BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001N15

Length=545
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

dbj|BAI47574.1|  zeta-carotene desaturase                               198   1e-56   Ipomoea sp. Kenyan
ref|XP_010323855.1|  PREDICTED: zeta-carotene desaturase, chlorop...    178   1e-49   
gb|AIX87520.1|  zeta-carotene desaturase                                179   2e-49   Lycium ruthenicum
ref|XP_006347795.1|  PREDICTED: zeta-carotene desaturase, chlorop...    179   2e-49   
gb|AGO05927.1|  plastid zeta-carotene desaturase                        179   2e-49   Solanum lycopersicum
ref|NP_001234383.1|  zeta-carotene desaturase, chloroplastic/chro...    179   3e-49   
gb|ABD67160.1|  zeta-carotene desaturase                                179   3e-49   Solanum lycopersicum
gb|ABR57231.1|  zeta-carotene desaturase                                178   3e-49   Solanum lycopersicum
ref|XP_009792956.1|  PREDICTED: zeta-carotene desaturase, chlorop...    177   6e-49   Nicotiana sylvestris
gb|AEG73891.1|  zeta-carotene desaturase                                177   6e-49   Nicotiana tabacum [American tobacco]
gb|AHA58685.1|  zeta-carotene desaturase                                177   6e-49   Nicotiana tabacum [American tobacco]
ref|XP_009588416.1|  PREDICTED: zeta-carotene desaturase, chlorop...    177   7e-49   Nicotiana tomentosiformis
sp|Q9SMJ3.1|ZDS_CAPAN  RecName: Full=Zeta-carotene desaturase, ch...    176   3e-48   Capsicum annuum
prf||2121278A  zeta carotene desaturase                                 176   3e-48
gb|AIX87496.1|  zeta-carotene desaturase                                175   4e-48   Lycium barbarum [Duke of Argyll's teatree]
gb|AHA36972.1|  zeta-carotene desaturase                                171   2e-46   Helianthus annuus
emb|CAD55814.2|  putative zeta-carotene desaturase                      171   2e-46   Helianthus annuus
gb|AAT76050.1|  zeta-carotene desaturase                                164   3e-46   Citrus clementina [clementine]
gb|AGN03856.1|  zeta-carotene desaturase                                170   3e-46   Scutellaria baicalensis [Baikal skullcap]
sp|Q9FV46.1|ZDS_TARER  RecName: Full=Zeta-carotene desaturase, ch...    169   6e-46   Tagetes erecta [big marigold]
emb|CAD27442.1|  putative zeta-carotene desaturase                      169   8e-46   Helianthus annuus
gb|KEH43038.1|  zeta-carotene desaturase                                166   2e-45   Medicago truncatula
emb|CDP08546.1|  unnamed protein product                                167   3e-45   Coffea canephora [robusta coffee]
ref|XP_004495784.1|  PREDICTED: zeta-carotene desaturase, chlorop...    167   4e-45   Cicer arietinum [garbanzo]
emb|CBI34203.3|  unnamed protein product                                167   4e-45   Vitis vinifera
gb|ABB52070.1|  putative zeta carotene desaturase                       166   6e-45   Daucus carota subsp. sativus
emb|CAN65781.1|  hypothetical protein VITISV_010561                     166   6e-45   Vitis vinifera
dbj|BAE79555.1|  zeta-carotene desaturase                               166   6e-45   Chrysanthemum x morifolium [florist's chrysanthemum]
gb|KEH43037.1|  zeta-carotene desaturase                                166   7e-45   Medicago truncatula
ref|XP_002277348.2|  PREDICTED: zeta-carotene desaturase, chlorop...    166   7e-45   Vitis vinifera
ref|XP_003591015.1|  Zeta-carotene desaturase                           166   8e-45   
gb|AES61266.2|  zeta-carotene desaturase                                166   8e-45   Medicago truncatula
ref|XP_010025059.1|  PREDICTED: zeta-carotene desaturase, chlorop...    166   8e-45   Eucalyptus grandis [rose gum]
ref|XP_010041364.1|  PREDICTED: zeta-carotene desaturase, chlorop...    166   1e-44   Eucalyptus grandis [rose gum]
gb|AFP28797.1|  zeta-carotene desaturase 1                              166   1e-44   Vitis vinifera
ref|NP_001275793.1|  ZDS                                                166   1e-44   Citrus sinensis [apfelsine]
dbj|BAA88843.1|  zeta-Carotene Desaturase                               166   1e-44   Gentiana lutea
gb|KHG06842.1|  Zeta-carotene desaturase, chloroplastic/chromopla...    165   2e-44   Gossypium arboreum [tree cotton]
ref|XP_002319628.1|  hypothetical protein POPTR_0013s03470g             165   2e-44   
gb|KJB82544.1|  hypothetical protein B456_013G201600                    164   3e-44   Gossypium raimondii
gb|AAK51557.1|AF372617_1  zeta-carotene desaturase precursor            164   3e-44   Citrus x paradisi [grapefruit]
ref|XP_007030628.1|  Zeta-carotene desaturase                           165   3e-44   
dbj|BAB68552.1|  zeta-carotene desaturase                               164   3e-44   Citrus unshiu [satsuma mandarin]
gb|ABC33728.1|  zeta-carotene desaturase                                164   3e-44   Citrus unshiu [satsuma mandarin]
gb|AFK39985.1|  unknown                                                 164   4e-44   Medicago truncatula
ref|XP_007144812.1|  hypothetical protein PHAVU_007G186000g             164   4e-44   Phaseolus vulgaris [French bean]
gb|ACE79169.1|  zeta carotene desaturase                                164   5e-44   Citrus maxima [buntan]
gb|ACR61394.1|  zeta-carotene desaturase protein                        164   6e-44   Fragaria x ananassa
gb|AFH53817.1|  zeta-carotene desaturase                                164   6e-44   Narcissus tazetta subsp. chinensis
dbj|BAJ96277.1|  predicted protein                                      163   7e-44   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ACB87206.1|  zeta-carotene desaturase                                164   7e-44   Narcissus tazetta subsp. chinensis
gb|AEW70738.1|  zeta-carotene desaturase                                164   7e-44   Ficus carica
ref|XP_008218201.1|  PREDICTED: zeta-carotene desaturase, chlorop...    163   7e-44   Prunus mume [ume]
sp|O49901.1|ZDS_NARPS  RecName: Full=Zeta-carotene desaturase, ch...    163   7e-44   Narcissus pseudonarcissus
gb|KDP23635.1|  hypothetical protein JCGZ_23468                         163   9e-44   Jatropha curcas
gb|ACO40527.1|  zeta-carotene desaturase                                163   1e-43   Carica papaya [mamon]
ref|XP_003557406.1|  PREDICTED: zeta-carotene desaturase, chlorop...    162   1e-43   Brachypodium distachyon [annual false brome]
ref|XP_006382767.1|  hypothetical protein POPTR_0005s05230g             162   2e-43   Populus trichocarpa [western balsam poplar]
ref|XP_011032463.1|  PREDICTED: zeta-carotene desaturase, chlorop...    162   2e-43   Populus euphratica
gb|ACI04664.1|  zeta-carotene desaturase                                162   2e-43   Triticum aestivum [Canadian hard winter wheat]
ref|XP_002512239.1|  Zeta-carotene desaturase, chloroplast precur...    165   2e-43   
gb|KJB45011.1|  hypothetical protein B456_007G284900                    160   2e-43   Gossypium raimondii
ref|XP_010256022.1|  PREDICTED: zeta-carotene desaturase, chlorop...    162   2e-43   Nelumbo nucifera [Indian lotus]
gb|AFH53814.1|  zeta-carotene desaturase                                162   2e-43   Narcissus tazetta subsp. chinensis
gb|ACT87979.1|  zeta carotene desaturase                                162   2e-43   Jatropha curcas
ref|XP_010090263.1|  Zeta-carotene desaturase                           162   2e-43   Morus notabilis
ref|XP_010256023.1|  PREDICTED: zeta-carotene desaturase, chlorop...    162   2e-43   Nelumbo nucifera [Indian lotus]
gb|KJB45012.1|  hypothetical protein B456_007G284900                    160   3e-43   Gossypium raimondii
gb|AEI26314.1|  zeta-carotene desaturase                                162   3e-43   Triticum aestivum [Canadian hard winter wheat]
ref|XP_011091935.1|  PREDICTED: zeta-carotene desaturase, chlorop...    162   3e-43   Sesamum indicum [beniseed]
gb|KJB45013.1|  hypothetical protein B456_007G284900                    160   3e-43   Gossypium raimondii
ref|XP_008813000.1|  PREDICTED: zeta-carotene desaturase, chlorop...    161   4e-43   Phoenix dactylifera
gb|AFH53813.1|  zeta-carotene desaturase                                161   4e-43   Narcissus tazetta subsp. chinensis
ref|XP_004955783.1|  PREDICTED: zeta-carotene desaturase, chlorop...    161   4e-43   Setaria italica
gb|ABX45112.1|  zeta-carotene desaturase                                161   4e-43   Narcissus tazetta subsp. chinensis
gb|AJB84621.1|  zeta-carotene desaturase                                161   5e-43   Camellia sinensis [black tea]
ref|NP_001059145.1|  Os07g0204900                                       160   8e-43   
dbj|BAC79799.1|  putative zeta-carotene desaturase precursor            160   8e-43   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007204989.1|  hypothetical protein PRUPE_ppa003478mg             160   1e-42   Prunus persica
gb|KJB45010.1|  hypothetical protein B456_007G284900                    160   1e-42   Gossypium raimondii
gb|KHG15309.1|  Zeta-carotene desaturase, chloroplastic/chromopla...    160   1e-42   Gossypium arboreum [tree cotton]
gb|KHN16183.1|  Zeta-carotene desaturase, chloroplastic/chromopla...    160   1e-42   Glycine soja [wild soybean]
ref|XP_003536112.1|  PREDICTED: zeta-carotene desaturase, chlorop...    160   1e-42   Glycine max [soybeans]
gb|ABG72806.2|  zeta-carotene desaturase protein                        160   1e-42   Carica papaya [mamon]
gb|ABB52083.1|  zeta carotene desaturase                                160   2e-42   Daucus carota subsp. sativus
ref|XP_011078737.1|  PREDICTED: zeta-carotene desaturase, chlorop...    160   2e-42   Sesamum indicum [beniseed]
ref|XP_003556484.1|  PREDICTED: zeta-carotene desaturase, chlorop...    159   2e-42   Glycine max [soybeans]
ref|XP_004142522.1|  PREDICTED: zeta-carotene desaturase, chlorop...    159   2e-42   Cucumis sativus [cucumbers]
ref|XP_008462722.1|  PREDICTED: zeta-carotene desaturase, chlorop...    159   2e-42   
ref|XP_004155720.1|  PREDICTED: LOW QUALITY PROTEIN: zeta-caroten...    160   2e-42   
ref|XP_010934915.1|  PREDICTED: zeta-carotene desaturase, chlorop...    159   2e-42   Elaeis guineensis
tpg|DAA59952.1|  TPA: zeta-carotene desaturase, /chromoplastic Pr...    159   3e-42   
ref|XP_004302025.1|  PREDICTED: zeta-carotene desaturase, chlorop...    159   4e-42   Fragaria vesca subsp. vesca
ref|XP_010550937.1|  PREDICTED: zeta-carotene desaturase, chlorop...    158   4e-42   Tarenaya hassleriana [spider flower]
emb|CDY41905.1|  BnaC05g46990D                                          158   5e-42   Brassica napus [oilseed rape]
gb|AEK86566.1|  chloroplast zeta-carotene desaturase                    158   6e-42   Cucurbita moschata [ayote]
ref|XP_011005691.1|  PREDICTED: zeta-carotene desaturase, chlorop...    158   6e-42   Populus euphratica
gb|AAX56323.1|  zeta-carotene desaturase                                157   9e-42   Sorghum bicolor [broomcorn]
ref|XP_002459524.1|  hypothetical protein SORBIDRAFT_02g006100          157   9e-42   Sorghum bicolor [broomcorn]
gb|ACM68701.1|  zeta-carotene desaturase                                157   1e-41   Brassica rapa subsp. pekinensis [bai cai]
ref|XP_009124205.1|  PREDICTED: zeta-carotene desaturase, chlorop...    157   1e-41   Brassica rapa
ref|XP_002882378.1|  zeta-carotene desaturase precursor                 157   2e-41   
gb|AAF85796.1|AF121947_1  zeta-carotene desaturase precursor            157   2e-41   Arabidopsis thaliana [mouse-ear cress]
gb|AEN94305.1|  zeta-carotene desaturase                                157   2e-41   Brassica napus [oilseed rape]
ref|NP_187138.1|  zeta-carotene desaturase                              157   2e-41   Arabidopsis thaliana [mouse-ear cress]
gb|AAM63349.1|  putative zeta-carotene desaturase precursor             157   2e-41   Arabidopsis thaliana [mouse-ear cress]
gb|EYU22642.1|  hypothetical protein MIMGU_mgv1a003845mg                157   2e-41   Erythranthe guttata [common monkey flower]
ref|XP_008388655.1|  PREDICTED: zeta-carotene desaturase, chlorop...    157   2e-41   Malus domestica [apple tree]
ref|NP_001280951.1|  zeta-carotene desaturase, chloroplastic/chro...    157   2e-41   Malus domestica [apple tree]
ref|XP_010463975.1|  PREDICTED: zeta-carotene desaturase, chlorop...    156   2e-41   Camelina sativa [gold-of-pleasure]
ref|XP_010419722.1|  PREDICTED: zeta-carotene desaturase, chlorop...    156   2e-41   
ref|XP_009364531.1|  PREDICTED: zeta-carotene desaturase, chlorop...    156   2e-41   Pyrus x bretschneideri [bai li]
ref|XP_010485876.1|  PREDICTED: zeta-carotene desaturase, chlorop...    156   2e-41   
ref|XP_010934924.1|  PREDICTED: zeta-carotene desaturase, chlorop...    157   2e-41   Elaeis guineensis
gb|ACG46735.1|  zeta-carotene desaturase                                156   3e-41   Zea mays [maize]
ref|XP_009396830.1|  PREDICTED: zeta-carotene desaturase, chlorop...    156   3e-41   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010674842.1|  PREDICTED: zeta-carotene desaturase, chlorop...    155   4e-41   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006858905.1|  hypothetical protein AMTR_s00068p00029180          155   6e-41   Amborella trichopoda
ref|XP_006297343.1|  hypothetical protein CARUB_v10013363mg             155   6e-41   Capsella rubella
gb|AAA91161.1|  zeta-carotene desaturase precursor                      155   9e-41   Arabidopsis thaliana [mouse-ear cress]
gb|ABR18432.1|  unknown                                                 150   6e-39   Picea sitchensis
gb|EYU22998.1|  hypothetical protein MIMGU_mgv1a003605mg                147   4e-38   Erythranthe guttata [common monkey flower]
ref|XP_001776850.1|  predicted protein                                  145   2e-37   
ref|XP_008370678.1|  PREDICTED: zeta-carotene desaturase, chlorop...    145   3e-37   
gb|AAQ04224.1|  zeta-carotene desaturase ZDS1                           145   3e-37   Malus domestica [apple tree]
ref|XP_002978356.1|  hypothetical protein SELMODRAFT_108745             145   3e-37   
gb|EMT13673.1|  Zeta-carotene desaturase, chloroplastic/chromopla...    145   3e-37   
ref|XP_009364533.1|  PREDICTED: zeta-carotene desaturase, chlorop...    145   3e-37   Pyrus x bretschneideri [bai li]
ref|XP_002970191.1|  hypothetical protein SELMODRAFT_146971             145   3e-37   Selaginella moellendorffii
gb|KDO38850.1|  hypothetical protein CISIN_1g0233862mg                  135   5e-37   Citrus sinensis [apfelsine]
ref|XP_006658387.1|  PREDICTED: zeta-carotene desaturase, chlorop...    142   3e-36   
sp|C3VEQ0.1|ZDS_ONCHC  RecName: Full=Zeta-carotene desaturase, ch...    142   3e-36   Oncidium hybrid cultivar
ref|XP_001780369.1|  predicted protein                                  141   4e-36   
ref|XP_001772345.1|  predicted protein                                  141   7e-36   
ref|XP_006408139.1|  hypothetical protein EUTSA_v10020402mg             140   1e-35   Eutrema salsugineum [saltwater cress]
gb|EMS67399.1|  Zeta-carotene desaturase, chloroplastic/chromopla...    139   4e-35   Triticum urartu
ref|XP_006471842.1|  PREDICTED: zeta-carotene desaturase, chlorop...    132   1e-34   
gb|EPS57847.1|  hypothetical protein M569_16970                         136   2e-34   Genlisea aurea
ref|NP_001105609.1|  zeta-carotene desaturase, chloroplastic/chro...    134   3e-33   
gb|ADN65328.1|  zeta-carotene desaturase                                128   1e-32   Manihot esculenta [manioc]
gb|KDO37078.1|  hypothetical protein CISIN_1g046976mg                   105   1e-25   Citrus sinensis [apfelsine]
ref|XP_011005715.1|  PREDICTED: zeta-carotene desaturase, chlorop...    107   7e-25   Populus euphratica
ref|XP_006432993.1|  hypothetical protein CICLE_v10002974mg             103   7e-25   
ref|XP_006432999.1|  hypothetical protein CICLE_v10003502mg             103   8e-25   
ref|XP_006433004.1|  hypothetical protein CICLE_v10002967mg             102   1e-24   
ref|XP_006471711.1|  PREDICTED: zeta-carotene desaturase, chlorop...    103   1e-24   Citrus sinensis [apfelsine]
ref|XP_008230988.1|  PREDICTED: zeta-carotene desaturase, chlorop...    103   3e-24   Prunus mume [ume]
ref|XP_006471924.1|  PREDICTED: protein tesmin/TSO1-like CXC 2-like     101   6e-23   
ref|XP_005843062.1|  hypothetical protein CHLNCDRAFT_141585           96.7    4e-20   Chlorella variabilis
ref|XP_011396566.1|  Zeta-carotene desaturase, chloroplastic/chro...  97.4    4e-20   Auxenochlorella protothecoides
gb|ADR82201.1|  zeta-carotene desaturase                              93.6    9e-19   Auxenochlorella protothecoides
ref|XP_005650492.1|  zeta-carotene desaturase                         90.9    8e-18   Coccomyxa subellipsoidea C-169
gb|KIY97244.1|  zeta-carotene desaturase                              88.2    1e-17   Monoraphidium neglectum
ref|XP_002954228.1|  hypothetical protein VOLCADRAFT_95071            90.1    1e-17   Volvox carteri f. nagariensis
ref|XP_001700786.1|  zeta-carotene desaturase                         90.1    2e-17   Chlamydomonas reinhardtii
ref|WP_010873021.1|  zeta-carotene desaturase                         88.2    5e-17   Synechocystis
ref|WP_028947937.1|  zeta-carotene desaturase                         87.8    6e-17   Synechocystis sp. PCC 6714
ref|WP_006101879.1|  zeta-carotene desaturase                         87.0    1e-16   Coleofasciculus chthonoplastes
ref|WP_012306160.1|  zeta-carotene desaturase                         85.9    3e-16   Synechococcus
ref|WP_015170063.1|  carotene 7,8-desaturase                          85.9    3e-16   Synechococcus sp. PCC 7502
ref|WP_008181727.1|  zeta-carotene desaturase                         85.5    3e-16   Moorea producens
ref|WP_039727183.1|  MULTISPECIES: zeta-carotene desaturase           85.5    4e-16   Lyngbya confervoides
ref|WP_030005806.1|  zeta-carotene desaturase                         85.5    4e-16   Synechococcus sp. NKBG042902
ref|WP_015132414.1|  zeta-carotene desaturase                         85.5    5e-16   Leptolyngbya sp. PCC 7376
ref|WP_029959080.1|  zeta-carotene desaturase                         81.3    6e-16   
ref|WP_015158175.1|  carotene 7,8-desaturase                          85.1    6e-16   Chamaesiphon minutus
ref|WP_029983587.1|  zeta-carotene desaturase                         80.5    6e-16   
ref|WP_015146661.1|  zeta-carotene desaturase                         84.7    8e-16   Oscillatoria acuminata
ref|WP_006509674.1|  carotene 7,8-desaturase                          84.7    8e-16   Xenococcus sp. PCC 7305
ref|WP_008312128.1|  carotene 7,8-desaturase                          84.7    9e-16   Leptolyngbya sp. PCC 6406
ref|WP_015181504.1|  carotene 7,8-desaturase                          84.7    9e-16   Microcoleus sp. PCC 7113
ref|WP_036916414.1|  MULTISPECIES: zeta-carotene desaturase           84.3    9e-16   Prochlorococcus
ref|WP_032523894.1|  zeta-carotene desaturase                         84.3    1e-15   Prochlorococcus marinus
ref|WP_025905874.1|  zeta-carotene desaturase                         84.3    1e-15   
ref|WP_025979527.1|  zeta-carotene desaturase                         84.0    1e-15   
ref|WP_025945602.1|  zeta-carotene desaturase                         84.0    1e-15   
ref|WP_032514724.1|  zeta-carotene desaturase                         84.0    1e-15   Prochlorococcus marinus
gb|EYU45246.1|  hypothetical protein MIMGU_mgv1a005547mg              84.0    1e-15   Erythranthe guttata [common monkey flower]
ref|WP_025936184.1|  zeta-carotene desaturase                         84.0    1e-15   
ref|XP_008813001.1|  PREDICTED: zeta-carotene desaturase, chlorop...  84.0    1e-15   Phoenix dactylifera
gb|ABB49180.1|  zeta-carotene desaturase                              84.0    1e-15   Prochlorococcus marinus str. MIT 9312
ref|WP_015172316.1|  zeta-carotene desaturase                         84.0    1e-15   Geitlerinema sp. PCC 7407
ref|WP_011613311.1|  zeta-carotene desaturase                         83.6    2e-15   Trichodesmium erythraeum
ref|WP_019475733.1|  zeta-carotene desaturase                         83.6    2e-15   
ref|WP_036922357.1|  zeta-carotene desaturase                         83.6    2e-15   
ref|WP_019503087.1|  zeta-carotene desaturase                         83.6    2e-15   Pseudanabaena sp. PCC 6802
gb|ACI14289.1|  zeta-carotene desaturase                              83.6    2e-15   Linum usitatissimum
ref|WP_036901689.1|  zeta-carotene desaturase                         83.6    2e-15   Prochlorococcus sp. MIT 0601
ref|WP_021829644.1|  Pro-zeta-carotene desaturase, prolycopene pr...  80.9    2e-15   
ref|XP_005836476.1|  hypothetical protein GUITHDRAFT_93434            83.6    2e-15   Guillardia theta CCMP2712
ref|WP_012628567.1|  zeta-carotene desaturase                         83.2    2e-15   Cyanothece sp. PCC 7425
ref|WP_019478374.1|  zeta-carotene desaturase                         83.2    3e-15   
ref|WP_019476153.1|  zeta-carotene desaturase                         82.8    3e-15   
ref|WP_019505779.1|  zeta-carotene desaturase                         82.8    4e-15   Pleurocapsa sp. PCC 7319
ref|WP_036924468.1|  zeta-carotene desaturase                         82.8    4e-15   Prochlorococcus marinus
ref|WP_011131754.1|  zeta-carotene desaturase                         82.4    4e-15   Prochlorococcus marinus
ref|WP_032516794.1|  zeta-carotene desaturase                         82.4    4e-15   Prochlorococcus marinus
ref|WP_032522962.1|  zeta-carotene desaturase                         82.4    4e-15   Prochlorococcus marinus
ref|WP_025937920.1|  zeta-carotene desaturase                         82.4    4e-15   
ref|WP_025971586.1|  zeta-carotene desaturase                         82.4    4e-15   
ref|WP_025953053.1|  zeta-carotene desaturase                         82.4    4e-15   
ref|WP_025939866.1|  zeta-carotene desaturase                         82.4    5e-15   
ref|WP_025924976.1|  zeta-carotene desaturase                         82.4    5e-15   
ref|WP_025962778.1|  MULTISPECIES: zeta-carotene desaturase           82.4    5e-15   
ref|WP_025932943.1|  zeta-carotene desaturase                         82.4    5e-15   
ref|WP_025890273.1|  MULTISPECIES: zeta-carotene desaturase           82.4    5e-15   
ref|WP_025880230.1|  MULTISPECIES: zeta-carotene desaturase           82.4    5e-15   Prochlorococcus
ref|WP_032519772.1|  zeta-carotene desaturase                         82.4    5e-15   Prochlorococcus marinus
ref|WP_025952229.1|  zeta-carotene desaturase                         82.4    5e-15   
ref|WP_002805954.1|  zeta-carotene desaturase                         82.4    5e-15   Prochlorococcus marinus
ref|WP_025955073.1|  MULTISPECIES: zeta-carotene desaturase           82.4    5e-15   
ref|WP_025921324.1|  zeta-carotene desaturase                         82.4    5e-15   
ref|WP_011862158.1|  zeta-carotene desaturase                         82.4    5e-15   Prochlorococcus marinus
ref|WP_025973661.1|  zeta-carotene desaturase                         82.4    5e-15   
ref|WP_025963149.1|  zeta-carotene desaturase                         82.4    5e-15   
ref|WP_025956429.1|  MULTISPECIES: zeta-carotene desaturase           82.4    5e-15   
ref|WP_025893773.1|  zeta-carotene desaturase                         82.4    5e-15   
ref|WP_042849604.1|  zeta-carotene desaturase                         82.4    5e-15   Prochlorococcus sp. MIT 0604
ref|WP_025941175.1|  zeta-carotene desaturase                         82.4    5e-15   
ref|WP_012006931.1|  zeta-carotene desaturase                         82.4    5e-15   Prochlorococcus marinus
ref|WP_011822978.1|  zeta-carotene desaturase                         82.4    5e-15   Prochlorococcus marinus
ref|WP_025954278.1|  zeta-carotene desaturase                         82.4    5e-15   
ref|WP_025932286.1|  MULTISPECIES: zeta-carotene desaturase           82.4    5e-15   
ref|WP_025931278.1|  zeta-carotene desaturase                         82.4    5e-15   
ref|WP_036899170.1|  zeta-carotene desaturase                         82.4    5e-15   
ref|WP_019474796.1|  zeta-carotene desaturase                         82.4    5e-15   
ref|WP_008276389.1|  zeta-carotene desaturase                         82.0    6e-15   Cyanothece sp. CCY0110
ref|WP_011819453.1|  zeta-carotene desaturase                         81.6    8e-15   Prochlorococcus marinus
ref|WP_006624376.1|  MULTISPECIES: zeta-carotene desaturase           81.6    8e-15   Arthrospira
