRLIRYMQGKEDKIAVLVGTVTDDLRVYEVPTLKVTALRFTERARARIEKAGGECLTF  189

Query  456  DQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            DQLALRAPLGQNTVLLRGPKN+REAVKHFG APGVPHSHTKPYVR+
Sbjct  190  DQLALRAPLGQNTVLLRGPKNAREAVKHFGKAPGVPHSHTKPYVRS  235



>ref|XP_004494578.1| PREDICTED: 60S ribosomal protein L18-like [Cicer arietinum]
Length=187

 Score =   298 bits (764),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 142/168 (85%), Positives = 157/168 (93%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDLKAGGK+K+TKRT+PKS+D+YLKLLVKLYRFLVRRT S FNAVILKRLFMSK N+P
Sbjct  1    MGIDLKAGGKNKKTKRTSPKSNDIYLKLLVKLYRFLVRRTDSNFNAVILKRLFMSKVNRP  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLSLSRLI +  GKE KI V+VG +TDD+R Y+VPA+KV ALRFT+TARARIEKAGGECL
Sbjct  61   PLSLSRLIKYMQGKEGKIGVVVGAVTDDIRVYDVPAIKVTALRFTETARARIEKAGGECL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPAPGVPHSHTKPYVR+
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPAPGVPHSHTKPYVRS  168



>ref|XP_006298640.1| hypothetical protein CARUB_v10014730mg [Capsella rubella]
 gb|EOA31538.1| hypothetical protein CARUB_v10014730mg [Capsella rubella]
Length=187

 Score =   298 bits (763),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 146/167 (87%), Positives = 154/167 (92%), Gaps = 0/167 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK+TKRTAPKSDDVYLKL VKLYRFLVRRT SKFNAVILKRLFMSK NK 
Sbjct  1    MGIDLIAGGKSKKTKRTAPKSDDVYLKLTVKLYRFLVRRTQSKFNAVILKRLFMSKVNKA  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLSLSRL+ F  GKEDKIAVLVGT+TDDVR +E+PA+KV ALRFT+ ARARIEKAGGECL
Sbjct  61   PLSLSRLVEFMEGKEDKIAVLVGTVTDDVRVHEIPAMKVTALRFTERARARIEKAGGECL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVR  590
            TFDQLALRAPLGQNT+LLRGPKNSREAVKHFG APGVPHS TKPYVR
Sbjct  121  TFDQLALRAPLGQNTILLRGPKNSREAVKHFGLAPGVPHSDTKPYVR  167



>emb|CBI36879.3| unnamed protein product [Vitis vinifera]
Length=297

 Score =   302 bits (773),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 147/168 (88%), Positives = 157/168 (93%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK NKP
Sbjct  111  MGIDLVAGGKSKRTKRTAPKSDDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKVNKP  170

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLSLSRL+ +  GKE KIAV+VGT+TDD+R YEVP LKV ALRFT+ ARARIEKAGGECL
Sbjct  171  PLSLSRLVRYMDGKEGKIAVVVGTVTDDLRVYEVPCLKVTALRFTERARARIEKAGGECL  230

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFG APGVPHSHTKPYVR+
Sbjct  231  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGKAPGVPHSHTKPYVRS  278



>ref|XP_009129884.1| PREDICTED: 60S ribosomal protein L18-2-like [Brassica rapa]
Length=222

 Score =   299 bits (765),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 146/168 (87%), Positives = 157/168 (93%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK+TKRTAPKSDDVYLKLLVKLYRFLVRRTGSKF+AVILKRLFMSK NK 
Sbjct  36   MGIDLIAGGKSKKTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFDAVILKRLFMSKVNKA  95

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLSLS+L+ F  GK+ KIAVLVGTITDD+R +E+PA+KV ALRFT+ ARARIEKAGGECL
Sbjct  96   PLSLSKLVEFMKGKDGKIAVLVGTITDDLRVHEIPAMKVTALRFTERARARIEKAGGECL  155

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLAL APLGQNTVLLRGPKNSREAVKHFGPAPGVPHSH+KPYVRA
Sbjct  156  TFDQLALVAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHSKPYVRA  203



>ref|XP_010269589.1| PREDICTED: 60S ribosomal protein L18-3 [Nelumbo nucifera]
Length=187

 Score =   297 bits (761),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 144/168 (86%), Positives = 156/168 (93%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK+TKRTAPKS+D+YLKLLVKLYRFLVRRTGS FNAVILKRLFMS+ NK 
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSNDIYLKLLVKLYRFLVRRTGSNFNAVILKRLFMSRVNKA  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            P+SLSRLI +  GKE+KIAVLVGT+TDD R Y+VPALKV ALRFT+TARARI KAGGECL
Sbjct  61   PMSLSRLIRYMEGKENKIAVLVGTVTDDTRVYDVPALKVTALRFTETARARILKAGGECL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFG APGVPHSHTKPYVR+
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGKAPGVPHSHTKPYVRS  168



>emb|CDY66803.1| BnaAnng22990D, partial [Brassica napus]
Length=200

 Score =   298 bits (762),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 146/168 (87%), Positives = 157/168 (93%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK+TKRTAPKSDDVYLKLLVKLYRFLVRRTGSKF+AVILKRLFMSK NK 
Sbjct  14   MGIDLIAGGKSKKTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFDAVILKRLFMSKVNKA  73

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLSLS+L+ F  GK+ KIAVLVGTITDD+R +E+PA+KV ALRFT+ ARARIEKAGGECL
Sbjct  74   PLSLSKLVEFMNGKDGKIAVLVGTITDDLRVHEIPAMKVTALRFTERARARIEKAGGECL  133

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLAL APLGQNTVLLRGPKNSREAVKHFGPAPGVPHSH+KPYVRA
Sbjct  134  TFDQLALVAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHSKPYVRA  181



>ref|XP_009111741.1| PREDICTED: 60S ribosomal protein L18-2-like [Brassica rapa]
Length=187

 Score =   297 bits (761),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 146/168 (87%), Positives = 156/168 (93%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK+TKRTAPKSDDVYLKLLVKLYRFLVRRTGSKF+AVILKRLFMSK NK 
Sbjct  1    MGIDLIAGGKSKKTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFDAVILKRLFMSKVNKA  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLSLS+L+ F  GK+ KIAVLVGTITDD+R +E+PA+KV ALRFT+ ARARIEKAGGECL
Sbjct  61   PLSLSKLVEFMKGKDGKIAVLVGTITDDLRVHEIPAMKVTALRFTERARARIEKAGGECL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLAL APLGQNTVLLRGPKNSREAVKHFG APGVPHSHTKPYVRA
Sbjct  121  TFDQLALVAPLGQNTVLLRGPKNSREAVKHFGKAPGVPHSHTKPYVRA  168



>ref|XP_003591163.1| Ribosomal protein L18 [Medicago truncatula]
 gb|AES61414.1| 60S ribosomal protein L18-3 [Medicago truncatula]
Length=187

 Score =   297 bits (760),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 145/168 (86%), Positives = 154/168 (92%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDLKAGGK+K+TKRTAPKS+D+YLKLLVKLYRFLVRRTGS FNAVILKRLFMSK NKP
Sbjct  1    MGIDLKAGGKNKKTKRTAPKSNDIYLKLLVKLYRFLVRRTGSNFNAVILKRLFMSKVNKP  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLSLSRLI +T GKE KIAV+VG ITDDVR  EVPA+KV ALRFT+ ARARIE AGGECL
Sbjct  61   PLSLSRLIKYTNGKEGKIAVVVGAITDDVRVNEVPAIKVTALRFTERARARIESAGGECL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFG APGVP SHTKPYVR 
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGRAPGVPQSHTKPYVRG  168



>gb|KEH24393.1| 60S ribosomal protein L18-3 [Medicago truncatula]
Length=188

 Score =   297 bits (760),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 144/168 (86%), Positives = 155/168 (92%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDLKAGGKSK+TKRTAPKS+D+YLKLLVKLYRFLVRRT S FN VILKRLFMSK NKP
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSNDIYLKLLVKLYRFLVRRTESNFNKVILKRLFMSKVNKP  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLSLSRLI +T GKE KIAV+VG +TDD+R YEVPA+KV ALRFT+ ARARIEKAGGECL
Sbjct  61   PLSLSRLIRYTKGKEGKIAVVVGAVTDDIRVYEVPAIKVTALRFTEKARARIEKAGGECL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFG APGVPHS+TKPYVR 
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGRAPGVPHSNTKPYVRG  168



>gb|AFK34017.1| unknown [Medicago truncatula]
Length=188

 Score =   297 bits (760),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 144/168 (86%), Positives = 155/168 (92%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDLKAGGKSK+TKRTAPKS+D+YLKLLVKLYRFLVRRT S FN VILKRLFMSK NKP
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSNDIYLKLLVKLYRFLVRRTESNFNKVILKRLFMSKVNKP  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLSLSRLI +T GKE KIAV+VG +TDD+R YEVPA+KV ALRFT+ ARARIEKAGGECL
Sbjct  61   PLSLSRLIRYTKGKEGKIAVVVGAVTDDIRVYEVPAIKVTALRFTEKARARIEKAGGECL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFG APGVPHS+TKPYVR 
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGRAPGVPHSNTKPYVRG  168



>gb|ACJ85943.1| unknown [Medicago truncatula]
 gb|AFK48653.1| unknown [Medicago truncatula]
Length=174

 Score =   296 bits (758),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 144/168 (86%), Positives = 155/168 (92%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDLKAGGKSK+TKRTAPKS+D+YLKLLVKLYRFLVRRT S FN VILKRLFMSK NKP
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSNDIYLKLLVKLYRFLVRRTESNFNKVILKRLFMSKVNKP  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLSLSRLI +T GKE KIAV+VG +TDD+R YEVPA+KV ALRFT+ ARARIEKAGGECL
Sbjct  61   PLSLSRLIRYTKGKEGKIAVVVGAVTDDIRVYEVPAIKVTALRFTEKARARIEKAGGECL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFG APGVPHS+TKPYVR 
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGRAPGVPHSNTKPYVRG  168



>emb|CDY19736.1| BnaA09g03890D [Brassica napus]
Length=215

 Score =   298 bits (762),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 146/168 (87%), Positives = 156/168 (93%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK+TKRTAPKSDDVYLKLLVKLYRFLVRRTGSKF+AVILKRLFMSK NK 
Sbjct  29   MGIDLIAGGKSKKTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFDAVILKRLFMSKVNKA  88

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLSLS+L+ F  GK+ KIAVLVGTITDD+R +E+PA+KV ALRFT+ ARARIEKAGGECL
Sbjct  89   PLSLSKLVEFMKGKDGKIAVLVGTITDDLRVHEIPAMKVTALRFTERARARIEKAGGECL  148

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLAL APLGQNTVLLRGPKNSREAVKHFG APGVPHSHTKPYVRA
Sbjct  149  TFDQLALVAPLGQNTVLLRGPKNSREAVKHFGKAPGVPHSHTKPYVRA  196



>ref|XP_006394935.1| hypothetical protein EUTSA_v10004865mg [Eutrema salsugineum]
 gb|ESQ32221.1| hypothetical protein EUTSA_v10004865mg [Eutrema salsugineum]
Length=230

 Score =   298 bits (763),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 146/168 (87%), Positives = 158/168 (94%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK+TKRTAPKSDDVYLKLLVKLYRFLVRR+GSKFNAVILKRLFMSK NK 
Sbjct  44   MGIDLIAGGKSKKTKRTAPKSDDVYLKLLVKLYRFLVRRSGSKFNAVILKRLFMSKVNKA  103

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLSLSRL++F  GKE KIAVLVGTITDD+R +E+PA+KV ALRFT+ ARARIEKAGGECL
Sbjct  104  PLSLSRLVTFMKGKEGKIAVLVGTITDDLRIHEIPAMKVTALRFTERARARIEKAGGECL  163

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLAL+APLGQNTVLLRGPKNSREAVKHFG APGVPHS+TKPYVR+
Sbjct  164  TFDQLALKAPLGQNTVLLRGPKNSREAVKHFGLAPGVPHSNTKPYVRS  211



>ref|XP_009417724.1| PREDICTED: 60S ribosomal protein L18-2 [Musa acuminata subsp. 
malaccensis]
Length=187

 Score =   296 bits (759),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 142/168 (85%), Positives = 157/168 (93%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGID+ AGG+SK+ +RTAP+SDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK N+P
Sbjct  1    MGIDIVAGGRSKKARRTAPRSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKINRP  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            P+SL RLI+F  GK+DKIAV+VGT+TDD R YEVPA+KV ALRFT+TARARI KAGGECL
Sbjct  61   PISLKRLITFMNGKDDKIAVIVGTVTDDKRVYEVPAMKVTALRFTETARARILKAGGECL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFG APGVPHSHTKPYVR+
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGKAPGVPHSHTKPYVRS  168



>ref|XP_002461201.1| hypothetical protein SORBIDRAFT_02g042750 [Sorghum bicolor]
 gb|EER97722.1| hypothetical protein SORBIDRAFT_02g042750 [Sorghum bicolor]
Length=187

 Score =   296 bits (758),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 142/168 (85%), Positives = 155/168 (92%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGG++K+TKRTAPKSDDVYLKLLVKLYRFLVRRT S FNAVILKRLFMSKTN+P
Sbjct  1    MGIDLVAGGRNKKTKRTAPKSDDVYLKLLVKLYRFLVRRTKSNFNAVILKRLFMSKTNRP  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLS+ RL+ F  GK D+IAV+VGT+TDD R  EVPA+KVCALRFT+TARARI  AGGECL
Sbjct  61   PLSMRRLVKFMEGKSDQIAVIVGTVTDDKRINEVPAMKVCALRFTETARARIINAGGECL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPAPGVPHSHTKPYVR+
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPAPGVPHSHTKPYVRS  168



>emb|CDX99969.1| BnaC09g03320D [Brassica napus]
Length=210

 Score =   297 bits (760),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 146/168 (87%), Positives = 156/168 (93%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK+TKRTAPKSDDVYLKLLVKLYRFLVRRTGSKF+AVILKRLFMSK NK 
Sbjct  24   MGIDLIAGGKSKKTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFDAVILKRLFMSKVNKA  83

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLSLS+L+ F  GK+ KIAVLVGTITDD+R +E+PA+KV ALRFT+ ARARIEKAGGECL
Sbjct  84   PLSLSKLVEFMKGKDGKIAVLVGTITDDLRVHEIPAMKVTALRFTERARARIEKAGGECL  143

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLAL APLGQNTVLLRGPKNSREAVKHFG APGVPHSHTKPYVRA
Sbjct  144  TFDQLALVAPLGQNTVLLRGPKNSREAVKHFGKAPGVPHSHTKPYVRA  191



>gb|EMS45435.1| 60S ribosomal protein L18-2 [Triticum urartu]
Length=187

 Score =   296 bits (757),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 141/168 (84%), Positives = 156/168 (93%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGG++K+TKRTAPKSDDVYLKLLVKLYRFLVRRT S+FNAVILKRLFMSKTN+P
Sbjct  1    MGIDLVAGGRNKRTKRTAPKSDDVYLKLLVKLYRFLVRRTKSQFNAVILKRLFMSKTNRP  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLS+ RL+ F  GKEDKIAV+VGTITDD R YE+PA+KV ALRFT+TARARI  AGGECL
Sbjct  61   PLSMRRLVRFMEGKEDKIAVIVGTITDDQRVYEIPAMKVAALRFTETARARIVNAGGECL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLALRAPLGQNT+LLRGPKN+REAV+HFG APGVPHSHTKPYVR+
Sbjct  121  TFDQLALRAPLGQNTLLLRGPKNAREAVRHFGKAPGVPHSHTKPYVRS  168



>ref|XP_008810211.1| PREDICTED: 60S ribosomal protein L18-2-like [Phoenix dactylifera]
Length=187

 Score =   295 bits (756),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 143/168 (85%), Positives = 154/168 (92%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGG+SK+ +RTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK N+P
Sbjct  1    MGIDLVAGGRSKKARRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKINRP  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            P+SL RLI F  GKEDKI V+VGT+TDD R YEVPA+KV ALRFT+TARARI  AGGECL
Sbjct  61   PISLKRLIRFMEGKEDKIVVIVGTVTDDKRVYEVPAMKVTALRFTETARARILNAGGECL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFG APGVPHSHTKPYVR+
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGLAPGVPHSHTKPYVRS  168



>ref|XP_006288739.1| hypothetical protein CARUB_v10002048mg [Capsella rubella]
 gb|EOA21637.1| hypothetical protein CARUB_v10002048mg [Capsella rubella]
Length=187

 Score =   295 bits (756),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 144/168 (86%), Positives = 155/168 (92%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK+TKRTAPKSDDVYLKLLVKLYRFLVRR+ SKFNAVILKRLFMSK NK 
Sbjct  1    MGIDLIAGGKSKKTKRTAPKSDDVYLKLLVKLYRFLVRRSNSKFNAVILKRLFMSKVNKA  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLSLS+L+SF  GK+ KI VLVGTITDD+R  E+PA+K+ ALRFT+ ARARIEKAGGECL
Sbjct  61   PLSLSKLVSFMEGKDGKIGVLVGTITDDLRIQEIPAMKITALRFTERARARIEKAGGECL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLAL+APLGQNTVLLRGPKNSREAVKHFGPAPGVPHS TKPYVRA
Sbjct  121  TFDQLALKAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSSTKPYVRA  168



>ref|XP_010486014.1| PREDICTED: 60S ribosomal protein L18-3 [Camelina sativa]
Length=187

 Score =   295 bits (756),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 144/167 (86%), Positives = 154/167 (92%), Gaps = 0/167 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK+T+RTAPKSDDVYLKL VKLYRFLVRRT SKFNAVILKRLFMSK NK 
Sbjct  1    MGIDLIAGGKSKKTRRTAPKSDDVYLKLTVKLYRFLVRRTESKFNAVILKRLFMSKVNKA  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLSLSRL+ F  GKEDKIAVLVGT+TDD+R +E+PA+KV ALRFT+ ARARIEKAGGECL
Sbjct  61   PLSLSRLVEFMSGKEDKIAVLVGTVTDDLRVHEIPAMKVTALRFTERARARIEKAGGECL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVR  590
            TFDQLALRAPLGQNT+LLRGPKNSREAVKHFG APGVPHS TKPYVR
Sbjct  121  TFDQLALRAPLGQNTILLRGPKNSREAVKHFGLAPGVPHSDTKPYVR  167



>ref|XP_008784768.1| PREDICTED: 60S ribosomal protein L18-2-like [Phoenix dactylifera]
Length=187

 Score =   295 bits (756),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 141/168 (84%), Positives = 157/168 (93%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGG+SK+ +RTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK N+P
Sbjct  1    MGIDLIAGGRSKKARRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKINRP  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            P+SL RL++F  GK+DKIAV+VGT+TDD R YEVPA+KV ALRFT+TARARI KAGGECL
Sbjct  61   PISLKRLVTFMQGKDDKIAVIVGTVTDDKRVYEVPAMKVTALRFTETARARILKAGGECL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLAL++PLGQNTVLLRGPKN+REAVKHFG APGVPHSHTKPYVR+
Sbjct  121  TFDQLALQSPLGQNTVLLRGPKNAREAVKHFGKAPGVPHSHTKPYVRS  168