ref|WP_006616919.1|  zeta-carotene desaturase                         81.6    9e-15   Arthrospira platensis
ref|WP_014274504.1|  zeta-carotene desaturase                         81.6    9e-15   Arthrospira platensis
ref|WP_009544536.1|  MULTISPECIES: zeta-carotene desaturase           81.6    9e-15   Cyanothece
ref|WP_015228996.1|  carotene 7,8-desaturase                          81.6    1e-14   Dactylococcopsis salina
ref|WP_010469723.1|  zeta-carotene desaturase                         81.3    1e-14   Acaryochloris sp. CCMEE 5410
ref|WP_012164067.1|  zeta-carotene desaturase                         81.3    1e-14   Acaryochloris marina
ref|WP_038650792.1|  zeta-carotene desaturase                         81.3    1e-14   Prochlorococcus sp. MIT 0801
ref|WP_036479960.1|  zeta-carotene desaturase                         81.3    1e-14   Myxosarcina sp. GI1
ref|WP_011294117.1|  zeta-carotene desaturase                         81.3    1e-14   Prochlorococcus marinus
ref|WP_036904745.1|  zeta-carotene desaturase                         81.3    1e-14   Prochlorococcus marinus
ref|WP_025923867.1|  zeta-carotene desaturase                         81.3    1e-14   
ref|WP_015220074.1|  zeta-carotene desaturase                         80.9    1e-14   Cyanobacterium aponinum
ref|WP_032515874.1|  zeta-carotene desaturase                         80.9    2e-14   Prochlorococcus marinus
ref|WP_025957514.1|  zeta-carotene desaturase                         80.9    2e-14   
ref|WP_025924062.1|  MULTISPECIES: zeta-carotene desaturase           80.9    2e-14   
ref|WP_011817608.1|  zeta-carotene desaturase                         80.9    2e-14   Prochlorococcus marinus
ref|WP_025922039.1|  MULTISPECIES: zeta-carotene desaturase           80.9    2e-14   
ref|WP_012598084.1|  zeta-carotene desaturase                         80.9    2e-14   Cyanothece sp. PCC 7424
ref|WP_017717674.1|  zeta-carotene desaturase                         80.9    2e-14   Oscillatoria sp. PCC 10802
ref|WP_019477173.1|  zeta-carotene desaturase                         80.9    2e-14   
ref|WP_009626851.1|  zeta-carotene desaturase                         80.9    2e-14   Pseudanabaena biceps
ref|WP_015166147.1|  zeta-carotene desaturase                         80.9    2e-14   Pseudanabaena sp. PCC 7367
gb|KGG16821.1|  Pro-zeta-carotene desaturase                          80.9    2e-14   Prochlorococcus sp. MIT 0602
ref|WP_015144007.1|  carotene 7,8-desaturase                          80.5    2e-14   Pleurocapsa minor
ref|WP_012194687.1|  zeta-carotene desaturase                         80.5    2e-14   Prochlorococcus marinus
ref|WP_015226977.1|  zeta-carotene desaturase                         80.5    2e-14   Halothece sp. PCC 7418
ref|WP_032525823.1|  zeta-carotene desaturase                         80.5    3e-14   Prochlorococcus marinus
ref|WP_011934112.1|  zeta-carotene desaturase                         80.5    3e-14   Synechococcus sp. WH 7803
ref|WP_011124291.1|  MULTISPECIES: zeta-carotene desaturase           80.1    3e-14   Prochlorococcus
ref|WP_015192125.1|  zeta-carotene desaturase                         80.1    3e-14   Stanieria cyanosphaera
ref|WP_015175312.1|  carotene 7,8-desaturase                          80.1    3e-14   Oscillatoria nigro-viridis
ref|WP_012596658.1|  MULTISPECIES: zeta-carotene desaturase           80.1    3e-14   Cyanothece
ref|WP_011365287.1|  zeta-carotene desaturase                         80.1    3e-14   Synechococcus sp. CC9605
ref|WP_015222888.1|  zeta-carotene desaturase                         80.1    3e-14   
gb|AHF64768.1|  Carotene 7,8-desaturase                               80.1    3e-14   Synechococcus sp. WH 8109
ref|WP_026796095.1|  MULTISPECIES: zeta-carotene desaturase           80.1    3e-14   Planktothrix
ref|WP_007303963.1|  zeta-carotene desaturase                         80.1    3e-14   Crocosphaera watsonii
ref|WP_026796254.1|  zeta-carotene desaturase                         80.1    3e-14   Planktothrix
ref|WP_025934707.1|  zeta-carotene desaturase                         80.1    3e-14   
ref|WP_042153636.1|  zeta-carotene desaturase                         80.1    3e-14   Planktothrix agardhii
ref|WP_026785642.1|  MULTISPECIES: zeta-carotene desaturase           80.1    3e-14   Planktothrix
ref|WP_038552845.1|  zeta-carotene desaturase                         80.1    4e-14   Synechococcus sp. KORDI-52
ref|WP_039715937.1|  zeta-carotene desaturase                         79.7    4e-14   
ref|WP_028083991.1|  zeta-carotene desaturase                         79.7    4e-14   Dolichospermum circinale
ref|WP_035372164.1|  zeta-carotene desaturase                         79.7    4e-14   Dolichospermum circinale
ref|WP_028952928.1|  zeta-carotene desaturase                         79.7    5e-14   Synechococcus sp. CC9616
ref|WP_017322437.1|  zeta-carotene desaturase                         79.3    5e-14   cyanobacterium PCC 7702
ref|WP_007352889.1|  MULTISPECIES: zeta-carotene desaturase           79.3    5e-14   Kamptonema
ref|WP_010311530.1|  zeta-carotene desaturase                         79.3    5e-14   Synechococcus sp. CB0101
ref|WP_006043052.1|  zeta-carotene desaturase                         79.3    5e-14   Synechococcus sp. WH 7805
ref|WP_017305968.1|  zeta-carotene desaturase                         79.3    6e-14   
ref|WP_011129069.1|  zeta-carotene desaturase                         79.3    6e-14   
ref|WP_006632676.1|  zeta-carotene desaturase                         79.3    6e-14   
ref|WP_023068890.1|  9,9'-di-cis-zeta-carotene desaturase             79.0    7e-14   
ref|WP_009786389.1|  zeta-carotene desaturase                         79.0    7e-14   
ref|XP_005712997.1|  zeta-carotene desaturase                         79.0    8e-14   
ref|WP_017660852.1|  zeta-carotene desaturase                         78.6    9e-14   
ref|WP_015110467.1|  carotene 7,8-desaturase                          78.6    9e-14   
ref|WP_038546976.1|  zeta-carotene desaturase                         78.6    1e-13   
ref|WP_015153689.1|  zeta-carotene desaturase                         78.6    1e-13   
ref|WP_011934693.1|  zeta-carotene desaturase                         78.6    1e-13   
ref|WP_043693134.1|  zeta-carotene desaturase                         78.6    1e-13   
ref|WP_035833559.1|  zeta-carotene desaturase                         78.2    1e-13   
ref|WP_011432691.1|  zeta-carotene desaturase                         78.2    1e-13   
ref|WP_019490788.1|  zeta-carotene desaturase                         78.2    1e-13   
ref|WP_013192972.1|  zeta-carotene desaturase                         78.2    2e-13   
ref|WP_027842846.1|  zeta-carotene desaturase                         77.8    2e-13   
ref|WP_017296227.1|  zeta-carotene desaturase                         77.8    2e-13   
ref|WP_039743588.1|  zeta-carotene desaturase                         77.8    2e-13   
ref|WP_018399171.1|  zeta-carotene desaturase                         77.8    2e-13   
ref|WP_017655161.1|  zeta-carotene desaturase                         77.4    2e-13   
ref|WP_006526943.1|  carotene 7,8-desaturase                          77.4    2e-13   
ref|YP_002048946.1|  zeta-carotene desaturase                         77.4    2e-13   
ref|WP_011620462.1|  zeta-carotene desaturase                         77.4    2e-13   
ref|WP_006854570.1|  zeta-carotene desaturase                         77.4    3e-13   
gb|KDO39191.1|  hypothetical protein CISIN_1g034688mg                 72.4    3e-13   
ref|WP_017324264.1|  hypothetical protein                             77.4    3e-13   
ref|WP_015200559.1|  zeta-carotene desaturase                         77.4    3e-13   
ref|WP_009633167.1|  carotene 7,8-desaturase                          77.4    3e-13   
ref|WP_044106302.1|  zeta-carotene desaturase                         77.0    3e-13   
ref|WP_016867700.1|  zeta-carotene desaturase                         77.0    3e-13   
ref|WP_016951556.1|  zeta-carotene desaturase                         77.0    3e-13   
ref|WP_009458269.1|  MULTISPECIES: zeta-carotene desaturase           77.0    3e-13   
ref|WP_011429564.1|  zeta-carotene desaturase                         77.0    3e-13   
ref|XP_005760283.1|  hypothetical protein EMIHUDRAFT_258445           73.9    4e-13   
ref|WP_027403635.1|  zeta-carotene desaturase                         76.6    5e-13   
ref|WP_015140745.1|  carotene 7,8-desaturase                          76.6    5e-13   
ref|WP_015115824.1|  zeta-carotene desaturase                         76.3    5e-13   
ref|WP_015211255.1|  zeta-carotene desaturase                         76.3    5e-13   
ref|WP_015079855.1|  carotene 7,8-desaturase                          76.3    6e-13   
ref|WP_012407300.1|  zeta-carotene desaturase                         76.3    6e-13   
ref|WP_011359164.1|  zeta-carotene desaturase                         76.3    6e-13   
ref|WP_037221580.1|  zeta-carotene desaturase                         76.3    7e-13   
ref|WP_011317089.1|  zeta-carotene desaturase                         76.3    7e-13   
ref|WP_009788218.1|  zeta-carotene desaturase                         76.3    7e-13   
ref|WP_015122754.1|  zeta-carotene desaturase                         75.9    8e-13   
gb|KIE07965.1|  zeta-carotene desaturase                              75.9    8e-13   
ref|WP_026135055.1|  zeta-carotene desaturase                         75.9    8e-13   
ref|WP_044452849.1|  zeta-carotene desaturase                         75.5    8e-13   
ref|WP_026732974.1|  zeta-carotene desaturase                         75.9    9e-13   
ref|WP_026722453.1|  zeta-carotene desaturase                         75.9    9e-13   
ref|WP_017311524.1|  zeta-carotene desaturase                         75.9    9e-13   
emb|CAB56041.1|  zeta-carotene desaturase                             75.5    1e-12   
ref|WP_010996538.1|  zeta-carotene desaturase                         75.5    1e-12   
ref|WP_006194399.1|  zeta-carotene desaturase                         75.5    1e-12   
ref|WP_016872384.1|  zeta-carotene desaturase                         75.5    1e-12   
ref|WP_041034621.1|  zeta-carotene desaturase                         75.1    2e-12   
emb|CBN76924.1|  zeta-carotene desaturase, chloroplast precursor      75.5    2e-12   
ref|WP_002800446.1|  zeta-carotene desaturase                         74.7    2e-12   
gb|ADK95008.1|  chloroplast zeta-carotene desaturase                  75.1    2e-12   
ref|WP_017316100.1|  zeta-carotene desaturase                         74.7    2e-12   
ref|WP_002744950.1|  carotene 7,8-desaturase                          74.7    2e-12   
dbj|GAL91277.1|  pro-zeta-carotene desaturase, prolycopene producing  74.7    2e-12   
ref|WP_024970325.1|  zeta-carotene desaturase                         74.7    2e-12   
ref|WP_002738691.1|  carotene 7,8-desaturase                          74.7    2e-12   
ref|WP_008196176.1|  zeta-carotene desaturase                         74.7    2e-12   
ref|WP_002755392.1|  zeta-carotene desaturase                         74.7    2e-12   
ref|WP_002796087.1|  zeta-carotene desaturase                         74.7    2e-12   
ref|WP_002792824.1|  zeta-carotene desaturase                         74.7    2e-12   
ref|WP_002780881.1|  Zeta-carotene desaturase                         74.7    2e-12   
ref|WP_002787023.1|  zeta-carotene desaturase                         74.7    2e-12   
ref|WP_002764632.1|  zeta-carotene desaturase                         74.7    2e-12   
ref|WP_002759655.1|  zeta-carotene desaturase                         74.7    2e-12   
ref|WP_029637206.1|  zeta-carotene desaturase [                       74.3    3e-12   
ref|XP_005767829.1|  hypothetical protein EMIHUDRAFT_421941           74.7    3e-12   
ref|WP_015130469.1|  zeta-carotene desaturase                         74.3    3e-12   
gb|ERN42097.1|  carotene 7,8-desaturase                               74.3    4e-12   
ref|XP_005705885.1|  zeta-carotene desaturase                         72.8    4e-12   
gb|EFA72095.1|  hypothetical protein CRD_02617                        70.5    4e-12   
ref|WP_040655267.1|  zeta-carotene desaturase                         73.6    5e-12   
ref|XP_005539120.1|  zeta-carotene desaturase                         73.9    5e-12   
ref|WP_002778277.1|  zeta-carotene desaturase                         73.6    5e-12   
ref|WP_035156290.1|  zeta-carotene desaturase                         73.6    5e-12   
ref|WP_006276633.1|  zeta-carotene desaturase                         73.2    6e-12   
gb|KIJ82480.1|  zeta-carotene desaturase                              72.8    9e-12   
ref|WP_008232862.1|  Pro-zeta-carotene desaturase, prolycopene pr...  72.8    9e-12   
ref|XP_009033554.1|  hypothetical protein AURANDRAFT_6909             68.9    1e-11   
ref|WP_008229377.1|  Pro-zeta-carotene desaturase, prolycopene pr...  72.8    1e-11   
gb|ABC87740.1|  zeta carotene desaturase                              69.3    1e-11   
ref|XP_002293738.1|  predicted protein                                71.6    3e-11   
dbj|BAM54881.1|  zeta-carotene desaturase                             69.3    1e-10   
gb|EJK64522.1|  hypothetical protein THAOC_14736                      68.9    3e-10   
ref|XP_002176685.1|  zeta-carotene desaturase                         68.2    4e-10   
ref|WP_017287792.1|  zeta-carotene desaturase                         65.9    2e-09   
ref|WP_009767765.1|  zeta-carotene desaturase                         65.5    3e-09   
gb|AFI09269.1|  carotene desaturase                                   62.4    4e-09   
ref|WP_035997160.1|  zeta-carotene desaturase                         64.7    5e-09   
ref|WP_006172229.1|  zeta-carotene desaturase                         63.9    8e-09   
emb|CAB65434.1|  zeta carotene desaturase                             62.8    8e-09   
ref|WP_011244807.1|  zeta-carotene desaturase                         63.5    1e-08   
ref|WP_040943538.1|  zeta-carotene desaturase                         63.5    1e-08   
ref|WP_011378061.1|  MULTISPECIES: zeta-carotene desaturase           63.5    1e-08   
ref|WP_012474382.1|  zeta-carotene desaturase                         63.2    1e-08   
ref|WP_015124123.1|  zeta-carotene desaturase                         62.8    2e-08   
gb|EDY38499.1|  carotene 7,8-desaturase                               62.8    2e-08   
ref|WP_007099059.1|  zeta-carotene desaturase                         62.8    2e-08   
ref|WP_043370035.1|  zeta-carotene desaturase                         62.4    3e-08   
ref|WP_012508488.1|  zeta-carotene desaturase                         62.0    3e-08   
ref|WP_011362607.1|  zeta-carotene desaturase                         61.6    5e-08   
ref|WP_010313236.1|  zeta-carotene desaturase                         61.2    6e-08   
ref|WP_012506077.1|  zeta-carotene desaturase                         60.8    7e-08   
ref|WP_010933081.1|  zeta-carotene desaturase                         60.8    8e-08   
ref|WP_006366988.1|  zeta-carotene desaturase                         60.8    8e-08   
ref|WP_012465874.1|  zeta-carotene desaturase                         60.8    8e-08   
ref|WP_012502001.1|  zeta-carotene desaturase                         60.8    8e-08   
ref|WP_011358146.1|  zeta-carotene desaturase                         60.5    1e-07   
ref|WP_035399863.1|  zeta-carotene desaturase                         60.5    1e-07   
ref|WP_038001819.1|  zeta-carotene desaturase                         60.5    1e-07   
gb|EAQ68236.1|  zeta-carotene desaturase                              60.1    1e-07   
ref|WP_036913831.1|  MULTISPECIES: zeta-carotene desaturase           60.1    2e-07   
ref|WP_011827195.1|  zeta-carotene desaturase                         60.1    2e-07   
ref|WP_011131333.1|  zeta-carotene desaturase                         60.1    2e-07   
ref|WP_017714696.1|  zeta-carotene desaturase                         59.7    2e-07   
ref|WP_014098773.1|  hypothetical protein                             58.9    3e-07   
gb|EWM29966.1|  zeta-carotene desaturase                              58.9    4e-07   
ref|WP_009061612.1|  phytoene synthase                                58.9    5e-07   
ref|WP_012500238.1|  zeta-carotene desaturase                         58.5    5e-07   
ref|WP_012464543.1|  phytoene synthase                                58.5    6e-07   
ref|WP_015204957.1|  zeta-carotene desaturase                         58.2    6e-07   
ref|WP_011744709.1|  zeta-carotene desaturase                         58.2    6e-07   
ref|WP_011056192.1|  zeta-carotene desaturase                         57.4    1e-06   
ref|WP_024123886.1|  carotene 7,8-desaturase CrtQ                     57.4    1e-06   
ref|XP_002291632.1|  predicted protein                                56.2    3e-06   
emb|CBN77338.1|  Phytoene desaturase, chloroplast precursor           56.2    3e-06   
gb|EJK73821.1|  hypothetical protein THAOC_04531                      55.5    6e-06   
sp|Q40406.1|CRTI_NARPS  RecName: Full=Phytoene dehydrogenase, chl...  55.1    8e-06   
ref|XP_008222708.1|  PREDICTED: phytoene dehydrogenase, chloropla...  54.7    8e-06   
ref|XP_002180171.1|  phytoene dehydrogenase                           54.7    9e-06   
gb|ACY78343.1|  phytoene desaturase                                   54.3    1e-05   
gb|AII46264.1|  zeta-carotene desaturase                              53.9    1e-05   
gb|ABX45113.1|  phytoene desaturase                                   54.3    1e-05   
ref|XP_009371104.1|  PREDICTED: phytoene dehydrogenase, chloropla...  53.9    2e-05   
ref|WP_012194715.1|  15-cis-phytoene desaturase                       53.9    2e-05   
ref|WP_036916436.1|  MULTISPECIES: phytoene desaturase                53.5    2e-05   
gb|AFH53816.1|  phytoene desaturase                                   53.5    2e-05   
dbj|BAD07272.1|  zeta-carotene desaturase                             52.0    2e-05   
gb|AFH53812.1|  phytoene desaturase                                   53.5    2e-05   
dbj|BAD07280.1|  zeta-carotene desaturase                             52.0    3e-05   
gb|AAX33347.1|  phytoene desaturase                                   53.1    3e-05   
ref|XP_007222459.1|  hypothetical protein PRUPE_ppa003457mg           53.1    3e-05   
ref|WP_025945002.1|  hypothetical protein                             51.2    3e-05   
dbj|BAE79552.1|  phytoene desaturase                                  53.1    3e-05   
ref|XP_003055146.1|  predicted protein                                53.1    3e-05   
gb|AFK76452.1|  phytoene desaturase                                   53.1    3e-05   
gb|ABV46593.1|  phytoene desaturase                                   53.1    3e-05   
ref|WP_038650865.1|  phytoene desaturase                              53.1    3e-05   
ref|XP_004296964.1|  PREDICTED: 15-cis-phytoene desaturase, chlor...  53.1    3e-05   
ref|XP_009386782.1|  PREDICTED: phytoene dehydrogenase, chloropla...  52.8    4e-05   
gb|AFH53810.1|  phytoene desaturase                                   52.8    4e-05   
gb|ACI45964.1|  putative plastid phytoene desaturase precursor        52.8    4e-05   
ref|XP_008337492.1|  PREDICTED: phytoene dehydrogenase, chloropla...  52.8    4e-05   
ref|XP_009033581.1|  hypothetical protein AURANDRAFT_70771            52.8    4e-05   
ref|WP_011827238.1|  15-cis-phytoene desaturase                       52.8    4e-05   
gb|KIY99406.1|  phytoene dehydrogenase, phytoenedesaturase            52.4    4e-05   
ref|XP_010440516.1|  PREDICTED: 15-cis-phytoene desaturase, chlor...  52.8    4e-05   
ref|XP_002988989.1|  hypothetical protein SELMODRAFT_269459           52.4    5e-05   
ref|XP_011000016.1|  PREDICTED: 15-cis-phytoene desaturase, chlor...  52.4    6e-05   
ref|XP_010551675.1|  PREDICTED: 15-cis-phytoene desaturase, chlor...  52.4    6e-05   
gb|AHA36971.1|  phytoene desaturase                                   52.4    6e-05   
ref|WP_036911507.1|  MULTISPECIES: phytoene desaturase                52.0    6e-05   
gb|KGG28551.1|  Phytoene desaturase                                   52.0    6e-05   
gb|AHA90853.1|  phytoene desaturase                                   52.0    6e-05   
gb|EYF07787.1|  phi-Carotenoid synthase                               52.0    6e-05   
ref|WP_011124322.1|  MULTISPECIES: 15-cis-phytoene desaturase         52.0    6e-05   
emb|CAK27141.1|  Phytoene dehydrogenase                               52.0    6e-05   
gb|AGN03855.1|  phytoene desaturase                                   52.0    7e-05   
ref|XP_002975100.1|  hypothetical protein SELMODRAFT_232430           52.0    7e-05   
ref|WP_026393877.1|  pyridine nucleotide-disulfide oxidoreductase     52.0    7e-05   
pir||JC7723  phytoene desaturase (EC 1.14.99.-) 1 - citrus            52.0    7e-05
gb|AEQ29518.1|  phytoene desaturase                                   52.0    7e-05   
ref|NP_001275791.1|  phytoene desaturase                              52.0    7e-05   
gb|AEQ29519.1|  phytoene desaturase                                   52.0    7e-05   
ref|WP_011131369.1|  15-cis-phytoene desaturase                       52.0    8e-05   
ref|XP_003601734.1|  Phytoene desaturase                              52.0    8e-05   
dbj|BAH10588.1|  zeta-carotene desaturase                             52.0    8e-05   
gb|AGQ04196.1|  phytoene dehydrogenase                                52.0    8e-05   
emb|CDX90267.1|  BnaA08g17170D                                        51.2    8e-05   
gb|AGC74040.1|  phytoene desaturase                                   52.0    8e-05   
ref|XP_005836027.1|  hypothetical protein GUITHDRAFT_85858            51.6    9e-05   
gb|AFK65668.1|  chloroplast phytoene desaturase                       51.6    9e-05   
ref|WP_036901635.1|  phytoene desaturase                              51.6    9e-05   
gb|ACT20709.1|  chloroplast phytoene desaturase                       51.6    9e-05   
ref|XP_006421059.1|  hypothetical protein CICLE_v10007114mg           51.2    9e-05   
ref|XP_010450087.1|  PREDICTED: 15-cis-phytoene desaturase, chlor...  51.6    1e-04   
gb|ABG72807.2|  phytoene desaturase                                   51.6    1e-04   
ref|XP_004502268.1|  PREDICTED: phytoene dehydrogenase, chloropla...  51.6    1e-04   
gb|ABG77271.2|  phytoene desaturase                                   51.6    1e-04   
ref|XP_002503801.1|  phytoene desaturase                              51.2    1e-04   
ref|XP_002184512.1|  phytoene desaturase                              51.2    1e-04   
ref|XP_003081728.1|  Amine oxidase (ISS)                              51.2    1e-04   
ref|WP_011294143.1|  15-cis-phytoene desaturase                       51.2    1e-04   
ref|WP_036904708.1|  phytoene desaturase                              51.2    1e-04   
ref|WP_011823004.1|  15-cis-phytoene desaturase                       51.2    1e-04   
gb|ACR61393.1|  phytoene desaturase protein                           51.2    1e-04   
ref|WP_015203840.1|  phytoene desaturase                              51.2    1e-04   
gb|AFH53815.1|  phytoene desaturase                                   51.2    1e-04   
ref|XP_011398349.1|  15-cis-phytoene desaturase, chloroplastic/ch...  51.2    1e-04   
ref|XP_010435176.1|  PREDICTED: 15-cis-phytoene desaturase, chlor...  51.2    1e-04   
gb|AFH53811.1|  phytoene desaturase                                   51.2    1e-04   
emb|CDY12744.1|  BnaC04g28970D                                        51.2    1e-04   
ref|WP_011378266.1|  MULTISPECIES: 15-cis-phytoene desaturase         50.8    2e-04   
ref|XP_005850369.1|  hypothetical protein CHLNCDRAFT_34420            50.8    2e-04   
ref|WP_011244423.1|  15-cis-phytoene desaturase                       50.8    2e-04   
gb|AGT45481.1|  phytoene desaturase                                   50.8    2e-04   
gb|AGU91433.1|  phytoene desaturase                                   50.8    2e-04   
ref|XP_006283428.1|  hypothetical protein CARUB_v10004476mg           50.8    2e-04   
gb|ADT89708.1|  chloroplast phytoene desaturase                       50.8    2e-04   
gb|AAL15300.1|  AT4g14210/dl3145c                                     50.8    2e-04   
emb|CDY65023.1|  BnaC03g76050D                                        50.8    2e-04   
gb|ADT89706.1|  chloroplast phytoene desaturase                       50.8    2e-04   
ref|NP_974545.1|  phytoene desaturase 3                               50.8    2e-04   



>dbj|BAI47574.1| zeta-carotene desaturase [Ipomoea sp. Kenyan]
Length=588

 Score =   198 bits (504),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 123/130 (95%), Positives = 124/130 (95%), Gaps = 0/130 (0%)
 Frame = +3

Query  156  MaaassasICFPATRKGTDFrsgstglllrsglrvstglrsrKSVIRSDLDSMVSDMSTN  335
            MAAASSAS+CFPATRKG DFRSGSTGLL RS  RVST L SRKSVIRSDLDSMVSDMSTN
Sbjct  1    MAAASSASMCFPATRKGADFRSGSTGLLRRSNCRVSTRLTSRKSVIRSDLDSMVSDMSTN  60

Query  336  APKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFV  515
            APKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFV
Sbjct  61   APKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFV  120

Query  516  DRRGNHIEMG  545
            DRRGNHIEMG
Sbjct  121  DRRGNHIEMG  130



>ref|XP_010323855.1| PREDICTED: zeta-carotene desaturase, chloroplastic/chromoplastic 
isoform X1 [Solanum lycopersicum]
Length=482

 Score =   178 bits (451),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 84/88 (95%), Positives = 88/88 (100%), Gaps = 0/88 (0%)
 Frame = +3

Query  282  KSVIRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE  461
            KSVIR+DLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE
Sbjct  45   KSVIRADLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE  104

Query  462  VDIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            VDIY+S++FIGGKVGSFVDRRGNHIEMG
Sbjct  105  VDIYESRTFIGGKVGSFVDRRGNHIEMG  132



>gb|AIX87520.1| zeta-carotene desaturase [Lycium ruthenicum]
Length=588

 Score =   179 bits (453),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 84/88 (95%), Positives = 88/88 (100%), Gaps = 0/88 (0%)
 Frame = +3

Query  282  KSVIRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE  461
            KSVIR+DLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE
Sbjct  45   KSVIRADLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE  104

Query  462  VDIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            VDIY+S++FIGGKVGSFVDRRGNHIEMG
Sbjct  105  VDIYESRTFIGGKVGSFVDRRGNHIEMG  132



>ref|XP_006347795.1| PREDICTED: zeta-carotene desaturase, chloroplastic/chromoplastic-like 
[Solanum tuberosum]
Length=588

 Score =   179 bits (453),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 84/88 (95%), Positives = 88/88 (100%), Gaps = 0/88 (0%)
 Frame = +3

Query  282  KSVIRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE  461
            KSVIR+DLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE
Sbjct  45   KSVIRADLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE  104

Query  462  VDIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            VDIY+S++FIGGKVGSFVDRRGNHIEMG
Sbjct  105  VDIYESRTFIGGKVGSFVDRRGNHIEMG  132



>gb|AGO05927.1| plastid zeta-carotene desaturase [Solanum lycopersicum]
Length=588

 Score =   179 bits (453),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 84/88 (95%), Positives = 88/88 (100%), Gaps = 0/88 (0%)
 Frame = +3

Query  282  KSVIRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE  461
            KSVIR+DLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE
Sbjct  45   KSVIRADLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE  104

Query  462  VDIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            VDIY+S++FIGGKVGSFVDRRGNHIEMG
Sbjct  105  VDIYESRTFIGGKVGSFVDRRGNHIEMG  132



>ref|NP_001234383.1| zeta-carotene desaturase, chloroplastic/chromoplastic [Solanum 
lycopersicum]
 sp|Q9SE20.1|ZDS_SOLLC RecName: Full=Zeta-carotene desaturase, chloroplastic/chromoplastic; 
AltName: Full=9,9'-di-cis-zeta-carotene desaturase; 
AltName: Full=Carotene 7,8-desaturase; Flags: Precursor [Solanum 
lycopersicum]
 gb|AAF13698.1|AF195507_1 zeta-carotene desaturase [Solanum lycopersicum]
Length=588

 Score =   179 bits (453),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 84/88 (95%), Positives = 88/88 (100%), Gaps = 0/88 (0%)
 Frame = +3

Query  282  KSVIRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE  461
            KSVIR+DLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE
Sbjct  45   KSVIRADLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE  104

Query  462  VDIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            VDIY+S++FIGGKVGSFVDRRGNHIEMG
Sbjct  105  VDIYESRTFIGGKVGSFVDRRGNHIEMG  132



>gb|ABD67160.1| zeta-carotene desaturase [Solanum lycopersicum]
Length=588

 Score =   179 bits (453),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 84/88 (95%), Positives = 88/88 (100%), Gaps = 0/88 (0%)
 Frame = +3

Query  282  KSVIRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE  461
            KSVIR+DLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE
Sbjct  45   KSVIRADLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE  104

Query  462  VDIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            VDIY+S++FIGGKVGSFVDRRGNHIEMG
Sbjct  105  VDIYESRTFIGGKVGSFVDRRGNHIEMG  132



>gb|ABR57231.1| zeta-carotene desaturase [Solanum lycopersicum]
Length=588

 Score =   178 bits (452),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 84/88 (95%), Positives = 88/88 (100%), Gaps = 0/88 (0%)
 Frame = +3

Query  282  KSVIRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE  461
            KSVIR+DLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE
Sbjct  45   KSVIRADLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE  104

Query  462  VDIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            VDIY+S++FIGGKVGSFVDRRGNHIEMG
Sbjct  105  VDIYESRTFIGGKVGSFVDRRGNHIEMG  132



>ref|XP_009792956.1| PREDICTED: zeta-carotene desaturase, chloroplastic/chromoplastic 
[Nicotiana sylvestris]
Length=588

 Score =   177 bits (450),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 84/88 (95%), Positives = 87/88 (99%), Gaps = 0/88 (0%)
 Frame = +3

Query  282  KSVIRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE  461
            KSVIR+DLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE
Sbjct  45   KSVIRADLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE  104

Query  462  VDIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            VDIY+S+ FIGGKVGSFVDRRGNHIEMG
Sbjct  105  VDIYESRPFIGGKVGSFVDRRGNHIEMG  132



>gb|AEG73891.1| zeta-carotene desaturase [Nicotiana tabacum]
Length=588

 Score =   177 bits (450),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 84/88 (95%), Positives = 87/88 (99%), Gaps = 0/88 (0%)
 Frame = +3

Query  282  KSVIRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE  461
            KSVIR+DLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE
Sbjct  45   KSVIRADLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE  104

Query  462  VDIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            VDIY+S+ FIGGKVGSFVDRRGNHIEMG
Sbjct  105  VDIYESRPFIGGKVGSFVDRRGNHIEMG  132



>gb|AHA58685.1| zeta-carotene desaturase [Nicotiana tabacum]
Length=588

 Score =   177 bits (450),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 84/88 (95%), Positives = 87/88 (99%), Gaps = 0/88 (0%)
 Frame = +3

Query  282  KSVIRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE  461
            KSVIR+DLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE
Sbjct  45   KSVIRADLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE  104

Query  462  VDIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            VDIY+S+ FIGGKVGSFVDRRGNHIEMG
Sbjct  105  VDIYESRPFIGGKVGSFVDRRGNHIEMG  132



>ref|XP_009588416.1| PREDICTED: zeta-carotene desaturase, chloroplastic/chromoplastic 
[Nicotiana tomentosiformis]
Length=588

 Score =   177 bits (450),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 84/88 (95%), Positives = 87/88 (99%), Gaps = 0/88 (0%)
 Frame = +3

Query  282  KSVIRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE  461
            KSVIR+DLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE
Sbjct  45   KSVIRADLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE  104

Query  462  VDIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            VDIY+S+ FIGGKVGSFVDRRGNHIEMG
Sbjct  105  VDIYESRPFIGGKVGSFVDRRGNHIEMG  132



>sp|Q9SMJ3.1|ZDS_CAPAN RecName: Full=Zeta-carotene desaturase, chloroplastic/chromoplastic; 
AltName: Full=9,9'-di-cis-zeta-carotene desaturase; 
AltName: Full=Carotene 7,8-desaturase; Flags: Precursor [Capsicum 
annuum]
 gb|AAB35386.1| zeta-carotene desaturase, CapZDS=phytoene desaturase homolog 
[Capsicum annuum, early ripening fruit, Peptide, 588 aa]
 emb|CAA61985.1| zeta-carotene /neurosporene dehydrogenase (desaturase) [Capsicum 
annuum]
Length=588

 Score =   176 bits (445),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 82/88 (93%), Positives = 88/88 (100%), Gaps = 0/88 (0%)
 Frame = +3

Query  282  KSVIRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE  461
            KSVIR+DL+SMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE
Sbjct  45   KSVIRADLNSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE  104

Query  462  VDIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            VDIY+S++FIGGKVGSFVD+RGNHIEMG
Sbjct  105  VDIYESRTFIGGKVGSFVDKRGNHIEMG  132



>prf||2121278A zeta carotene desaturase
Length=588

 Score =   176 bits (445),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 82/88 (93%), Positives = 88/88 (100%), Gaps = 0/88 (0%)
 Frame = +3

Query  282  KSVIRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE  461
            KSVIR+DL+SMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE
Sbjct  45   KSVIRADLNSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE  104

Query  462  VDIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            VDIY+S++FIGGKVGSFVD+RGNHIEMG
Sbjct  105  VDIYESRTFIGGKVGSFVDKRGNHIEMG  132



>gb|AIX87496.1| zeta-carotene desaturase [Lycium barbarum]
Length=588

 Score =   175 bits (444),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 83/88 (94%), Positives = 86/88 (98%), Gaps = 0/88 (0%)
 Frame = +3

Query  282  KSVIRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE  461
            KSVIR+DLDSMVSDM TNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE
Sbjct  45   KSVIRADLDSMVSDMGTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE  104

Query  462  VDIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            VDIY S++FIGGKVGSFVDRRGNHIEMG
Sbjct  105  VDIYGSRTFIGGKVGSFVDRRGNHIEMG  132



>gb|AHA36972.1| zeta-carotene desaturase [Helianthus annuus]
Length=587

 Score =   171 bits (432),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 91/125 (73%), Positives = 103/125 (82%), Gaps = 3/125 (2%)
 Frame = +3

Query  180  ICFPATRKG---TDFrsgstglllrsglrvstglrsrKSVIRSDLDSMVSDMSTNAPKGL  350
            +CFPAT      + F + ++ LL     R  T L+ RK+VIRSDLD  VSDM TNAPKGL
Sbjct  11   LCFPATSAAGTRSSFHTTTSTLLRCRRSRQLTRLKVRKAVIRSDLDRDVSDMRTNAPKGL  70

Query  351  FPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGN  530
            FPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDIY+S++FIGGKVGSFVD++GN
Sbjct  71   FPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDIYESRTFIGGKVGSFVDKQGN  130

Query  531  HIEMG  545
            HIEMG
Sbjct  131  HIEMG  135



>emb|CAD55814.2| putative zeta-carotene desaturase [Helianthus annuus]
 gb|AEI70832.1| zeta-carotene desaturase [Helianthus annuus]
Length=587

 Score =   171 bits (432),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 91/125 (73%), Positives = 103/125 (82%), Gaps = 3/125 (2%)
 Frame = +3

Query  180  ICFPATRKG---TDFrsgstglllrsglrvstglrsrKSVIRSDLDSMVSDMSTNAPKGL  350
            +CFPAT      + F + ++ LL     R  T L+ RK+VIRSDLD  VSDM TNAPKGL
Sbjct  11   LCFPATSAAGTRSSFHTTTSTLLRCRRSRQLTRLKVRKAVIRSDLDRDVSDMRTNAPKGL  70

Query  351  FPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGN  530
            FPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDIY+S++FIGGKVGSFVD++GN
Sbjct  71   FPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDIYESRTFIGGKVGSFVDKQGN  130

Query  531  HIEMG  545
            HIEMG
Sbjct  131  HIEMG  135



>gb|AAT76050.1| zeta-carotene desaturase [Citrus clementina]
Length=263

 Score =   164 bits (414),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 76/88 (86%), Positives = 83/88 (94%), Gaps = 0/88 (0%)
 Frame = +3

Query  282  KSVIRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE  461
            +  +R+ LD+ VSDMS NAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE
Sbjct  26   RFCVRASLDANVSDMSVNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE  85

Query  462  VDIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            VDIY+S+SFIGGKVGSFVD+RGNHIEMG
Sbjct  86   VDIYESRSFIGGKVGSFVDKRGNHIEMG  113



>gb|AGN03856.1| zeta-carotene desaturase [Scutellaria baicalensis]
Length=574

 Score =   170 bits (430),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 80/88 (91%), Positives = 85/88 (97%), Gaps = 0/88 (0%)
 Frame = +3

Query  282  KSVIRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE  461
            +  +RSDLDS VSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE
Sbjct  35   RLTLRSDLDSNVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE  94

Query  462  VDIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            VDIYDS+SFIGGKVGSFVD++GNHIEMG
Sbjct  95   VDIYDSRSFIGGKVGSFVDKKGNHIEMG  122



>sp|Q9FV46.1|ZDS_TARER RecName: Full=Zeta-carotene desaturase, chloroplastic/chromoplastic; 
AltName: Full=9,9'-di-cis-zeta-carotene desaturase; 
AltName: Full=Carotene 7,8-desaturase; Flags: Precursor [Tagetes 
erecta]
 gb|AAG10425.1| zeta desaturase [Tagetes erecta]
Length=587

 Score =   169 bits (429),  Expect = 6e-46, Method: Composition-based stats.
 Identities = 78/88 (89%), Positives = 85/88 (97%), Gaps = 0/88 (0%)
 Frame = +3

Query  282  KSVIRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE  461
            K+V+RSDLD  VSDM TNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE
Sbjct  48   KAVVRSDLDRDVSDMRTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE  107

Query  462  VDIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            VDIY+S++FIGGKVGSFVD++GNHIEMG
Sbjct  108  VDIYESRTFIGGKVGSFVDKQGNHIEMG  135



>emb|CAD27442.1| putative zeta-carotene desaturase [Helianthus annuus]
Length=587

 Score =   169 bits (428),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 90/125 (72%), Positives = 103/125 (82%), Gaps = 3/125 (2%)
 Frame = +3

Query  180  ICFPATRKG---TDFrsgstglllrsglrvstglrsrKSVIRSDLDSMVSDMSTNAPKGL  350
            +CFPAT      + F + ++ LL     R  T L+ RK+VIRSDLD  VSDM TNAPKGL
Sbjct  11   LCFPATSAAGTRSSFHTTTSTLLRCRRSRQLTRLKVRKAVIRSDLDRDVSDMRTNAPKGL  70

Query  351  FPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGN  530
            FPPEPEHYRGPKLKVAIIGAGLAGMSTAVELL+QGHEVDIY+S++FIGGKVGSFVD++GN
Sbjct  71   FPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLNQGHEVDIYESRTFIGGKVGSFVDKQGN  130

Query  531  HIEMG  545
            HIEMG
Sbjct  131  HIEMG  135



>gb|KEH43038.1| zeta-carotene desaturase [Medicago truncatula]
Length=446

 Score =   166 bits (420),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 78/88 (89%), Positives = 83/88 (94%), Gaps = 0/88 (0%)
 Frame = +3

Query  282  KSVIRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE  461
            K  +R  LDS VSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE
Sbjct  37   KPRVRCSLDSNVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE  96

Query  462  VDIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            VDIY+S++FIGGKVGSFVD+RGNHIEMG
Sbjct  97   VDIYESRTFIGGKVGSFVDKRGNHIEMG  124



>emb|CDP08546.1| unnamed protein product [Coffea canephora]
Length=594

 Score =   167 bits (424),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 79/87 (91%), Positives = 83/87 (95%), Gaps = 0/87 (0%)
 Frame = +3

Query  285  SVIRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEV  464
            S++RSDLDS VSDM  NAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEV
Sbjct  52   SIVRSDLDSNVSDMRNNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEV  111

Query  465  DIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            DIY+S SFIGGKVGSFVD+RGNHIEMG
Sbjct  112  DIYESHSFIGGKVGSFVDKRGNHIEMG  138



>ref|XP_004495784.1| PREDICTED: zeta-carotene desaturase, chloroplastic/chromoplastic-like 
isoform X1 [Cicer arietinum]
 ref|XP_004495785.1| PREDICTED: zeta-carotene desaturase, chloroplastic/chromoplastic-like 
isoform X2 [Cicer arietinum]
Length=582

 Score =   167 bits (422),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 79/88 (90%), Positives = 84/88 (95%), Gaps = 0/88 (0%)
 Frame = +3

Query  282  KSVIRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE  461
            K+ +RS LDS VSDMS NAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE
Sbjct  40   KARVRSSLDSNVSDMSINAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE  99

Query  462  VDIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            VDIY+S+SFIGGKVGSFVD+RGNHIEMG
Sbjct  100  VDIYESRSFIGGKVGSFVDKRGNHIEMG  127



>emb|CBI34203.3| unnamed protein product [Vitis vinifera]
Length=552

 Score =   167 bits (422),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 79/85 (93%), Positives = 82/85 (96%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  IRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  470
            +RS LDS VSDMS NAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI
Sbjct  12   VRSSLDSDVSDMSVNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  71

Query  471  YDSKSFIGGKVGSFVDRRGNHIEMG  545
            Y+S+SFIGGKVGSFVDRRGNHIEMG
Sbjct  72   YESRSFIGGKVGSFVDRRGNHIEMG  96



>gb|ABB52070.1| putative zeta carotene desaturase [Daucus carota subsp. sativus]
Length=575

 Score =   166 bits (421),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 78/86 (91%), Positives = 83/86 (97%), Gaps = 0/86 (0%)
 Frame = +3

Query  288  VIRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVD  467
            V+RSDL+  VSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVD
Sbjct  39   VVRSDLEKNVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVD  98

Query  468  IYDSKSFIGGKVGSFVDRRGNHIEMG  545
            IY+S+ FIGGKVGSFVD+RGNHIEMG
Sbjct  99   IYESRPFIGGKVGSFVDKRGNHIEMG  124



>emb|CAN65781.1| hypothetical protein VITISV_010561 [Vitis vinifera]
Length=576

 Score =   166 bits (421),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 79/85 (93%), Positives = 82/85 (96%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  IRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  470
            +RS LDS VSDMS NAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI
Sbjct  43   VRSSLDSDVSDMSVNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  102

Query  471  YDSKSFIGGKVGSFVDRRGNHIEMG  545
            Y+S+SFIGGKVGSFVDRRGNHIEMG
Sbjct  103  YESRSFIGGKVGSFVDRRGNHIEMG  127



>dbj|BAE79555.1| zeta-carotene desaturase [Chrysanthemum x morifolium]
Length=584

 Score =   166 bits (421),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 92/131 (70%), Positives = 103/131 (79%), Gaps = 1/131 (1%)
 Frame = +3

Query  156  MaaassasICFPATRK-GTDFrsgstglllrsglrvstglrsrKSVIRSDLDSMVSDMST  332
            MA +S++S+CFPAT   GT     +    LR     +  L   K V+RSDLD  VSDM T
Sbjct  2    MATSSTSSLCFPATSAAGTRHSFPTNDTFLRCNRHRNRQLNRLKFVVRSDLDKDVSDMRT  61

Query  333  NAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSF  512
            NAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDIY+S++FIGGKVGSF
Sbjct  62   NAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDIYESRTFIGGKVGSF  121

Query  513  VDRRGNHIEMG  545
            VD+ GNHIEMG
Sbjct  122  VDKGGNHIEMG  132



>gb|KEH43037.1| zeta-carotene desaturase [Medicago truncatula]
Length=557

 Score =   166 bits (420),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 78/88 (89%), Positives = 83/88 (94%), Gaps = 0/88 (0%)
 Frame = +3

Query  282  KSVIRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE  461
            K  +R  LDS VSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE
Sbjct  37   KPRVRCSLDSNVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE  96

Query  462  VDIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            VDIY+S++FIGGKVGSFVD+RGNHIEMG
Sbjct  97   VDIYESRTFIGGKVGSFVDKRGNHIEMG  124



>ref|XP_002277348.2| PREDICTED: zeta-carotene desaturase, chloroplastic/chromoplastic 
[Vitis vinifera]
Length=583

 Score =   166 bits (421),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 79/85 (93%), Positives = 82/85 (96%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  IRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  470
            +RS LDS VSDMS NAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI
Sbjct  43   VRSSLDSDVSDMSVNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  102

Query  471  YDSKSFIGGKVGSFVDRRGNHIEMG  545
            Y+S+SFIGGKVGSFVDRRGNHIEMG
Sbjct  103  YESRSFIGGKVGSFVDRRGNHIEMG  127



>ref|XP_003591015.1| Zeta-carotene desaturase [Medicago truncatula]
Length=587

 Score =   166 bits (421),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 78/88 (89%), Positives = 83/88 (94%), Gaps = 0/88 (0%)
 Frame = +3

Query  282  KSVIRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE  461
            K  +R  LDS VSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE
Sbjct  37   KPRVRCSLDSNVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE  96

Query  462  VDIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            VDIY+S++FIGGKVGSFVD+RGNHIEMG
Sbjct  97   VDIYESRTFIGGKVGSFVDKRGNHIEMG  124



>gb|AES61266.2| zeta-carotene desaturase [Medicago truncatula]
Length=579

 Score =   166 bits (420),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 78/88 (89%), Positives = 83/88 (94%), Gaps = 0/88 (0%)
 Frame = +3

Query  282  KSVIRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE  461
            K  +R  LDS VSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE
Sbjct  37   KPRVRCSLDSNVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE  96

Query  462  VDIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            VDIY+S++FIGGKVGSFVD+RGNHIEMG
Sbjct  97   VDIYESRTFIGGKVGSFVDKRGNHIEMG  124



>ref|XP_010025059.1| PREDICTED: zeta-carotene desaturase, chloroplastic/chromoplastic-like 
[Eucalyptus grandis]
 gb|KCW61653.1| hypothetical protein EUGRSUZ_H04384 [Eucalyptus grandis]
Length=581

 Score =   166 bits (420),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 77/86 (90%), Positives = 82/86 (95%), Gaps = 0/86 (0%)
 Frame = +3

Query  288  VIRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVD  467
             +RS LDS VSDMS NAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVD
Sbjct  39   CVRSSLDSNVSDMSVNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVD  98

Query  468  IYDSKSFIGGKVGSFVDRRGNHIEMG  545
            IY+S+SFIGGKVGSFVD+RGNH+EMG
Sbjct  99   IYESRSFIGGKVGSFVDKRGNHVEMG  124



>ref|XP_010041364.1| PREDICTED: zeta-carotene desaturase, chloroplastic/chromoplastic-like 
[Eucalyptus grandis]
 gb|KCW44410.1| hypothetical protein EUGRSUZ_L02103 [Eucalyptus grandis]
Length=581

 Score =   166 bits (420),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 77/86 (90%), Positives = 82/86 (95%), Gaps = 0/86 (0%)
 Frame = +3

Query  288  VIRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVD  467
             +RS LDS VSDMS NAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVD
Sbjct  39   CVRSSLDSNVSDMSVNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVD  98

Query  468  IYDSKSFIGGKVGSFVDRRGNHIEMG  545
            IY+S+SFIGGKVGSFVD+RGNH+EMG
Sbjct  99   IYESRSFIGGKVGSFVDKRGNHVEMG  124



>gb|AFP28797.1| zeta-carotene desaturase 1 [Vitis vinifera]
Length=583

 Score =   166 bits (419),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 78/85 (92%), Positives = 82/85 (96%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  IRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  470
            +RS LDS VSDMS NAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVD+
Sbjct  43   VRSSLDSDVSDMSVNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDV  102

Query  471  YDSKSFIGGKVGSFVDRRGNHIEMG  545
            Y+S+SFIGGKVGSFVDRRGNHIEMG
Sbjct  103  YESRSFIGGKVGSFVDRRGNHIEMG  127



>ref|NP_001275793.1| ZDS [Citrus sinensis]
 emb|CAC85667.1| zeta-carotene desaturase [Citrus sinensis]
Length=570

 Score =   166 bits (419),  Expect = 1e-44, Method: Composition-based stats.
 Identities = 76/85 (89%), Positives = 82/85 (96%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  IRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  470
            +R+ LD+ VSDMS NAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI
Sbjct  29   VRASLDANVSDMSVNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  88

Query  471  YDSKSFIGGKVGSFVDRRGNHIEMG  545
            Y+S+SFIGGKVGSFVD+RGNHIEMG
Sbjct  89   YESRSFIGGKVGSFVDKRGNHIEMG  113



>dbj|BAA88843.1| zeta-Carotene Desaturase [Gentiana lutea]
 gb|ACF21785.1| zeta-carotene desaturase [Gentiana lutea]
Length=587

 Score =   166 bits (419),  Expect = 1e-44, Method: Composition-based stats.
 Identities = 77/85 (91%), Positives = 81/85 (95%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  IRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  470
            +RSDLDS VSDMS NAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI
Sbjct  47   VRSDLDSNVSDMSVNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  106