>ref|XP_010429374.1| PREDICTED: 60S ribosomal protein L18-3-like [Camelina sativa]
Length=187

 Score =   295 bits (755),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 144/167 (86%), Positives = 154/167 (92%), Gaps = 0/167 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK+T+RTAPKSDDVYLKL VKLYRFLVRRT SKFNAVILKRLFMSK NK 
Sbjct  1    MGIDLIAGGKSKKTRRTAPKSDDVYLKLTVKLYRFLVRRTQSKFNAVILKRLFMSKVNKA  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            P+SLSRL+ F  GKEDKIAVLVGTITDD+R +E+PA+KV ALRFT+ ARARIEKAGGECL
Sbjct  61   PISLSRLVEFMSGKEDKIAVLVGTITDDLRVHEIPAMKVTALRFTERARARIEKAGGECL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVR  590
            TFDQLALRAPLGQNT+LLRGPKNSREAVKHFG APGVPHS TKPYVR
Sbjct  121  TFDQLALRAPLGQNTILLRGPKNSREAVKHFGLAPGVPHSDTKPYVR  167



>ref|XP_010455077.1| PREDICTED: 60S ribosomal protein L18-3-like isoform X1 [Camelina 
sativa]
Length=187

 Score =   295 bits (755),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 143/168 (85%), Positives = 156/168 (93%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK+TKRTAPKSDDVYLKLLVKLYRFLVRR+ SKFNAVILKRLFMSK NK 
Sbjct  1    MGIDLIAGGKSKKTKRTAPKSDDVYLKLLVKLYRFLVRRSESKFNAVILKRLFMSKVNKA  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLSLS+L+SF  GK+ KI VLVGTITDD+R +++PA+K+ ALRFT+ ARARIEKAGGECL
Sbjct  61   PLSLSKLVSFMNGKDGKIGVLVGTITDDLRVHDIPAMKITALRFTERARARIEKAGGECL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLAL+APLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVR 
Sbjct  121  TFDQLALKAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRG  168



>ref|XP_010914484.1| PREDICTED: 60S ribosomal protein L18-3 [Elaeis guineensis]
Length=187

 Score =   295 bits (754),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 143/168 (85%), Positives = 154/168 (92%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGG+SK+ +RTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK NKP
Sbjct  1    MGIDLVAGGRSKKARRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKINKP  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            P+SL RL  F  GK+DKIAV+VGT+TDD R YEVPA+KV ALRFT+T RARI KAGGECL
Sbjct  61   PISLKRLAKFMEGKDDKIAVIVGTVTDDKRVYEVPAMKVTALRFTETVRARILKAGGECL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPAPGVPHS TKPYVR+
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPAPGVPHSRTKPYVRS  168



>ref|XP_009384409.1| PREDICTED: 60S ribosomal protein L18-2 [Musa acuminata subsp. 
malaccensis]
Length=187

 Score =   295 bits (754),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 141/168 (84%), Positives = 157/168 (93%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGG+SK+ +RTAP+SDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK N+P
Sbjct  1    MGIDLVAGGRSKKARRTAPRSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKINRP  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            P+SL RLI+F  GK++KIAV+VGT+TDD R YEVPALKV ALRFT+TARARI KAGGECL
Sbjct  61   PISLKRLITFMNGKDNKIAVIVGTVTDDKRVYEVPALKVTALRFTETARARILKAGGECL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLALRAPLGQNTVLLRGPKN+REAV+HFG APGVPHSHTKPY+R+
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNAREAVRHFGKAPGVPHSHTKPYIRS  168



>ref|XP_010464086.1| PREDICTED: 60S ribosomal protein L18-3-like [Camelina sativa]
Length=187

 Score =   295 bits (754),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 143/167 (86%), Positives = 154/167 (92%), Gaps = 0/167 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK+T+RTAPKSDDVYLKL VKLYRFLVRRT SKFNAVILKRLFMSK NK 
Sbjct  1    MGIDLIAGGKSKKTRRTAPKSDDVYLKLTVKLYRFLVRRTESKFNAVILKRLFMSKVNKA  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLSLSRL+ F  GKEDKIAVLVGT+TDD+R +E+PA+K+ ALRFT+ ARARIEKAGGECL
Sbjct  61   PLSLSRLVEFMSGKEDKIAVLVGTVTDDLRVHEIPAMKITALRFTERARARIEKAGGECL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVR  590
            TFDQLALRAPLGQNT+LLRGPKNSREAVKHFG APGVPHS TKPYVR
Sbjct  121  TFDQLALRAPLGQNTILLRGPKNSREAVKHFGLAPGVPHSDTKPYVR  167



>ref|XP_009402513.1| PREDICTED: 60S ribosomal protein L18-2-like [Musa acuminata subsp. 
malaccensis]
Length=187

 Score =   295 bits (754),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 141/168 (84%), Positives = 156/168 (93%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGG+SK+ +RTA +SDDVYLKLLVKLYRFLVRRTGSKFNAVIL+RLFMSK N+P
Sbjct  1    MGIDLVAGGRSKKARRTASRSDDVYLKLLVKLYRFLVRRTGSKFNAVILRRLFMSKINRP  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            P+SL RLI+F  GK+DKIAV+VGT+TDD R YEVPA+KV ALRFT+TARARI KAGGECL
Sbjct  61   PISLKRLITFMQGKDDKIAVIVGTVTDDKRVYEVPAMKVTALRFTETARARILKAGGECL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFG APGVPHSHTKPYVR+
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGKAPGVPHSHTKPYVRS  168



>ref|XP_010421566.1| PREDICTED: 60S ribosomal protein L18-2-like [Camelina sativa]
Length=187

 Score =   294 bits (753),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 142/168 (85%), Positives = 156/168 (93%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK+TKRTAPKSDDVYLKLLVKLYRFLVRR+ SKFNAVILKRLFMSK NK 
Sbjct  1    MGIDLIAGGKSKKTKRTAPKSDDVYLKLLVKLYRFLVRRSESKFNAVILKRLFMSKVNKA  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLSLS+L+SF  GK+ KI VLVGTITDD+R +++PA+K+ ALRFT+ ARARIEKAGGECL
Sbjct  61   PLSLSKLVSFMNGKDGKIGVLVGTITDDLRVHDIPAMKITALRFTERARARIEKAGGECL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLAL+APLGQNTVLLRGPKNSREAVKHFGPAPGVPHSH+KPYVR 
Sbjct  121  TFDQLALKAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHSKPYVRG  168



>ref|NP_001131538.1| uncharacterized protein LOC100192878 [Zea mays]
 gb|ACG24841.1| 60S ribosomal protein L18 [Zea mays]
 gb|ACG31936.1| 60S ribosomal protein L18 [Zea mays]
 tpg|DAA64098.1| TPA: ribosomal protein L18 [Zea mays]
Length=187

 Score =   294 bits (752),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 141/168 (84%), Positives = 155/168 (92%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGG++K+TKRTAPKSDDVYLKLLVKLYRFLVRRT S FNAVILKRLFMSKTN+P
Sbjct  1    MGIDLVAGGRNKKTKRTAPKSDDVYLKLLVKLYRFLVRRTKSNFNAVILKRLFMSKTNRP  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLS+ RL+ F  GK D+IAV+VGT+TDD R  EVPA+KVCALRFT+TARARI  AGGECL
Sbjct  61   PLSMRRLVRFMEGKGDQIAVIVGTVTDDKRISEVPAMKVCALRFTETARARIINAGGECL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLALRAPLGQNTVLLRGPKN+REAV+HFGPAPGVPHSHTKPYVR+
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNAREAVRHFGPAPGVPHSHTKPYVRS  168



>ref|XP_009411663.1| PREDICTED: 60S ribosomal protein L18-3-like [Musa acuminata subsp. 
malaccensis]
Length=187

 Score =   293 bits (750),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 141/168 (84%), Positives = 157/168 (93%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGID+ AGG+SK+ +RTAP+SDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK N+P
Sbjct  1    MGIDIVAGGRSKKARRTAPRSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKINRP  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            P+SL RLI+F  GK++KIAV+VGT+TDD R YEVPALKV ALRFT+TARARI KAGGECL
Sbjct  61   PISLKRLITFMNGKDNKIAVIVGTVTDDKRVYEVPALKVTALRFTETARARILKAGGECL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFG APGVPHS+TKPYVR+
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGKAPGVPHSNTKPYVRS  168



>gb|EMT12638.1| 60S ribosomal protein L18-2 [Aegilops tauschii]
Length=187

 Score =   293 bits (750),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 140/168 (83%), Positives = 155/168 (92%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGG++K+TKRTAPKSDDVYLKLLVKLYRFLVRRT S+FNAVILKRLFMSKTN+P
Sbjct  1    MGIDLVAGGRNKRTKRTAPKSDDVYLKLLVKLYRFLVRRTKSQFNAVILKRLFMSKTNRP  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLS+ RL+ F  GK DKIAV+VGTITDD R YE+PA+KV ALRFT+TARARI  AGGECL
Sbjct  61   PLSMRRLVRFMEGKADKIAVIVGTITDDQRVYEIPAMKVAALRFTETARARIVNAGGECL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLALRAPLGQNT+LLRGPKN+REAV+HFG APGVPHSHTKPYVR+
Sbjct  121  TFDQLALRAPLGQNTLLLRGPKNAREAVRHFGKAPGVPHSHTKPYVRS  168



>emb|CDX80616.1| BnaC07g28280D [Brassica napus]
Length=232

 Score =   295 bits (754),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 144/168 (86%), Positives = 156/168 (93%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK+TKRTAPKSDDVYLKLLVKLYRFLVRRTGSKF+AVILKRLFMSK NK 
Sbjct  46   MGIDLIAGGKSKKTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFDAVILKRLFMSKVNKA  105

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLSLS+L+ F  GK+ KIAVLVGTITDD+R +E+PA+KV ALRFT+ ARARIEKAGGECL
Sbjct  106  PLSLSKLVEFMKGKDGKIAVLVGTITDDLRVHEIPAMKVTALRFTERARARIEKAGGECL  165

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLAL APLGQNTVLLRGPKNSREAVKHFG APGVPHSH+KPYVR+
Sbjct  166  TFDQLALVAPLGQNTVLLRGPKNSREAVKHFGLAPGVPHSHSKPYVRS  213



>gb|KFK37967.1| hypothetical protein AALP_AA3G053100 [Arabis alpina]
Length=187

 Score =   293 bits (750),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 143/168 (85%), Positives = 153/168 (91%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK+TKRTAPKSDDVYLKL VKLYRFLVRRT S FN VILKRLFMSK NK 
Sbjct  1    MGIDLIAGGKSKKTKRTAPKSDDVYLKLTVKLYRFLVRRTQSNFNKVILKRLFMSKVNKA  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLSLSRL+    GK+DKIAVLVGTITDDVR +++PA+KV ALRFT+ ARARI KAGGECL
Sbjct  61   PLSLSRLVELMSGKDDKIAVLVGTITDDVRVHDIPAIKVAALRFTERARARIVKAGGECL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSH+KPYVR+
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHSKPYVRS  168



>emb|CDY25018.1| BnaC02g39900D [Brassica napus]
Length=197

 Score =   293 bits (750),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 144/168 (86%), Positives = 155/168 (92%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK+TKRTAPKSDDVYLKLLVKLYRFLVRRTGSKF+AVILKRLFMSK NK 
Sbjct  11   MGIDLIAGGKSKKTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFDAVILKRLFMSKVNKA  70

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLSLS+L  F  GK+ KIAVLVGTITDD+R +E+PA+KV ALRFT+ ARARIEKAGGECL
Sbjct  71   PLSLSKLAEFMKGKDGKIAVLVGTITDDLRVHEIPAMKVTALRFTERARARIEKAGGECL  130

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLAL APLGQNTVLLRGPKNSREAVKHFG APGVPHSH+KPYVR+
Sbjct  131  TFDQLALVAPLGQNTVLLRGPKNSREAVKHFGLAPGVPHSHSKPYVRS  178



>gb|ABK26318.1| unknown [Picea sitchensis]
Length=187

 Score =   293 bits (749),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 143/168 (85%), Positives = 155/168 (92%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSKQT+RTAPKS+D+YLKLLVKLYRFLVRRT S+FNAVILKRLFMSKTNKP
Sbjct  1    MGIDLIAGGKSKQTRRTAPKSEDIYLKLLVKLYRFLVRRTSSRFNAVILKRLFMSKTNKP  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLSLSRL  +  GKEDKIAV+VGTITDD R YE+P +K+ ALRFT+TARARI KAGGECL
Sbjct  61   PLSLSRLARYMQGKEDKIAVVVGTITDDNRVYELPPVKITALRFTETARARILKAGGECL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLALRAPLGQNTVLLRGPK+ REAVKHFG APGVPHSHTKPYVR+
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKSHREAVKHFGRAPGVPHSHTKPYVRS  168



>ref|XP_007050975.1| Ribosomal protein L18 isoform 2 [Theobroma cacao]
 gb|EOX95132.1| Ribosomal protein L18 isoform 2 [Theobroma cacao]
Length=180

 Score =   292 bits (748),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 145/168 (86%), Positives = 153/168 (91%), Gaps = 7/168 (4%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK++KRTAPKSDD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK NKP
Sbjct  1    MGIDLVAGGKSKKSKRTAPKSDDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKVNKP  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLSLSRLI F   KEDKIAV+VGT+TDD+R YEVPALKV ALRFT+TARARIEKAGGECL
Sbjct  61   PLSLSRLIEFMKCKEDKIAVVVGTVTDDIRVYEVPALKVTALRFTETARARIEKAGGECL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLALRAPLGQNT       NSREAVKHFGPAPGVPHSHTKPYVR+
Sbjct  121  TFDQLALRAPLGQNT-------NSREAVKHFGPAPGVPHSHTKPYVRS  161



>ref|XP_006855263.1| hypothetical protein AMTR_s00183p00048560 [Amborella trichopoda]
 gb|ERN16730.1| hypothetical protein AMTR_s00183p00048560 [Amborella trichopoda]
Length=187

 Score =   291 bits (746),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 143/168 (85%), Positives = 153/168 (91%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGID+ AGGKSK+T RTAPKS DVYLK+LVKLYRFLVRRTGSKFNAVILKRLFMSK NK 
Sbjct  1    MGIDIVAGGKSKKTHRTAPKSGDVYLKILVKLYRFLVRRTGSKFNAVILKRLFMSKVNKA  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLSLSRLI F  GKEDK+AV+VGT+TDD R YEVPALKV ALRFT+ ARARI KAGGECL
Sbjct  61   PLSLSRLIKFMAGKEDKVAVIVGTVTDDTRVYEVPALKVTALRFTERARARILKAGGECL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFD LALRAPLG+NTVLLRGPKN+REAVKHFG APGVPHSHTKPYVR+
Sbjct  121  TFDDLALRAPLGRNTVLLRGPKNAREAVKHFGKAPGVPHSHTKPYVRS  168



>ref|XP_004495692.1| PREDICTED: 60S ribosomal protein L18-like [Cicer arietinum]
Length=187

 Score =   291 bits (746),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 150/168 (89%), Positives = 160/168 (95%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDLKAGGKSK++KRTAPKS+D+YLKLLVKLYRFLVRRTGS FNAVILKRLFMSK NKP
Sbjct  1    MGIDLKAGGKSKKSKRTAPKSNDIYLKLLVKLYRFLVRRTGSNFNAVILKRLFMSKVNKP  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLSLSRLI +T GKE KIAV+VG ITDD+R YEVPA+KV ALRFT+TARARIEKAGGECL
Sbjct  61   PLSLSRLIKYTKGKEGKIAVVVGAITDDIRVYEVPAIKVTALRFTETARARIEKAGGECL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPAPGVPHSHTKPYVRA
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPAPGVPHSHTKPYVRA  168



>ref|XP_003626231.1| 60S ribosomal protein L18 [Medicago truncatula]
 gb|ACJ85938.1| unknown [Medicago truncatula]
 gb|AES82449.1| 60S ribosomal protein L18-3 [Medicago truncatula]
 gb|AFK48984.1| unknown [Medicago truncatula]
Length=187

 Score =   291 bits (745),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 137/168 (82%), Positives = 153/168 (91%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDLKAGGKSK TKRT PKS+D+YLKLLVKLYRFLVRRT S FNAVILKRLFMSK N+P
Sbjct  1    MGIDLKAGGKSKNTKRTEPKSNDIYLKLLVKLYRFLVRRTDSNFNAVILKRLFMSKVNRP  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            P+SLS++I +  GK+ KI V+VG +TDD+R YEVP LK+ ALRFT+TARARIEKAGGECL
Sbjct  61   PISLSKMIEYMKGKDGKIGVVVGAVTDDIRVYEVPVLKIAALRFTETARARIEKAGGECL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFG APGVPHSH+KPYVR+
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGRAPGVPHSHSKPYVRS  168



>ref|NP_001050069.1| Os03g0341100 [Oryza sativa Japonica Group]
 gb|ABF95861.1| 60S ribosomal protein L18, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF11983.1| Os03g0341100 [Oryza sativa Japonica Group]
 gb|EEC75232.1| hypothetical protein OsI_11506 [Oryza sativa Indica Group]
 gb|EEE59035.1| hypothetical protein OsJ_10788 [Oryza sativa Japonica Group]
Length=187

 Score =   291 bits (744),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 139/168 (83%), Positives = 155/168 (92%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGG++K+TKRTAPKSDDVYLKL+VKLYRFLVRRT S FNAVIL+RLFMSKTN+P
Sbjct  1    MGIDLVAGGRNKKTKRTAPKSDDVYLKLIVKLYRFLVRRTKSPFNAVILRRLFMSKTNRP  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLSL RL+ F  GKE++IAV+VGT+TDD R YEVPA+KV ALRFT+TARARI   GGECL
Sbjct  61   PLSLRRLVRFMEGKENQIAVIVGTVTDDKRVYEVPAMKVAALRFTETARARIVNTGGECL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPAPGVPHS+TKPYVR+
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPAPGVPHSNTKPYVRS  168



>ref|XP_009381102.1| PREDICTED: 60S ribosomal protein L18-2-like [Musa acuminata subsp. 
malaccensis]
Length=187

 Score =   290 bits (743),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 140/168 (83%), Positives = 155/168 (92%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGG+SK+ +RTAP+SDDVYLKLLVKLYRFLVRRT SKFNAVILKRLFMSK N+P
Sbjct  1    MGIDLVAGGRSKKARRTAPRSDDVYLKLLVKLYRFLVRRTESKFNAVILKRLFMSKNNRP  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            P+SL RLI+F   K+DKIAV+VGT+TDD R Y+VPA+KV ALRFT+TARARI KAGGECL
Sbjct  61   PISLKRLITFMERKDDKIAVIVGTVTDDKRVYDVPAMKVTALRFTETARARILKAGGECL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFG APGVPHSHTKPYVR+
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGKAPGVPHSHTKPYVRS  168



>ref|XP_003562459.1| PREDICTED: 60S ribosomal protein L18-3-like [Brachypodium distachyon]
Length=187