Query  471  YDSKSFIGGKVGSFVDRRGNHIEMG  545
            Y+S+ FIGGKVGSFVD+ GNHIEMG
Sbjct  107  YESRPFIGGKVGSFVDKGGNHIEMG  131



>gb|KHG06842.1| Zeta-carotene desaturase, chloroplastic/chromoplastic [Gossypium 
arboreum]
Length=566

 Score =   165 bits (417),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 77/88 (88%), Positives = 83/88 (94%), Gaps = 0/88 (0%)
 Frame = +3

Query  282  KSVIRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE  461
            +  ++S LD+ VSDMS NAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE
Sbjct  23   RHFVKSSLDNNVSDMSVNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE  82

Query  462  VDIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            VDIY+S+SFIGGKVGSFVDRRGNHIEMG
Sbjct  83   VDIYESRSFIGGKVGSFVDRRGNHIEMG  110



>ref|XP_002319628.1| hypothetical protein POPTR_0013s03470g [Populus trichocarpa]
 gb|EEE95551.1| hypothetical protein POPTR_0013s03470g [Populus trichocarpa]
Length=582

 Score =   165 bits (417),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 80/88 (91%), Positives = 83/88 (94%), Gaps = 3/88 (3%)
 Frame = +3

Query  291  IRSDLDSM---VSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE  461
            +RS LDS+   VSDMS NAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE
Sbjct  39   VRSALDSLETNVSDMSVNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE  98

Query  462  VDIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            VDIYDS+SFIGGKVGSFVDRRGNHIEMG
Sbjct  99   VDIYDSRSFIGGKVGSFVDRRGNHIEMG  126



>gb|KJB82544.1| hypothetical protein B456_013G201600 [Gossypium raimondii]
Length=566

 Score =   164 bits (416),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 77/85 (91%), Positives = 82/85 (96%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  IRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  470
            ++S LD+ VSDMS NAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI
Sbjct  26   VKSSLDNNVSDMSVNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  85

Query  471  YDSKSFIGGKVGSFVDRRGNHIEMG  545
            Y+S+SFIGGKVGSFVDRRGNHIEMG
Sbjct  86   YESRSFIGGKVGSFVDRRGNHIEMG  110



>gb|AAK51557.1|AF372617_1 zeta-carotene desaturase precursor [Citrus x paradisi]
Length=570

 Score =   164 bits (416),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 76/88 (86%), Positives = 83/88 (94%), Gaps = 0/88 (0%)
 Frame = +3

Query  282  KSVIRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE  461
            +  +R+ LD+ VSDMS NAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE
Sbjct  26   RFCVRASLDANVSDMSVNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE  85

Query  462  VDIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            VDIY+S+SFIGGKVGSFVD+RGNHIEMG
Sbjct  86   VDIYESRSFIGGKVGSFVDKRGNHIEMG  113



>ref|XP_007030628.1| Zeta-carotene desaturase [Theobroma cacao]
 gb|EOY11130.1| Zeta-carotene desaturase [Theobroma cacao]
Length=580

 Score =   165 bits (417),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 77/88 (88%), Positives = 83/88 (94%), Gaps = 0/88 (0%)
 Frame = +3

Query  282  KSVIRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE  461
            K  ++S LD+ VSDMS NAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE
Sbjct  23   KLFVKSSLDTSVSDMSVNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE  82

Query  462  VDIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            VDIY+S+SFIGGKVGSFVDR+GNHIEMG
Sbjct  83   VDIYESRSFIGGKVGSFVDRKGNHIEMG  110



>dbj|BAB68552.1| zeta-carotene desaturase [Citrus unshiu]
Length=570

 Score =   164 bits (416),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 76/88 (86%), Positives = 83/88 (94%), Gaps = 0/88 (0%)
 Frame = +3

Query  282  KSVIRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE  461
            +  +R+ LD+ VSDMS NAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE
Sbjct  26   RFCVRASLDANVSDMSVNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE  85

Query  462  VDIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            VDIY+S+SFIGGKVGSFVD+RGNHIEMG
Sbjct  86   VDIYESRSFIGGKVGSFVDKRGNHIEMG  113



>gb|ABC33728.1| zeta-carotene desaturase [Citrus unshiu]
Length=570

 Score =   164 bits (416),  Expect = 3e-44, Method: Composition-based stats.
 Identities = 75/85 (88%), Positives = 82/85 (96%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  IRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  470
            +R+ LD+ VSDMS NAP+GLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI
Sbjct  29   VRASLDANVSDMSVNAPQGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  88

Query  471  YDSKSFIGGKVGSFVDRRGNHIEMG  545
            Y+S+SFIGGKVGSFVD+RGNHIEMG
Sbjct  89   YESRSFIGGKVGSFVDKRGNHIEMG  113



>gb|AFK39985.1| unknown [Medicago truncatula]
Length=579

 Score =   164 bits (416),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 77/88 (88%), Positives = 82/88 (93%), Gaps = 0/88 (0%)
 Frame = +3

Query  282  KSVIRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE  461
            K  +R  LDS VSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE
Sbjct  37   KPRVRCSLDSNVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE  96

Query  462  VDIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            VDIY+S++FIG KVGSFVD+RGNHIEMG
Sbjct  97   VDIYESRTFIGAKVGSFVDKRGNHIEMG  124



>ref|XP_007144812.1| hypothetical protein PHAVU_007G186000g [Phaseolus vulgaris]
 gb|ESW16806.1| hypothetical protein PHAVU_007G186000g [Phaseolus vulgaris]
Length=581

 Score =   164 bits (416),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 77/88 (88%), Positives = 82/88 (93%), Gaps = 0/88 (0%)
 Frame = +3

Query  282  KSVIRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE  461
            KS +R  LD  VSDMS NAPKGLFPPEPEHYRGPKLKVAI+GAGLAGMSTAVELLDQGHE
Sbjct  39   KSRLRCSLDDNVSDMSVNAPKGLFPPEPEHYRGPKLKVAIVGAGLAGMSTAVELLDQGHE  98

Query  462  VDIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            VDIY+S+SFIGGKVGSFVD+RGNHIEMG
Sbjct  99   VDIYESRSFIGGKVGSFVDKRGNHIEMG  126



>gb|ACE79169.1| zeta carotene desaturase [Citrus maxima]
Length=570

 Score =   164 bits (415),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 75/88 (85%), Positives = 83/88 (94%), Gaps = 0/88 (0%)
 Frame = +3

Query  282  KSVIRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE  461
            +  +R+ LD+ VSDMS NAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE
Sbjct  26   RFCVRASLDANVSDMSVNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE  85

Query  462  VDIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            VD+Y+S+SFIGGKVGSFVD+RGNHIEMG
Sbjct  86   VDVYESRSFIGGKVGSFVDKRGNHIEMG  113



>gb|ACR61394.1| zeta-carotene desaturase protein [Fragaria x ananassa]
Length=569

 Score =   164 bits (414),  Expect = 6e-44, Method: Composition-based stats.
 Identities = 76/84 (90%), Positives = 80/84 (95%), Gaps = 0/84 (0%)
 Frame = +3

Query  294  RSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDIY  473
            RS LD+ VSDMS NAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDIY
Sbjct  32   RSSLDTNVSDMSVNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDIY  91

Query  474  DSKSFIGGKVGSFVDRRGNHIEMG  545
            +S+ FIGGKVGSFVD+RGNHIEMG
Sbjct  92   ESRPFIGGKVGSFVDKRGNHIEMG  115



>gb|AFH53817.1| zeta-carotene desaturase [Narcissus tazetta var. chinensis]
Length=574

 Score =   164 bits (414),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 77/85 (91%), Positives = 81/85 (95%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  IRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  470
            IRS LD+ VSDMS NAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI
Sbjct  33   IRSALDTKVSDMSVNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  92

Query  471  YDSKSFIGGKVGSFVDRRGNHIEMG  545
            Y+S+ FIGGKVGSFVD+RGNHIEMG
Sbjct  93   YESRQFIGGKVGSFVDKRGNHIEMG  117



>dbj|BAJ96277.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=568

 Score =   163 bits (413),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 75/86 (87%), Positives = 82/86 (95%), Gaps = 0/86 (0%)
 Frame = +3

Query  288  VIRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVD  467
            V+R  LDS VSDM+ NAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVD
Sbjct  30   VVRCSLDSKVSDMAVNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVD  89

Query  468  IYDSKSFIGGKVGSFVDRRGNHIEMG  545
            +YDS++FIGGKVGSFVD++GNHIEMG
Sbjct  90   LYDSRTFIGGKVGSFVDKQGNHIEMG  115



>gb|ACB87206.1| zeta-carotene desaturase [Narcissus tazetta var. chinensis]
Length=574

 Score =   164 bits (414),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 77/85 (91%), Positives = 81/85 (95%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  IRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  470
            IRS LD+ VSDMS NAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI
Sbjct  33   IRSALDTKVSDMSVNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  92

Query  471  YDSKSFIGGKVGSFVDRRGNHIEMG  545
            Y+S+ FIGGKVGSFVD+RGNHIEMG
Sbjct  93   YESRQFIGGKVGSFVDKRGNHIEMG  117



>gb|AEW70738.1| zeta-carotene desaturase [Ficus carica]
Length=581

 Score =   164 bits (414),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 76/85 (89%), Positives = 81/85 (95%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  IRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  470
            +RS LDS +SDMS NAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI
Sbjct  42   VRSSLDSNISDMSVNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  101

Query  471  YDSKSFIGGKVGSFVDRRGNHIEMG  545
            Y+S+ FIGGKVGSFVD+RGNHIEMG
Sbjct  102  YESRPFIGGKVGSFVDKRGNHIEMG  126



>ref|XP_008218201.1| PREDICTED: zeta-carotene desaturase, chloroplastic/chromoplastic 
[Prunus mume]
Length=571

 Score =   163 bits (413),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 76/86 (88%), Positives = 81/86 (94%), Gaps = 0/86 (0%)
 Frame = +3

Query  288  VIRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVD  467
             +RS LD+ VSDMS NAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVD
Sbjct  30   CVRSSLDANVSDMSVNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVD  89

Query  468  IYDSKSFIGGKVGSFVDRRGNHIEMG  545
            IY+S+ FIGGKVGSFVD+RGNHIEMG
Sbjct  90   IYESRPFIGGKVGSFVDKRGNHIEMG  115



>sp|O49901.1|ZDS_NARPS RecName: Full=Zeta-carotene desaturase, chloroplastic/chromoplastic; 
AltName: Full=9,9'-di-cis-zeta-carotene desaturase; 
AltName: Full=Carotene 7,8-desaturase; Flags: Precursor [Narcissus 
pseudonarcissus]
 emb|CAA12062.1| zeta-carotene desaturase [Narcissus pseudonarcissus]
Length=574

 Score =   163 bits (413),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 77/85 (91%), Positives = 81/85 (95%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  IRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  470
            IRS LD+ VSDMS NAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI
Sbjct  33   IRSALDTKVSDMSVNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  92

Query  471  YDSKSFIGGKVGSFVDRRGNHIEMG  545
            Y+S+ FIGGKVGSFVD+RGNHIEMG
Sbjct  93   YESRQFIGGKVGSFVDKRGNHIEMG  117



>gb|KDP23635.1| hypothetical protein JCGZ_23468 [Jatropha curcas]
Length=586

 Score =   163 bits (413),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 79/90 (88%), Positives = 84/90 (93%), Gaps = 3/90 (3%)
 Frame = +3

Query  285  SVIRSDLDSM---VSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQG  455
            S +RS LDS+   VSDMS NAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQG
Sbjct  41   SFVRSALDSLETKVSDMSVNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQG  100

Query  456  HEVDIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            HEVDIY+S+SFIGGKVGSFVD+RGNHIEMG
Sbjct  101  HEVDIYESRSFIGGKVGSFVDKRGNHIEMG  130



>gb|ACO40527.1| zeta-carotene desaturase [Carica papaya]
Length=572

 Score =   163 bits (412),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 77/91 (85%), Positives = 83/91 (91%), Gaps = 3/91 (3%)
 Frame = +3

Query  282  KSVIRSDLDSM---VSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQ  452
            +  +RS LDS+   VSDMS NAPKGLFPPEPEHYRGPKLKVAI+GAGLAGMSTAVELLDQ
Sbjct  26   RVCVRSSLDSLETNVSDMSVNAPKGLFPPEPEHYRGPKLKVAIVGAGLAGMSTAVELLDQ  85

Query  453  GHEVDIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            GHEVDIYD +SFIGGKVGSFVD+RGNHIEMG
Sbjct  86   GHEVDIYDCRSFIGGKVGSFVDKRGNHIEMG  116



>ref|XP_003557406.1| PREDICTED: zeta-carotene desaturase, chloroplastic/chromoplastic 
[Brachypodium distachyon]
Length=570

 Score =   162 bits (411),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 74/86 (86%), Positives = 82/86 (95%), Gaps = 0/86 (0%)
 Frame = +3

Query  288  VIRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVD  467
            V+R  LDS VSDM+ NAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVD
Sbjct  32   VVRCSLDSKVSDMAVNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVD  91

Query  468  IYDSKSFIGGKVGSFVDRRGNHIEMG  545
            +YD+++FIGGKVGSFVD++GNHIEMG
Sbjct  92   LYDTRTFIGGKVGSFVDKQGNHIEMG  117



>ref|XP_006382767.1| hypothetical protein POPTR_0005s05230g [Populus trichocarpa]
 gb|ERP60564.1| hypothetical protein POPTR_0005s05230g [Populus trichocarpa]
Length=589

 Score =   162 bits (411),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 79/88 (90%), Positives = 82/88 (93%), Gaps = 3/88 (3%)
 Frame = +3

Query  291  IRSDLDSM---VSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE  461
            +RS LDS+   VSDMS NAPKGLFPPEP HYRGPKLKVAIIGAGLAGMSTAVELLDQGHE
Sbjct  46   VRSALDSLETKVSDMSVNAPKGLFPPEPAHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE  105

Query  462  VDIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            VDIYDS+SFIGGKVGSFVDRRGNHIEMG
Sbjct  106  VDIYDSRSFIGGKVGSFVDRRGNHIEMG  133



>ref|XP_011032463.1| PREDICTED: zeta-carotene desaturase, chloroplastic/chromoplastic 
[Populus euphratica]
Length=589

 Score =   162 bits (411),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 79/88 (90%), Positives = 82/88 (93%), Gaps = 3/88 (3%)
 Frame = +3

Query  291  IRSDLDSM---VSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE  461
            +RS LDS+   VSDMS NAPKGLFPPEP HYRGPKLKVAIIGAGLAGMSTAVELLDQGHE
Sbjct  46   VRSALDSLETKVSDMSVNAPKGLFPPEPAHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE  105

Query  462  VDIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            VDIYDS+SFIGGKVGSFVDRRGNHIEMG
Sbjct  106  VDIYDSRSFIGGKVGSFVDRRGNHIEMG  133



>gb|ACI04664.1| zeta-carotene desaturase [Triticum aestivum]
 emb|CAX36915.1| zeta-carotene desaturase enzyme [Triticum aestivum]
 gb|AEI26316.1| zeta-carotene desaturase [Triticum aestivum]
 gb|AEI26317.1| zeta-carotene desaturase [Triticum aestivum]
Length=568

 Score =   162 bits (411),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 75/86 (87%), Positives = 81/86 (94%), Gaps = 0/86 (0%)
 Frame = +3

Query  288  VIRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVD  467
            V+R  LDS VSDM+ NAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVD
Sbjct  30   VVRCSLDSKVSDMAINAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVD  89

Query  468  IYDSKSFIGGKVGSFVDRRGNHIEMG  545
            +YDS++FIGGKVGSFVD+ GNHIEMG
Sbjct  90   LYDSRTFIGGKVGSFVDKHGNHIEMG  115



>ref|XP_002512239.1| Zeta-carotene desaturase, chloroplast precursor, putative [Ricinus 
communis]
 gb|EEF49691.1| Zeta-carotene desaturase, chloroplast precursor, putative [Ricinus 
communis]
Length=964

 Score =   165 bits (417),  Expect = 2e-43, Method: Composition-based stats.
 Identities = 78/88 (89%), Positives = 83/88 (94%), Gaps = 3/88 (3%)
 Frame = +3

Query  291  IRSDLDSM---VSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE  461
            +RS LDS+   VSDMS NAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE
Sbjct  45   VRSALDSLETKVSDMSVNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE  104

Query  462  VDIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            VDIY+S++FIGGKVGSFVDRRGNHIEMG
Sbjct  105  VDIYESRTFIGGKVGSFVDRRGNHIEMG  132



>gb|KJB45011.1| hypothetical protein B456_007G284900 [Gossypium raimondii]
Length=401

 Score =   160 bits (404),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 74/85 (87%), Positives = 81/85 (95%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  IRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  470
            ++S LD+ VSDMS NAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI
Sbjct  26   VKSSLDTNVSDMSVNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  85

Query  471  YDSKSFIGGKVGSFVDRRGNHIEMG  545
            ++S+ FIGGKVGSFVDR+GNHIEMG
Sbjct  86   FESRPFIGGKVGSFVDRKGNHIEMG  110



>ref|XP_010256022.1| PREDICTED: zeta-carotene desaturase, chloroplastic/chromoplastic 
isoform X1 [Nelumbo nucifera]
Length=586

 Score =   162 bits (410),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 76/85 (89%), Positives = 81/85 (95%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  IRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  470
            +RS LD+ VSDMS NAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI
Sbjct  46   VRSSLDTNVSDMSINAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  105

Query  471  YDSKSFIGGKVGSFVDRRGNHIEMG  545
            Y+S+SFIGGKVGSFVD+ GNHIEMG
Sbjct  106  YESRSFIGGKVGSFVDKHGNHIEMG  130



>gb|AFH53814.1| zeta-carotene desaturase [Narcissus tazetta var. chinensis]
 gb|AFH53818.1| zeta-carotene desaturase [Narcissus tazetta var. chinensis]
Length=574

 Score =   162 bits (410),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 76/85 (89%), Positives = 81/85 (95%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  IRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  470
            IRS LD+ VSDMS NAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI
Sbjct  33   IRSALDTKVSDMSVNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  92

Query  471  YDSKSFIGGKVGSFVDRRGNHIEMG  545
            ++S+ FIGGKVGSFVD+RGNHIEMG
Sbjct  93   FESRQFIGGKVGSFVDKRGNHIEMG  117



>gb|ACT87979.1| zeta carotene desaturase [Jatropha curcas]
Length=586

 Score =   162 bits (410),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 78/90 (87%), Positives = 84/90 (93%), Gaps = 3/90 (3%)
 Frame = +3

Query  285  SVIRSDLDSM---VSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQG  455
            S +R+ LDS+   VSDMS NAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQG
Sbjct  41   SFVRAALDSLETKVSDMSVNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQG  100

Query  456  HEVDIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            HEVDIY+S+SFIGGKVGSFVD+RGNHIEMG
Sbjct  101  HEVDIYESRSFIGGKVGSFVDKRGNHIEMG  130



>ref|XP_010090263.1| Zeta-carotene desaturase [Morus notabilis]
 gb|EXB39201.1| Zeta-carotene desaturase [Morus notabilis]
Length=581

 Score =   162 bits (410),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 76/85 (89%), Positives = 80/85 (94%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  IRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  470
            +RS LD  VSDMS NAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI
Sbjct  41   VRSSLDGNVSDMSVNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  100

Query  471  YDSKSFIGGKVGSFVDRRGNHIEMG  545
            Y+S+ FIGGKVGSFVD+RGNHIEMG
Sbjct  101  YESRPFIGGKVGSFVDKRGNHIEMG  125



>ref|XP_010256023.1| PREDICTED: zeta-carotene desaturase, chloroplastic/chromoplastic 
isoform X2 [Nelumbo nucifera]
Length=546

 Score =   162 bits (409),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 76/85 (89%), Positives = 81/85 (95%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  IRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  470
            +RS LD+ VSDMS NAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI
Sbjct  46   VRSSLDTNVSDMSINAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  105

Query  471  YDSKSFIGGKVGSFVDRRGNHIEMG  545
            Y+S+SFIGGKVGSFVD+ GNHIEMG
Sbjct  106  YESRSFIGGKVGSFVDKHGNHIEMG  130



>gb|KJB45012.1| hypothetical protein B456_007G284900 [Gossypium raimondii]
Length=430

 Score =   160 bits (404),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 74/85 (87%), Positives = 81/85 (95%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  IRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  470
            ++S LD+ VSDMS NAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI
Sbjct  26   VKSSLDTNVSDMSVNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  85

Query  471  YDSKSFIGGKVGSFVDRRGNHIEMG  545
            ++S+ FIGGKVGSFVDR+GNHIEMG
Sbjct  86   FESRPFIGGKVGSFVDRKGNHIEMG  110



>gb|AEI26314.1| zeta-carotene desaturase [Triticum aestivum]
 gb|AEI26315.1| zeta-carotene desaturase [Triticum aestivum]
Length=568

 Score =   162 bits (409),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 74/85 (87%), Positives = 81/85 (95%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  IRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  470
            +R  LDS VSDM+ NAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVD+
Sbjct  31   VRCSLDSKVSDMAINAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDL  90

Query  471  YDSKSFIGGKVGSFVDRRGNHIEMG  545
            YDS++FIGGKVGSFVD++GNHIEMG
Sbjct  91   YDSRTFIGGKVGSFVDKQGNHIEMG  115



>ref|XP_011091935.1| PREDICTED: zeta-carotene desaturase, chloroplastic/chromoplastic-like 
[Sesamum indicum]
Length=573

 Score =   162 bits (409),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 77/86 (90%), Positives = 82/86 (95%), Gaps = 0/86 (0%)
 Frame = +3

Query  288  VIRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVD  467
            V+RSDLDS VSDMS NA KGLFPPEPE YRGPKLKVAIIGAGLAGMSTAVELLDQGHEVD
Sbjct  36   VVRSDLDSNVSDMSVNAAKGLFPPEPERYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVD  95

Query  468  IYDSKSFIGGKVGSFVDRRGNHIEMG  545
            IY+S+SFIGGKVGSFVD++GNHIEMG
Sbjct  96   IYESRSFIGGKVGSFVDKQGNHIEMG  121



>gb|KJB45013.1| hypothetical protein B456_007G284900 [Gossypium raimondii]
Length=432

 Score =   160 bits (404),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 74/85 (87%), Positives = 81/85 (95%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  IRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  470
            ++S LD+ VSDMS NAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI
Sbjct  26   VKSSLDTNVSDMSVNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  85

Query  471  YDSKSFIGGKVGSFVDRRGNHIEMG  545
            ++S+ FIGGKVGSFVDR+GNHIEMG
Sbjct  86   FESRPFIGGKVGSFVDRKGNHIEMG  110



>ref|XP_008813000.1| PREDICTED: zeta-carotene desaturase, chloroplastic/chromoplastic 
isoform X1 [Phoenix dactylifera]
Length=588

 Score =   161 bits (408),  Expect = 4e-43, Method: Composition-based stats.
 Identities = 73/85 (86%), Positives = 80/85 (94%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  IRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  470
            +R+ LD  VSDM  NAPKGLFPPEPEHY+GPKLKVAIIGAGLAGMSTAVELLDQGHEVDI
Sbjct  48   VRASLDIKVSDMGVNAPKGLFPPEPEHYKGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  107

Query  471  YDSKSFIGGKVGSFVDRRGNHIEMG  545
            YD+++FIGGKVGSFVD+RGNHIEMG
Sbjct  108  YDTRTFIGGKVGSFVDKRGNHIEMG  132



>gb|AFH53813.1| zeta-carotene desaturase [Narcissus tazetta var. chinensis]
Length=574

 Score =   161 bits (408),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 76/85 (89%), Positives = 81/85 (95%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  IRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  470
            IRS LD+ VSDMS NAPKGLFPPEPE+YRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI
Sbjct  33   IRSALDTKVSDMSVNAPKGLFPPEPEYYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  92

Query  471  YDSKSFIGGKVGSFVDRRGNHIEMG  545
            Y+S+ FIGGKVGSFVD+RGNHIEMG
Sbjct  93   YESRQFIGGKVGSFVDKRGNHIEMG  117



>ref|XP_004955783.1| PREDICTED: zeta-carotene desaturase, chloroplastic/chromoplastic-like 
[Setaria italica]
Length=575

 Score =   161 bits (408),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 75/87 (86%), Positives = 81/87 (93%), Gaps = 0/87 (0%)
 Frame = +3

Query  285  SVIRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEV  464
            +V+R  LDS VSDM  NAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEV
Sbjct  36   AVVRCSLDSNVSDMGVNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEV  95

Query  465  DIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            D+Y+S+ FIGGKVGSFVDR+GNHIEMG
Sbjct  96   DLYESRPFIGGKVGSFVDRQGNHIEMG  122



>gb|ABX45112.1| zeta-carotene desaturase [Narcissus tazetta var. chinensis]
Length=574

 Score =   161 bits (408),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 76/85 (89%), Positives = 81/85 (95%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  IRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  470
            IRS LD+ VSDMS NAPKGLFPPEPE+YRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI
Sbjct  33   IRSALDTKVSDMSVNAPKGLFPPEPEYYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  92

Query  471  YDSKSFIGGKVGSFVDRRGNHIEMG  545
            Y+S+ FIGGKVGSFVD+RGNHIEMG
Sbjct  93   YESRQFIGGKVGSFVDKRGNHIEMG  117



>gb|AJB84621.1| zeta-carotene desaturase [Camellia sinensis]
Length=582

 Score =   161 bits (407),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 76/85 (89%), Positives = 80/85 (94%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  IRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  470
            +R  LDS VSDMS NAPKGLFP EPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI
Sbjct  45   VRCSLDSNVSDMSVNAPKGLFPSEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  104