 Score =   290 bits (743),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 139/168 (83%), Positives = 154/168 (92%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGG++K+TKRTAPKSDDVYLKLLVKLYRFLVRRT S FNAVILKRLFMSKTN+P
Sbjct  1    MGIDLVAGGRNKKTKRTAPKSDDVYLKLLVKLYRFLVRRTKSHFNAVILKRLFMSKTNRP  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLS+ RL+ F  GK D+IAV+VGTITDD R YE+PA+KV ALRFT+TARARI  AGGECL
Sbjct  61   PLSMRRLVRFMEGKGDQIAVIVGTITDDKRVYEIPAMKVAALRFTETARARIVNAGGECL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLALRAPLGQNT+LLRGPKN+REAV+HFG APGVPHSHTKPYVR+
Sbjct  121  TFDQLALRAPLGQNTLLLRGPKNAREAVRHFGAAPGVPHSHTKPYVRS  168



>gb|ABK21809.1| unknown [Picea sitchensis]
 gb|ABK26564.1| unknown [Picea sitchensis]
Length=187

 Score =   290 bits (743),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 143/168 (85%), Positives = 154/168 (92%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK+TKRTAPKS+D+YLKLLVKLYRFLVRRT S FNAVILKRLFMSKTNKP
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSEDIYLKLLVKLYRFLVRRTSSSFNAVILKRLFMSKTNKP  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLSLSRL  +  GK+DKIAV+VGTITDD R YE+P +KV ALRFT+TARARI KAGGECL
Sbjct  61   PLSLSRLARYMQGKDDKIAVVVGTITDDNRVYELPPVKVTALRFTETARARILKAGGECL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLALRAPLGQNTVLLRGPK+ REAVKHFG APGVPHSHTKPYVR+
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKSHREAVKHFGRAPGVPHSHTKPYVRS  168



>ref|XP_009629121.1| PREDICTED: 60S ribosomal protein L18-2 [Nicotiana tomentosiformis]
Length=187

 Score =   290 bits (741),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 152/168 (90%), Positives = 161/168 (96%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK+TKRTAPKSDDVYLKLLVKLYRFLVRRTGS+FNAVILKRLFMSK NK 
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSDDVYLKLLVKLYRFLVRRTGSQFNAVILKRLFMSKINKA  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLSLSRLI++  GKEDK+AV+VGT+TDDVRAYEVP+LKV ALRFT+TARARIEKAGGECL
Sbjct  61   PLSLSRLITYMKGKEDKVAVVVGTVTDDVRAYEVPSLKVTALRFTETARARIEKAGGECL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLALRAPLGQNTVLLRGPKNSREAVKHFG APGVPHSHTKPYVRA
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGRAPGVPHSHTKPYVRA  168



>emb|CDY05559.1| BnaA02g31320D [Brassica napus]
Length=503

 Score =   300 bits (768),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 146/168 (87%), Positives = 157/168 (93%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK+TKRTAPKSDDVYLKLLVKLYRFLVRRTGSKF+AVILKRLFMSK NK 
Sbjct  36   MGIDLIAGGKSKKTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFDAVILKRLFMSKVNKA  95

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLSLS+L+ F  GK+ KIAVLVGTITDD+R +E+PA+KV ALRFT+ ARARIEKAGGECL
Sbjct  96   PLSLSKLVEFMKGKDGKIAVLVGTITDDLRVHEIPAMKVTALRFTERARARIEKAGGECL  155

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLAL APLGQNTVLLRGPKNSREAVKHFGPAPGVPHSH+KPYVRA
Sbjct  156  TFDQLALVAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHSKPYVRA  203



>ref|XP_010228645.1| PREDICTED: 60S ribosomal protein L18-2-like [Brachypodium distachyon]
Length=187

 Score =   289 bits (740),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 139/168 (83%), Positives = 154/168 (92%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGG++K+TKRTAPKSDDVYLKLLVKLYRFLVRRT + FNAVILKRLFMSKTN+P
Sbjct  1    MGIDLVAGGRNKKTKRTAPKSDDVYLKLLVKLYRFLVRRTKNHFNAVILKRLFMSKTNRP  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLSL RL+ F  GKE++IAV+VGTITDD + YEVPA+KV ALRFT+TARARI  AGGECL
Sbjct  61   PLSLRRLVKFMEGKENQIAVIVGTITDDKKVYEVPAMKVAALRFTETARARIVNAGGECL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLAL APLGQNTVLLRGPKN+REAV+HFG APGVPHSHTKPYVR+
Sbjct  121  TFDQLALHAPLGQNTVLLRGPKNAREAVRHFGKAPGVPHSHTKPYVRS  168



>ref|XP_004958675.1| PREDICTED: 60S ribosomal protein L18-3-like [Setaria italica]
Length=187

 Score =   288 bits (738),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 139/168 (83%), Positives = 153/168 (91%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGG++K+TKRTAPKSDDVYLKLLVKLYRFLVRRT S FNAVILKRLFMSK N+ 
Sbjct  1    MGIDLVAGGRNKKTKRTAPKSDDVYLKLLVKLYRFLVRRTKSPFNAVILKRLFMSKANRS  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLS+ RL+ F  GK D+IAV+VGT+TDD R  EVPA+KVCALRFT+TARARI  AGGECL
Sbjct  61   PLSMRRLVKFMEGKGDQIAVIVGTVTDDKRITEVPAMKVCALRFTETARARIINAGGECL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLALRAPLGQNTV+LRGPKN+REAVKHFGPAPGVPHSHTKPYVR+
Sbjct  121  TFDQLALRAPLGQNTVILRGPKNAREAVKHFGPAPGVPHSHTKPYVRS  168



>ref|XP_006650060.1| PREDICTED: 60S ribosomal protein L18-3-like [Oryza brachyantha]
Length=187

 Score =   288 bits (737),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 137/168 (82%), Positives = 155/168 (92%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGG++K+TKRTAP+S+DVYLKL+VKLYRFLVRRT S FNAVIL+RLFMSKTN+P
Sbjct  1    MGIDLVAGGRNKKTKRTAPRSEDVYLKLIVKLYRFLVRRTKSPFNAVILRRLFMSKTNRP  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLSL RL+ F  GKE++IAV+VGT+TDD R YEVPA+KV ALRFT+T RARI  AGGECL
Sbjct  61   PLSLRRLVRFMEGKENQIAVIVGTVTDDKRVYEVPAMKVAALRFTETVRARIVNAGGECL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPAPGVPHS+TKPYVR+
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPAPGVPHSNTKPYVRS  168



>gb|ABK22247.1| unknown [Picea sitchensis]
Length=187

 Score =   288 bits (737),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 142/168 (85%), Positives = 154/168 (92%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSKQTKRTAPKS+D+YLKLLVKLYRFLVRRT S+FNAVILKRLFMSKTNKP
Sbjct  1    MGIDLIAGGKSKQTKRTAPKSEDIYLKLLVKLYRFLVRRTSSRFNAVILKRLFMSKTNKP  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLSLSRL  +  GK+DK+AV+VGTITDD R YE+P +KV ALRFT+TARARI KAGGECL
Sbjct  61   PLSLSRLARYMQGKDDKVAVVVGTITDDNRVYELPPVKVTALRFTETARARILKAGGECL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLAL APLGQNTVLLRGPK+ REAVKHFG APGVPHSHTKPYVR+
Sbjct  121  TFDQLALCAPLGQNTVLLRGPKSHREAVKHFGRAPGVPHSHTKPYVRS  168



>ref|XP_010550997.1| PREDICTED: 60S ribosomal protein L18-3-like isoform X1 [Tarenaya 
hassleriana]
Length=187

 Score =   288 bits (736),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 151/167 (90%), Positives = 158/167 (95%), Gaps = 0/167 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK+TKRTAPKSDDVYLKLLVKLYRFLVRRTGS FNAVILKRLFMSK NK 
Sbjct  1    MGIDLIAGGKSKKTKRTAPKSDDVYLKLLVKLYRFLVRRTGSSFNAVILKRLFMSKVNKA  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLSLSRL++F  GKEDKI V+VGT+TDDVR YEVPALKV ALRFT+TARARIEKAGGECL
Sbjct  61   PLSLSRLVNFMQGKEDKIGVVVGTVTDDVRVYEVPALKVTALRFTETARARIEKAGGECL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVR  590
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPAPGVPHSHTKPYVR
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPAPGVPHSHTKPYVR  167



>ref|XP_010524859.1| PREDICTED: 60S ribosomal protein L18-3 [Tarenaya hassleriana]
Length=187

 Score =   288 bits (736),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 151/168 (90%), Positives = 158/168 (94%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK+TKRTAPKSDDVYLKLLVKLYRFLVRRTGS FNAVILKRLFMSK NK 
Sbjct  1    MGIDLIAGGKSKKTKRTAPKSDDVYLKLLVKLYRFLVRRTGSNFNAVILKRLFMSKVNKA  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLSLSRL+ F  GKEDKI V+VGT+TDDVR YEVPALKV ALRFT+TARARIEKAGGECL
Sbjct  61   PLSLSRLVRFMQGKEDKIGVVVGTVTDDVRVYEVPALKVTALRFTETARARIEKAGGECL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPAPGVPHSHTKPYVR+
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPAPGVPHSHTKPYVRS  168



>gb|AGV54741.1| 60S ribosomal protein L18-3-like protein [Phaseolus vulgaris]
Length=222

 Score =   288 bits (738),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 146/203 (72%), Positives = 158/203 (78%), Gaps = 35/203 (17%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGID KAGGKSK+TKRTAPKS+D+YLKLLVKLYRFLVRRTGS FNAVILKRLFMSK NKP
Sbjct  1    MGIDFKAGGKSKKTKRTAPKSNDIYLKLLVKLYRFLVRRTGSNFNAVILKRLFMSKVNKP  60

Query  270  PLSLSRLISFTPGK-----------------------------------EDKIAVLVGTI  344
            PLSLSRLI +T GK                                   EDKIAV+VGTI
Sbjct  61   PLSLSRLIRYTKGKVCLSIFFTSCTGVASSHIVLLIIAYISTFYFCQMLEDKIAVVVGTI  120

Query  345  TDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSR  524
            TDD+R YEVP LK+ AL+FT+ ARARIEKAGGECLTFDQLALRAPLGQNTVL RGPKN+R
Sbjct  121  TDDIRVYEVPQLKITALKFTERARARIEKAGGECLTFDQLALRAPLGQNTVLFRGPKNAR  180

Query  525  EAVKHFGPAPGVPHSHTKPYVRA  593
            EAVKHFGPAPGVPHSH+KPYVR+
Sbjct  181  EAVKHFGPAPGVPHSHSKPYVRS  203



>gb|AAO46881.1| 60S ribosomal protein [Medicago sativa]
Length=164

 Score =   285 bits (729),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 139/163 (85%), Positives = 150/163 (92%), Gaps = 0/163 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDLKAGGKSK+TKRTAPKS+D+YLKLLVKLYRFLVRRT S FN VILKRLFMSK NKP
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSNDIYLKLLVKLYRFLVRRTESNFNKVILKRLFMSKVNKP  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLSLSRLI +T GKE KIAV+VG +TDD+R YEVPA+KV ALRFT+ ARARIEKAGGECL
Sbjct  61   PLSLSRLIRYTKGKEGKIAVVVGAVTDDIRVYEVPAIKVTALRFTEKARARIEKAGGECL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTK  578
            TFDQLAL+APLGQNTVLLRGPKN+REAVKHFG APGVPHS TK
Sbjct  121  TFDQLALKAPLGQNTVLLRGPKNAREAVKHFGRAPGVPHSSTK  163



>ref|NP_001132852.1| uncharacterized protein LOC100194344 [Zea mays]
 gb|ACG24961.1| 60S ribosomal protein L18 [Zea mays]
 gb|ACG34787.1| 60S ribosomal protein L18 [Zea mays]
 gb|ACG39589.1| 60S ribosomal protein L18 [Zea mays]
 gb|ACR34137.1| unknown [Zea mays]
 gb|AFW77275.1| ribosomal protein L18 [Zea mays]
 gb|AFW81439.1| ribosomal protein L18 [Zea mays]
 gb|AGS43131.1| hypothetical protein [Zea mays]
Length=187

 Score =   286 bits (731),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 137/168 (82%), Positives = 152/168 (90%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGG++K+TKRTAPKSDDVYLKLLVKLYRFLVRRT S FNAVILKRLFMSKTN+P
Sbjct  1    MGIDLVAGGRNKKTKRTAPKSDDVYLKLLVKLYRFLVRRTKSNFNAVILKRLFMSKTNRP  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            P+S+ RL+ F  GKE  IAV+VGT+TDD R  EVPA+KV ALRFT+TARARI  AGGECL
Sbjct  61   PISMRRLVKFMEGKEKNIAVIVGTVTDDKRIQEVPAMKVTALRFTETARARIVNAGGECL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLALRAPLG+NTVLLRGPKN+REAV+HFG APGVPHSHTKPYVR+
Sbjct  121  TFDQLALRAPLGENTVLLRGPKNAREAVRHFGKAPGVPHSHTKPYVRS  168



>ref|XP_008656150.1| PREDICTED: 60S ribosomal protein L18-3-like [Zea mays]
Length=222

 Score =   287 bits (734),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 137/168 (82%), Positives = 152/168 (90%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGG++K+TKRTAPKSDDVYLKLLVKLYRFLVRRT S FNAVILKRLFMSKTN+P
Sbjct  36   MGIDLVAGGRNKKTKRTAPKSDDVYLKLLVKLYRFLVRRTKSNFNAVILKRLFMSKTNRP  95

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            P+S+ RL+ F  GKE  IAV+VGT+TDD R  EVPA+KV ALRFT+TARARI  AGGECL
Sbjct  96   PISMRRLVKFMEGKEKNIAVIVGTVTDDKRIQEVPAMKVTALRFTETARARIVNAGGECL  155

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLALRAPLG+NTVLLRGPKN+REAV+HFG APGVPHSHTKPYVR+
Sbjct  156  TFDQLALRAPLGENTVLLRGPKNAREAVRHFGKAPGVPHSHTKPYVRS  203



>emb|CDY05183.1| BnaC05g46200D [Brassica napus]
Length=223

 Score =   287 bits (734),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 141/167 (84%), Positives = 150/167 (90%), Gaps = 0/167 (0%)
 Frame = +3

Query  93   GIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPP  272
            GIDL AGGKSK+TKRTAPKSDDVYL      YRFLVRRT SKFNAVILKRLFMSK NK P
Sbjct  38   GIDLIAGGKSKKTKRTAPKSDDVYLSSPESFYRFLVRRTQSKFNAVILKRLFMSKVNKAP  97

Query  273  LSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLT  452
            LSLSRL+ F  GKEDKIAVLVGTITDD+R +E+PA+KV ALRFT+ ARA IEKAGGECLT
Sbjct  98   LSLSRLVEFMTGKEDKIAVLVGTITDDLRVHEIPAIKVTALRFTERARASIEKAGGECLT  157

Query  453  FDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            FDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSH+KPYVR+
Sbjct  158  FDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHSKPYVRS  204



>ref|XP_002439318.1| hypothetical protein SORBIDRAFT_09g004290 [Sorghum bicolor]
 gb|EES17748.1| hypothetical protein SORBIDRAFT_09g004290 [Sorghum bicolor]
Length=188

 Score =   285 bits (729),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 139/169 (82%), Positives = 154/169 (91%), Gaps = 1/169 (1%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGG++K+TKRTAPKSDDVYLKLLVKLYRFLVRRT S FNAVILKRLFMSKTN+P
Sbjct  1    MGIDLVAGGRNKKTKRTAPKSDDVYLKLLVKLYRFLVRRTKSNFNAVILKRLFMSKTNRP  60

Query  270  PLSLSRLISFTPGKEDK-IAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGEC  446
            P+SL RL+ F  GKE+K IAV+VGT+TDD R  EVPA+KV ALRFT+TARARI  AGGEC
Sbjct  61   PISLRRLVKFMEGKEEKNIAVIVGTVTDDKRIQEVPAMKVTALRFTETARARIVNAGGEC  120

Query  447  LTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            LTFDQLALRAPLG+NTVLLRGPKN+REAV+HFG APGVPHSHTKPYVR+
Sbjct  121  LTFDQLALRAPLGENTVLLRGPKNAREAVRHFGKAPGVPHSHTKPYVRS  169



>gb|EPS67068.1| hypothetical protein M569_07709, partial [Genlisea aurea]
Length=186

 Score =   285 bits (728),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 139/167 (83%), Positives = 152/167 (91%), Gaps = 0/167 (0%)
 Frame = +3

Query  93   GIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPP  272
            GIDL AGGKSK+TKRTAPKS+D+YLKLLVKLYRFLVRRT SKFN V+LKRLFMS+ N+PP
Sbjct  1    GIDLVAGGKSKKTKRTAPKSNDIYLKLLVKLYRFLVRRTESKFNGVVLKRLFMSRVNRPP  60

Query  273  LSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLT  452
            L LSRLI+   GKEDKIAVLVGTITDD R +EVP LKV ALRFT+T RARIEKAGGECLT
Sbjct  61   LRLSRLIAHMKGKEDKIAVLVGTITDDNRIHEVPPLKVTALRFTETVRARIEKAGGECLT  120

Query  453  FDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            FDQLALRAPLGQNTVLLRG +N+REAV+HFGPAPGVPHS TKPYVR+
Sbjct  121  FDQLALRAPLGQNTVLLRGSRNAREAVRHFGPAPGVPHSSTKPYVRS  167



>ref|XP_006658116.1| PREDICTED: 60S ribosomal protein L18-3-like [Oryza brachyantha]
Length=187

 Score =   285 bits (728),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 136/168 (81%), Positives = 154/168 (92%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGG++K+TKRTAP+S+DVY+KLLVKLYRFL RRT S FNAVILKRLFMSKTN+P
Sbjct  1    MGIDLVAGGRNKKTKRTAPRSEDVYVKLLVKLYRFLERRTKSHFNAVILKRLFMSKTNRP  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLS+ RL+ F  GK D+IAV+VGT+TDD R YEVPA+KV ALRFT+TA+ARI  AGGECL
Sbjct  61   PLSMRRLVRFMEGKGDQIAVIVGTVTDDKRVYEVPAMKVAALRFTETAKARIINAGGECL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPAPGVPHS+TKPYVR+
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPAPGVPHSNTKPYVRS  168



>gb|AFC88838.1| 60S ribosomal protein L18-like protein [Miscanthus sinensis]
Length=188

 Score =   284 bits (727),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 138/169 (82%), Positives = 154/169 (91%), Gaps = 1/169 (1%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGG++K+TKRTAPKSDDVYLKLLVKLYRFLVRRT S FNAVILKRLFMSKTN+P
Sbjct  1    MGIDLVAGGRNKKTKRTAPKSDDVYLKLLVKLYRFLVRRTKSNFNAVILKRLFMSKTNRP  60

Query  270  PLSLSRLISFTPGKEDK-IAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGEC  446
            P+SL RL+ F  GKE+K IAV+VGT+TDD R  EVPA+KV ALRFT+TARARI  AGGEC
Sbjct  61   PISLRRLVKFMEGKEEKNIAVIVGTVTDDKRIQEVPAMKVTALRFTETARARIVNAGGEC  120