Query  471  YDSKSFIGGKVGSFVDRRGNHIEMG  545
            Y+S+SFIGGKVGSFVD+RGNHIEMG
Sbjct  105  YESRSFIGGKVGSFVDKRGNHIEMG  129



>ref|NP_001059145.1| Os07g0204900 [Oryza sativa Japonica Group]
 dbj|BAF21059.1| Os07g0204900 [Oryza sativa Japonica Group]
Length=578

 Score =   160 bits (406),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 74/85 (87%), Positives = 80/85 (94%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  IRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  470
            +R  LDS VSDM+ NAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVD+
Sbjct  41   VRCSLDSNVSDMAVNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDL  100

Query  471  YDSKSFIGGKVGSFVDRRGNHIEMG  545
            Y+S+ FIGGKVGSFVDR+GNHIEMG
Sbjct  101  YESRPFIGGKVGSFVDRKGNHIEMG  125



>dbj|BAC79799.1| putative zeta-carotene desaturase precursor [Oryza sativa Japonica 
Group]
 gb|EEC81707.1| hypothetical protein OsI_25316 [Oryza sativa Indica Group]
 gb|EEE66770.1| hypothetical protein OsJ_23495 [Oryza sativa Japonica Group]
Length=576

 Score =   160 bits (406),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 74/85 (87%), Positives = 80/85 (94%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  IRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  470
            +R  LDS VSDM+ NAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVD+
Sbjct  39   VRCSLDSNVSDMAVNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDL  98

Query  471  YDSKSFIGGKVGSFVDRRGNHIEMG  545
            Y+S+ FIGGKVGSFVDR+GNHIEMG
Sbjct  99   YESRPFIGGKVGSFVDRKGNHIEMG  123



>ref|XP_007204989.1| hypothetical protein PRUPE_ppa003478mg [Prunus persica]
 gb|EMJ06188.1| hypothetical protein PRUPE_ppa003478mg [Prunus persica]
Length=571

 Score =   160 bits (405),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 75/86 (87%), Positives = 80/86 (93%), Gaps = 0/86 (0%)
 Frame = +3

Query  288  VIRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVD  467
             +RS LD+ VSDMS NAPKGLFP EPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVD
Sbjct  30   CVRSSLDTNVSDMSVNAPKGLFPAEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVD  89

Query  468  IYDSKSFIGGKVGSFVDRRGNHIEMG  545
            IY+S+ FIGGKVGSFVD+RGNHIEMG
Sbjct  90   IYESRPFIGGKVGSFVDKRGNHIEMG  115



>gb|KJB45010.1| hypothetical protein B456_007G284900 [Gossypium raimondii]
Length=566

 Score =   160 bits (405),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 74/85 (87%), Positives = 81/85 (95%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  IRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  470
            ++S LD+ VSDMS NAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI
Sbjct  26   VKSSLDTNVSDMSVNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  85

Query  471  YDSKSFIGGKVGSFVDRRGNHIEMG  545
            ++S+ FIGGKVGSFVDR+GNHIEMG
Sbjct  86   FESRPFIGGKVGSFVDRKGNHIEMG  110



>gb|KHG15309.1| Zeta-carotene desaturase, chloroplastic/chromoplastic [Gossypium 
arboreum]
Length=564

 Score =   160 bits (405),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 74/85 (87%), Positives = 81/85 (95%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  IRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  470
            ++S LD+ VSDMS NAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI
Sbjct  26   VKSSLDTNVSDMSVNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  85

Query  471  YDSKSFIGGKVGSFVDRRGNHIEMG  545
            ++S+ FIGGKVGSFVDR+GNHIEMG
Sbjct  86   FESRPFIGGKVGSFVDRKGNHIEMG  110



>gb|KHN16183.1| Zeta-carotene desaturase, chloroplastic/chromoplastic [Glycine 
soja]
Length=570

 Score =   160 bits (405),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 76/88 (86%), Positives = 81/88 (92%), Gaps = 0/88 (0%)
 Frame = +3

Query  282  KSVIRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE  461
            KS +R  LD+ VSDMS NAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE
Sbjct  28   KSRLRCSLDANVSDMSVNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE  87

Query  462  VDIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            VDIY+S+ FIGGKVGSFVD+ GNHIEMG
Sbjct  88   VDIYESRPFIGGKVGSFVDKGGNHIEMG  115



>ref|XP_003536112.1| PREDICTED: zeta-carotene desaturase, chloroplastic/chromoplastic-like 
[Glycine max]
Length=570

 Score =   160 bits (405),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 76/88 (86%), Positives = 81/88 (92%), Gaps = 0/88 (0%)
 Frame = +3

Query  282  KSVIRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE  461
            KS +R  LD+ VSDMS NAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE
Sbjct  28   KSRLRCSLDANVSDMSVNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE  87

Query  462  VDIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            VDIY+S+ FIGGKVGSFVD+ GNHIEMG
Sbjct  88   VDIYESRPFIGGKVGSFVDKGGNHIEMG  115



>gb|ABG72806.2| zeta-carotene desaturase protein [Carica papaya]
Length=552

 Score =   160 bits (404),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 75/91 (82%), Positives = 82/91 (90%), Gaps = 3/91 (3%)
 Frame = +3

Query  282  KSVIRSDLDSM---VSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQ  452
            +  +RS LDS+   VSDMS NAPKGLFPPEPEHYRGPKL+VAI+GAGLAGMSTAVELLDQ
Sbjct  26   RVCVRSSLDSLETNVSDMSVNAPKGLFPPEPEHYRGPKLEVAIVGAGLAGMSTAVELLDQ  85

Query  453  GHEVDIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            GHEVDIYD +SFIGGKVGSF D+RGNHIEMG
Sbjct  86   GHEVDIYDCRSFIGGKVGSFADKRGNHIEMG  116



>gb|ABB52083.1| zeta carotene desaturase [Daucus carota subsp. sativus]
Length=573

 Score =   160 bits (404),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 74/86 (86%), Positives = 81/86 (94%), Gaps = 0/86 (0%)
 Frame = +3

Query  288  VIRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVD  467
            ++RSDLD  VSDMS+NAPKGLFPPEP+ YRGPKLKVAIIGAGLAGMSTAVELLDQGHEVD
Sbjct  37   LVRSDLDQNVSDMSSNAPKGLFPPEPQLYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVD  96

Query  468  IYDSKSFIGGKVGSFVDRRGNHIEMG  545
            IY+S+ FIGGKVGSF D+RGNHIEMG
Sbjct  97   IYESRPFIGGKVGSFTDKRGNHIEMG  122



>ref|XP_011078737.1| PREDICTED: zeta-carotene desaturase, chloroplastic/chromoplastic 
[Sesamum indicum]
Length=582

 Score =   160 bits (404),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 74/85 (87%), Positives = 82/85 (96%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  IRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  470
            IRSDL+S VSDM  NAPKGLFPPEPEHY+GPKLKVAIIGAGLAGMSTAVELLDQGHEVDI
Sbjct  49   IRSDLESNVSDMRVNAPKGLFPPEPEHYKGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  108

Query  471  YDSKSFIGGKVGSFVDRRGNHIEMG  545
            Y+S+SF+GGKVGS+VD++GNHIEMG
Sbjct  109  YESRSFVGGKVGSYVDKQGNHIEMG  133



>ref|XP_003556484.1| PREDICTED: zeta-carotene desaturase, chloroplastic/chromoplastic-like 
[Glycine max]
 gb|KHN14723.1| Zeta-carotene desaturase, chloroplastic/chromoplastic [Glycine 
soja]
Length=570

 Score =   159 bits (403),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 76/88 (86%), Positives = 81/88 (92%), Gaps = 0/88 (0%)
 Frame = +3

Query  282  KSVIRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE  461
            KS +R  LD+ VSDMS NAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE
Sbjct  28   KSRLRCSLDANVSDMSVNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE  87

Query  462  VDIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            VDIY+S+ FIGGKVGSFVD+ GNHIEMG
Sbjct  88   VDIYESRPFIGGKVGSFVDKGGNHIEMG  115



>ref|XP_004142522.1| PREDICTED: zeta-carotene desaturase, chloroplastic/chromoplastic-like 
[Cucumis sativus]
 gb|KGN66802.1| hypothetical protein Csa_1G695370 [Cucumis sativus]
Length=576

 Score =   159 bits (403),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 75/88 (85%), Positives = 82/88 (93%), Gaps = 0/88 (0%)
 Frame = +3

Query  282  KSVIRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE  461
            K +++S LD  VSDMS NAPKGLFPPEPE YRGPKLKVAIIGAGLAGMSTAVELLDQGHE
Sbjct  37   KFLVKSSLDKDVSDMSVNAPKGLFPPEPERYRGPKLKVAIIGAGLAGMSTAVELLDQGHE  96

Query  462  VDIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            VDIY+S++FIGGKVGSFVD+RGNHIEMG
Sbjct  97   VDIYESRTFIGGKVGSFVDKRGNHIEMG  124



>ref|XP_008462722.1| PREDICTED: zeta-carotene desaturase, chloroplastic/chromoplastic 
[Cucumis melo]
 gb|AID51465.1| zeta-carotene desaturase [Cucumis melo var. makuwa]
Length=576

 Score =   159 bits (403),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 75/88 (85%), Positives = 82/88 (93%), Gaps = 0/88 (0%)
 Frame = +3

Query  282  KSVIRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE  461
            K +++S LD  VSDMS NAPKGLFPPEPE YRGPKLKVAIIGAGLAGMSTAVELLDQGHE
Sbjct  37   KFLVKSSLDKDVSDMSVNAPKGLFPPEPERYRGPKLKVAIIGAGLAGMSTAVELLDQGHE  96

Query  462  VDIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            VDIY+S++FIGGKVGSFVD+RGNHIEMG
Sbjct  97   VDIYESRTFIGGKVGSFVDKRGNHIEMG  124



>ref|XP_004155720.1| PREDICTED: LOW QUALITY PROTEIN: zeta-carotene desaturase, chloroplastic/chromoplastic-like 
[Cucumis sativus]
Length=612

 Score =   160 bits (404),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 75/88 (85%), Positives = 82/88 (93%), Gaps = 0/88 (0%)
 Frame = +3

Query  282  KSVIRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE  461
            K +++S LD  VSDMS NAPKGLFPPEPE YRGPKLKVAIIGAGLAGMSTAVELLDQGHE
Sbjct  73   KFLVKSSLDKDVSDMSVNAPKGLFPPEPERYRGPKLKVAIIGAGLAGMSTAVELLDQGHE  132

Query  462  VDIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            VDIY+S++FIGGKVGSFVD+RGNHIEMG
Sbjct  133  VDIYESRTFIGGKVGSFVDKRGNHIEMG  160



>ref|XP_010934915.1| PREDICTED: zeta-carotene desaturase, chloroplastic/chromoplastic 
isoform X1 [Elaeis guineensis]
Length=602

 Score =   159 bits (403),  Expect = 2e-42, Method: Composition-based stats.
 Identities = 71/85 (84%), Positives = 80/85 (94%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  IRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  470
            +R+ LD+ VSDM   APKGLFPPEPEHYRGPKLK+AIIGAGLAGMSTAVELLDQGHEV+I
Sbjct  48   VRASLDAKVSDMGVKAPKGLFPPEPEHYRGPKLKIAIIGAGLAGMSTAVELLDQGHEVEI  107

Query  471  YDSKSFIGGKVGSFVDRRGNHIEMG  545
            Y+S++FIGGKVGSFVD+RGNHIEMG
Sbjct  108  YESRTFIGGKVGSFVDKRGNHIEMG  132



>tpg|DAA59952.1| TPA: zeta-carotene desaturase, /chromoplastic Precursor [Zea 
mays]
Length=572

 Score =   159 bits (402),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 74/87 (85%), Positives = 79/87 (91%), Gaps = 0/87 (0%)
 Frame = +3

Query  285  SVIRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEV  464
            S +R  LD  VSDM  NAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEV
Sbjct  33   SAVRCSLDRNVSDMGVNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEV  92

Query  465  DIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            D+Y+S+ FIGGKVGSFVDR+GNHIEMG
Sbjct  93   DLYESRPFIGGKVGSFVDRQGNHIEMG  119



>ref|XP_004302025.1| PREDICTED: zeta-carotene desaturase, chloroplastic/chromoplastic 
[Fragaria vesca subsp. vesca]
Length=569

 Score =   159 bits (401),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 74/81 (91%), Positives = 78/81 (96%), Gaps = 0/81 (0%)
 Frame = +3

Query  303  LDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDIYDSK  482
            LD+ VSDMS NAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDIY+S+
Sbjct  35   LDTNVSDMSVNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDIYESR  94

Query  483  SFIGGKVGSFVDRRGNHIEMG  545
             FIGGKVGSFVD+RGNHIEMG
Sbjct  95   PFIGGKVGSFVDKRGNHIEMG  115



>ref|XP_010550937.1| PREDICTED: zeta-carotene desaturase, chloroplastic/chromoplastic 
[Tarenaya hassleriana]
Length=569

 Score =   158 bits (400),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 75/88 (85%), Positives = 81/88 (92%), Gaps = 0/88 (0%)
 Frame = +3

Query  282  KSVIRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE  461
            +  +RS LD+ VSDMS NAPKGLFPPEPE Y+GPKLKVAIIGAGLAGMSTAVELLDQGHE
Sbjct  25   RFCLRSSLDTDVSDMSVNAPKGLFPPEPEPYKGPKLKVAIIGAGLAGMSTAVELLDQGHE  84

Query  462  VDIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            VDIY+S+ FIGGKVGSFVDRRGNHIEMG
Sbjct  85   VDIYESRPFIGGKVGSFVDRRGNHIEMG  112



>emb|CDY41905.1| BnaC05g46990D [Brassica napus]
Length=561

 Score =   158 bits (400),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 75/85 (88%), Positives = 80/85 (94%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  IRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  470
            +RS LD+ VSDMS NAPKGLFPPEP  Y+GPKLKVAIIGAGLAGMSTAVELLDQGHEVDI
Sbjct  30   VRSSLDADVSDMSVNAPKGLFPPEPVPYKGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  89

Query  471  YDSKSFIGGKVGSFVDRRGNHIEMG  545
            YDS++FIGGKVGSFVDRRGNHIEMG
Sbjct  90   YDSRTFIGGKVGSFVDRRGNHIEMG  114



>gb|AEK86566.1| chloroplast zeta-carotene desaturase [Cucurbita moschata]
Length=573

 Score =   158 bits (399),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 74/88 (84%), Positives = 82/88 (93%), Gaps = 0/88 (0%)
 Frame = +3

Query  282  KSVIRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE  461
            + ++RS LD+ VSDMS NAPK LFPPEPE YRGPKLKVAIIGAGLAGMSTAVELLDQGHE
Sbjct  34   RFLVRSSLDTDVSDMSVNAPKELFPPEPERYRGPKLKVAIIGAGLAGMSTAVELLDQGHE  93

Query  462  VDIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            VDIY+S++FIGGKVGSFVD+RGNHIEMG
Sbjct  94   VDIYESRTFIGGKVGSFVDKRGNHIEMG  121



>ref|XP_011005691.1| PREDICTED: zeta-carotene desaturase, chloroplastic/chromoplastic-like 
[Populus euphratica]
 ref|XP_011005692.1| PREDICTED: zeta-carotene desaturase, chloroplastic/chromoplastic-like 
[Populus euphratica]
Length=592

 Score =   158 bits (400),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 77/88 (88%), Positives = 82/88 (93%), Gaps = 3/88 (3%)
 Frame = +3

Query  291  IRSDLDSM---VSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE  461
            +R+ LDS+   VSDMS NAPKGLFPPEPEH+RGPKLKVAIIGAGLAGMSTAVELLDQGHE
Sbjct  49   VRAALDSLETNVSDMSVNAPKGLFPPEPEHHRGPKLKVAIIGAGLAGMSTAVELLDQGHE  108

Query  462  VDIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            VDIYDS+SFIGGKVGSFVDR GNHIEMG
Sbjct  109  VDIYDSRSFIGGKVGSFVDRCGNHIEMG  136



>gb|AAX56323.1| zeta-carotene desaturase [Sorghum bicolor]
Length=574

 Score =   157 bits (398),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 73/85 (86%), Positives = 79/85 (93%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  IRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  470
            +R  LDS VSDM  NAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVD+
Sbjct  37   VRCSLDSNVSDMGVNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDL  96

Query  471  YDSKSFIGGKVGSFVDRRGNHIEMG  545
            Y+S+ FIGGKVGSFVD++GNHIEMG
Sbjct  97   YESRPFIGGKVGSFVDKQGNHIEMG  121



>ref|XP_002459524.1| hypothetical protein SORBIDRAFT_02g006100 [Sorghum bicolor]
 gb|EER96045.1| hypothetical protein SORBIDRAFT_02g006100 [Sorghum bicolor]
Length=577

 Score =   157 bits (398),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 73/85 (86%), Positives = 79/85 (93%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  IRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  470
            +R  LDS VSDM  NAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVD+
Sbjct  40   VRCSLDSNVSDMGVNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDL  99

Query  471  YDSKSFIGGKVGSFVDRRGNHIEMG  545
            Y+S+ FIGGKVGSFVD++GNHIEMG
Sbjct  100  YESRPFIGGKVGSFVDKQGNHIEMG  124



>gb|ACM68701.1| zeta-carotene desaturase [Brassica rapa subsp. pekinensis]
Length=561

 Score =   157 bits (397),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 74/85 (87%), Positives = 79/85 (93%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  IRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  470
            +R  LD+ VSDMS NAPKGLFPPEP  Y+GPKLKVAIIGAGLAGMSTAVELLDQGHEVDI
Sbjct  30   VRCSLDADVSDMSVNAPKGLFPPEPVPYKGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  89

Query  471  YDSKSFIGGKVGSFVDRRGNHIEMG  545
            YDS++FIGGKVGSFVDRRGNHIEMG
Sbjct  90   YDSRTFIGGKVGSFVDRRGNHIEMG  114



>ref|XP_009124205.1| PREDICTED: zeta-carotene desaturase, chloroplastic/chromoplastic 
[Brassica rapa]
Length=561

 Score =   157 bits (397),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 74/85 (87%), Positives = 79/85 (93%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  IRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  470
            +R  LD+ VSDMS NAPKGLFPPEP  Y+GPKLKVAIIGAGLAGMSTAVELLDQGHEVDI
Sbjct  30   VRCSLDADVSDMSVNAPKGLFPPEPVPYKGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  89

Query  471  YDSKSFIGGKVGSFVDRRGNHIEMG  545
            YDS++FIGGKVGSFVDRRGNHIEMG
Sbjct  90   YDSRTFIGGKVGSFVDRRGNHIEMG  114



>ref|XP_002882378.1| zeta-carotene desaturase precursor [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58637.1| zeta-carotene desaturase precursor [Arabidopsis lyrata subsp. 
lyrata]
Length=561

 Score =   157 bits (396),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 75/85 (88%), Positives = 79/85 (93%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  IRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  470
            + S LDS VSDMS NAPKGLFPPEP  Y+GPKLKVAIIGAGLAGMSTAVELLDQGHEVDI
Sbjct  28   VNSSLDSDVSDMSVNAPKGLFPPEPVPYKGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  87

Query  471  YDSKSFIGGKVGSFVDRRGNHIEMG  545
            YDS++FIGGKVGSFVDRRGNHIEMG
Sbjct  88   YDSRTFIGGKVGSFVDRRGNHIEMG  112



>gb|AAF85796.1|AF121947_1 zeta-carotene desaturase precursor [Arabidopsis thaliana]
Length=558

 Score =   157 bits (396),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 75/85 (88%), Positives = 79/85 (93%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  IRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  470
            + S LDS VSDMS NAPKGLFPPEP  Y+GPKLKVAIIGAGLAGMSTAVELLDQGHEVDI
Sbjct  25   VNSSLDSDVSDMSVNAPKGLFPPEPVPYKGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  84

Query  471  YDSKSFIGGKVGSFVDRRGNHIEMG  545
            YDS++FIGGKVGSFVDRRGNHIEMG
Sbjct  85   YDSRTFIGGKVGSFVDRRGNHIEMG  109



>gb|AEN94305.1| zeta-carotene desaturase [Brassica napus]
 gb|AEN94306.1| zeta-carotene desaturase [Brassica napus]
 emb|CDY50762.1| BnaAnng10690D [Brassica napus]
Length=561

 Score =   157 bits (396),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 74/85 (87%), Positives = 79/85 (93%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  IRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  470
            +R  LD+ VSDMS NAPKGLFPPEP  Y+GPKLKVAIIGAGLAGMSTAVELLDQGHEVDI
Sbjct  30   VRCSLDADVSDMSVNAPKGLFPPEPVPYKGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  89

Query  471  YDSKSFIGGKVGSFVDRRGNHIEMG  545
            YDS++FIGGKVGSFVDRRGNHIEMG
Sbjct  90   YDSRTFIGGKVGSFVDRRGNHIEMG  114



>ref|NP_187138.1| zeta-carotene desaturase [Arabidopsis thaliana]
 ref|NP_974222.1| zeta-carotene desaturase [Arabidopsis thaliana]
 sp|Q38893.3|ZDS_ARATH RecName: Full=Zeta-carotene desaturase, chloroplastic/chromoplastic; 
AltName: Full=9,9'-di-cis-zeta-carotene desaturase; 
AltName: Full=Carotene 7,8-desaturase; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAG51402.1|AC009465_2 putative zeta-carotene desaturase precursor; 62103-58756 [Arabidopsis 
thaliana]
 gb|AAL24402.1| putative zeta-carotene desaturase precursor [Arabidopsis thaliana]
 gb|AAL59918.1| putative zeta-carotene desaturase precursor [Arabidopsis thaliana]
 gb|AAM20233.1| putative zeta-carotene desaturase precursor [Arabidopsis thaliana]
 gb|AEE74148.1| zeta-carotene desaturase [Arabidopsis thaliana]
 gb|AEE74149.1| zeta-carotene desaturase [Arabidopsis thaliana]
Length=558

 Score =   157 bits (396),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 75/85 (88%), Positives = 79/85 (93%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  IRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  470
            + S LDS VSDMS NAPKGLFPPEP  Y+GPKLKVAIIGAGLAGMSTAVELLDQGHEVDI
Sbjct  25   VNSSLDSDVSDMSVNAPKGLFPPEPVPYKGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  84

Query  471  YDSKSFIGGKVGSFVDRRGNHIEMG  545
            YDS++FIGGKVGSFVDRRGNHIEMG
Sbjct  85   YDSRTFIGGKVGSFVDRRGNHIEMG  109



>gb|AAM63349.1| putative zeta-carotene desaturase precursor [Arabidopsis thaliana]
Length=558

 Score =   157 bits (396),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 75/85 (88%), Positives = 79/85 (93%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  IRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  470
            + S LDS VSDMS NAPKGLFPPEP  Y+GPKLKVAIIGAGLAGMSTAVELLDQGHEVDI
Sbjct  25   VNSSLDSDVSDMSVNAPKGLFPPEPVPYKGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  84

Query  471  YDSKSFIGGKVGSFVDRRGNHIEMG  545
            YDS++FIGGKVGSFVDRRGNHIEMG
Sbjct  85   YDSRTFIGGKVGSFVDRRGNHIEMG  109



>gb|EYU22642.1| hypothetical protein MIMGU_mgv1a003845mg [Erythranthe guttata]
Length=560

 Score =   157 bits (396),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 73/85 (86%), Positives = 82/85 (96%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  IRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  470
            +RSDL++ VSDMS NAPKGLFPPEP+HY+GPKLKVAIIGAGLAGMSTAVELLDQGHEVDI
Sbjct  32   VRSDLETNVSDMSVNAPKGLFPPEPKHYKGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  91

Query  471  YDSKSFIGGKVGSFVDRRGNHIEMG  545
            Y+S+SFIGGKVGS VD++GNHIEMG
Sbjct  92   YESRSFIGGKVGSTVDKQGNHIEMG  116



>ref|XP_008388655.1| PREDICTED: zeta-carotene desaturase, chloroplastic/chromoplastic 
[Malus domestica]
Length=571

 Score =   157 bits (396),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 73/85 (86%), Positives = 79/85 (93%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  IRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  470
            +RS LD+ VSDM  NAPKGLFPPEPE YRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI
Sbjct  31   VRSSLDTNVSDMGVNAPKGLFPPEPERYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  90

Query  471  YDSKSFIGGKVGSFVDRRGNHIEMG  545
            Y+S+ FIGGKVGSFVD++GNHIEMG
Sbjct  91   YESRPFIGGKVGSFVDKKGNHIEMG  115



>ref|NP_001280951.1| zeta-carotene desaturase, chloroplastic/chromoplastic-like [Malus 
domestica]
 gb|AAQ04225.1| zeta-carotene desaturase ZDS2 [Malus domestica]
Length=571

 Score =   157 bits (396),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 73/85 (86%), Positives = 79/85 (93%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  IRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  470
            +RS LD+ VSDM  NAPKGLFPPEPE YRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI
Sbjct  31   VRSSLDTNVSDMRVNAPKGLFPPEPEFYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  90

Query  471  YDSKSFIGGKVGSFVDRRGNHIEMG  545
            Y+S+ FIGGKVGSFVD++GNHIEMG
Sbjct  91   YESRPFIGGKVGSFVDKKGNHIEMG  115



>ref|XP_010463975.1| PREDICTED: zeta-carotene desaturase, chloroplastic/chromoplastic 
[Camelina sativa]
Length=562

 Score =   156 bits (395),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 74/85 (87%), Positives = 79/85 (93%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  IRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  470
            + S LD+ VSDMS NAPKGLFPPEP  Y+GPKLKVAIIGAGLAGMSTAVELLDQGHEVDI
Sbjct  29   VCSSLDADVSDMSVNAPKGLFPPEPVQYKGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  88

Query  471  YDSKSFIGGKVGSFVDRRGNHIEMG  545
            YDS++FIGGKVGSFVDRRGNHIEMG
Sbjct  89   YDSRTFIGGKVGSFVDRRGNHIEMG  113



>ref|XP_010419722.1| PREDICTED: zeta-carotene desaturase, chloroplastic/chromoplastic-like 
[Camelina sativa]
 ref|XP_010419792.1| PREDICTED: zeta-carotene desaturase, chloroplastic/chromoplastic-like 
[Camelina sativa]
Length=562

 Score =   156 bits (395),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 74/85 (87%), Positives = 79/85 (93%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  IRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  470
            + S LD+ VSDMS NAPKGLFPPEP  Y+GPKLKVAIIGAGLAGMSTAVELLDQGHEVDI
Sbjct  29   VCSSLDADVSDMSVNAPKGLFPPEPVQYKGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  88

Query  471  YDSKSFIGGKVGSFVDRRGNHIEMG  545
            YDS++FIGGKVGSFVDRRGNHIEMG
Sbjct  89   YDSRTFIGGKVGSFVDRRGNHIEMG  113



>ref|XP_009364531.1| PREDICTED: zeta-carotene desaturase, chloroplastic/chromoplastic 
isoform X1 [Pyrus x bretschneideri]
 ref|XP_009364532.1| PREDICTED: zeta-carotene desaturase, chloroplastic/chromoplastic 
isoform X1 [Pyrus x bretschneideri]
Length=571

 Score =   156 bits (395),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 73/85 (86%), Positives = 79/85 (93%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  IRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  470
            +RS LD+ VSDM  NAPKGLFPPEPE YRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI
Sbjct  31   VRSSLDTNVSDMGVNAPKGLFPPEPERYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  90

Query  471  YDSKSFIGGKVGSFVDRRGNHIEMG  545
            Y+S+ FIGGKVGSFVD++GNHIEMG
Sbjct  91   YESRPFIGGKVGSFVDKKGNHIEMG  115



>ref|XP_010485876.1| PREDICTED: zeta-carotene desaturase, chloroplastic/chromoplastic-like 
[Camelina sativa]
Length=562

 Score =   156 bits (395),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 74/85 (87%), Positives = 79/85 (93%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  IRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  470
            + S LD+ VSDMS NAPKGLFPPEP  Y+GPKLKVAIIGAGLAGMSTAVELLDQGHEVDI
Sbjct  29   VCSSLDADVSDMSVNAPKGLFPPEPVQYKGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  88

Query  471  YDSKSFIGGKVGSFVDRRGNHIEMG  545
            YDS++FIGGKVGSFVDRRGNHIEMG
Sbjct  89   YDSRTFIGGKVGSFVDRRGNHIEMG  113



>ref|XP_010934924.1| PREDICTED: zeta-carotene desaturase, chloroplastic/chromoplastic 
isoform X2 [Elaeis guineensis]
Length=588

 Score =   157 bits (396),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 71/86 (83%), Positives = 80/86 (93%), Gaps = 0/86 (0%)
 Frame = +3

Query  288  VIRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVD  467
             +R+ LD+ VSDM   APKGLFPPEPEHYRGPKLK+AIIGAGLAGMSTAVELLDQGHEV+
Sbjct  47   TVRASLDAKVSDMGVKAPKGLFPPEPEHYRGPKLKIAIIGAGLAGMSTAVELLDQGHEVE  106

Query  468  IYDSKSFIGGKVGSFVDRRGNHIEMG  545
            IY+S++FIGGKVGSFVD+RGNHIEMG
Sbjct  107  IYESRTFIGGKVGSFVDKRGNHIEMG  132



>gb|ACG46735.1| zeta-carotene desaturase [Zea mays]
Length=572

 Score =   156 bits (395),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 73/87 (84%), Positives = 78/87 (90%), Gaps = 0/87 (0%)
 Frame = +3

Query  285  SVIRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEV  464
            S +R  LD  VSDM  NAPKGLFPPEPEHYRGPKLK+AIIGAGLAGMSTAVELLDQGHEV
Sbjct  33   SAVRCSLDRNVSDMGVNAPKGLFPPEPEHYRGPKLKLAIIGAGLAGMSTAVELLDQGHEV  92

Query  465  DIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            D+Y+S  FIGGKVGSFVDR+GNHIEMG
Sbjct  93   DLYESCPFIGGKVGSFVDRQGNHIEMG  119



>ref|XP_009396830.1| PREDICTED: zeta-carotene desaturase, chloroplastic/chromoplastic 
[Musa acuminata subsp. malaccensis]
 ref|XP_009396831.1| PREDICTED: zeta-carotene desaturase, chloroplastic/chromoplastic 
[Musa acuminata subsp. malaccensis]
Length=576

 Score =   156 bits (394),  Expect = 3e-41, Method: Composition-based stats.
 Identities = 71/87 (82%), Positives = 78/87 (90%), Gaps = 0/87 (0%)
 Frame = +3

Query  285  SVIRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEV  464
            + +R  LDS VSDM  NAPKGLFPPEPEHY GPKLKVAI+G GLAGMSTAVELLDQGHEV
Sbjct  34   AAVRCSLDSQVSDMRINAPKGLFPPEPEHYTGPKLKVAIVGGGLAGMSTAVELLDQGHEV  93

Query  465  DIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            DIY+S+ FIGGKVGSFVD++GNHIEMG
Sbjct  94   DIYESRPFIGGKVGSFVDKQGNHIEMG  120



>ref|XP_010674842.1| PREDICTED: zeta-carotene desaturase, chloroplastic/chromoplastic 
[Beta vulgaris subsp. vulgaris]
Length=569

 Score =   155 bits (393),  Expect = 4e-41, Method: Composition-based stats.
 Identities = 71/85 (84%), Positives = 79/85 (93%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  IRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  470
            +R  LD+ VSDMSTNAPKGLFPPEP  Y+GPKLK+AIIGAGLAGMSTAVELLDQGHEVDI
Sbjct  31   VRCSLDTDVSDMSTNAPKGLFPPEPALYKGPKLKIAIIGAGLAGMSTAVELLDQGHEVDI  90

Query  471  YDSKSFIGGKVGSFVDRRGNHIEMG  545
            Y+S+ F+GGKVGSFVD+RGNHIEMG
Sbjct  91   YESRPFVGGKVGSFVDKRGNHIEMG  115



>ref|XP_006858905.1| hypothetical protein AMTR_s00068p00029180 [Amborella trichopoda]
 gb|ERN20372.1| hypothetical protein AMTR_s00068p00029180 [Amborella trichopoda]
Length=573

 Score =   155 bits (392),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 72/84 (86%), Positives = 76/84 (90%), Gaps = 0/84 (0%)
 Frame = +3

Query  294  RSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDIY  473
            R  L+  VSDM  NAPKGLFPPEPEHYRGPKLKVA+IGAGLAGMSTAVELLDQGHEVDIY
Sbjct  40   RCSLEEKVSDMRVNAPKGLFPPEPEHYRGPKLKVAVIGAGLAGMSTAVELLDQGHEVDIY  99

Query  474  DSKSFIGGKVGSFVDRRGNHIEMG  545
            +S+ FIGGKVGSF DRRGNHIEMG
Sbjct  100  ESRQFIGGKVGSFQDRRGNHIEMG  123



>ref|XP_006297343.1| hypothetical protein CARUB_v10013363mg [Capsella rubella]
 gb|EOA30241.1| hypothetical protein CARUB_v10013363mg [Capsella rubella]
Length=561

 Score =   155 bits (392),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 74/85 (87%), Positives = 79/85 (93%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  IRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  470
            + S LD+ VSDMS NAPKGLFPPEP  Y+GPKLKVAIIGAGLAGMSTAVELLDQGHEVDI
Sbjct  28   VCSSLDTDVSDMSVNAPKGLFPPEPVPYKGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  87

Query  471  YDSKSFIGGKVGSFVDRRGNHIEMG  545
            YDS++FIGGKVGSFVDRRGNHIEMG
Sbjct  88   YDSRTFIGGKVGSFVDRRGNHIEMG  112



>gb|AAA91161.1| zeta-carotene desaturase precursor [Arabidopsis thaliana]
Length=558

 Score =   155 bits (391),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 74/85 (87%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  IRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  470
            + S LDS VSDMS NAPKGLFPPEP  Y+GPKLKVAIIGAGLAGMSTAVELLDQGHEVDI
Sbjct  25   VNSSLDSDVSDMSVNAPKGLFPPEPVPYKGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  84

Query  471  YDSKSFIGGKVGSFVDRRGNHIEMG  545
            YDS++FIG KVGSFVDRRGNHIEMG
Sbjct  85   YDSRTFIGAKVGSFVDRRGNHIEMG  109



>gb|ABR18432.1| unknown [Picea sitchensis]
Length=591

 Score =   150 bits (378),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 69/85 (81%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  IRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  470
            +  +L + VSDMS+ APKGLFPPEPE Y GPKLKVAIIG+GLAG+STAVELLDQGHEVDI
Sbjct  51   VSCNLKAKVSDMSSKAPKGLFPPEPEKYEGPKLKVAIIGSGLAGLSTAVELLDQGHEVDI  110

Query  471  YDSKSFIGGKVGSFVDRRGNHIEMG  545
            Y+S+SFIGGKVGSFVD+RGNHIEMG
Sbjct  111  YESRSFIGGKVGSFVDKRGNHIEMG  135



>gb|EYU22998.1| hypothetical protein MIMGU_mgv1a003605mg [Erythranthe guttata]
Length=574

 Score =   147 bits (371),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 68/85 (80%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  IRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  470
            +RSDL+S V DM+T+APKG+FPPEPE Y GPKLKVAIIGAGLAGMS A+ELLDQGHEVDI
Sbjct  45   LRSDLESNVCDMTTHAPKGIFPPEPEKYGGPKLKVAIIGAGLAGMSAAIELLDQGHEVDI  104

Query  471  YDSKSFIGGKVGSFVDRRGNHIEMG  545
            YD +S +GGKVGS+VD+RGNHIEMG
Sbjct  105  YDKRSSVGGKVGSYVDKRGNHIEMG  129



>ref|XP_001776850.1| predicted protein [Physcomitrella patens]
 gb|EDQ58400.1| predicted protein [Physcomitrella patens]
Length=593

 Score =   145 bits (367),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/85 (80%), Positives = 76/85 (89%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  IRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  470
            + + L S+VSDMS  APKGLFPPEPE Y+GPKLKVAIIGAGLAGMSTAVELL+QGHEVDI
Sbjct  51   VSASLQSLVSDMSKKAPKGLFPPEPETYKGPKLKVAIIGAGLAGMSTAVELLEQGHEVDI  110

Query  471  YDSKSFIGGKVGSFVDRRGNHIEMG  545
            Y+S+ FIGGKVGSF D+ GNHIEMG
Sbjct  111  YESRKFIGGKVGSFKDKNGNHIEMG  135



>ref|XP_008370678.1| PREDICTED: zeta-carotene desaturase, chloroplastic/chromoplastic-like 
isoform X2 [Malus domestica]
Length=568

 Score =   145 bits (365),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 70/85 (82%), Positives = 76/85 (89%), Gaps = 3/85 (4%)
 Frame = +3

Query  291  IRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  470
            +RS LD+ VSDM  N   GLFPPEPE YRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI
Sbjct  31   VRSSLDTNVSDMRVN---GLFPPEPEFYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  87

Query  471  YDSKSFIGGKVGSFVDRRGNHIEMG  545
            Y+S+ FIGGKVGSFVD++GNHIEMG
Sbjct  88   YESRPFIGGKVGSFVDKKGNHIEMG  112



>gb|AAQ04224.1| zeta-carotene desaturase ZDS1 [Malus domestica]
Length=568

 Score =   145 bits (365),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 70/85 (82%), Positives = 76/85 (89%), Gaps = 3/85 (4%)
 Frame = +3

Query  291  IRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  470
            +RS LD+ VSDM  N   GLFPPEPE YRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI
Sbjct  31   VRSSLDTNVSDMRVN---GLFPPEPEFYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  87

Query  471  YDSKSFIGGKVGSFVDRRGNHIEMG  545
            Y+S+ FIGGKVGSFVD++GNHIEMG
Sbjct  88   YESRPFIGGKVGSFVDKKGNHIEMG  112



>ref|XP_002978356.1| hypothetical protein SELMODRAFT_108745 [Selaginella moellendorffii]
 gb|EFJ20342.1| hypothetical protein SELMODRAFT_108745 [Selaginella moellendorffii]
Length=564

 Score =   145 bits (365),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 67/85 (79%), Positives = 75/85 (88%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  IRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  470
            +   L++MVSDM   APKGLFPPEPE Y GPKLKVAI+GAGLAGMSTAVELLDQGHEVDI
Sbjct  22   VSCSLEAMVSDMGKGAPKGLFPPEPESYTGPKLKVAIVGAGLAGMSTAVELLDQGHEVDI  81

Query  471  YDSKSFIGGKVGSFVDRRGNHIEMG  545
            YD++SFIGGKVGS+ D+ GNHIEMG
Sbjct  82   YDTRSFIGGKVGSYQDKNGNHIEMG  106



>gb|EMT13673.1| Zeta-carotene desaturase, chloroplastic/chromoplastic [Aegilops 
tauschii]
Length=627

 Score =   145 bits (366),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 66/74 (89%), Positives = 72/74 (97%), Gaps = 0/74 (0%)
 Frame = +3

Query  324  MSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKV  503
            +S  APKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVD+YDS++FIGGKV
Sbjct  101  LSATAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDLYDSRTFIGGKV  160

Query  504  GSFVDRRGNHIEMG  545
            GSFVD++GNHIEMG
Sbjct  161  GSFVDKQGNHIEMG  174



>ref|XP_009364533.1| PREDICTED: zeta-carotene desaturase, chloroplastic/chromoplastic 
isoform X2 [Pyrus x bretschneideri]
Length=568

 Score =   145 bits (365),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 70/85 (82%), Positives = 76/85 (89%), Gaps = 3/85 (4%)
 Frame = +3

Query  291  IRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  470
            +RS LD+ VSDM  N   GLFPPEPE YRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI
Sbjct  31   VRSSLDTNVSDMGVN---GLFPPEPERYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  87

Query  471  YDSKSFIGGKVGSFVDRRGNHIEMG  545
            Y+S+ FIGGKVGSFVD++GNHIEMG
Sbjct  88   YESRPFIGGKVGSFVDKKGNHIEMG  112



>ref|XP_002970191.1| hypothetical protein SELMODRAFT_146971 [Selaginella moellendorffii]
 gb|EFJ28321.1| hypothetical protein SELMODRAFT_146971 [Selaginella moellendorffii]
Length=586

 Score =   145 bits (365),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 67/85 (79%), Positives = 75/85 (88%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  IRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  470
            +   L++MVSDM   APKGLFPPEPE Y GPKLKVAI+GAGLAGMSTAVELLDQGHEVDI
Sbjct  44   VSCSLEAMVSDMGKGAPKGLFPPEPESYTGPKLKVAIVGAGLAGMSTAVELLDQGHEVDI  103

Query  471  YDSKSFIGGKVGSFVDRRGNHIEMG  545
            YD++SFIGGKVGS+ D+ GNHIEMG
Sbjct  104  YDTRSFIGGKVGSYQDKNGNHIEMG  128



>gb|KDO38850.1| hypothetical protein CISIN_1g0233862mg, partial [Citrus sinensis]
 gb|KDO38851.1| hypothetical protein CISIN_1g0233862mg, partial [Citrus sinensis]
 gb|KDO38852.1| hypothetical protein CISIN_1g0233862mg, partial [Citrus sinensis]
Length=106

 Score =   135 bits (339),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 64/73 (88%), Positives = 68/73 (93%), Gaps = 0/73 (0%)
 Frame = +3

Query  327  STNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVG  506
            ST  PK LFPPEPEHY GPKLKVAIIGAGLAGMSTAVELLDQGHEVDIY+S+SFIGGKVG
Sbjct  11   STEDPKCLFPPEPEHYGGPKLKVAIIGAGLAGMSTAVELLDQGHEVDIYESRSFIGGKVG  70

Query  507  SFVDRRGNHIEMG  545
            SF+D+ GNHIEMG
Sbjct  71   SFIDKHGNHIEMG  83



>ref|XP_006658387.1| PREDICTED: zeta-carotene desaturase, chloroplastic/chromoplastic-like 
[Oryza brachyantha]
Length=543

 Score =   142 bits (357),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 65/71 (92%), Positives = 70/71 (99%), Gaps = 0/71 (0%)
 Frame = +3

Query  333  NAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSF  512
            +APKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVD+Y+S+ FIGGKVGSF
Sbjct  20   SAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDLYESRPFIGGKVGSF  79

Query  513  VDRRGNHIEMG  545
            VDR+GNHIEMG
Sbjct  80   VDRKGNHIEMG  90



>sp|C3VEQ0.1|ZDS_ONCHC RecName: Full=Zeta-carotene desaturase, chloroplastic/chromoplastic; 
Short=OgZDS; AltName: Full=9,9'-di-cis-zeta-carotene 
desaturase; AltName: Full=Carotene 7,8-desaturase; Flags: Precursor 
[Oncidium hybrid cultivar]
 gb|ACP27625.1| carotene desaturase [Oncidium hybrid cultivar]
Length=563

 Score =   142 bits (357),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 66/83 (80%), Positives = 74/83 (89%), Gaps = 0/83 (0%)
 Frame = +3

Query  297  SDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDIYD  476
            + LD  VSDMS NAPKGLFPPEP+ Y GPKL+VAIIG+GLAGMSTAVELLDQGH+VDIY+
Sbjct  28   ASLDRKVSDMSVNAPKGLFPPEPDIYSGPKLRVAIIGSGLAGMSTAVELLDQGHQVDIYE  87

Query  477  SKSFIGGKVGSFVDRRGNHIEMG  545
            S+ FIGGKV SFVD+ GNHIEMG
Sbjct  88   SRQFIGGKVASFVDKHGNHIEMG  110



>ref|XP_001780369.1| predicted protein [Physcomitrella patens]
 gb|EDQ54823.1| predicted protein [Physcomitrella patens]
Length=528

 Score =   141 bits (356),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 67/78 (86%), Positives = 72/78 (92%), Gaps = 0/78 (0%)
 Frame = +3

Query  312  MVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFI  491
            MVSDMS  APKGLFPPEPE Y+GPKLKVAIIGAGLAGMSTAVELL+QGHEVDIY+S+ FI
Sbjct  1    MVSDMSRKAPKGLFPPEPEAYKGPKLKVAIIGAGLAGMSTAVELLEQGHEVDIYESRKFI  60

Query  492  GGKVGSFVDRRGNHIEMG  545
            GGKVGSF D+ GNHIEMG
Sbjct  61   GGKVGSFKDKDGNHIEMG  78



>ref|XP_001772345.1| predicted protein [Physcomitrella patens]
 gb|EDQ62816.1| predicted protein [Physcomitrella patens]
Length=597

 Score =   141 bits (356),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 66/85 (78%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = +3

Query  291  IRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  470
            + + L SM+SDMS  APKGLFPPEPE Y+GPKLKVAIIGAGLAGMSTAVELL+QGHEVDI
Sbjct  59   VSASLQSMMSDMSRKAPKGLFPPEPEAYKGPKLKVAIIGAGLAGMSTAVELLEQGHEVDI  118

Query  471  YDSKSFIGGKVGSFVDRRGNHIEMG  545
            Y+ + FIGGK GSF D+ GNHIEMG
Sbjct  119  YELRKFIGGKAGSFKDKNGNHIEMG  143



>ref|XP_006408139.1| hypothetical protein EUTSA_v10020402mg [Eutrema salsugineum]
 gb|ESQ49592.1| hypothetical protein EUTSA_v10020402mg [Eutrema salsugineum]
Length=566

 Score =   140 bits (353),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 65/72 (90%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = +3

Query  330  TNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGS  509
             NAPKGLFPPEP  Y+GPKLKVAIIGAGLAGMSTAVELLDQGHEVDIYDS++FIGGKVGS
Sbjct  41   VNAPKGLFPPEPVPYKGPKLKVAIIGAGLAGMSTAVELLDQGHEVDIYDSRTFIGGKVGS  100

Query  510  FVDRRGNHIEMG  545
            FVD+RGNHIEMG
Sbjct  101  FVDKRGNHIEMG  112



>gb|EMS67399.1| Zeta-carotene desaturase, chloroplastic/chromoplastic [Triticum 
urartu]
Length=528

 Score =   139 bits (349),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 63/70 (90%), Positives = 68/70 (97%), Gaps = 0/70 (0%)
 Frame = +3

Query  336  APKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFV  515
            +PKGLFPPEPEHYRGPKLKVAIIGAGLAGMS AVELLDQGHEVD+YDS++FIGGKVGSFV
Sbjct  6    SPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSAAVELLDQGHEVDLYDSRTFIGGKVGSFV  65

Query  516  DRRGNHIEMG  545
            D+ GNHIEMG
Sbjct  66   DKHGNHIEMG  75



>ref|XP_006471842.1| PREDICTED: zeta-carotene desaturase, chloroplastic/chromoplastic-like 
[Citrus sinensis]
Length=204

 Score =   132 bits (332),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 64/84 (76%), Positives = 72/84 (86%), Gaps = 4/84 (5%)
 Frame = +3

Query  291  IRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  470
            +R+ LD+ VSDMS      +FPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI
Sbjct  29   VRASLDTNVSDMSVK----VFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDI  84

Query  471  YDSKSFIGGKVGSFVDRRGNHIEM  542
            Y+ +SFIGGKV SFV + GNHIE+
Sbjct  85   YELRSFIGGKVASFVGKHGNHIEI  108



>gb|EPS57847.1| hypothetical protein M569_16970, partial [Genlisea aurea]
Length=506

 Score =   136 bits (343),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 63/70 (90%), Positives = 68/70 (97%), Gaps = 0/70 (0%)
 Frame = +3

Query  336  APKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFV  515
            APKGLFPPEPE Y GPKLKVAIIGAGLAGMSTAVELLDQGHEVDIY+S+SFIGGKVGSFV
Sbjct  3    APKGLFPPEPESYLGPKLKVAIIGAGLAGMSTAVELLDQGHEVDIYESRSFIGGKVGSFV  62

Query  516  DRRGNHIEMG  545
            D++GNH+EMG
Sbjct  63   DKKGNHVEMG  72



>ref|NP_001105609.1| zeta-carotene desaturase, chloroplastic/chromoplastic [Zea mays]
 sp|Q9ZTP4.1|ZDS_MAIZE RecName: Full=Zeta-carotene desaturase, chloroplastic/chromoplastic; 
AltName: Full=9,9'-di-cis-zeta-carotene desaturase; 
AltName: Full=Carotene 7,8-desaturase; Flags: Precursor [Zea 
mays]
 gb|AAD02462.1| zeta-carotene desaturase precursor [Zea mays]
 gb|AAV91511.1| zeta-carotene desaturase [Zea mays]
Length=570

 Score =   134 bits (336),  Expect = 3e-33, Method: Composition-based stats.
 Identities = 61/66 (92%), Positives = 65/66 (98%), Gaps = 0/66 (0%)
 Frame = +3

Query  348  LFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRG  527
            LFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVD+Y+S+ FIGGKVGSFVDR+G
Sbjct  52   LFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDLYESRPFIGGKVGSFVDRQG  111

Query  528  NHIEMG  545
            NHIEMG
Sbjct  112  NHIEMG  117



>gb|ADN65328.1| zeta-carotene desaturase [Manihot esculenta]
Length=275

 Score =   128 bits (322),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 60/66 (91%), Positives = 64/66 (97%), Gaps = 0/66 (0%)
 Frame = +3

Query  348  LFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRG  527
            LFPPEPE YRGPKLKVAIIG+GLAGMSTAVELLDQGHEVDIY+S++FIGGKVGSFVDR G
Sbjct  1    LFPPEPERYRGPKLKVAIIGSGLAGMSTAVELLDQGHEVDIYESRTFIGGKVGSFVDRGG  60

Query  528  NHIEMG  545
            NHIEMG
Sbjct  61   NHIEMG  66



>gb|KDO37078.1| hypothetical protein CISIN_1g046976mg [Citrus sinensis]
Length=89

 Score =   105 bits (262),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 50/58 (86%), Positives = 53/58 (91%), Gaps = 0/58 (0%)
 Frame = +3

Query  291  IRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEV  464
            +R+ LD+ VSDMS NAPKGLF PEPEHYRGPKLKVAIIGAGLAGMSTAVELLD GHEV
Sbjct  29   VRASLDTNVSDMSVNAPKGLFLPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDHGHEV  86



>ref|XP_011005715.1| PREDICTED: zeta-carotene desaturase, chloroplastic/chromoplastic-like 
[Populus euphratica]
Length=259

 Score =   107 bits (268),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 52/61 (85%), Positives = 56/61 (92%), Gaps = 3/61 (5%)
 Frame = +3

Query  291  IRSDLDSM---VSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHE  461
            +R+ LDS+   VSDMS NAPKGLFPPEPEH+RGPKLKVAIIGAGLAGMSTAVELLDQGHE
Sbjct  49   VRAALDSLETNVSDMSVNAPKGLFPPEPEHHRGPKLKVAIIGAGLAGMSTAVELLDQGHE  108

Query  462  V  464
            V
Sbjct  109  V  109



>ref|XP_006432993.1| hypothetical protein CICLE_v10002974mg [Citrus clementina]
 ref|XP_006432994.1| hypothetical protein CICLE_v10002974mg [Citrus clementina]
 gb|ESR46233.1| hypothetical protein CICLE_v10002974mg [Citrus clementina]
 gb|ESR46234.1| hypothetical protein CICLE_v10002974mg [Citrus clementina]
Length=89