Query  447  LTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            LTFDQLALRAPLG+NTVL+RGPKN+REAV+HFG APGVPHSHTKPYVR+
Sbjct  121  LTFDQLALRAPLGENTVLMRGPKNAREAVRHFGKAPGVPHSHTKPYVRS  169



>ref|XP_004247404.1| PREDICTED: 60S ribosomal protein L18-2 [Solanum lycopersicum]
Length=187

 Score =   283 bits (725),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 149/168 (89%), Positives = 157/168 (93%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK+TKR APKSDDVYLKLLVKLYRFL RRTGSKFNAVILKRLFMSK NK 
Sbjct  1    MGIDLVAGGKSKKTKRIAPKSDDVYLKLLVKLYRFLSRRTGSKFNAVILKRLFMSKINKA  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLSLSRL+++  GKED IAV+VGT+TDDVRAYEVP +KV ALRFT+TARARIEKAGGECL
Sbjct  61   PLSLSRLVTYMTGKEDNIAVVVGTVTDDVRAYEVPKIKVTALRFTETARARIEKAGGECL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLALRAPLGQNTVLLRGPKNSREAVKHFG APGVPHSHTKPYVRA
Sbjct  121  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGKAPGVPHSHTKPYVRA  168



>ref|XP_010921627.1| PREDICTED: uncharacterized protein LOC105045157 [Elaeis guineensis]
Length=398

 Score =   291 bits (744),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 140/169 (83%), Positives = 155/169 (92%), Gaps = 0/169 (0%)
 Frame = +3

Query  87   TMGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNK  266
            + GIDL AGG+SK+ +RTAPKSDDVYLKLLVKLYRFLVRRTGS+FNAVILKRLFMSK N+
Sbjct  211  SQGIDLIAGGRSKKARRTAPKSDDVYLKLLVKLYRFLVRRTGSRFNAVILKRLFMSKINR  270

Query  267  PPLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGEC  446
            PP+SL RL++F  GK DKIAV+VGT+TDD R Y+VPALKV ALRFT+TARARI KAGGEC
Sbjct  271  PPISLKRLVTFMEGKGDKIAVIVGTVTDDKRVYDVPALKVTALRFTETARARILKAGGEC  330

Query  447  LTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            LTFD LALRAPLGQNTVLLRGPKN+REAVKHFG APGVPHSHTKPYVR+
Sbjct  331  LTFDHLALRAPLGQNTVLLRGPKNAREAVKHFGKAPGVPHSHTKPYVRS  379



>pdb|3J61|Q Chain Q, Localization Of The Large Subunit Ribosomal Proteins 
Into A 5.5 A Cryo-em Map Of Triticum Aestivum Translating 80s 
Ribosome
 gb|AAW50985.1| ribosomal protein L18 [Triticum aestivum]
Length=188

 Score =   283 bits (723),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 138/169 (82%), Positives = 154/169 (91%), Gaps = 1/169 (1%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGG++K+TKR APKSDDVYLKLLVKLYRFLVRRT SKFNAVILKRLFMSKTN+P
Sbjct  1    MGIDLVAGGRNKRTKRVAPKSDDVYLKLLVKLYRFLVRRTKSKFNAVILKRLFMSKTNRP  60

Query  270  PLSLSRLISFTPGKEDK-IAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGEC  446
            PLS+ RL +F  GKE+K IAV+VGTITDD+R  EVPA+KV ALRFT+TARARI  AGGEC
Sbjct  61   PLSMRRLSNFMKGKEEKNIAVVVGTITDDMRIQEVPAMKVTALRFTETARARIINAGGEC  120

Query  447  LTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            LTFDQLALRAP G+NT+LLRGPKN+REAV+HFG APGVPHSHTKPYVR+
Sbjct  121  LTFDQLALRAPTGENTILLRGPKNAREAVRHFGKAPGVPHSHTKPYVRS  169



>gb|EMT18368.1| 60S ribosomal protein L18-2 [Aegilops tauschii]
Length=188

 Score =   282 bits (722),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 138/169 (82%), Positives = 154/169 (91%), Gaps = 1/169 (1%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGG++K+TKR APKSDDVYLKLLVKLYRFLVRRT SKFNAVILKRLFMSKTN+P
Sbjct  1    MGIDLVAGGRNKRTKRVAPKSDDVYLKLLVKLYRFLVRRTKSKFNAVILKRLFMSKTNRP  60

Query  270  PLSLSRLISFTPGKEDK-IAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGEC  446
            PLS+ RL +F  GKE+K IAV+VGTITDD+R  EVPA+KV ALRFT+TARARI  AGGEC
Sbjct  61   PLSMRRLSNFMKGKEEKNIAVVVGTITDDMRIQEVPAMKVTALRFTETARARIINAGGEC  120

Query  447  LTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            LTFDQLALRAP G+NT+LLRGPKN+REAV+HFG APGVPHSHTKPYVR+
Sbjct  121  LTFDQLALRAPTGENTILLRGPKNAREAVRHFGKAPGVPHSHTKPYVRS  169



>dbj|BAJ90421.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ88976.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=188

 Score =   282 bits (722),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 137/169 (81%), Positives = 154/169 (91%), Gaps = 1/169 (1%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGG++K+TKR APKSDDVYLKLLVKLYRFLVRRT SKFNAVILKRLFMSKTN+P
Sbjct  1    MGIDLVAGGRNKRTKRVAPKSDDVYLKLLVKLYRFLVRRTKSKFNAVILKRLFMSKTNRP  60

Query  270  PLSLSRLISFTPGKEDK-IAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGEC  446
            PLS+ RL +F  GKE+K IAV+VGTITDD+R  E+PA+KV ALRFT+TARARI  AGGEC
Sbjct  61   PLSMRRLSNFMKGKEEKNIAVVVGTITDDMRIQEIPAMKVTALRFTETARARIVNAGGEC  120

Query  447  LTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            LTFDQLALRAP G+NT+LLRGPKN+REAV+HFG APGVPHSHTKPYVR+
Sbjct  121  LTFDQLALRAPTGENTILLRGPKNAREAVRHFGKAPGVPHSHTKPYVRS  169



>ref|XP_003568896.1| PREDICTED: 60S ribosomal protein L18-2-like [Brachypodium distachyon]
Length=188

 Score =   282 bits (721),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 136/169 (80%), Positives = 155/169 (92%), Gaps = 1/169 (1%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGG++K+TKRTAPKSDDVYL+LLVKLYRFLVRRT SKFNAVILKRLFMSKTN+P
Sbjct  1    MGIDLVAGGRNKKTKRTAPKSDDVYLRLLVKLYRFLVRRTKSKFNAVILKRLFMSKTNRP  60

Query  270  PLSLSRLISFTPGKEDK-IAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGEC  446
            PLS+ RL +F  GK++K IAV+VGTITDD R  E+PA+KV ALRFT+TARARI  AGGEC
Sbjct  61   PLSMRRLSNFMKGKDEKSIAVIVGTITDDKRIQEIPAMKVTALRFTETARARIINAGGEC  120

Query  447  LTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            LTFDQLALRAP+G+NT+LLRGPKN+REAV+HFG APGVPHSHTKPYVR+
Sbjct  121  LTFDQLALRAPMGENTILLRGPKNAREAVRHFGKAPGVPHSHTKPYVRS  169



>ref|XP_006654064.1| PREDICTED: 60S ribosomal protein L18-2-like [Oryza brachyantha]
Length=188

 Score =   281 bits (719),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 137/169 (81%), Positives = 153/169 (91%), Gaps = 1/169 (1%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGG++K+TKRTAP+SDDVYLKL+VKLYRFL RRT SKFNAVILKRLFMSKTN+P
Sbjct  1    MGIDLVAGGRNKKTKRTAPRSDDVYLKLIVKLYRFLYRRTKSKFNAVILKRLFMSKTNRP  60

Query  270  PLSLSRLISFTPGKEDK-IAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGEC  446
            PLSL RL  F  GKE+K IAV+VGT+TDD R  E+PA+KV ALRFT+TARARI  AGGEC
Sbjct  61   PLSLRRLAKFMEGKEEKNIAVIVGTVTDDKRIQEIPAMKVTALRFTETARARIVNAGGEC  120

Query  447  LTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            LTFDQLALRAPLG+NTVLLRGPKN+REAV+HFG APGVPHSHTKPYVR+
Sbjct  121  LTFDQLALRAPLGENTVLLRGPKNAREAVRHFGKAPGVPHSHTKPYVRS  169



>ref|XP_004977069.1| PREDICTED: 60S ribosomal protein L18-2-like [Setaria italica]
Length=188

 Score =   281 bits (718),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 137/169 (81%), Positives = 153/169 (91%), Gaps = 1/169 (1%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGG++K+TKRTAPKSDDVYLKLLVKLYRFLVRRT S FNAVILKRLFMSK N+P
Sbjct  1    MGIDLVAGGRNKKTKRTAPKSDDVYLKLLVKLYRFLVRRTKSSFNAVILKRLFMSKANRP  60

Query  270  PLSLSRLISFTPGKEDK-IAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGEC  446
            P+SL RL +F  GKE+K IAV+VGT+TDD R  E+PA+KV ALRFT+TARARI  AGGEC
Sbjct  61   PISLRRLANFMKGKEEKNIAVIVGTVTDDKRIQEIPAMKVTALRFTETARARIINAGGEC  120

Query  447  LTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            LTFDQLALRAPLG+NTVLLRGPKN+REAV+HFG APGVPHSHTKPYVR+
Sbjct  121  LTFDQLALRAPLGENTVLLRGPKNAREAVRHFGKAPGVPHSHTKPYVRS  169



>ref|NP_001060617.1| Os07g0674700 [Oryza sativa Japonica Group]
 dbj|BAC83538.1| putative cytoplasmic ribosomal protein L18 [Oryza sativa Japonica 
Group]
 dbj|BAD31974.1| putative cytoplasmic ribosomal protein L18 [Oryza sativa Japonica 
Group]
 dbj|BAF22531.1| Os07g0674700 [Oryza sativa Japonica Group]
 gb|EAZ05118.1| hypothetical protein OsI_27311 [Oryza sativa Indica Group]
 dbj|BAG89915.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE67806.1| hypothetical protein OsJ_25556 [Oryza sativa Japonica Group]
Length=195

 Score =   281 bits (718),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 138/176 (78%), Positives = 155/176 (88%), Gaps = 8/176 (5%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGG++K+TKRTAP+S+DVYLKL+VKLYRFLVRRT S FNAVILKRLFMSKTN+P
Sbjct  1    MGIDLVAGGRNKKTKRTAPRSEDVYLKLIVKLYRFLVRRTKSHFNAVILKRLFMSKTNRP  60

Query  270  PLSLSRLISFTPGK--------EDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARI  425
            PLS+ RL+ F  GK         D+IAV+VGT+TDD R YEVPA+KV ALRFT+TARARI
Sbjct  61   PLSMRRLVRFMEGKVPDRHAISGDQIAVIVGTVTDDKRIYEVPAMKVAALRFTETARARI  120

Query  426  EKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
              AGGECLTFDQLALRAPLGQNTVLLRGPKN+REAVKHFGPAPGVPHS+TKPYVR+
Sbjct  121  INAGGECLTFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPAPGVPHSNTKPYVRS  176



>ref|XP_001781485.1| predicted protein [Physcomitrella patens]
 gb|EDQ53665.1| predicted protein [Physcomitrella patens]
Length=186

 Score =   280 bits (717),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 137/168 (82%), Positives = 153/168 (91%), Gaps = 1/168 (1%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDLKAGG++K+TKRTAPKS +VYLKLLVKLYRFLVRRT + FN+V+LKRLFMS+TN+ 
Sbjct  1    MGIDLKAGGRNKKTKRTAPKSQNVYLKLLVKLYRFLVRRTDAPFNSVVLKRLFMSRTNRA  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLS+SRL+ +  GKE KIAVLVGTITDDVR +EVPALKVCALRFT+TARARI KAGGECL
Sbjct  61   PLSMSRLVKYMTGKEGKIAVLVGTITDDVRQFEVPALKVCALRFTETARARILKAGGECL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLALRAP G NTVLLRGPKN+REAVKHFG APGVP SH KPYVR+
Sbjct  121  TFDQLALRAPTGSNTVLLRGPKNAREAVKHFG-APGVPQSHAKPYVRS  167



>ref|XP_001760902.1| predicted protein [Physcomitrella patens]
 gb|EDQ74291.1| predicted protein [Physcomitrella patens]
Length=186

 Score =   280 bits (716),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 136/168 (81%), Positives = 153/168 (91%), Gaps = 1/168 (1%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDLKAGG++K+TKRTAPKS +VYLKLLVKLYRFLVRRT + FN+V+LKRLFMS+ N+ 
Sbjct  1    MGIDLKAGGRNKKTKRTAPKSQNVYLKLLVKLYRFLVRRTDAPFNSVVLKRLFMSRINRA  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLS+SRL+ +  GK+DKIAVLVGTITDDVR +EVPALKVCALRFT+TARARI KAGGECL
Sbjct  61   PLSMSRLVKYMAGKDDKIAVLVGTITDDVRQFEVPALKVCALRFTETARARIVKAGGECL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLALRAP G NTVLLRGPKN+REAVKHFG APGVP SH KPYVR+
Sbjct  121  TFDQLALRAPTGANTVLLRGPKNAREAVKHFG-APGVPQSHAKPYVRS  167



>gb|EYU46738.1| hypothetical protein MIMGU_mgv1a014520mg [Erythranthe guttata]
Length=187

 Score =   280 bits (716),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 131/168 (78%), Positives = 152/168 (90%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK+TKRT PKSDD+Y+KLLVKLY FLVRRTGSKFN V+ KRL MS+ N+P
Sbjct  1    MGIDLVAGGKSKKTKRTKPKSDDIYIKLLVKLYSFLVRRTGSKFNEVVRKRLTMSRVNRP  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLSLSRL +   GKE++IAVLVG++TDD+R +E+PA+KV ALRFT+TARARIEKAGGECL
Sbjct  61   PLSLSRLSALMKGKENQIAVLVGSVTDDIRVHEIPAMKVAALRFTETARARIEKAGGECL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLALRAPLGQNTV+LRG + +REAV+HFG APGVPHSHTKPYVR+
Sbjct  121  TFDQLALRAPLGQNTVILRGSRKAREAVRHFGAAPGVPHSHTKPYVRS  168



>ref|NP_001054688.1| Os05g0155100 [Oryza sativa Japonica Group]
 gb|AAV32218.1| cytoplasmic ribosomal protein L18 [Oryza sativa Japonica Group]
 dbj|BAF16602.1| Os05g0155100 [Oryza sativa Japonica Group]
 gb|EAY96610.1| hypothetical protein OsI_18515 [Oryza sativa Indica Group]
 gb|ABR25945.1| 60S ribosomal protein l18 [Oryza sativa Indica Group]
 dbj|BAG88175.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH00211.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE62383.1| hypothetical protein OsJ_17172 [Oryza sativa Japonica Group]
Length=188

 Score =   279 bits (714),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 136/169 (80%), Positives = 151/169 (89%), Gaps = 1/169 (1%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGG++K+TKRTAP+SDDVYLKLLVKLYRFLVRRT S FNAVILKRLFMSKTN+P
Sbjct  1    MGIDLVAGGRNKKTKRTAPRSDDVYLKLLVKLYRFLVRRTKSNFNAVILKRLFMSKTNRP  60

Query  270  PLSLSRLISFTPGKEDK-IAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGEC  446
            PLSL RL  F  GKE+  IAV+VGT+TDD R  E+P +KV ALRFT+TARARI  AGGEC
Sbjct  61   PLSLRRLAKFMEGKEENNIAVIVGTVTDDKRIQEIPKMKVTALRFTETARARIVNAGGEC  120

Query  447  LTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            LTFDQLALRAPLG+NTVLLRGPKN+REAV+HFG APGVPHSHTKPYVR+
Sbjct  121  LTFDQLALRAPLGENTVLLRGPKNAREAVRHFGKAPGVPHSHTKPYVRS  169



>ref|XP_001751734.1| predicted protein [Physcomitrella patens]
 gb|EDQ83169.1| predicted protein [Physcomitrella patens]
Length=186

 Score =   278 bits (712),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 137/168 (82%), Positives = 153/168 (91%), Gaps = 1/168 (1%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDLKAGG++K+TKRTAPKS +VYLKLLVKLYRFLVRRT + FN+VILKRLFMS+TN+ 
Sbjct  1    MGIDLKAGGRNKKTKRTAPKSGNVYLKLLVKLYRFLVRRTDAPFNSVILKRLFMSRTNRA  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLS+SRL+ +  GK+DKIAVLVGTITDDVR +EVPALKV ALRFT+TARARI KAGGECL
Sbjct  61   PLSMSRLVKYMAGKDDKIAVLVGTITDDVRQFEVPALKVAALRFTETARARILKAGGECL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLALRAP G NTVLLRGPKN+REAVKHFG APGVP SH KPYVR+
Sbjct  121  TFDQLALRAPTGANTVLLRGPKNAREAVKHFG-APGVPQSHAKPYVRS  167



>ref|XP_009611670.1| PREDICTED: 60S ribosomal protein L18-2-like [Nicotiana tomentosiformis]
Length=187

 Score =   278 bits (712),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 149/168 (89%), Positives = 157/168 (93%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK+TK TAPKS DVYLKLLVKLYRFLVRRTGS+FNAVILKRLFMSK NK 
Sbjct  1    MGIDLVAGGKSKKTKCTAPKSGDVYLKLLVKLYRFLVRRTGSQFNAVILKRLFMSKINKA  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLSLSRLI++  GKEDK+ V+VGT+TDDVRAYEVP+LKV ALRFTKTARARIEKAGGECL
Sbjct  61   PLSLSRLITYMKGKEDKVVVVVGTVTDDVRAYEVPSLKVTALRFTKTARARIEKAGGECL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLALRAPLGQN VLLRGPKNSREAVKHFG APGVPHSHTKPYVRA
Sbjct  121  TFDQLALRAPLGQNMVLLRGPKNSREAVKHFGRAPGVPHSHTKPYVRA  168



>ref|XP_008789961.1| PREDICTED: uncharacterized protein LOC103707302 [Phoenix dactylifera]
Length=988

 Score =   299 bits (765),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 142/168 (85%), Positives = 156/168 (93%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGG+SK+ KRTAPKSDDVYLKLLVKLYRFLVRRTGS+FNAVILKRLFMSK N+P
Sbjct  802  MGIDLIAGGRSKKAKRTAPKSDDVYLKLLVKLYRFLVRRTGSRFNAVILKRLFMSKVNRP  861

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            P+SL RL++F  GKEDKIAV+VGT+TDD R YEVPA+KV ALRFT+TARARI KAGGEC 
Sbjct  862  PISLKRLVTFMQGKEDKIAVIVGTVTDDKRVYEVPAMKVTALRFTETARARILKAGGECF  921