 Score =   103 bits (256),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 49/58 (84%), Positives = 53/58 (91%), Gaps = 0/58 (0%)
 Frame = +3

Query  291  IRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEV  464
            +R+ LD+ VSDMS NAPKGLF PEPEHYRGPKLKVAIIGAGLAGMSTAV+LLDQGH V
Sbjct  29   VRASLDTNVSDMSVNAPKGLFLPEPEHYRGPKLKVAIIGAGLAGMSTAVDLLDQGHGV  86



>ref|XP_006432999.1| hypothetical protein CICLE_v10003502mg [Citrus clementina]
 gb|ESR46239.1| hypothetical protein CICLE_v10003502mg [Citrus clementina]
Length=92

 Score =   103 bits (256),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 53/62 (85%), Gaps = 3/62 (5%)
 Frame = +3

Query  288  VIRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLD---QGH  458
             +R+ LD+ VSDMS NAPK LFPPEPEHYRGPKLKVAIIG GLAGMSTAVELLD   QGH
Sbjct  28   CVRASLDTNVSDMSVNAPKCLFPPEPEHYRGPKLKVAIIGVGLAGMSTAVELLDQGPQGH  87

Query  459  EV  464
            EV
Sbjct  88   EV  89



>ref|XP_006433004.1| hypothetical protein CICLE_v10002967mg [Citrus clementina]
 gb|ESR46244.1| hypothetical protein CICLE_v10002967mg [Citrus clementina]
Length=91

 Score =   102 bits (255),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = +3

Query  288  VIRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGH  458
             +R+ LD+ VSDMS NAPKGLF PEPEHYRGPKLKVAIIGAGLAGMSTAV+LLDQGH
Sbjct  28   CVRASLDTNVSDMSVNAPKGLFLPEPEHYRGPKLKVAIIGAGLAGMSTAVDLLDQGH  84



>ref|XP_006471711.1| PREDICTED: zeta-carotene desaturase, chloroplastic/chromoplastic-like 
[Citrus sinensis]
Length=104

 Score =   103 bits (256),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 50/64 (78%), Positives = 54/64 (84%), Gaps = 3/64 (5%)
 Frame = +3

Query  282  KSVIRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLD---Q  452
            +  +R+ LD+ VSDMS NAPK LFPPEPEHYRGPKLKVAIIG GLAGMSTAVELLD   Q
Sbjct  38   RFCVRASLDTNVSDMSVNAPKCLFPPEPEHYRGPKLKVAIIGVGLAGMSTAVELLDQGPQ  97

Query  453  GHEV  464
            GHEV
Sbjct  98   GHEV  101



>ref|XP_008230988.1| PREDICTED: zeta-carotene desaturase, chloroplastic/chromoplastic-like 
[Prunus mume]
Length=146

 Score =   103 bits (257),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 50/59 (85%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = +3

Query  288  VIRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEV  464
             IRS LD+ VSDMS  APKGLFPPE EHYRGPKLKVAIIGAGLAGMS A ELLDQGHEV
Sbjct  30   CIRSFLDTNVSDMSVRAPKGLFPPESEHYRGPKLKVAIIGAGLAGMSIAFELLDQGHEV  88



>ref|XP_006471924.1| PREDICTED: protein tesmin/TSO1-like CXC 2-like [Citrus sinensis]
Length=216

 Score =   101 bits (252),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 48/59 (81%), Positives = 52/59 (88%), Gaps = 0/59 (0%)
 Frame = +3

Query  288  VIRSDLDSMVSDMSTNAPKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEV  464
             +R+ LD+ VSDMS  APKGLF PEPEHYRGPKLKVAIIGAGLAGMSTAV+LLDQGH V
Sbjct  155  CVRASLDTNVSDMSVKAPKGLFLPEPEHYRGPKLKVAIIGAGLAGMSTAVDLLDQGHGV  213



>ref|XP_005843062.1| hypothetical protein CHLNCDRAFT_141585 [Chlorella variabilis]
 gb|EFN50960.1| hypothetical protein CHLNCDRAFT_141585 [Chlorella variabilis]
Length=459

 Score = 96.7 bits (239),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 51/87 (59%), Positives = 66/87 (76%), Gaps = 3/87 (3%)
 Frame = +3

Query  294  RSDLDSMVSDMSTNAP-KGLFPPEPEHYR--GPKLKVAIIGAGLAGMSTAVELLDQGHEV  464
            RSD+ ++ +    + P + LFP +P   R   PKLKVAI+G+GLAG+STAVELLDQG+EV
Sbjct  47   RSDVGNVNNVGLKDVPLRSLFPEDPGTPRPGAPKLKVAIVGSGLAGLSTAVELLDQGYEV  106

Query  465  DIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            DIY+S+ F+GGKV S+ DR GN IEMG
Sbjct  107  DIYESRPFVGGKVASYRDRNGNDIEMG  133



>ref|XP_011396566.1| Zeta-carotene desaturase, chloroplastic/chromoplastic [Auxenochlorella 
protothecoides]
 gb|KFM23692.1| Zeta-carotene desaturase, chloroplastic/chromoplastic [Auxenochlorella 
protothecoides]
Length=586

 Score = 97.4 bits (241),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 48/74 (65%), Positives = 59/74 (80%), Gaps = 3/74 (4%)
 Frame = +3

Query  333  NAP-KGLFPPEPEHYR--GPKLKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKV  503
            +AP + L+P EP       P+LKVAI+G GLAG+STAVELLDQG+EVDIY+S+ +IGGKV
Sbjct  61   DAPLRSLYPEEPSRPEPGAPRLKVAIVGGGLAGLSTAVELLDQGYEVDIYESRPWIGGKV  120

Query  504  GSFVDRRGNHIEMG  545
             SF D+ GNHIEMG
Sbjct  121  ASFKDKEGNHIEMG  134



>gb|ADR82201.1| zeta-carotene desaturase [Auxenochlorella protothecoides]
 gb|ADR82202.1| zeta-carotene desaturase [Auxenochlorella protothecoides]
Length=584

 Score = 93.6 bits (231),  Expect = 9e-19, Method: Composition-based stats.
 Identities = 52/82 (63%), Positives = 64/82 (78%), Gaps = 3/82 (4%)
 Frame = +3

Query  309  SMVSDMS-TNAP-KGLFPPEPEHYRG-PKLKVAIIGAGLAGMSTAVELLDQGHEVDIYDS  479
            S VSD++  + P + LFP  P    G PKLKVAI+G+GLAG+STAVELLDQG+EVDIY+S
Sbjct  52   SNVSDVALKDVPLRSLFPDVPTICPGAPKLKVAIVGSGLAGLSTAVELLDQGYEVDIYES  111

Query  480  KSFIGGKVGSFVDRRGNHIEMG  545
            + +IGGKV SF D+ GN IEMG
Sbjct  112  RPWIGGKVASFKDKDGNDIEMG  133



>ref|XP_005650492.1| zeta-carotene desaturase [Coccomyxa subellipsoidea C-169]
 gb|EIE25948.1| zeta-carotene desaturase [Coccomyxa subellipsoidea C-169]
Length=541

 Score = 90.9 bits (224),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 51/88 (58%), Positives = 65/88 (74%), Gaps = 4/88 (5%)
 Frame = +3

Query  291  IRSDLDSMVSDMST-NAP-KGLFPPEPEHYRG-PKLKVAIIGAGLAGMSTAVELLDQGHE  461
            +R  L   V D+   +AP + LFP  P    G PKLKVAI+G+GLAG+STAVELLDQG+E
Sbjct  11   VRPTLKPGVDDVGLKDAPLRSLFPEIPNIAPGAPKLKVAIVGSGLAGLSTAVELLDQGYE  70

Query  462  VDIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            VD+Y+S+ FIGGKV S+  + GNH+EMG
Sbjct  71   VDVYESRPFIGGKVASW-QKDGNHVEMG  97



>gb|KIY97244.1| zeta-carotene desaturase [Monoraphidium neglectum]
Length=310

 Score = 88.2 bits (217),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/54 (74%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = +3

Query  384  KLKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            KL+VAI+G GLAG+STAVELLDQGHEVDIY+ + ++GGKV SF D+ GNHIEMG
Sbjct  80   KLRVAILGGGLAGLSTAVELLDQGHEVDIYEGRQWVGGKVASFKDKDGNHIEMG  133



>ref|XP_002954228.1| hypothetical protein VOLCADRAFT_95071 [Volvox carteri f. nagariensis]
 gb|EFJ44652.1| hypothetical protein VOLCADRAFT_95071 [Volvox carteri f. nagariensis]
Length=592

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 46/70 (66%), Positives = 55/70 (79%), Gaps = 2/70 (3%)
 Frame = +3

Query  342  KGLFPPEPEHYRGPK--LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFV  515
            + LFP EP+        LKVAI+G GLAG+STAVELLDQG+EVDIY+ + +IGGKV SFV
Sbjct  67   RSLFPDEPKPPAPGAPKLKVAIVGGGLAGLSTAVELLDQGYEVDIYEGRQWIGGKVASFV  126

Query  516  DRRGNHIEMG  545
            D+ GNHIEMG
Sbjct  127  DKNGNHIEMG  136



>ref|XP_001700786.1| zeta-carotene desaturase [Chlamydomonas reinhardtii]
 gb|EDP07040.1| zeta-carotene desaturase [Chlamydomonas reinhardtii]
Length=582

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 46/70 (66%), Positives = 55/70 (79%), Gaps = 2/70 (3%)
 Frame = +3

Query  342  KGLFPPEPEHYRGPK--LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFV  515
            + LFP EP+        LKVAI+G GLAG+STAVELLDQG+EVDIY+ + +IGGKV SFV
Sbjct  62   RSLFPDEPKPPAPGAPKLKVAIVGGGLAGLSTAVELLDQGYEVDIYEGRQWIGGKVASFV  121

Query  516  DRRGNHIEMG  545
            D+ GNHIEMG
Sbjct  122  DKDGNHIEMG  131



>ref|WP_010873021.1| zeta-carotene desaturase [Synechocystis sp. PCC 6803]
 ref|NP_441720.1| zeta-carotene desaturase [Synechocystis sp. PCC 6803]
 sp|P74306.1|ZDS_SYNY3 RecName: Full=Zeta-carotene desaturase; AltName: Full=9,9'-di-cis-zeta-carotene 
desaturase; AltName: Full=Carotene 7,8-desaturase 
[Synechocystis sp. PCC 6803 substr. Kazusa]
 dbj|BAA18400.1| zeta-carotene desaturase precursor [Synechocystis sp. PCC 6803]
 dbj|BAK50574.1| zeta-carotene desaturase [Synechocystis sp. PCC 6803]
 dbj|BAL29573.1| zeta-carotene desaturase [Synechocystis sp. PCC 6803 substr. 
GT-I]
 dbj|BAL32742.1| zeta-carotene desaturase [Synechocystis sp. PCC 6803 substr. 
PCC-N]
 dbj|BAL35911.1| zeta-carotene desaturase [Synechocystis sp. PCC 6803 substr. 
PCC-P]
 gb|AGF52088.1| zeta-carotene desaturase precursor [Synechocystis sp. PCC 6803]
Length=489

 Score = 88.2 bits (217),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 50/53 (94%), Gaps = 0/53 (0%)
 Frame = +3

Query  387  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            ++VAI+GAGLAGM+TAVEL+D GHEV++Y+++SFIGGKVGS+VD  GNHIEMG
Sbjct  1    MRVAIVGAGLAGMATAVELVDAGHEVELYEARSFIGGKVGSWVDGDGNHIEMG  53



>ref|WP_028947937.1| zeta-carotene desaturase [Synechocystis sp. PCC 6714]
 gb|AIE74580.1| Pro-zeta-carotene desaturase, prolycopene producing [Synechocystis 
sp. PCC 6714]
Length=489

 Score = 87.8 bits (216),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 50/53 (94%), Gaps = 0/53 (0%)
 Frame = +3

Query  387  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            ++VAI+GAGLAGM+TAVEL+D GHEV++Y+++SFIGGKVGS+VD  GNHIEMG
Sbjct  1    MRVAIVGAGLAGMATAVELVDAGHEVELYEARSFIGGKVGSWVDGDGNHIEMG  53



>ref|WP_006101879.1| zeta-carotene desaturase [Coleofasciculus chthonoplastes]
 gb|EDX74548.1| carotene 7,8-desaturase [Coleofasciculus chthonoplastes PCC 7420]
Length=489

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/53 (72%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = +3

Query  387  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            ++VAI+GAGLAGM+TAVEL+D GHEV+I++S+ F+GGKVGS+VD  GNHIEMG
Sbjct  1    MRVAIVGAGLAGMATAVELVDAGHEVEIFESRPFVGGKVGSWVDAEGNHIEMG  53



>ref|WP_012306160.1| zeta-carotene desaturase [Synechococcus sp. PCC 7002]
 gb|ACA98536.1| zeta-carotene desaturase [Synechococcus sp. PCC 7002]
Length=487

 Score = 85.9 bits (211),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 50/53 (94%), Gaps = 0/53 (0%)
 Frame = +3

Query  387  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            ++VAI+GAGLAG+STAVEL+D GHEV+I++++ F+GGKVGS+VD+ GNHIEMG
Sbjct  1    MRVAIVGAGLAGLSTAVELVDAGHEVEIFEARPFVGGKVGSWVDKDGNHIEMG  53



>ref|WP_015170063.1| carotene 7,8-desaturase [Synechococcus sp. PCC 7502]
 gb|AFY75412.1| carotene 7,8-desaturase [Synechococcus sp. PCC 7502]
Length=462

 Score = 85.9 bits (211),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 38/53 (72%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = +3

Query  387  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            +KVAIIGAGLAGM+TA+EL D+GHEV+I++S+ F+GGKVGS++D  GNHIEMG
Sbjct  1    MKVAIIGAGLAGMTTALELCDRGHEVEIFESRPFVGGKVGSWLDTDGNHIEMG  53



>ref|WP_008181727.1| zeta-carotene desaturase [Moorea producens]
 gb|EGJ33784.1| zeta-carotene desaturase [Moorea producens 3L]
Length=478

 Score = 85.5 bits (210),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 50/53 (94%), Gaps = 0/53 (0%)
 Frame = +3

Query  387  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            +++AI+GAGLAGM+TA+EL+D GHEV+I++S+ F+GGKVGS+VD+ GNHIEMG
Sbjct  1    MRLAIVGAGLAGMATAIELVDAGHEVEIFESRPFVGGKVGSWVDKDGNHIEMG  53



>ref|WP_039727183.1| MULTISPECIES: zeta-carotene desaturase [Oscillatoriophycideae]
 gb|KIF15203.1| zeta-carotene desaturase [Aphanocapsa montana BDHKU210001]
 gb|KIF40116.1| zeta-carotene desaturase [Lyngbya confervoides BDU141951]
Length=478

 Score = 85.5 bits (210),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = +3

Query  387  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            ++VAI+GAGLAG+STAVEL D GHEV+I++S+ F+GGKVGS+VD+ GNH+EMG
Sbjct  1    MRVAIVGAGLAGLSTAVELADAGHEVEIFESRPFVGGKVGSWVDKDGNHVEMG  53



>ref|WP_030005806.1| zeta-carotene desaturase [Synechococcus sp. NKBG042902]
Length=487

 Score = 85.5 bits (210),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 50/53 (94%), Gaps = 0/53 (0%)
 Frame = +3

Query  387  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            ++VAI+GAGLAG+STA+EL+D GHEV+I++++ F+GGKVGS+VD+ GNHIEMG
Sbjct  1    MRVAIVGAGLAGLSTAIELVDAGHEVEIFEARPFVGGKVGSWVDKDGNHIEMG  53



>ref|WP_015132414.1| zeta-carotene desaturase [Leptolyngbya sp. PCC 7376]
 gb|AFY36627.1| zeta-carotene desaturase [Leptolyngbya sp. PCC 7376]
Length=487

 Score = 85.5 bits (210),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 50/53 (94%), Gaps = 0/53 (0%)
 Frame = +3

Query  387  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            ++VAI+GAGLAG+STA+EL+D GHEV+I++++ F+GGKVGS+VD+ GNHIEMG
Sbjct  1    MRVAIVGAGLAGLSTAIELVDAGHEVEIFEARPFVGGKVGSWVDKDGNHIEMG  53



>ref|WP_029959080.1| zeta-carotene desaturase, partial [Prochlorococcus sp. scB241_526B19]
Length=143

 Score = 81.3 bits (199),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +3

Query  387  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            +K+AI+G+GLAG++ AV L+D+GHEV+IY+S+SF GGKVGS+ D+ GNHIEMG
Sbjct  1    MKIAIVGSGLAGLTAAVNLVDEGHEVEIYESRSFWGGKVGSWEDKDGNHIEMG  53



>ref|WP_015158175.1| carotene 7,8-desaturase [Chamaesiphon minutus]
 gb|AFY91981.1| carotene 7,8-desaturase [Chamaesiphon minutus PCC 6605]
Length=479

 Score = 85.1 bits (209),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = +3

Query  387  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            ++VAI+GAGLAGM+TAV+L+D GHEV+I++S+ F+GGKVGS+VD  GNHIEMG
Sbjct  1    MRVAIVGAGLAGMATAVDLVDAGHEVEIFESRPFVGGKVGSWVDAEGNHIEMG  53



>ref|WP_029983587.1| zeta-carotene desaturase, partial [Prochlorococcus sp. scB243_495N4]
Length=114

 Score = 80.5 bits (197),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +3

Query  387  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            +K+AI+G+GLAG++ AV L+D+GHEV+IY+S+SF GGKVGS+ D+ GNHIEMG
Sbjct  1    MKIAIVGSGLAGLTAAVNLVDEGHEVEIYESRSFWGGKVGSWGDKDGNHIEMG  53



>ref|WP_015146661.1| zeta-carotene desaturase [Oscillatoria acuminata]
 gb|AFY80011.1| zeta-carotene desaturase [Oscillatoria acuminata PCC 6304]
Length=490

 Score = 84.7 bits (208),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +3

Query  387  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            ++VAI GAGLAGMSTA+EL+D GHEV+I++S+ F+GGKVGS+VD  GNH+EMG
Sbjct  1    MRVAIAGAGLAGMSTAIELVDAGHEVEIFESRPFVGGKVGSWVDAEGNHLEMG  53



>ref|WP_006509674.1| carotene 7,8-desaturase [Xenococcus sp. PCC 7305]
 gb|ELS03230.1| carotene 7,8-desaturase [Xenococcus sp. PCC 7305]
Length=477

 Score = 84.7 bits (208),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 50/53 (94%), Gaps = 0/53 (0%)
 Frame = +3

Query  387  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            ++VAI+GAGLAGM+TA++L+D GHEV+I++S+ F+GGKVGS+VD+ GNH+EMG
Sbjct  1    MRVAIVGAGLAGMATAIDLVDAGHEVEIFESRPFVGGKVGSWVDKDGNHVEMG  53



>ref|WP_008312128.1| carotene 7,8-desaturase [Leptolyngbya sp. PCC 6406]
Length=484

 Score = 84.7 bits (208),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = +3

Query  387  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            ++VAI+GAGLAG+STAV+L D GHEV+I++S+ F+GGKVGS+VD+ GNHIEMG
Sbjct  1    MRVAIVGAGLAGLSTAVDLADAGHEVEIFESRPFVGGKVGSWVDQDGNHIEMG  53



>ref|WP_015181504.1| carotene 7,8-desaturase [Microcoleus sp. PCC 7113]
 gb|AFZ17348.1| carotene 7,8-desaturase [Microcoleus sp. PCC 7113]
Length=489

 Score = 84.7 bits (208),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = +3

Query  387  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            ++VAI+GAGLAGM+TAVEL+D GHEV++++S+ F+GGKVGS+VD  GNH+EMG
Sbjct  1    MRVAIVGAGLAGMATAVELVDAGHEVELFESRPFVGGKVGSWVDADGNHVEMG  53



>ref|WP_036916414.1| MULTISPECIES: zeta-carotene desaturase [Prochlorococcus]
 gb|KGG18205.1| Pro-zeta-carotene desaturase [Prochlorococcus sp. MIT 0603]
Length=486

 Score = 84.3 bits (207),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = +3

Query  387  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            +KVAI+GAGLAG+S AV+L+D+GHEVD+Y+++ F+GGKVGS+ D+ GNHIEMG
Sbjct  1    MKVAIVGAGLAGLSAAVDLVDEGHEVDLYEARPFLGGKVGSWEDKDGNHIEMG  53



>ref|WP_032523894.1| zeta-carotene desaturase [Prochlorococcus marinus]
 gb|KGF88355.1| Pro-zeta-carotene desaturase [Prochlorococcus marinus str. GP2]
Length=484

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +3

Query  387  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            +K+AI+G+GLAG++ AV L+D+GHEVDIY+S+SF GGKVGS+ D+ GNHIEMG
Sbjct  1    MKIAIVGSGLAGLTAAVNLVDEGHEVDIYESRSFWGGKVGSWEDKDGNHIEMG  53



>ref|WP_025905874.1| zeta-carotene desaturase [Prochlorococcus sp. scB245a_519B7]
Length=484

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +3

Query  387  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            +K+AI+G+GLAG++ AV L+D+GHEVDIY+S+SF GGKVGS+ D+ GNHIEMG
Sbjct  1    MKIAIVGSGLAGLTAAVNLVDEGHEVDIYESRSFWGGKVGSWEDKDGNHIEMG  53



>ref|WP_025979527.1| zeta-carotene desaturase [Prochlorococcus sp. scB243_498B23]
Length=484

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +3

Query  387  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            +K+AI+G+GLAG++ AV L+D+GHEVDIY+S+SF GGKVGS+ D+ GNHIEMG
Sbjct  1    MKIAIVGSGLAGLTAAVNLVDEGHEVDIYESRSFWGGKVGSWEDKDGNHIEMG  53



>ref|WP_025945602.1| zeta-carotene desaturase [Prochlorococcus sp. scB241_528N17]
Length=484

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +3

Query  387  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            +K+AI+G+GLAG++ AV L+D+GHEVDIY+S+SF GGKVGS+ D+ GNHIEMG
Sbjct  1    MKIAIVGSGLAGLTAAVNLVDEGHEVDIYESRSFWGGKVGSWEDKDGNHIEMG  53



>ref|WP_032514724.1| zeta-carotene desaturase [Prochlorococcus marinus]
 gb|KGF89296.1| Pro-zeta-carotene desaturase [Prochlorococcus marinus str. MIT 
9107]
 gb|KGF90052.1| Pro-zeta-carotene desaturase [Prochlorococcus marinus str. MIT 
9116]
 gb|KGF95488.1| Pro-zeta-carotene desaturase [Prochlorococcus marinus str. MIT 
9123]
Length=484

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +3

Query  387  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            +K+AI+G+GLAG++ AV L+D+GHEVDIY+S+SF GGKVGS+ D+ GNHIEMG
Sbjct  1    MKIAIVGSGLAGLTAAVNLVDEGHEVDIYESRSFWGGKVGSWEDKDGNHIEMG  53



>gb|EYU45246.1| hypothetical protein MIMGU_mgv1a005547mg [Erythranthe guttata]
Length=479

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 38/41 (93%), Positives = 41/41 (100%), Gaps = 0/41 (0%)
 Frame = +3

Query  423  MSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            MSTAVELLDQGHEVDIYDSKSF+GGKVGSFVD++GNHIEMG
Sbjct  1    MSTAVELLDQGHEVDIYDSKSFVGGKVGSFVDKQGNHIEMG  41



>ref|WP_025936184.1| zeta-carotene desaturase [Prochlorococcus sp. scB245a_518D8]
Length=484

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +3

Query  387  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            +K+AI+G+GLAG++ AV L+D+GHEVDIY+S+SF GGKVGS+ D+ GNHIEMG
Sbjct  1    MKIAIVGSGLAGLTAAVNLVDEGHEVDIYESRSFWGGKVGSWEDKDGNHIEMG  53



>ref|XP_008813001.1| PREDICTED: zeta-carotene desaturase, chloroplastic/chromoplastic 
isoform X2 [Phoenix dactylifera]
Length=497

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/41 (90%), Positives = 41/41 (100%), Gaps = 0/41 (0%)
 Frame = +3

Query  423  MSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            MSTAVELLDQGHEVDIYD+++FIGGKVGSFVD+RGNHIEMG
Sbjct  1    MSTAVELLDQGHEVDIYDTRTFIGGKVGSFVDKRGNHIEMG  41



>gb|ABB49180.1| zeta-carotene desaturase [Prochlorococcus marinus str. MIT 9312]
 gb|KGF99580.1| Pro-zeta-carotene desaturase [Prochlorococcus marinus str. MIT 
9311]
Length=499

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = +3

Query  384  KLKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            K+K+AI+G+GLAG++ AV L+D+GHEV+IY+S+SF GGKVGS+ D+ GNHIEMG
Sbjct  15   KVKIAIVGSGLAGLTAAVNLVDEGHEVEIYESRSFWGGKVGSWEDKDGNHIEMG  68



>ref|WP_015172316.1| zeta-carotene desaturase [Geitlerinema sp. PCC 7407]
 gb|AFY66751.1| zeta-carotene desaturase [Geitlerinema sp. PCC 7407]
Length=490

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = +3

Query  387  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            ++VAI+GAGLAGM+TAV+L+D GHEV+I++S+ F+GGKVGS+VD  GNHIEMG
Sbjct  1    MRVAIVGAGLAGMATAVDLVDAGHEVEIFESRPFVGGKVGSWVDADGNHIEMG  53