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLALR+PLGQNTVLLRGPKN+REAVKHFG APGVPHSHTKPYVR+
Sbjct  922  TFDQLALRSPLGQNTVLLRGPKNAREAVKHFGKAPGVPHSHTKPYVRS  969



>gb|EMS65848.1| 60S ribosomal protein L18-2 [Triticum urartu]
Length=229

 Score =   279 bits (713),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 136/168 (81%), Positives = 153/168 (91%), Gaps = 1/168 (1%)
 Frame = +3

Query  93   GIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPP  272
            GIDL AGG++K+TKR APKS+DVYLKLLVKLYRFLVRRT SKFNAVILKRLFMSKTN+PP
Sbjct  8    GIDLVAGGRNKRTKRVAPKSNDVYLKLLVKLYRFLVRRTKSKFNAVILKRLFMSKTNRPP  67

Query  273  LSLSRLISFTPGKEDK-IAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            LS+ RL +F  GKE+K IAV+VGTITDD+R  EVPA+KV ALRFT+TARARI  AGGECL
Sbjct  68   LSMRRLSNFMKGKEEKNIAVVVGTITDDMRIQEVPAMKVTALRFTETARARIVNAGGECL  127

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLALRAP G+NT+LLRGPKN+REAV+HFG APGVPHSHTKPYVR+
Sbjct  128  TFDQLALRAPTGENTILLRGPKNAREAVRHFGKAPGVPHSHTKPYVRS  175



>gb|KFK32338.1| hypothetical protein AALP_AA6G228700 [Arabis alpina]
Length=197

 Score =   276 bits (705),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 135/167 (81%), Positives = 146/167 (87%), Gaps = 0/167 (0%)
 Frame = +3

Query  93   GIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPP  272
            GIDL AGGKSK+TKRTAPKSDDVYLKL VKLYRFLVRRT S FN VILKRLFMSK NK P
Sbjct  14   GIDLIAGGKSKKTKRTAPKSDDVYLKLTVKLYRFLVRRTQSNFNKVILKRLFMSKVNKAP  73

Query  273  LSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLT  452
             SLSRL+    GK+DKIAVLVGTI DDV  +++ A+KV ALRFT+ ARARI KAGG+CLT
Sbjct  74   FSLSRLVELMSGKDDKIAVLVGTIIDDVSVHDILAIKVAALRFTERARARIVKAGGKCLT  133

Query  453  FDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            FDQLALRAPLGQNTV LRG KNSREAVKHFGPAPGVPHSH+KPYVR+
Sbjct  134  FDQLALRAPLGQNTVFLRGRKNSREAVKHFGPAPGVPHSHSKPYVRS  180



>sp|O65729.1|RL18_CICAR RecName: Full=60S ribosomal protein L18, partial [Cicer arietinum]
 emb|CAA06246.1| ribosomal protein L18 [Cicer arietinum]
Length=183

 Score =   273 bits (699),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 132/165 (80%), Positives = 150/165 (91%), Gaps = 1/165 (1%)
 Frame = +3

Query  99   DLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLS  278
            DLKAGGK+K+TKRT+PKS+D+YLKLLVKLYRFLVRRT S FNAVILKRLFMSK N+PPLS
Sbjct  1    DLKAGGKNKKTKRTSPKSNDIYLKLLVKLYRFLVRRTDSNFNAVILKRLFMSKVNRPPLS  60

Query  279  LSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFD  458
            LSRLI +  GKE KI V+VG +TDD+R Y+VP +KV AL+FT+TARARI+KAGGECLTFD
Sbjct  61   LSRLIKYMQGKEGKIGVVVGAVTDDIRVYDVPTIKVTALKFTETARARIQKAGGECLTFD  120

Query  459  QLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            QLALR PL  +TVLLRGPKN+REAVKHFGPAPGVPHSHTKPYVR+
Sbjct  121  QLALRLPL-TDTVLLRGPKNAREAVKHFGPAPGVPHSHTKPYVRS  164



>emb|CEF99132.1| Ribosomal protein L18e, conserved site [Ostreococcus tauri]
Length=186

 Score =   272 bits (695),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 132/168 (79%), Positives = 148/168 (88%), Gaps = 1/168 (1%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDLKAGG++K+T RTAPKSD+VYLKLLVKLYRFL RRTGSKFN  +LKRLFMSKTN+P
Sbjct  1    MGIDLKAGGRNKKTSRTAPKSDNVYLKLLVKLYRFLARRTGSKFNETVLKRLFMSKTNRP  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLSLS+L  F  GKE K+A +VGTITDDVR ++VP LKVCALRFT+TARARI KAGGEC+
Sbjct  61   PLSLSKLAKFMKGKEGKVAAVVGTITDDVRMFDVPKLKVCALRFTETARARIIKAGGECM  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLAL AP G+  VLLRGPKNSREAVKHFG APG+P SH KPYVR+
Sbjct  121  TFDQLALAAPTGEGVVLLRGPKNSREAVKHFG-APGIPGSHAKPYVRS  167



>ref|XP_001785869.1| predicted protein [Physcomitrella patens]
 gb|EDQ49322.1| predicted protein [Physcomitrella patens]
Length=186

 Score =   270 bits (690),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 131/168 (78%), Positives = 150/168 (89%), Gaps = 1/168 (1%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDLKAGG++K+TKRTAPKSD+VYLKLLVKLYRFLVRRT + FN+V+LKRLFMS+ N+P
Sbjct  1    MGIDLKAGGRNKKTKRTAPKSDNVYLKLLVKLYRFLVRRTDAPFNSVVLKRLFMSRINRP  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            P+S+SRL+ +  GKE KIAV+VGT+TDD R YEVPALKV ALRFT+TARARI K+GGE L
Sbjct  61   PISMSRLVKYMTGKEGKIAVIVGTVTDDTRIYEVPALKVAALRFTETARARILKSGGEVL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLALRAP G N VLLRGPKN+REAVKHFG APGVP SH KPYVR+
Sbjct  121  TFDQLALRAPTGSNCVLLRGPKNAREAVKHFG-APGVPQSHAKPYVRS  167



>ref|XP_004290808.1| PREDICTED: 60S ribosomal protein L18-2 [Fragaria vesca subsp. 
vesca]
Length=187

 Score =   270 bits (690),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 133/168 (79%), Positives = 145/168 (86%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK T+RT+P+S D+YLKL VKLY F+ RRT S F+ VI  RL MSK NK 
Sbjct  1    MGIDLVAGGKSKNTRRTSPRSQDIYLKLTVKLYDFIHRRTKSHFSKVIRHRLCMSKVNKA  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLSLSRL  +  G EDKIAVLVGT+TDDVR  EVPALKV ALRFT+ ARARIEKAGGECL
Sbjct  61   PLSLSRLCRYMQGHEDKIAVLVGTVTDDVRIAEVPALKVTALRFTERARARIEKAGGECL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLALRAPLGQNT+LLRGPKN+REAVKHFGPAPGVPHSHTKPYVR+
Sbjct  121  TFDQLALRAPLGQNTMLLRGPKNAREAVKHFGPAPGVPHSHTKPYVRS  168



>ref|XP_001690885.1| ribosomal protein L18, component of cytosolic 80S ribosome and 
60S large subunit [Chlamydomonas reinhardtii]
 ref|XP_010832938.1| PREDICTED: 60S ribosomal protein L18-2-like [Bison bison bison]
 gb|EDP05331.1| ribosomal protein L18 [Chlamydomonas reinhardtii]
Length=187

 Score =   269 bits (688),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 131/168 (78%), Positives = 147/168 (88%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDLKAGG+SK+  RTAPKS +VYL LLVKLYRFLVRRT SKFN VILKRLFMSKTN+P
Sbjct  1    MGIDLKAGGRSKKVHRTAPKSQNVYLALLVKLYRFLVRRTESKFNKVILKRLFMSKTNRP  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLSLS+L +F  GKE K+AV+V T+TDDVR +EVP L+VCALRFT+TARARI KAGGECL
Sbjct  61   PLSLSKLAAFMKGKESKVAVIVATVTDDVRLFEVPKLRVCALRFTETARARITKAGGECL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLAL+ P G++ VLLRGPK+ REA KHFGPAPGVP S TKPYVRA
Sbjct  121  TFDQLALQRPTGKDCVLLRGPKSQREACKHFGPAPGVPGSTTKPYVRA  168



>gb|KIZ05100.1| 60S ribosomal protein L18-3 [Monoraphidium neglectum]
 gb|KIZ07537.1| 60S ribosomal protein L18-3 [Monoraphidium neglectum]
Length=187

 Score =   269 bits (688),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 131/168 (78%), Positives = 147/168 (88%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGG++ +  RTAPKSD+VYLKLLVKLYRFL RRT S FNAV+LKRLFMSK N+P
Sbjct  1    MGIDLVAGGRNTKKHRTAPKSDNVYLKLLVKLYRFLERRTESNFNAVVLKRLFMSKINRP  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLSLS+L  F  GKEDK+AVLVGT+TDDVR +EVP L+V ALRFT+TARARI KAGGECL
Sbjct  61   PLSLSKLAKFMAGKEDKVAVLVGTVTDDVRLHEVPKLRVTALRFTETARARIVKAGGECL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLAL  P G++ VLLRGPKN+REAVKHFGPAPGVPHS TKPYVR+
Sbjct  121  TFDQLALERPTGKDCVLLRGPKNNREAVKHFGPAPGVPHSSTKPYVRS  168



>sp|O22254.3|RL181_ARATH RecName: Full=Putative 60S ribosomal protein L18-1 [Arabidopsis 
thaliana]
Length=188

 Score =   269 bits (688),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 135/168 (80%), Positives = 147/168 (88%), Gaps = 1/168 (1%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK+TKRT PKSDDVYLKLLVK  R+LVRRT SKFNAVILKRLFMSK NK 
Sbjct  1    MGIDLIAGGKSKKTKRTEPKSDDVYLKLLVKANRYLVRRTESKFNAVILKRLFMSKVNKA  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLSLSRL+ +  GK+ KIAV+VGT+TDDVR  +VPAL V ALRFT++ARARI KAGGECL
Sbjct  61   PLSLSRLVRYMDGKDGKIAVIVGTVTDDVRIEDVPALTVTALRFTESARARIHKAGGECL  120

Query  450  TFDQLALRAP-LGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVR  590
            TFDQLAL  P   +NTVLLRGPKN+REAVKHFGPAPGVPHSHTKPYVR
Sbjct  121  TFDQLALPCPTWSENTVLLRGPKNTREAVKHFGPAPGVPHSHTKPYVR  168



>ref|XP_001419602.1| Ribosomal protein L18, component of cytosolic 80S ribosome and 
60S large subunit [Ostreococcus lucimarinus CCE9901]
 gb|ABO97895.1| Ribosomal protein L18, component of cytosolic 80S ribosome and 
60S large subunit [Ostreococcus lucimarinus CCE9901]
Length=186

 Score =   269 bits (688),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 131/168 (78%), Positives = 148/168 (88%), Gaps = 1/168 (1%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDLKAGG++K+T RTAPKSD+VYLKLLVKLYRFL RRT SKFN  +LKRLFMSKTN+P
Sbjct  1    MGIDLKAGGRNKKTNRTAPKSDNVYLKLLVKLYRFLARRTDSKFNDTVLKRLFMSKTNRP  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLSLS++  F  GKE K+A +VGT+TDDVR ++VPALKVCALRFT+TARARI KAGG+C+
Sbjct  61   PLSLSKVAKFMKGKEGKVAAIVGTVTDDVRLHDVPALKVCALRFTETARARIIKAGGQCM  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLAL AP G+  VLLRGPKNSREAVKHFG APGVP SH KPYVRA
Sbjct  121  TFDQLALSAPTGEGVVLLRGPKNSREAVKHFG-APGVPGSHAKPYVRA  167



>ref|XP_001760959.1| predicted protein [Physcomitrella patens]
 gb|EDQ74348.1| predicted protein [Physcomitrella patens]
Length=186

 Score =   268 bits (686),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 131/168 (78%), Positives = 149/168 (89%), Gaps = 1/168 (1%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDLKAGG++K+TKRTAPKS +VYLKLLVKLYRFLVRRT + FNAV+LKRLFMS+ N+P
Sbjct  1    MGIDLKAGGRNKKTKRTAPKSGNVYLKLLVKLYRFLVRRTDAPFNAVVLKRLFMSRINRP  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            P+S+SRL+ +  GKEDKIAV+VG++TDD R YEVPALKV ALRFT+TARARI K GGE L
Sbjct  61   PISMSRLVRYMKGKEDKIAVIVGSVTDDTRIYEVPALKVAALRFTETARARILKNGGEVL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLALRAP G N VLLRGPKN+REAVKHFG APGVP SH KPYVR+
Sbjct  121  TFDQLALRAPTGSNCVLLRGPKNAREAVKHFG-APGVPRSHAKPYVRS  167



>ref|XP_002948325.1| component of cytosolic 80S ribosome and 60S large subunit [Volvox 
carteri f. nagariensis]
 gb|EFJ50732.1| component of cytosolic 80S ribosome and 60S large subunit [Volvox 
carteri f. nagariensis]
Length=187

 Score =   268 bits (686),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 132/168 (79%), Positives = 147/168 (88%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDLKAGG+SK+  RTAPKS +VYL LLVKLYRFLVRRT SKFN VILKRLFMSKTN+P
Sbjct  1    MGIDLKAGGRSKKVHRTAPKSQNVYLALLVKLYRFLVRRTDSKFNKVILKRLFMSKTNRP  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLSLS+L +F  GKE+K+AV+V T+TDDVR YEVP L+V ALRFT+TARARI KAGGECL
Sbjct  61   PLSLSKLATFMKGKENKVAVIVATVTDDVRLYEVPKLRVVALRFTETARARITKAGGECL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLAL  P G++ VLLRGPK+ REAVKHFGPAPGVP S TKPYVRA
Sbjct  121  TFDQLALERPTGKDCVLLRGPKSHREAVKHFGPAPGVPGSTTKPYVRA  168



>gb|KHG01788.1| 60S ribosomal L18-2 -like protein [Gossypium arboreum]
Length=160

 Score =   266 bits (680),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 135/168 (80%), Positives = 143/168 (85%), Gaps = 13/168 (8%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK++KRTAPKSDD+YLKLLVKLYRFLVRRTGSKFN VILKRLFMSK NKP
Sbjct  1    MGIDLVAGGKSKKSKRTAPKSDDIYLKLLVKLYRFLVRRTGSKFNTVILKRLFMSKVNKP  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLSLSRLI F  GK              +  YEVPALKV ALRFT+TARARIEKAGGECL
Sbjct  61   PLSLSRLIQFMKGK-------------GLWVYEVPALKVTALRFTETARARIEKAGGECL  107

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            +FDQLALRAPLGQNTVLLRGPKN+REAVKHFGPAPGVPHS  KPYVR+
Sbjct  108  SFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPAPGVPHSLYKPYVRS  155



>gb|AFC88843.1| 60S ribosomal protein L18-3-like protein, partial [Miscanthus 
sinensis]
Length=166

 Score =   265 bits (677),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 127/150 (85%), Positives = 137/150 (91%), Gaps = 0/150 (0%)
 Frame = +3

Query  144  PKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTPGKEDKI  323
            PKSDDVYLKLLVKLYRFLVRRT S FNAVILKRLFMSKTN+ PLS+ RL+ F  GK D+I
Sbjct  1    PKSDDVYLKLLVKLYRFLVRRTKSNFNAVILKRLFMSKTNRAPLSMRRLVKFMEGKGDQI  60

Query  324  AVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLL  503
            AV+VGT+TDD R  EVPA+KVCALRFT+TARARI  AGGECLTFDQLALRAPLGQNTVLL
Sbjct  61   AVIVGTVTDDKRINEVPAMKVCALRFTETARARIINAGGECLTFDQLALRAPLGQNTVLL  120

Query  504  RGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            RGPKN+REAVKHFGPAPGVPHSHTKPYVR+
Sbjct  121  RGPKNAREAVKHFGPAPGVPHSHTKPYVRS  150



>gb|EYU21621.1| hypothetical protein MIMGU_mgv1a014504mg [Erythranthe guttata]
Length=187

 Score =   265 bits (678),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 135/168 (80%), Positives = 154/168 (92%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK+TKRTAP+S+DVY+KLLVKLYRFL RRTGS FN++ILKRL MS+ N+P
Sbjct  1    MGIDLVAGGKSKKTKRTAPRSNDVYIKLLVKLYRFLTRRTGSSFNSIILKRLIMSRVNRP  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLSLSRL S   GKE +IAVLVG+ITDD+R +E+PA+KV ALRFT+TARARIEKAGGECL
Sbjct  61   PLSLSRLSSLMKGKEGQIAVLVGSITDDIRVHEIPAMKVAALRFTETARARIEKAGGECL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLALRAPLGQNTVLLRG + +REAV+HFGPAPGVPHSHTKPYVR+
Sbjct  121  TFDQLALRAPLGQNTVLLRGSRKAREAVRHFGPAPGVPHSHTKPYVRS  168



>ref|XP_002985888.1| hypothetical protein SELMODRAFT_181978 [Selaginella moellendorffii]
 gb|EFJ13065.1| hypothetical protein SELMODRAFT_181978 [Selaginella moellendorffii]
Length=187

 Score =   265 bits (676),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 131/168 (78%), Positives = 148/168 (88%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGID++AGG++K+TKRTAPKSD+VYLKLLVKLYRFLVRRT SKFNAVILKRLFMSKTN+P
Sbjct  1    MGIDIEAGGRNKKTKRTAPKSDNVYLKLLVKLYRFLVRRTNSKFNAVILKRLFMSKTNQP  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            P+SLSRL +    K  KIAVLVGT+TDD R   VPA+ V ALRFT+TARARI  AGG+CL
Sbjct  61   PVSLSRLSASMEKKSGKIAVLVGTVTDDPRLAAVPAMTVVALRFTRTARARITNAGGKCL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFD+LAL AP G NTVLLRG K++REAVKHFGPAPGVPHSHTKPYVR+
Sbjct  121  TFDELALLAPTGCNTVLLRGRKSAREAVKHFGPAPGVPHSHTKPYVRS  168



>ref|XP_002976425.1| hypothetical protein SELMODRAFT_267976 [Selaginella moellendorffii]
 gb|EFJ22685.1| hypothetical protein SELMODRAFT_267976 [Selaginella moellendorffii]
Length=187

 Score =   265 bits (676),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 131/168 (78%), Positives = 148/168 (88%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGID++AGG++K+TKRTAPKSD+VYLKLLVKLYRFLVRRT SKFNAVILKRLFMSKTN+P
Sbjct  1    MGIDIEAGGRNKKTKRTAPKSDNVYLKLLVKLYRFLVRRTNSKFNAVILKRLFMSKTNQP  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            P+SLSRL +    K  KIAVLVGT+TDD R   VPA+ V ALRFT+TARARI  AGG+CL
Sbjct  61   PVSLSRLSASMEKKSGKIAVLVGTVTDDPRLATVPAMTVVALRFTRTARARITNAGGKCL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFD+LAL AP G NTVLLRG K++REAVKHFGPAPGVPHSHTKPYVR+
Sbjct  121  TFDELALLAPTGCNTVLLRGRKSAREAVKHFGPAPGVPHSHTKPYVRS  168



>ref|XP_005843726.1| hypothetical protein CHLNCDRAFT_37334 [Chlorella variabilis]
 gb|EFN51624.1| hypothetical protein CHLNCDRAFT_37334 [Chlorella variabilis]
Length=187

 Score =   263 bits (671),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 130/168 (77%), Positives = 145/168 (86%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGG++K+  RTAPKS++ Y+KLLVKLYRFLVRRT S FN V+LKRLFMSKTN+P
Sbjct  1    MGIDLIAGGRNKRVHRTAPKSENPYVKLLVKLYRFLVRRTESDFNKVVLKRLFMSKTNRP  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLSLS+L+ F  GKE K+AVLVGTITDD R +EVP L+VCALR T+TARARI KAGGE +
Sbjct  61   PLSLSKLVKFMEGKEGKLAVLVGTITDDTRLFEVPKLRVCALRVTETARARILKAGGEII  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLAL AP G NTVLLRGPKNSREAVKHFGPAPGVP S  KPYVRA
Sbjct  121  TFDQLALIAPTGSNTVLLRGPKNSREAVKHFGPAPGVPGSTAKPYVRA  168



>ref|XP_007510670.1| predicted protein [Bathycoccus prasinos]
 emb|CCO18203.1| predicted protein [Bathycoccus prasinos]
Length=240

 Score =   264 bits (674),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 128/166 (77%), Positives = 144/166 (87%), Gaps = 1/166 (1%)
 Frame = +3

Query  93   GIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPP  272
            GIDL+AGG++K+TKRT+ KS++VYL LLVKLYRFL RRT SKFN  +LKRLFMSKTN+PP
Sbjct  56   GIDLEAGGRNKKTKRTSQKSENVYLALLVKLYRFLARRTDSKFNQTVLKRLFMSKTNRPP  115

Query  273  LSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLT  452
            LSLS+L  F  GKE K+A +VGTITDDVR +EVP L VCALRFT TARARI KAGGECLT
Sbjct  116  LSLSKLAKFMKGKEGKVACVVGTITDDVRMFEVPKLTVCALRFTATARARIVKAGGECLT  175

Query  453  FDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVR  590
            FDQLAL+AP G+  VLLRGPKNSREAVKHFG APGVPHSH KPYV+
Sbjct  176  FDQLALKAPTGEGVVLLRGPKNSREAVKHFG-APGVPHSHAKPYVQ  220



>gb|KJB26287.1| hypothetical protein B456_004G239000 [Gossypium raimondii]
Length=224

 Score =   260 bits (665),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 136/199 (68%), Positives = 150/199 (75%), Gaps = 31/199 (16%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK++KRTAPKSDD+YLKLLVKLYRFLVRR GS FNAVILKRLFM K NKP
Sbjct  1    MGIDLVAGGKSKKSKRTAPKSDDIYLKLLVKLYRFLVRRAGSNFNAVILKRLFMRKVNKP  60

Query  270  PLSLSRL--------ISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARI  425
            PLSL  +        +++    EDKI V+VGT+TDD+R YEVPAL V ALRFT+TARARI
Sbjct  61   PLSLYFICGSGFLGSLNYCWFGEDKIGVVVGTVTDDIRVYEVPALTVTALRFTETARARI  120

Query  426  EKAGGECLTFDQLALRAPLGQNT-----------------------VLLRGPKNSREAVK  536
            EKAGGECLTFDQLALRAPLG                          VLLRGPKN+REAVK
Sbjct  121  EKAGGECLTFDQLALRAPLGVEMPVLLPCTIKNVTGMISRKHNVPEVLLRGPKNAREAVK  180

Query  537  HFGPAPGVPHSHTKPYVRA  593
            HFGPAPGVPHSH+KPYVR+
Sbjct  181  HFGPAPGVPHSHSKPYVRS  199



>ref|XP_005643635.1| ribosomal protein L18 component of cytosolic 80S ribosome and 
60S large subunit [Coccomyxa subellipsoidea C-169]
 gb|EIE19091.1| ribosomal protein L18 component of cytosolic 80S ribosome and 
60S large subunit [Coccomyxa subellipsoidea C-169]
Length=186

 Score =   256 bits (655),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 129/168 (77%), Positives = 145/168 (86%), Gaps = 1/168 (1%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL+AGG++K+T RTAPKS++VYLKLLVKLY FLVRRT SKFN V+LKRLFMS+TN+P
Sbjct  1    MGIDLEAGGRNKKTWRTAPKSENVYLKLLVKLYTFLVRRTESKFNKVVLKRLFMSRTNRP  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLSLS+L +F  GKEDK AVL+GTITDDVR +EVP L V ALR T+TARARI  AGG+ L
Sbjct  61   PLSLSKLATFMKGKEDKTAVLIGTITDDVRLFEVPKLTVVALRVTETARARILGAGGKIL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLAL AP G N VLLRGPKNSREAVKH G APGVPHSH KPYVR+
Sbjct  121  TFDQLALLAPTGSNCVLLRGPKNSREAVKHRG-APGVPHSHAKPYVRS  167



>ref|XP_009775352.1| PREDICTED: 60S ribosomal protein L18-2 [Nicotiana sylvestris]
Length=173

 Score =   252 bits (644),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 134/168 (80%), Positives = 141/168 (84%), Gaps = 14/168 (8%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK+TKRT P+SDDVYLKLLVKLYRFLVRRTGS+FNAVILKRLFMSK NK 
Sbjct  1    MGIDLVAGGKSKKTKRTTPQSDDVYLKLLVKLYRFLVRRTGSQFNAVILKRLFMSKINKA  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLSLSRLI++  GKEDK+A              V    V ALRFT+TARARIEKAGGECL
Sbjct  61   PLSLSRLITYMKGKEDKVA--------------VVVGTVTALRFTETARARIEKAGGECL  106

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLALRAPLGQNTVLLRGPKNSREAVKHFG APGV HSHTKPYVRA
Sbjct  107  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGRAPGVSHSHTKPYVRA  154



>ref|XP_011396696.1| 60S ribosomal protein L18-3 [Auxenochlorella protothecoides]
 gb|KFM23818.1| 60S ribosomal protein L18-3 [Auxenochlorella protothecoides]
Length=187

 Score =   253 bits (645),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 125/168 (74%), Positives = 141/168 (84%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL+AGG++ +  RTAPKS + Y+KLLVKLYRFLVRRT S FN VILKRLFMSK N+P
Sbjct  1    MGIDLRAGGRNTKVHRTAPKSQNPYVKLLVKLYRFLVRRTESDFNKVILKRLFMSKVNRP  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLSLS+L  FT G+  KIAVLVGT+TDD+R +EVP ++V ALR T+TARARI  AGGE L
Sbjct  61   PLSLSKLAKFTAGQPGKIAVLVGTVTDDIRLHEVPKIRVAALRVTETARARIVAAGGEVL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            T DQLAL AP G NTVLLRGPKNSREAVKHFGPAPGVP S TKPYVR+
Sbjct  121  TLDQLALLAPTGSNTVLLRGPKNSREAVKHFGPAPGVPGSSTKPYVRS  168



>gb|ADD54595.1| putative ribosomal protein L18 [Linum usitatissimum]
Length=154

 Score =   251 bits (641),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 121/135 (90%), Positives = 128/135 (95%), Gaps = 0/135 (0%)
 Frame = +3

Query  189  RFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTPGKEDKIAVLVGTITDDVRAYE  368
            RFLVRRTGS FNAVILKRLFMSK NKPPLSLSRLI FT GKE KIAV+VGTITDD+R Y+
Sbjct  1    RFLVRRTGSSFNAVILKRLFMSKVNKPPLSLSRLIRFTKGKEGKIAVVVGTITDDIRVYD  60

Query  369  VPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGP  548
            VPA+KV ALRFT+TARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKN+REAVKHFGP
Sbjct  61   VPAMKVTALRFTETARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNAREAVKHFGP  120

Query  549  APGVPHSHTKPYVRA  593
            APGVPHSHTKPYVR+
Sbjct  121  APGVPHSHTKPYVRS  135



>gb|KJB41868.1| hypothetical protein B456_007G127300 [Gossypium raimondii]
Length=178

 Score =   252 bits (643),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 123/136 (90%), Positives = 129/136 (95%), Gaps = 0/136 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLSLSRLI F  GKEDKIAV+VG +TDD+R YEVPALKV ALRFT+TARARIEKAGGECL
Sbjct  61   PLSLSRLIQFMKGKEDKIAVVVGAVTDDIRVYEVPALKVTALRFTETARARIEKAGGECL  120

Query  450  TFDQLALRAPLGQNTV  497
            TFDQLALRAPLGQNTV
Sbjct  121  TFDQLALRAPLGQNTV  136



>gb|KJB45331.1| hypothetical protein B456_007G301700 [Gossypium raimondii]
Length=195

 Score =   252 bits (643),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 123/136 (90%), Positives = 129/136 (95%), Gaps = 0/136 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK NKP
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKVNKP  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLSLSRLI F  GKEDKIAV+VGT+TDD+R YEVPALKV ALRFT+TARARIEKAGGECL
Sbjct  61   PLSLSRLIEFMKGKEDKIAVVVGTVTDDIRVYEVPALKVTALRFTETARARIEKAGGECL  120

Query  450  TFDQLALRAPLGQNTV  497
            TFDQLALRAPLGQNTV
Sbjct  121  TFDQLALRAPLGQNTV  136



>gb|KJB23304.1| hypothetical protein B456_004G091200 [Gossypium raimondii]
Length=159

 Score =   248 bits (634),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 121/136 (89%), Positives = 129/136 (95%), Gaps = 0/136 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK+TKRTAPKSDD+YLKL+VKLYRFLVRRTGSKFNAVILKRLFMSK NKP
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSDDIYLKLIVKLYRFLVRRTGSKFNAVILKRLFMSKVNKP  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLSLSRLI F  GKEDKIAV+VGT+TDD+R YEVPALKV ALRFT+TARARI+KAGGECL
Sbjct  61   PLSLSRLIEFMKGKEDKIAVVVGTVTDDIRVYEVPALKVTALRFTETARARIDKAGGECL  120

Query  450  TFDQLALRAPLGQNTV  497
            TFDQLALRAPLGQNTV
Sbjct  121  TFDQLALRAPLGQNTV  136



>ref|XP_006433452.1| hypothetical protein CICLE_v10002597mg [Citrus clementina]
 gb|ESR46692.1| hypothetical protein CICLE_v10002597mg [Citrus clementina]
 gb|KDO39193.1| hypothetical protein CISIN_1g030771mg [Citrus sinensis]
Length=171

 Score =   245 bits (626),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 120/136 (88%), Positives = 128/136 (94%), Gaps = 0/136 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK++KRTAPKSDD+YLKLLVKLYRFLVRRT S FN VILKRLFMSK NKP
Sbjct  1    MGIDLVAGGKSKKSKRTAPKSDDIYLKLLVKLYRFLVRRTDSNFNKVILKRLFMSKVNKP  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLSLSRLI+F  GKEDKIAV+VGT+TDD+RAYEVPALKV ALRFT+TARARIEKAGGECL
Sbjct  61   PLSLSRLINFMKGKEDKIAVVVGTVTDDIRAYEVPALKVTALRFTETARARIEKAGGECL  120

Query  450  TFDQLALRAPLGQNTV  497
            TFDQLALRAPLGQNTV
Sbjct  121  TFDQLALRAPLGQNTV  136



>ref|XP_010559184.1| PREDICTED: 60S ribosomal protein L18-2-like [Tarenaya hassleriana]
Length=145

 Score =   244 bits (624),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 121/141 (86%), Positives = 129/141 (91%), Gaps = 0/141 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDLKAGGKSK+TKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK NKP
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKVNKP  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLSLSRLI +  GK+DKI V+VGT+TDD R YEVPALK+ ALRFT+ ARARIEKAGGECL
Sbjct  61   PLSLSRLIRYMQGKKDKIGVIVGTVTDDARVYEVPALKITALRFTERARARIEKAGGECL  120

Query  450  TFDQLALRAPLGQNTVLLRGP  512
            TFDQLALRAPLGQNTV +  P
Sbjct  121  TFDQLALRAPLGQNTVYIFLP  141



>dbj|BAJ93091.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=212

 Score =   245 bits (626),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 119/146 (82%), Positives = 133/146 (91%), Gaps = 1/146 (1%)
 Frame = +3

Query  159  VYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSRLISFTPGKEDK-IAVLV  335
            VYLKLLVKLYRFLVRRT SKFNAVILKRLFMSKTN+PPLS+ RL +F  GKE+K IAV+V
Sbjct  48   VYLKLLVKLYRFLVRRTKSKFNAVILKRLFMSKTNRPPLSMRRLSNFMKGKEEKNIAVVV  107

Query  336  GTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPK  515
            GTITDD+R  E+PA+KV ALRFT+TARARI  AGGECLTFDQLALRAP G+NT+LLRGPK
Sbjct  108  GTITDDMRIQEIPAMKVTALRFTETARARIVNAGGECLTFDQLALRAPTGENTILLRGPK  167

Query  516  NSREAVKHFGPAPGVPHSHTKPYVRA  593
            N+REAV+HFG APGVPHSHTKPYVR+
Sbjct  168  NAREAVRHFGKAPGVPHSHTKPYVRS  193



>ref|XP_003056676.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH58321.1| predicted protein [Micromonas pusilla CCMP1545]
Length=183

 Score =   244 bits (622),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 121/167 (72%), Positives = 137/167 (82%), Gaps = 4/167 (2%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL+AGG++K   RTAPKS++VYLKLLVKLYRFL RRT S FN  +LKRLFMSK N+P
Sbjct  1    MGIDLEAGGRNKVKHRTAPKSENVYLKLLVKLYRFLARRTDSDFNKTVLKRLFMSKINRP  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLSLS+L  F  G    ++ +VGT+TDD R +EVPA+KVCALRFT+TARARI KAGGEC+
Sbjct  61   PLSLSKLAKFHKGG---VSAIVGTVTDDARMFEVPAMKVCALRFTETARARIIKAGGECM  117

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVR  590
            TFDQLAL AP G    LLRGPKNSREAVKHFG APGVP SH KPYVR
Sbjct  118  TFDQLALSAPTGDGVTLLRGPKNSREAVKHFG-APGVPGSHAKPYVR  163



>gb|KDO39192.1| hypothetical protein CISIN_1g030771mg [Citrus sinensis]
Length=170

 Score =   238 bits (608),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 119/136 (88%), Positives = 127/136 (93%), Gaps = 1/136 (1%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDL AGGKSK++KRTAPKSDD+YLKLLVKLYRFLVRRT S FN VILKRLFMSK NKP
Sbjct  1    MGIDLVAGGKSKKSKRTAPKSDDIYLKLLVKLYRFLVRRTDSNFNKVILKRLFMSKVNKP  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLSLSRLI+F  GK DKIAV+VGT+TDD+RAYEVPALKV ALRFT+TARARIEKAGGECL
Sbjct  61   PLSLSRLINFMKGK-DKIAVVVGTVTDDIRAYEVPALKVTALRFTETARARIEKAGGECL  119

Query  450  TFDQLALRAPLGQNTV  497
            TFDQLALRAPLGQNTV
Sbjct  120  TFDQLALRAPLGQNTV  135



>ref|XP_002506220.1| ribosomal protein L18 [Micromonas sp. RCC299]
 gb|ACO67478.1| ribosomal protein L18 [Micromonas sp. RCC299]
Length=386

 Score =   246 bits (627),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 122/168 (73%), Positives = 142/168 (85%), Gaps = 3/168 (2%)
 Frame = +3

Query  87   TMGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNK  266
            + GID++AGG++K+  RTAPKS++VYLKLLVKLYRFLVRRT SK N  ILKRLFMSK N+
Sbjct  202  SQGIDIEAGGRNKKKSRTAPKSENVYLKLLVKLYRFLVRRTDSKVNETILKRLFMSKINR  261

Query  267  PPLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGEC  446
            PPLSLS+L  F   K  +I+ +VGTITDD R +EVPAL+VCALRFT+TARARI KAGGEC
Sbjct  262  PPLSLSKLAKFA--KPGQISAVVGTITDDARMFEVPALRVCALRFTETARARIVKAGGEC  319

Query  447  LTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVR  590
            +TFDQLAL+AP G+N  LLRGPK+ REAVKHFG APGVP SH KPYVR
Sbjct  320  ITFDQLALQAPTGENVCLLRGPKSHREAVKHFG-APGVPGSHAKPYVR  366



>ref|XP_011255380.1| PREDICTED: 60S ribosomal protein L18 [Camponotus floridanus]
 gb|EFN68908.1| 60S ribosomal protein L18 [Camponotus floridanus]
Length=188

 Score =   238 bits (608),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 111/170 (65%), Positives = 141/170 (83%), Gaps = 3/170 (2%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGID+      ++ +RT PKS DVYL+LLVKLYRFL RRT SKFN +IL+RLFMSK N+P
Sbjct  1    MGIDINHK-HDRKVRRTEPKSQDVYLRLLVKLYRFLARRTNSKFNQIILRRLFMSKINRP  59

Query  270  PLSLSRLISFT--PGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGE  443
            P+SL+R++ F   PG+E+ +AV+VG++TDD R +E+P L VCALR T+ ARARI KAGGE
Sbjct  60   PISLARIVRFMKKPGRENCVAVIVGSVTDDARIFEIPKLTVCALRVTERARARILKAGGE  119

Query  444  CLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
             +TFDQLALRAP G+ TVL++GP+ +RE+VKHFGPAPGVPHSH+KPYVR+
Sbjct  120  IITFDQLALRAPTGKRTVLMQGPRKARESVKHFGPAPGVPHSHSKPYVRS  169



>ref|XP_968042.1| PREDICTED: 60S ribosomal protein L18 [Tribolium castaneum]
 gb|EFA00786.1| hypothetical protein TcasGA2_TC003672 [Tribolium castaneum]
Length=188

 Score =   237 bits (604),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 116/169 (69%), Positives = 137/169 (81%), Gaps = 3/169 (2%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGID+      ++ +RT PKS DVYL+LLVKLYR+L RRTGSKFN +ILKRLFMSK NKP
Sbjct  1    MGIDINHK-HDRKVRRTEPKSQDVYLRLLVKLYRYLARRTGSKFNKIILKRLFMSKINKP  59

Query  270  PLSLSRLISFT--PGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGE  443
            P+SL+R++     PG+E   AV+VGT+TDD R +EVP L +CALR T TARARI KAGGE
Sbjct  60   PISLARVVRAMKKPGREGLTAVIVGTVTDDARIWEVPKLSICALRVTGTARARILKAGGE  119

Query  444  CLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVR  590
             +TFDQLALRAP G  TVLL+G +N+REAVKHFGPAPGVPHSHTKP+VR
Sbjct  120  VITFDQLALRAPTGAKTVLLQGRRNAREAVKHFGPAPGVPHSHTKPFVR  168



>ref|XP_011351685.1| PREDICTED: 60S ribosomal protein L18 [Cerapachys biroi]
 gb|EZA61183.1| 60S ribosomal protein L18 [Cerapachys biroi]
Length=188

 Score =   236 bits (602),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 112/170 (66%), Positives = 141/170 (83%), Gaps = 3/170 (2%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGID+      ++ +RT PKS+DVYL+LLVKLYRFL RRT SKFN +ILKRLFMSK ++P
Sbjct  1    MGIDINHK-HDRKVRRTEPKSEDVYLRLLVKLYRFLARRTNSKFNRIILKRLFMSKIHRP  59

Query  270  PLSLSRLISFT--PGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGE  443
            P+SL+R++ F   PG+E+ IAV+VGT+TDD R +E+P L VCALR T  ARARI KAGGE
Sbjct  60   PISLARIVRFMKKPGRENCIAVIVGTVTDDARIFEIPKLTVCALRVTTRARARILKAGGE  119

Query  444  CLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
             +T DQLALRAP G++TVL++GP+ +RE+VKHFGPAPGVPHSH+KPYVR+
Sbjct  120  IITLDQLALRAPTGKHTVLMQGPRKARESVKHFGPAPGVPHSHSKPYVRS  169



>ref|XP_003707499.1| PREDICTED: 60S ribosomal protein L18-like [Megachile rotundata]
Length=218

 Score =   236 bits (603),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 113/170 (66%), Positives = 140/170 (82%), Gaps = 3/170 (2%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGID+      ++ +RT PKS DVYL+LLVKLYRFL RRT +KFN +ILKRLFMSK ++P
Sbjct  31   MGIDINHK-HDRKVRRTEPKSQDVYLRLLVKLYRFLARRTNAKFNKIILKRLFMSKIHRP  89

Query  270  PLSLSRLISFT--PGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGE  443
            P+SL+R++ F   PG+E+ IAV+VGT+TDD R +E+P L VCALR T+ ARARI KAGGE
Sbjct  90   PISLARVVRFMKKPGRENAIAVIVGTVTDDARIFEIPKLTVCALRITEKARARILKAGGE  149

Query  444  CLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
             +TFDQLALRAP G+ TVL++G +N+REAVKHFGPAPGVPHSHTKP VR+
Sbjct  150  LITFDQLALRAPTGRRTVLMQGRRNAREAVKHFGPAPGVPHSHTKPLVRS  199



>emb|CBK21900.2| Ribosomal protein L18e [Blastocystis hominis]
Length=189

 Score =   235 bits (600),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 115/169 (68%), Positives = 139/169 (82%), Gaps = 2/169 (1%)
 Frame = +3

Query  90   MGIDLKAGGKS-KQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNK  266
            MGIDL AGG++    KR APKS++VYL LLV LYRFL RRT ++F  V+LKRL+MS+ N+
Sbjct  3    MGIDLVAGGRNCGHKKRQAPKSENVYLALLVNLYRFLARRTNARFPEVVLKRLYMSRINR  62

Query  267  PPLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGEC  446
            PP+SLSRL+    GKEDKIAV+VGT+TDD+R  EVPALKVCALRFT+TARARI KAGGEC
Sbjct  63   PPMSLSRLMKHMQGKEDKIAVIVGTVTDDIRVIEVPALKVCALRFTETARARILKAGGEC  122

Query  447  LTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            +T DQLALRAP G NTVLL+G +++REAV+HFG  PG P S  +PYVR+
Sbjct  123  ITLDQLALRAPTGANTVLLQGHRSAREAVRHFG-TPGTPGSKARPYVRS  170



>ref|XP_001745439.1| hypothetical protein [Monosiga brevicollis MX1]
 gb|EDQ90017.1| predicted protein [Monosiga brevicollis MX1]
Length=185

 Score =   234 bits (598),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 115/168 (68%), Positives = 139/168 (83%), Gaps = 2/168 (1%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGID++    +K+ +RTAP+S+D YL+LLVKLYRFL RRT S FN V+L+RLFMS+ N+P
Sbjct  1    MGIDIRHH-HAKKGRRTAPESEDPYLRLLVKLYRFLARRTESSFNKVVLRRLFMSRINRP  59

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLSLS+L++    +E KIAV+VGT+TDDVR  EVP L VCALR T++AR RI  AGGE +
Sbjct  60   PLSLSKLMTHMKKQESKIAVIVGTVTDDVRVIEVPKLTVCALRVTESARKRILAAGGEIM  119

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLALRAP GQNTVLL+GP+ SREAVKHFG APGVPHSH KPYVR+
Sbjct  120  TFDQLALRAPTGQNTVLLQGPRKSREAVKHFG-APGVPHSHVKPYVRS  166



>ref|XP_010277700.1| PREDICTED: uncharacterized protein LOC104612082 [Nelumbo nucifera]
Length=491

 Score =   244 bits (623),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 120/151 (79%), Positives = 131/151 (87%), Gaps = 4/151 (3%)
 Frame = +3

Query  108  AGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPPLSLSR  287
            AGGKSK+TKRTAPKS D+YLKL    YRFL+RRTGS FNAVILKRLFMS+ NK P+SLS 
Sbjct  282  AGGKSKKTKRTAPKSKDIYLKL----YRFLIRRTGSNFNAVILKRLFMSRVNKAPMSLSI  337

Query  288  LISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLTFDQLA  467
            LISF  GKEDKI V+VGT+TDD + YEVPALKV ALRFT+T RARI K GGECLTFDQLA
Sbjct  338  LISFMKGKEDKIVVIVGTVTDDTQVYEVPALKVTALRFTETTRARILKVGGECLTFDQLA  397

Query  468  LRAPLGQNTVLLRGPKNSREAVKHFGPAPGV  560
            LRAPLG NT+LLRGPKN+REAVKHFG APGV
Sbjct  398  LRAPLGHNTILLRGPKNAREAVKHFGKAPGV  428



>ref|XP_006561192.1| PREDICTED: 60S ribosomal protein L18-like [Apis mellifera]
 ref|XP_006622209.1| PREDICTED: 60S ribosomal protein L18-like [Apis dorsata]
Length=188

 Score =   234 bits (597),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 112/170 (66%), Positives = 139/170 (82%), Gaps = 3/170 (2%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGID+      ++ +RT PKS DVYL+LLVKLYRFL RRT SKFN +ILKRLFMSK ++P
Sbjct  1    MGIDINHK-HDRKVRRTEPKSQDVYLRLLVKLYRFLARRTNSKFNKIILKRLFMSKIHRP  59

Query  270  PLSLSRLISFT--PGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGE  443
            P+SL+R++ F   PG+E+ IAV+VGT+TDD R +E+P L VCALR T+ ARARI KAGGE
Sbjct  60   PISLARIVRFMKKPGRENAIAVIVGTVTDDARIFEIPKLTVCALRITERARARILKAGGE  119

Query  444  CLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
             ++FDQLALRAP G+ TVL++G + +REAVKHFGPAPGVPHSHTKP VR+
Sbjct  120  LISFDQLALRAPTGKRTVLMQGRRKAREAVKHFGPAPGVPHSHTKPLVRS  169



>ref|XP_003691391.1| PREDICTED: 60S ribosomal protein L18-like [Apis florea]
Length=188

 Score =   234 bits (596),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 112/170 (66%), Positives = 139/170 (82%), Gaps = 3/170 (2%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGID+      ++ +RT PKS DVYL+LLVKLYRFL RRT SKFN +ILKRLFMSK ++P
Sbjct  1    MGIDINHK-HDRKVRRTEPKSQDVYLRLLVKLYRFLARRTNSKFNKIILKRLFMSKIHRP  59

Query  270  PLSLSRLISFT--PGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGE  443
            P+SL+R++ F   PG+E+ IAV+VGT+TDD R +E+P L VCALR T+ ARARI KAGGE
Sbjct  60   PISLARIVRFMKKPGRENAIAVIVGTVTDDARIFEIPKLTVCALRVTERARARILKAGGE  119

Query  444  CLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
             ++FDQLALRAP G+ TVL++G + +REAVKHFGPAPGVPHSHTKP VR+
Sbjct  120  LISFDQLALRAPTGKRTVLMQGRRKAREAVKHFGPAPGVPHSHTKPLVRS  169



>ref|XP_006677675.1| hypothetical protein BATDEDRAFT_87003 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF82239.1| hypothetical protein BATDEDRAFT_87003 [Batrachochytrium dendrobatidis 
JAM81]
Length=186

 Score =   233 bits (595),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 116/168 (69%), Positives = 135/168 (80%), Gaps = 1/168 (1%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MG+DL+     K+  R APKSD+VYL+LLVKLYRFL RRT SKFN V+LKRLFMS+ N+P
Sbjct  1    MGVDLQKKHHQKKGARVAPKSDNVYLRLLVKLYRFLARRTNSKFNQVVLKRLFMSRVNRP  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            P+S+SRL  +  GKE+KIAV+VGT+TDD R  EVP + V ALR T +ARARI KAGGE L
Sbjct  61   PISISRLSKYLSGKENKIAVVVGTVTDDNRLLEVPKISVAALRVTNSARARILKAGGEIL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLALR+PLG+ TVLLRGPKNSREAVKHFG  PG P S  KPYVR+
Sbjct  121  TFDQLALRSPLGKGTVLLRGPKNSREAVKHFG-TPGKPGSTAKPYVRS  167



>gb|KFM61778.1| 60S ribosomal protein L18, partial [Stegodyphus mimosarum]
Length=171

 Score =   233 bits (593),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 112/170 (66%), Positives = 138/170 (81%), Gaps = 3/170 (2%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGID+      K  +R APKSDD+YL+LLVKLYRFL RRTG KFN ++LKR+FMS+ N+P
Sbjct  1    MGIDINHKYDRKVVRR-APKSDDIYLRLLVKLYRFLARRTGKKFNKIVLKRMFMSRINRP  59

Query  270  PLSLSRLISFT--PGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGE  443
            PLSL++L      PG E+KIAV+VGT+TDD+R YEVP L +CALR T+ ARARI KAGGE
Sbjct  60   PLSLAKLAKMVKKPGNENKIAVVVGTVTDDLRLYEVPKLTLCALRVTERARARILKAGGE  119

Query  444  CLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
             +TFDQLA+R+P GQNT+LL+G + +REA +HFG APGVPHSHTKPYVR+
Sbjct  120  IITFDQLAMRSPHGQNTLLLQGRRKAREACRHFGKAPGVPHSHTKPYVRS  169



>ref|XP_011497333.1| PREDICTED: 60S ribosomal protein L18 [Ceratosolen solmsi marchali]
Length=188

 Score =   233 bits (593),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 112/170 (66%), Positives = 138/170 (81%), Gaps = 3/170 (2%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGID+      ++ +RT PKS DVYL+LLVKLYRFL RRT SKFN +ILKRLFMS+ ++P
Sbjct  1    MGIDINHK-HDRKVRRTEPKSQDVYLRLLVKLYRFLARRTRSKFNRIILKRLFMSRIHRP  59

Query  270  PLSLSRLISFT--PGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGE  443
            P+SL+R+  F   PG+ED IAV+VGT+TDD R +EVP L +CALR T+ AR RI KAGGE
Sbjct  60   PISLARITRFMKKPGREDCIAVIVGTVTDDARIFEVPKLTICALRVTEKARGRILKAGGE  119

Query  444  CLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
             +TFDQLALR+P G+ TVL++GP+ +REAVKHFGPAPGVPHSHTKP VR+
Sbjct  120  IITFDQLALRSPTGRKTVLIQGPRKAREAVKHFGPAPGVPHSHTKPLVRS  169



>ref|XP_011062886.1| PREDICTED: 60S ribosomal protein L18 [Acromyrmex echinatior]
 gb|EGI60312.1| 60S ribosomal protein L18 [Acromyrmex echinatior]
Length=232

 Score =   233 bits (595),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 112/170 (66%), Positives = 138/170 (81%), Gaps = 3/170 (2%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGID+      ++ +RT PKS DVYL+LLVKLYRFL RRT SKFN +ILKRLFMSK ++P
Sbjct  45   MGIDIN-HKHDRKVRRTEPKSQDVYLRLLVKLYRFLARRTNSKFNKIILKRLFMSKIHRP  103

Query  270  PLSLSRLISFT--PGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGE  443
            P+SL+R++ F   P +E+ +AV+VGTITDD R +EVP L VCALR T+ ARARI K GGE
Sbjct  104  PISLARIVRFMKKPNRENCVAVIVGTITDDARIFEVPKLTVCALRVTEKARARILKNGGE  163

Query  444  CLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
             +TFDQLALR+P G  TVL++GP+N+RE+VKHFG APGVPHSHTKPYVR+
Sbjct  164  IITFDQLALRSPTGSRTVLMQGPRNARESVKHFGLAPGVPHSHTKPYVRS  213



>emb|CBK22327.2| unnamed protein product [Blastocystis hominis]
Length=194

 Score =   232 bits (592),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 114/168 (68%), Positives = 138/168 (82%), Gaps = 2/168 (1%)
 Frame = +3

Query  93   GIDLKAGGKS-KQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            GIDL AGG++    KR APKS++VYL LLV LYRFL RRT ++F  V+LKRL+MS+ N+P
Sbjct  9    GIDLVAGGRNCGHKKRQAPKSENVYLALLVNLYRFLARRTNARFPEVVLKRLYMSRINRP  68

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            P+SLSRL+    GKEDKIAV+VGT+TDD+R  EVPALKVCALRFT+TARARI KAGGEC+
Sbjct  69   PMSLSRLMKHMQGKEDKIAVIVGTVTDDIRVIEVPALKVCALRFTETARARILKAGGECI  128

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            T DQLALRAP G NTVLL+G +++REAV+HFG  PG P S  +PYVR+
Sbjct  129  TLDQLALRAPTGANTVLLQGHRSAREAVRHFG-TPGTPGSKARPYVRS  175



>ref|XP_011351645.1| PREDICTED: 60S ribosomal protein L18-like [Cerapachys biroi]
 gb|EZA61166.1| 60S ribosomal protein L18 [Cerapachys biroi]
Length=188

 Score =   231 bits (589),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 111/170 (65%), Positives = 138/170 (81%), Gaps = 3/170 (2%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGID+      ++ +RT PKS DVYL+LLVKLYRFL RRT SKFN +ILKRLFMSK + P
Sbjct  1    MGIDINHK-HDRKVRRTEPKSQDVYLRLLVKLYRFLARRTNSKFNRIILKRLFMSKIHLP  59

Query  270  PLSLSRLISFT--PGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGE  443
            P+SL+R++ F   PG+E+ IAV+VGT+TDD R +E+P L +CALR T+ AR RI KAGGE
Sbjct  60   PISLARIVRFMKKPGRENCIAVIVGTVTDDSRIFEIPKLTICALRVTEKARGRILKAGGE  119

Query  444  CLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
             +TFDQLALRAP G+ TVL++GP+ +RE+VKHFG APGVPHSHTKPYVR+
Sbjct  120  IITFDQLALRAPTGKRTVLMQGPRKARESVKHFGLAPGVPHSHTKPYVRS  169



>gb|KDR14978.1| 60S ribosomal protein L18 [Zootermopsis nevadensis]
Length=188

 Score =   231 bits (589),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 114/170 (67%), Positives = 137/170 (81%), Gaps = 3/170 (2%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGID+      ++ +RT PKS DVYL+LLVKLYRFL RRT SKFN +ILKRLFMSK N+P
Sbjct  1    MGIDINHKW-DRKVRRTEPKSQDVYLRLLVKLYRFLTRRTKSKFNKIILKRLFMSKINRP  59

Query  270  PLSLSRLISFT--PGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGE  443
            P+SL+R++     P + + IAV+VGTITDD R +EVP L VCALR T+ ARARI KAGGE
Sbjct  60   PISLARVVHLMKDPERANLIAVIVGTITDDQRIFEVPKLTVCALRVTERARARILKAGGE  119

Query  444  CLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
             +TFDQLALRAP G+ TVL++G +N+REAVKHFG APGVPHSHTKPYVR+
Sbjct  120  IITFDQLALRAPTGKKTVLIQGRRNAREAVKHFGLAPGVPHSHTKPYVRS  169



>emb|CAJ17294.1| ribosomal protein L18e [Hister sp. APV-2005]
Length=188

 Score =   231 bits (588),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 110/170 (65%), Positives = 137/170 (81%), Gaps = 3/170 (2%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGID+      ++ +RT P+S DVYL+LLVKLYR+L RRT SKFN +IL+RLFMS+ N+ 
Sbjct  1    MGIDINHK-HDRKVRRTEPRSQDVYLRLLVKLYRYLARRTNSKFNKIILRRLFMSRINRA  59

Query  270  PLSLSRLISFT--PGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGE  443
            P+SL+R++ F   PG+E  +AV+VGT+TDD R +EVP L VCALR T+ ARARI KAGGE
Sbjct  60   PMSLARIVRFMKKPGREGLMAVVVGTVTDDQRIWEVPKLTVCALRITEKARARILKAGGE  119

Query  444  CLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
             LTFDQLALRAP G  TVL++G + +REAVKHFGPAPGVPHSHTKP+VR+
Sbjct  120  ILTFDQLALRAPTGNKTVLMQGKRTAREAVKHFGPAPGVPHSHTKPFVRS  169



>ref|XP_008201914.1| PREDICTED: 60S ribosomal protein L18 [Nasonia vitripennis]
Length=188

 Score =   230 bits (587),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 111/170 (65%), Positives = 137/170 (81%), Gaps = 3/170 (2%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGID+      ++ +RT PKS DVYL+LLVKLYRFL RRT SKFN +ILKRLFMS+ ++P
Sbjct  1    MGIDINHK-HDRKVRRTEPKSQDVYLRLLVKLYRFLARRTNSKFNKIILKRLFMSRIHRP  59

Query  270  PLSLSRLISFT--PGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGE  443
            P+SL+R+  F   PG+E+ IAV+VGT+TDD R +EVP L VCALR T+ AR RI KAGGE
Sbjct  60   PISLARVTRFMKKPGRENCIAVIVGTVTDDARIFEVPKLTVCALRVTEKARGRILKAGGE  119

Query  444  CLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
             +TFDQLAL++P G+ TVL++GP+  REAVKHFGPAPGVPHSHTKP VR+
Sbjct  120  IITFDQLALKSPTGRKTVLIQGPRKGREAVKHFGPAPGVPHSHTKPLVRS  169



>ref|XP_005312106.1| PREDICTED: 60S ribosomal protein L18 [Chrysemys picta bellii]
Length=188

 Score =   230 bits (587),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 108/170 (64%), Positives = 138/170 (81%), Gaps = 3/170 (2%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MG+D++   K ++ +RT PKS D+YL+LLVKLYRFL RRT S+FN V+LKRLFMS+TN+P
Sbjct  1    MGVDIRHN-KDRKVRRTEPKSQDIYLRLLVKLYRFLARRTSSRFNKVVLKRLFMSRTNRP  59

Query  270  PLSLSRLISFT--PGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGE  443
            PLSLSR+I     PG+++K AV+VGT+TDD+R +++P LKVCALR T+ AR+RI KAGG+
Sbjct  60   PLSLSRMIRKMKLPGRDNKTAVVVGTVTDDIRIHDIPKLKVCALRVTQGARSRILKAGGQ  119

Query  444  CLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
             +TFDQLA+ AP GQ TVLL GP+  RE  +HFG APG PHSHTKPYVR+
Sbjct  120  IMTFDQLAMAAPKGQGTVLLSGPRKGREVYRHFGKAPGTPHSHTKPYVRS  169



>ref|XP_011135288.1| PREDICTED: 60S ribosomal protein L18 [Harpegnathos saltator]
Length=188

 Score =   229 bits (585),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 113/170 (66%), Positives = 135/170 (79%), Gaps = 3/170 (2%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGID+      ++ +RT PKS DVYL+LLVKLYRFL RRT SKFN +ILKRLFMSK NKP
Sbjct  1    MGIDINHK-HDRKVRRTEPKSQDVYLRLLVKLYRFLARRTNSKFNKIILKRLFMSKINKP  59

Query  270  PLSLSRLISFTP--GKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGE  443
            P+SL+R++       +E+ IAV+VGTITDD R +E+P L VCALR T+ AR RI KAGGE
Sbjct  60   PISLARIVRLMSKSHRENCIAVVVGTITDDARIFEIPKLTVCALRVTEKARGRILKAGGE  119

Query  444  CLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
             +TFDQLALRAP G+ TVLL+GP+ +REA KHFGPAPGVPHSHTKP VR+
Sbjct  120  LITFDQLALRAPTGKRTVLLQGPRKAREAQKHFGPAPGVPHSHTKPLVRS  169



>gb|ELT99918.1| hypothetical protein CAPTEDRAFT_159560 [Capitella teleta]
Length=188

 Score =   229 bits (584),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 109/170 (64%), Positives = 139/170 (82%), Gaps = 3/170 (2%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGID+    K K   R APKS+DVYL+LLVKLYRFL RRT +KFN +ILKRLFMS+TN+ 
Sbjct  1    MGIDISHKHKRKVV-RKAPKSEDVYLRLLVKLYRFLARRTDAKFNKIILKRLFMSRTNRA  59

Query  270  PLSLSRLISFT--PGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGE  443
            PLS+ RL+     PG+E+K+AV+VGTIT+DVR +E+P +KVCAL  T+ ARARI K+GGE
Sbjct  60   PLSIHRLVRLMKKPGRENKVAVVVGTITNDVRIFEIPKMKVCALHVTEEARARIIKSGGE  119

Query  444  CLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
             +TFDQLAL+AP GQ TVL++GP++ RE+ KHFG APG+PHSH+KP+VR+
Sbjct  120  IMTFDQLALKAPKGQRTVLVQGPRSQRESQKHFGAAPGLPHSHSKPHVRS  169



>gb|KDD74971.1| hypothetical protein H632_c955p1, partial [Helicosporidium sp. 
ATCC 50920]
Length=175

 Score =   228 bits (582),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 111/168 (66%), Positives = 132/168 (79%), Gaps = 0/168 (0%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGIDLKAGG+ K+T+RT  KS + YL+LL+KLY FL RR    FN V+L+RL  S+ N+ 
Sbjct  1    MGIDLKAGGRVKKTRRTETKSQNPYLQLLIKLYTFLDRRAPCSFNKVVLRRLVQSRVNQA  60

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            P+SLSR+      K+DK+AVLVG +TDD R  EVP L+VCALRFT+TARARI  AGGECL
Sbjct  61   PMSLSRVSKLMTKKQDKVAVLVGKLTDDTRLLEVPKLRVCALRFTETARARITAAGGECL  120

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLAL AP G +TVL+RG + +REA KHFGPAPGVP SHTKPYVRA
Sbjct  121  TFDQLALLAPKGSHTVLMRGKRTAREACKHFGPAPGVPGSHTKPYVRA  168



>ref|XP_005787945.1| hypothetical protein EMIHUDRAFT_433854 [Emiliania huxleyi CCMP1516]
 gb|EOD35516.1| hypothetical protein EMIHUDRAFT_433854 [Emiliania huxleyi CCMP1516]
Length=190

 Score =   229 bits (583),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 114/172 (66%), Positives = 140/172 (81%), Gaps = 5/172 (3%)
 Frame = +3

Query  90   MGIDLKAGGK--SKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTN  263
            MGID+KAGG+  +K++ RTAP S+++YL+L+VKLYRFL RRT +KFN V+LKRLF SKTN
Sbjct  1    MGIDIKAGGRKATKKSGRTAPVSENLYLRLIVKLYRFLARRTDAKFNKVVLKRLFTSKTN  60

Query  264  KPPLSLSRLISFT--PGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAG  437
            +PP+S+  +  F    G E KIAV+VG++TDDVR  +VP L VCALRFT TARARI KAG
Sbjct  61   RPPMSIKSIAKFMAREGNEGKIAVVVGSVTDDVRFLDVPKLTVCALRFTATARARIVKAG  120

Query  438  GECLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            GECLT DQLAL++PLG+ TVLLRG K+ RE+ KHFG APGVPHS  KPYVR+
Sbjct  121  GECLTLDQLALKSPLGEGTVLLRGCKSRRESAKHFG-APGVPHSSVKPYVRS  171



>gb|ABR23470.1| 60s ribosomal protein L18 [Ornithodoros parkeri]
Length=188

 Score =   229 bits (583),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 109/170 (64%), Positives = 138/170 (81%), Gaps = 3/170 (2%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGID+ +    ++  R  PKS +VYL LLVK+YRFL RRT +KFN VILKRLFMS+ N+P
Sbjct  1    MGIDI-SHKHDRKVARKRPKSKNVYLGLLVKVYRFLARRTDAKFNRVILKRLFMSRINRP  59

Query  270  PLSLSRLISFT--PGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGE  443
            P++LS+++ F   PG+E+KIAV+VGTITDDVR YEVP L+VCAL  T  ARARI KAGGE
Sbjct  60   PMALSKVVRFMKKPGRENKIAVVVGTITDDVRLYEVPKLRVCALHVTDRARARIHKAGGE  119

Query  444  CLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
             + FD+LA+++P GQNTVL++G + +REA +HFGPAPGVPHSHTKPYVR+
Sbjct  120  IMNFDELAVKSPRGQNTVLIQGRRTAREACRHFGPAPGVPHSHTKPYVRS  169



>ref|XP_008546759.1| PREDICTED: 60S ribosomal protein L18 [Microplitis demolitor]
Length=188

 Score =   229 bits (583),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 110/170 (65%), Positives = 135/170 (79%), Gaps = 3/170 (2%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGID+      ++ +RT P S D+YL+LLVKLYRFL RRTGSKFN +ILKRLFMS+ NKP
Sbjct  1    MGIDINHK-HDRKVRRTEPASQDIYLRLLVKLYRFLARRTGSKFNKIILKRLFMSRINKP  59

Query  270  PLSLSRLISFT--PGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGE  443
            P+SL+R++ F   P +E+ IAV+VGT+TDD R +E P L VCALR T  AR RI KAGGE
Sbjct  60   PISLARVVRFMKKPHRENCIAVIVGTVTDDARIFECPKLTVCALRVTDKARGRILKAGGE  119

Query  444  CLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
             +TFD+LALR+P G  TVL++G +N+REAVKHFGPAPGVPHSHTKP VR+
Sbjct  120  VITFDELALRSPTGSKTVLMQGRRNAREAVKHFGPAPGVPHSHTKPLVRS  169



>ref|XP_006840598.1| hypothetical protein AMTR_s00343p00015240, partial [Amborella 
trichopoda]
 gb|ERN02273.1| hypothetical protein AMTR_s00343p00015240, partial [Amborella 
trichopoda]
Length=165

 Score =   228 bits (581),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 113/135 (84%), Positives = 121/135 (90%), Gaps = 0/135 (0%)
 Frame = +3

Query  93   GIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPP  272
            GIDL AGGKSK+TKRTAPKS D+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK N+PP
Sbjct  1    GIDLVAGGKSKKTKRTAPKSGDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKINRPP  60

Query  273  LSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECLT  452
            +SLSRLI F  GKE KI V+VG +TDD R YEVPALKV ALRFT+TARARI KAGGECLT
Sbjct  61   ISLSRLIKFMQGKEGKIGVIVGCVTDDTRVYEVPALKVAALRFTETARARIVKAGGECLT  120

Query  453  FDQLALRAPLGQNTV  497
            FDQLAL APLGQNT+
Sbjct  121  FDQLALLAPLGQNTL  135



>ref|XP_008843215.1| PREDICTED: 60S ribosomal protein L18 isoform X2 [Nannospalax 
galili]
Length=185

 Score =   228 bits (581),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 110/168 (65%), Positives = 134/168 (80%), Gaps = 2/168 (1%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MG+D++   K ++ +R  PKS D+YL+LLVKLYRFL RRT S FN V+LKRLFMS+TN+P
Sbjct  1    MGVDIRHN-KDRKVRRKEPKSQDIYLRLLVKLYRFLARRTNSTFNQVVLKRLFMSRTNRP  59

Query  270  PLSLSRLISFTPGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGECL  449
            PLSLSR++   PG+E+K AV+VGTITDDVR  +VP LKVCALR T  AR+RI KAGG+ L
Sbjct  60   PLSLSRMMKL-PGRENKTAVVVGTITDDVRVLDVPKLKVCALRVTSRARSRILKAGGKIL  118

Query  450  TFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            TFDQLAL +P G+ TVLL GP+  RE  +HFG APG PHSHTKPYVR+
Sbjct  119  TFDQLALESPKGRGTVLLSGPRKGREVYRHFGKAPGTPHSHTKPYVRS  166



>ref|XP_002400316.1| ribosomal protein L18, putative [Ixodes scapularis]
 gb|EEC15787.1| ribosomal protein L18, putative [Ixodes scapularis]
Length=188

 Score =   228 bits (581),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 110/170 (65%), Positives = 140/170 (82%), Gaps = 3/170 (2%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGID+      K  +R  PKS++VYL LLVK+YRFL RR+G+KFN ++LKRLFMS+ NKP
Sbjct  1    MGIDINHKYDRKVVRRR-PKSENVYLGLLVKVYRFLARRSGAKFNRIVLKRLFMSRINKP  59

Query  270  PLSLSRLISFT--PGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGE  443
             +SL+R+  F   PG+E+ IAV+VGT+TDD+R Y+VP L++CALR T+ ARARI KAGGE
Sbjct  60   VISLARVTRFMKKPGRENLIAVVVGTVTDDLRLYDVPKLRLCALRVTERARARILKAGGE  119

Query  444  CLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
             LTFDQLA++AP G+ TVL++GP+NSREA +HFGPAPGVPHSHTKPYVR+
Sbjct  120  ILTFDQLAVQAPKGKGTVLMQGPRNSREACRHFGPAPGVPHSHTKPYVRS  169



>ref|XP_011313252.1| PREDICTED: 60S ribosomal protein L18 [Fopius arisanus]
Length=188

 Score =   228 bits (580),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 110/170 (65%), Positives = 136/170 (80%), Gaps = 3/170 (2%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGID+      ++ +RT PKS DVYL+LLVKLYRFL RRT +KFN +ILKRLFMSK ++P
Sbjct  1    MGIDINHK-HDRKVRRTEPKSQDVYLRLLVKLYRFLARRTNAKFNKIILKRLFMSKIHRP  59

Query  270  PLSLSRLISFT--PGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGE  443
            P+SL+R++ F   P +E+ IAV+VGT+TDD R +E+P L VCALR T+ AR RI KAGGE
Sbjct  60   PISLARVVRFMKKPTRENCIAVVVGTVTDDARIFEIPKLTVCALRVTEKARGRILKAGGE  119

Query  444  CLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
             +TFDQLALRAP G  TVL++G + +REAVKHFGPAPGVPHSHTKP VR+
Sbjct  120  IITFDQLALRAPTGNKTVLMQGRRKAREAVKHFGPAPGVPHSHTKPLVRS  169



>sp|Q4PM04.1|RL18_IXOSC RecName: Full=60S ribosomal protein L18 [Ixodes scapularis]
 gb|AAY66961.1| ribosomal protein L18 [Ixodes scapularis]
Length=188

 Score =   228 bits (580),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 110/170 (65%), Positives = 140/170 (82%), Gaps = 3/170 (2%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGID+      K  +R  PKS++VYL LLVK+YRFL RR+G+KFN ++LKRLFMS+ NKP
Sbjct  1    MGIDINHKYDRKVVRRR-PKSENVYLGLLVKVYRFLARRSGAKFNRIVLKRLFMSRINKP  59

Query  270  PLSLSRLISFT--PGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGE  443
             +SL+R+  F   PG+E+ IAV+VGT+TDD+R Y+VP L++CALR T+ ARARI KAGGE
Sbjct  60   VISLARVTRFMKKPGRENLIAVVVGTVTDDLRLYDVPKLRLCALRVTERARARILKAGGE  119

Query  444  CLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
             LTFDQLA++AP G+ TVL++GP+NSREA +HFGPAPGVPHSHTKPYVR+
Sbjct  120  ILTFDQLAVQAPKGKGTVLMQGPRNSREACRHFGPAPGVPHSHTKPYVRS  169



>ref|XP_008843214.1| PREDICTED: 60S ribosomal protein L18 isoform X1 [Nannospalax 
galili]
Length=188

 Score =   228 bits (580),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 111/170 (65%), Positives = 134/170 (79%), Gaps = 3/170 (2%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MG+D++   K ++ +R  PKS D+YL+LLVKLYRFL RRT S FN V+LKRLFMS+TN+P
Sbjct  1    MGVDIRHN-KDRKVRRKEPKSQDIYLRLLVKLYRFLARRTNSTFNQVVLKRLFMSRTNRP  59

Query  270  PLSLSRLISFT--PGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGE  443
            PLSLSR+I     PG+E+K AV+VGTITDDVR  +VP LKVCALR T  AR+RI KAGG+
Sbjct  60   PLSLSRMIQKMKLPGRENKTAVVVGTITDDVRVLDVPKLKVCALRVTSRARSRILKAGGK  119

Query  444  CLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
             LTFDQLAL +P G+ TVLL GP+  RE  +HFG APG PHSHTKPYVR+
Sbjct  120  ILTFDQLALESPKGRGTVLLSGPRKGREVYRHFGKAPGTPHSHTKPYVRS  169



>ref|XP_011163555.1| PREDICTED: LOW QUALITY PROTEIN: 60S ribosomal protein L18 [Solenopsis 
invicta]
Length=247

 Score =   229 bits (585),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 107/170 (63%), Positives = 140/170 (82%), Gaps = 3/170 (2%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MGID+      ++ +RT PKS DVYL+LLVKLYRFL RRT SKFN +ILKRLFMS+ ++P
Sbjct  60   MGIDIN-HKHDRKVRRTEPKSQDVYLRLLVKLYRFLARRTNSKFNKIILKRLFMSRIHRP  118

Query  270  PLSLSRLISFT--PGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGE  443
            P+S++R++ F   PG+E+ +AV+VG++TDD R +++P L VCALR T+ ARARI KAGGE
Sbjct  119  PISVARIVRFMKKPGRENCVAVIVGSVTDDARIFQIPKLTVCALRVTEKARARILKAGGE  178

Query  444  CLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
             +TFDQLALRAP G+ T+L++G +N+RE+VKHFG APGVPHSHTKPYVR+
Sbjct  179  IITFDQLALRAPTGKKTILMQGRRNARESVKHFGLAPGVPHSHTKPYVRS  228



>ref|XP_005336693.1| PREDICTED: 60S ribosomal protein L18 [Ictidomys tridecemlineatus]
Length=188

 Score =   228 bits (580),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 112/170 (66%), Positives = 133/170 (78%), Gaps = 3/170 (2%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MG+D++   K ++ +R  PKS D+YL+LLVKLYRFL RRT S FN V+LKRLFMS+TN+P
Sbjct  1    MGVDIRHN-KDRKVRRKEPKSQDIYLRLLVKLYRFLARRTNSTFNQVVLKRLFMSRTNRP  59

Query  270  PLSLSRLISFT--PGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGE  443
            PLSLSR+I     PG+E+K AV+VGTITDDVR  EVP LKVCALR T  AR RI KAGG+
Sbjct  60   PLSLSRMIRKMKLPGRENKTAVVVGTITDDVRVQEVPKLKVCALRVTSRARTRILKAGGK  119

Query  444  CLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
             LTFDQLAL +P G+ TVLL GP+  RE  +HFG APG PHSHTKPYVR+
Sbjct  120  ILTFDQLALDSPKGRGTVLLSGPRKGREVYRHFGKAPGTPHSHTKPYVRS  169



>ref|XP_004061142.1| PREDICTED: 60S ribosomal protein L18 [Gorilla gorilla gorilla]
Length=188

 Score =   228 bits (580),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 111/170 (65%), Positives = 134/170 (79%), Gaps = 3/170 (2%)
 Frame = +3

Query  90   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKP  269
            MG+D++   K ++ +R  PKS D+YL+LLVKLYRFL RRT S FN V+LKRLFMS+TN+P
Sbjct  1    MGVDIRHN-KDRKVRRKEPKSQDIYLRLLVKLYRFLARRTNSTFNQVVLKRLFMSRTNRP  59

Query  270  PLSLSRLISFT--PGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGE  443
            PLSLSR+I     PG+E+K AV+VGTITDDVR  EVP LKVCALR T  AR+RI +AGG+
Sbjct  60   PLSLSRMIRKMKLPGRENKTAVVVGTITDDVRVQEVPKLKVCALRVTSRARSRILRAGGK  119

Query  444  CLTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
             LTFDQLAL +P G+ TVLL GP+  RE  +HFG APG PHSHTKPYVR+
Sbjct  120  ILTFDQLALDSPKGRGTVLLSGPRKGREVYRHFGKAPGTPHSHTKPYVRS  169



>gb|EFZ15690.1| hypothetical protein SINV_04174 [Solenopsis invicta]
Length=187

 Score =   227 bits (579),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 106/169 (63%), Positives = 139/169 (82%), Gaps = 3/169 (2%)
 Frame = +3

Query  93   GIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSKTNKPP  272
            GID+      ++ +RT PKS DVYL+LLVKLYRFL RRT SKFN +ILKRLFMS+ ++PP
Sbjct  1    GIDINHK-HDRKVRRTEPKSQDVYLRLLVKLYRFLARRTNSKFNKIILKRLFMSRIHRPP  59

Query  273  LSLSRLISFT--PGKEDKIAVLVGTITDDVRAYEVPALKVCALRFTKTARARIEKAGGEC  446
            +S++R++ F   PG+E+ +AV+VG++TDD R +++P L VCALR T+ ARARI KAGGE 
Sbjct  60   ISVARIVRFMKKPGRENCVAVIVGSVTDDARIFQIPKLTVCALRVTEKARARILKAGGEI  119

Query  447  LTFDQLALRAPLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHTKPYVRA  593
            +TFDQLALRAP G+ T+L++G +N+RE+VKHFG APGVPHSHTKPYVR+
Sbjct  120  ITFDQLALRAPTGKKTILMQGRRNARESVKHFGLAPGVPHSHTKPYVRS  168



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 764930893160