>ref|WP_011613311.1| zeta-carotene desaturase [Trichodesmium erythraeum]
 gb|ABG52981.1| zeta-carotene desaturase [Trichodesmium erythraeum IMS101]
Length=483

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +3

Query  387  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            ++VAI GAGLAGM+TAVEL D GH+V+I++S+ F+GGKVGS+VD+ GNH+EMG
Sbjct  1    MRVAIAGAGLAGMATAVELADAGHQVEIFESRPFVGGKVGSWVDKNGNHVEMG  53



>ref|WP_019475733.1| zeta-carotene desaturase [Prochlorococcus sp. W3]
Length=485

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +3

Query  387  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            +K+AI+G+GLAG++ AV+L+D GHEV+IY+S+ F GGKVGS+VD+ GNHIEMG
Sbjct  1    MKIAIVGSGLAGLTAAVDLVDNGHEVEIYESRPFWGGKVGSWVDKEGNHIEMG  53



>ref|WP_036922357.1| zeta-carotene desaturase [Prochlorococcus marinus]
Length=485

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +3

Query  387  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            +K+AI+G+GLAG++ AV+L+D GHEV+IY+S+ F GGKVGS+VD+ GNHIEMG
Sbjct  1    MKIAIVGSGLAGLTAAVDLVDNGHEVEIYESRPFWGGKVGSWVDKEGNHIEMG  53



>ref|WP_019503087.1| zeta-carotene desaturase [Pseudanabaena sp. PCC 6802]
Length=486

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = +3

Query  387  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            ++VAI+GAGLAGMSTAVEL D+G++V+I++S+ F+GGKVGS+VD  GNH+EMG
Sbjct  1    MRVAIVGAGLAGMSTAVELCDRGYQVEIFESRPFVGGKVGSWVDPDGNHVEMG  53



>gb|ACI14289.1| zeta-carotene desaturase [Linum usitatissimum]
Length=481

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/44 (86%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  414  LAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            +AGMSTAVELLDQGHEVDIY+S++FIGGKVGSFVD+ GNHIEMG
Sbjct  1    VAGMSTAVELLDQGHEVDIYESRTFIGGKVGSFVDKGGNHIEMG  44



>ref|WP_036901689.1| zeta-carotene desaturase [Prochlorococcus sp. MIT 0601]
 gb|KGG13259.1| Pro-zeta-carotene desaturase [Prochlorococcus sp. MIT 0601]
Length=486

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +3

Query  387  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            +KVAI+GAGLAG++ AV+L+D GHEVDIY+++ F+GGKVGS+ D +GNHIEMG
Sbjct  1    MKVAIVGAGLAGLTAAVDLVDAGHEVDIYEARPFLGGKVGSWEDSQGNHIEMG  53



>ref|WP_021829644.1| Pro-zeta-carotene desaturase, prolycopene producing [Crocosphaera 
watsonii]
 emb|CCQ49749.1| Pro-zeta-carotene desaturase, prolycopene producing [Crocosphaera 
watsonii WH 8502]
Length=211

 Score = 80.9 bits (198),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 50/53 (94%), Gaps = 0/53 (0%)
 Frame = +3

Query  387  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            ++VAI+GAGLAGM+TA++L+D+G EV+I++S+ F+GGKVGS+VD+ GNHIEMG
Sbjct  1    MRVAIVGAGLAGMATAMDLVDRGCEVEIFESRPFVGGKVGSWVDKDGNHIEMG  53



>ref|XP_005836476.1| hypothetical protein GUITHDRAFT_93434 [Guillardia theta CCMP2712]
 gb|EKX49496.1| hypothetical protein GUITHDRAFT_93434 [Guillardia theta CCMP2712]
Length=522

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/69 (57%), Positives = 54/69 (78%), Gaps = 6/69 (9%)
 Frame = +3

Query  339  PKGLFPPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVD  518
            P   FP E       KLK+ I+G+GLAGM TA++L+D GHEV+I+++++F+GGKVGS+VD
Sbjct  8    PSVRFPEEK------KLKIGIVGSGLAGMVTAMDLVDAGHEVEIFEARNFVGGKVGSWVD  61

Query  519  RRGNHIEMG  545
            + GNHIEMG
Sbjct  62   KDGNHIEMG  70



>ref|WP_012628567.1| zeta-carotene desaturase [Cyanothece sp. PCC 7425]
 gb|ACL45504.1| carotene 7,8-desaturase [Cyanothece sp. PCC 7425]
Length=482

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = +3

Query  387  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            ++VAI+GAGLAGM+TAVEL+++GHEV +Y+++ F+GGKVGS++D  GNHIEMG
Sbjct  1    MRVAIVGAGLAGMATAVELVERGHEVSLYEARPFVGGKVGSWIDPAGNHIEMG  53



>ref|WP_019478374.1| zeta-carotene desaturase [Prochlorococcus sp. W8]
Length=485

 Score = 83.2 bits (204),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +3

Query  387  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            +K+AI+G+GLAG++ AV+L+D GHE++IY+S+ F GGKVGS+VD+ GNHIEMG
Sbjct  1    MKIAIVGSGLAGLTAAVDLVDNGHEIEIYESRPFWGGKVGSWVDKEGNHIEMG  53



>ref|WP_019476153.1| zeta-carotene desaturase [Prochlorococcus sp. W4]
Length=485

 Score = 82.8 bits (203),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +3

Query  387  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            +K+AI+G+GLAG++ AV+L+D GH VDIY+S+SF GGKVGS+ D++GNHIEMG
Sbjct  1    MKIAIVGSGLAGLTAAVDLVDSGHSVDIYESRSFWGGKVGSWEDKQGNHIEMG  53



>ref|WP_019505779.1| zeta-carotene desaturase [Pleurocapsa sp. PCC 7319]
Length=485

 Score = 82.8 bits (203),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = +3

Query  387  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            ++VAI+GAGLAGM+TA++L+D G EV+I++S+ F+GGKVGS+VD+ GNHIEMG
Sbjct  1    MRVAIVGAGLAGMATAIDLVDAGAEVEIFESRPFVGGKVGSWVDKEGNHIEMG  53



>ref|WP_036924468.1| zeta-carotene desaturase [Prochlorococcus marinus]
Length=484

 Score = 82.8 bits (203),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +3

Query  387  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            +K+AI+G+GLAG++ AV L+D+GHEV+IY+S+SF GGKVGS+ D+ GNHIEMG
Sbjct  1    MKIAIVGSGLAGLTAAVNLVDEGHEVEIYESRSFWGGKVGSWEDKDGNHIEMG  53



>ref|WP_011131754.1| zeta-carotene desaturase [Prochlorococcus marinus]
 emb|CAE18574.1| zeta-carotene desaturase [Prochlorococcus marinus subsp. pastoris 
str. CCMP1986]
 gb|KGF88132.1| Pro-zeta-carotene desaturase [Prochlorococcus marinus str. EQPAC1]
Length=484

 Score = 82.4 bits (202),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +3

Query  387  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            +K+AI+G+GLAG++ AV L+D+GHEV+IY+S+SF GGKVGS+ D+ GNHIEMG
Sbjct  1    MKIAIVGSGLAGLTAAVNLVDEGHEVEIYESRSFWGGKVGSWEDKDGNHIEMG  53



>ref|WP_032516794.1| zeta-carotene desaturase [Prochlorococcus marinus]
 gb|KGG05776.1| Pro-zeta-carotene desaturase [Prochlorococcus marinus str. MIT 
9321]
 gb|KGG06198.1| Pro-zeta-carotene desaturase [Prochlorococcus marinus str. MIT 
9322]
 gb|KGG06771.1| Pro-zeta-carotene desaturase [Prochlorococcus marinus str. MIT 
9401]
Length=484

 Score = 82.4 bits (202),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +3

Query  387  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            +K+AI+G+GLAG++ AV L+D+GHEV+IY+S+SF GGKVGS+ D+ GNHIEMG
Sbjct  1    MKIAIVGSGLAGLTAAVNLVDEGHEVEIYESRSFWGGKVGSWEDKDGNHIEMG  53



>ref|WP_032522962.1| zeta-carotene desaturase [Prochlorococcus marinus]
 gb|KGF94666.1| Pro-zeta-carotene desaturase [Prochlorococcus marinus str. MIT 
9201]
Length=484

 Score = 82.4 bits (202),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +3

Query  387  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            +K+AI+G+GLAG++ AV L+D+GHEV+IY+S+SF GGKVGS+ D+ GNHIEMG
Sbjct  1    MKIAIVGSGLAGLTAAVNLVDEGHEVEIYESRSFWGGKVGSWEDKDGNHIEMG  53



>ref|WP_025937920.1| zeta-carotene desaturase [Prochlorococcus sp. scB245a_519A13]
Length=484

 Score = 82.4 bits (202),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +3

Query  387  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            +K+AI+G+GLAG++ AV L+D+GHEV+IY+S+SF GGKVGS+ D+ GNHIEMG
Sbjct  1    MKIAIVGSGLAGLTAAVNLVDEGHEVEIYESRSFWGGKVGSWEDKDGNHIEMG  53



>ref|WP_025971586.1| zeta-carotene desaturase [Prochlorococcus sp. scB241_527L22]
Length=484

 Score = 82.4 bits (202),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +3

Query  387  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            +K+AI+G+GLAG++ AV L+D+GHEV+IY+S+SF GGKVGS+ D+ GNHIEMG
Sbjct  1    MKIAIVGSGLAGLTAAVNLVDEGHEVEIYESRSFWGGKVGSWEDKDGNHIEMG  53



>ref|WP_025953053.1| zeta-carotene desaturase [Prochlorococcus sp. scB243_496G15]
Length=484

 Score = 82.4 bits (202),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +3

Query  387  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            +K+AI+G+GLAG++ AV L+D+GHEV+IY+S+SF GGKVGS+ D+ GNHIEMG
Sbjct  1    MKIAIVGSGLAGLTAAVNLVDEGHEVEIYESRSFWGGKVGSWEDKDGNHIEMG  53



>ref|WP_025939866.1| zeta-carotene desaturase [Prochlorococcus sp. scB245a_520B18]
Length=484

 Score = 82.4 bits (202),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +3

Query  387  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            +K+AI+G+GLAG++ AV L+D+GHEV+IY+S+SF GGKVGS+ D+ GNHIEMG
Sbjct  1    MKIAIVGSGLAGLTAAVNLVDEGHEVEIYESRSFWGGKVGSWEDKDGNHIEMG  53



>ref|WP_025924976.1| zeta-carotene desaturase [Prochlorococcus sp. scB243_495N16]
Length=484

 Score = 82.4 bits (202),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +3

Query  387  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            +K+AI+G+GLAG++ AV L+D+GHEV+IY+S+SF GGKVGS+ D+ GNHIEMG
Sbjct  1    MKIAIVGSGLAGLTAAVNLVDEGHEVEIYESRSFWGGKVGSWEDKDGNHIEMG  53



>ref|WP_025962778.1| MULTISPECIES: zeta-carotene desaturase [Prochlorococcus]
Length=484

 Score = 82.4 bits (202),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +3

Query  387  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            +K+AI+G+GLAG++ AV L+D+GHEV+IY+S+SF GGKVGS+ D+ GNHIEMG
Sbjct  1    MKIAIVGSGLAGLTAAVNLVDEGHEVEIYESRSFWGGKVGSWEDKDGNHIEMG  53



>ref|WP_025932943.1| zeta-carotene desaturase [Prochlorococcus sp. scB243_498A3]
Length=484

 Score = 82.4 bits (202),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +3

Query  387  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            +K+AI+G+GLAG++ AV L+D+GHEV+IY+S+SF GGKVGS+ D+ GNHIEMG
Sbjct  1    MKIAIVGSGLAGLTAAVNLVDEGHEVEIYESRSFWGGKVGSWEDKDGNHIEMG  53



>ref|WP_025890273.1| MULTISPECIES: zeta-carotene desaturase [Prochlorococcus]
Length=484

 Score = 82.4 bits (202),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +3

Query  387  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            +K+AI+G+GLAG++ AV L+D+GHEV+IY+S+SF GGKVGS+ D+ GNHIEMG
Sbjct  1    MKIAIVGSGLAGLTAAVNLVDEGHEVEIYESRSFWGGKVGSWEDKDGNHIEMG  53



>ref|WP_025880230.1| MULTISPECIES: zeta-carotene desaturase [Prochlorococcus]
Length=484

 Score = 82.4 bits (202),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +3

Query  387  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            +K+AI+G+GLAG++ AV L+D+GHEV+IY+S+SF GGKVGS+ D+ GNHIEMG
Sbjct  1    MKIAIVGSGLAGLTAAVNLVDEGHEVEIYESRSFWGGKVGSWEDKDGNHIEMG  53



>ref|WP_032519772.1| zeta-carotene desaturase [Prochlorococcus marinus]
 gb|KGG08438.1| Pro-zeta-carotene desaturase [Prochlorococcus marinus str. SB]
Length=484

 Score = 82.4 bits (202),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +3

Query  387  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            +K+AI+G+GLAG++ AV L+D+GHEV+IY+S+SF GGKVGS+ D+ GNHIEMG
Sbjct  1    MKIAIVGSGLAGLTAAVNLVDEGHEVEIYESRSFWGGKVGSWEDKDGNHIEMG  53



>ref|WP_025952229.1| zeta-carotene desaturase [Prochlorococcus sp. scB243_495P20]
Length=484

 Score = 82.4 bits (202),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +3

Query  387  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            +K+AI+G+GLAG++ AV L+D+GHEV+IY+S+SF GGKVGS+ D+ GNHIEMG
Sbjct  1    MKIAIVGSGLAGLTAAVNLVDEGHEVEIYESRSFWGGKVGSWEDKDGNHIEMG  53



>ref|WP_002805954.1| zeta-carotene desaturase [Prochlorococcus marinus]
 gb|EEE39807.1| carotene 7,8-desaturase [Prochlorococcus marinus str. MIT 9202]
Length=484

 Score = 82.4 bits (202),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +3

Query  387  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            +K+AI+G+GLAG++ AV L+D+GHEV+IY+S+SF GGKVGS+ D+ GNHIEMG
Sbjct  1    MKIAIVGSGLAGLTAAVNLVDEGHEVEIYESRSFWGGKVGSWEDKDGNHIEMG  53



>ref|WP_025955073.1| MULTISPECIES: zeta-carotene desaturase [Prochlorococcus]
Length=484

 Score = 82.4 bits (202),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +3

Query  387  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            +K+AI+G+GLAG++ AV L+D+GHEV+IY+S+SF GGKVGS+ D+ GNHIEMG
Sbjct  1    MKIAIVGSGLAGLTAAVNLVDEGHEVEIYESRSFWGGKVGSWEDKDGNHIEMG  53



>ref|WP_025921324.1| zeta-carotene desaturase [Prochlorococcus sp. scB241_526N5]
Length=484

 Score = 82.4 bits (202),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +3

Query  387  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            +K+AI+G+GLAG++ AV L+D+GHEV+IY+S+SF GGKVGS+ D+ GNHIEMG
Sbjct  1    MKIAIVGSGLAGLTAAVNLVDEGHEVEIYESRSFWGGKVGSWEDKDGNHIEMG  53



>ref|WP_011862158.1| zeta-carotene desaturase [Prochlorococcus marinus]
 gb|ABO16755.1| zeta-carotene desaturase [Prochlorococcus marinus str. MIT 9301]
Length=484

 Score = 82.4 bits (202),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +3

Query  387  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            +K+AI+G+GLAG++ AV L+D+GHEV+IY+S+SF GGKVGS+ D+ GNHIEMG
Sbjct  1    MKIAIVGSGLAGLTAAVNLVDEGHEVEIYESRSFWGGKVGSWEDKDGNHIEMG  53



>ref|WP_025973661.1| zeta-carotene desaturase [Prochlorococcus sp. scB241_529B19]
Length=484

 Score = 82.4 bits (202),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +3

Query  387  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            +K+AI+G+GLAG++ AV L+D+GHEV+IY+S+SF GGKVGS+ D+ GNHIEMG
Sbjct  1    MKIAIVGSGLAGLTAAVNLVDEGHEVEIYESRSFWGGKVGSWEDKDGNHIEMG  53



>ref|WP_025963149.1| zeta-carotene desaturase [Prochlorococcus sp. scB241_526D20]
Length=484

 Score = 82.4 bits (202),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +3

Query  387  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            +K+AI+G+GLAG++ AV L+D+GHEV+IY+S+SF GGKVGS+ D+ GNHIEMG
Sbjct  1    MKIAIVGSGLAGLTAAVNLVDEGHEVEIYESRSFWGGKVGSWEDKDGNHIEMG  53



>ref|WP_025956429.1| MULTISPECIES: zeta-carotene desaturase [Prochlorococcus]
Length=484

 Score = 82.4 bits (202),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +3

Query  387  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            +K+AI+G+GLAG++ AV L+D+GHEV+IY+S+SF GGKVGS+ D+ GNHIEMG
Sbjct  1    MKIAIVGSGLAGLTAAVNLVDEGHEVEIYESRSFWGGKVGSWEDKDGNHIEMG  53



>ref|WP_025893773.1| zeta-carotene desaturase [Prochlorococcus sp. scB241_527N11]
Length=484

 Score = 82.4 bits (202),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +3

Query  387  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            +K+AI+G+GLAG++ AV L+D+GHEV+IY+S+SF GGKVGS+ D+ GNHIEMG
Sbjct  1    MKIAIVGSGLAGLTAAVNLVDEGHEVEIYESRSFWGGKVGSWEDKDGNHIEMG  53



>ref|WP_042849604.1| zeta-carotene desaturase [Prochlorococcus sp. MIT 0604]
 gb|AIQ94169.1| Pro-zeta-carotene desaturase [Prochlorococcus sp. MIT 0604]
Length=484

 Score = 82.4 bits (202),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +3

Query  387  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            +K+AI+G+GLAG++ AV L+D+GHEV+IY+S+SF GGKVGS+ D+ GNHIEMG
Sbjct  1    MKIAIVGSGLAGLTAAVNLVDEGHEVEIYESRSFWGGKVGSWEDKDGNHIEMG  53



>ref|WP_025941175.1| zeta-carotene desaturase [Prochlorococcus sp. scB245a_518O7]
Length=484

 Score = 82.4 bits (202),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +3

Query  387  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            +K+AI+G+GLAG++ AV L+D+GHEV+IY+S+SF GGKVGS+ D+ GNHIEMG
Sbjct  1    MKIAIVGSGLAGLTAAVNLVDEGHEVEIYESRSFWGGKVGSWEDKDGNHIEMG  53



>ref|WP_012006931.1| zeta-carotene desaturase [Prochlorococcus marinus]
 gb|ABV49752.1| zeta-carotene desaturase [Prochlorococcus marinus str. MIT 9215]
Length=484

 Score = 82.4 bits (202),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +3

Query  387  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            +K+AI+G+GLAG++ AV L+D+GHEV+IY+S+SF GGKVGS+ D+ GNHIEMG
Sbjct  1    MKIAIVGSGLAGLTAAVNLVDEGHEVEIYESRSFWGGKVGSWEDKDGNHIEMG  53



>ref|WP_011822978.1| zeta-carotene desaturase [Prochlorococcus marinus]
 gb|ABM74753.1| zeta-carotene desaturase [Prochlorococcus marinus str. NATL1A]
Length=486

 Score = 82.4 bits (202),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +3

Query  387  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            +K+AIIGAGLAG++ AV+L+D+GH+VD+Y++K FIGGKVGS+ D  GNHIEMG
Sbjct  1    MKIAIIGAGLAGLTAAVDLVDEGHDVDLYEAKPFIGGKVGSWEDSDGNHIEMG  53



>ref|WP_025954278.1| zeta-carotene desaturase [Prochlorococcus sp. scB243_498C16]
Length=484

 Score = 82.4 bits (202),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +3

Query  387  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            +K+AI+G+GLAG++ AV L+D+GHEV+IY+S+SF GGKVGS+ D+ GNHIEMG
Sbjct  1    MKIAIVGSGLAGLTAAVNLVDEGHEVEIYESRSFWGGKVGSWEDKDGNHIEMG  53



>ref|WP_025932286.1| MULTISPECIES: zeta-carotene desaturase [Prochlorococcus]
Length=484

 Score = 82.4 bits (202),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +3

Query  387  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            +K+AI+G+GLAG++ AV L+D+GHEV+IY+S+SF GGKVGS+ D+ GNHIEMG
Sbjct  1    MKIAIVGSGLAGLTAAVNLVDEGHEVEIYESRSFWGGKVGSWEDKDGNHIEMG  53



>ref|WP_025931278.1| zeta-carotene desaturase [Prochlorococcus sp. scB241_528P14]
Length=484

 Score = 82.4 bits (202),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +3

Query  387  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            +K+AI+G+GLAG++ AV L+D+GHEV+IY+S+SF GGKVGS+ D+ GNHIEMG
Sbjct  1    MKIAIVGSGLAGLTAAVNLVDEGHEVEIYESRSFWGGKVGSWEDKDGNHIEMG  53



>ref|WP_036899170.1| zeta-carotene desaturase [Prochlorococcus marinus]
Length=485

 Score = 82.4 bits (202),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = +3

Query  387  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            +K+AI+G+GLAG++ AV+L+D GH VDIY+S+SF GGKVGS+ D+ GNHIEMG
Sbjct  1    MKIAIVGSGLAGLTAAVDLVDSGHSVDIYESRSFWGGKVGSWEDKEGNHIEMG  53



>ref|WP_019474796.1| zeta-carotene desaturase [Prochlorococcus sp. W2]
Length=485

 Score = 82.4 bits (202),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = +3

Query  387  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            +K+AI+G+GLAG++ AV+L+D GH VDIY+S+SF GGKVGS+ D+ GNHIEMG
Sbjct  1    MKIAIVGSGLAGLTAAVDLVDSGHSVDIYESRSFWGGKVGSWEDKEGNHIEMG  53



>ref|WP_008276389.1| zeta-carotene desaturase [Cyanothece sp. CCY0110]
 gb|EAZ90456.1| zeta-carotene desaturase [Cyanothece sp. CCY0110]
Length=490

 Score = 82.0 bits (201),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = +3

Query  387  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            ++VAI+GAGLAGM+TA++L+D G EV+I++S+ FIGGKVGS+VD+ GNHIEMG
Sbjct  1    MRVAIVGAGLAGMATAIDLVDAGCEVEIFESRPFIGGKVGSWVDKDGNHIEMG  53



>ref|WP_011819453.1| zeta-carotene desaturase [Prochlorococcus marinus]
 gb|ABM71338.1| zeta-carotene desaturase [Prochlorococcus marinus str. MIT 9515]
Length=484

 Score = 81.6 bits (200),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +3

Query  387  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            +K+AI+G+GLAG++ AV+L+D GHEV+IY+S+SF GGKVGS+ D+ GNHIEMG
Sbjct  1    MKIAIVGSGLAGLTAAVDLVDAGHEVEIYESRSFWGGKVGSWEDKDGNHIEMG  53



>ref|WP_006624376.1| MULTISPECIES: zeta-carotene desaturase [Arthrospira]
 gb|EDZ95718.1| carotene 7,8-desaturase [Arthrospira maxima CS-328]
 emb|CCE17718.1| Zeta-carotene desaturase [Arthrospira sp. PCC 8005]
 gb|EKD07656.1| carotene 78-desaturase [Arthrospira platensis C1]
 emb|CDM96563.1| Zeta-carotene desaturase [Arthrospira sp. PCC 8005]
Length=490

 Score = 81.6 bits (200),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +3

Query  387  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            ++VAI GAGLAGM+TAV+L+D GHEV++++S+ F+GGKVGS+VD  GNH+EMG
Sbjct  1    MRVAIAGAGLAGMATAVDLVDAGHEVELFESRPFVGGKVGSWVDPEGNHVEMG  53



>ref|WP_006616919.1| zeta-carotene desaturase [Arthrospira platensis]
 gb|KDR57699.1| zeta-carotene desaturase [Arthrospira platensis str. Paraca]
Length=490

 Score = 81.6 bits (200),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +3

Query  387  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            ++VAI GAGLAGM+TAV+L+D GHEV++++S+ F+GGKVGS+VD  GNH+EMG
Sbjct  1    MRVAIAGAGLAGMATAVDLVDAGHEVELFESRPFVGGKVGSWVDPEGNHVEMG  53



>ref|WP_014274504.1| zeta-carotene desaturase [Arthrospira platensis]
 dbj|BAI88855.1| zeta-carotene desaturase [Arthrospira platensis NIES-39]
Length=490

 Score = 81.6 bits (200),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +3

Query  387  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            ++VAI GAGLAGM+TAV+L+D GHEV++++S+ F+GGKVGS+VD  GNH+EMG
Sbjct  1    MRVAIAGAGLAGMATAVDLVDAGHEVELFESRPFVGGKVGSWVDPEGNHVEMG  53



>ref|WP_009544536.1| MULTISPECIES: zeta-carotene desaturase [Cyanothece]
 gb|ACB52127.1| zeta-carotene desaturase [Cyanothece sp. ATCC 51142]
Length=490

 Score = 81.6 bits (200),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = +3

Query  387  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            ++VAI+GAGLAGM+TA++L+D G EV+I++S+ F+GGKVGS+VD+ GNHIEMG
Sbjct  1    MRVAIVGAGLAGMATAIDLVDAGCEVEIFESRPFVGGKVGSWVDKDGNHIEMG  53



>ref|WP_015228996.1| carotene 7,8-desaturase [Dactylococcopsis salina]
 gb|AFZ49990.1| carotene 7,8-desaturase [Dactylococcopsis salina PCC 8305]
Length=485

 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = +3

Query  387  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            ++VAI+GAGLAG+STAV L D G EV+IY+S+ F+GGKVGS+VD+ GNH+EMG
Sbjct  1    MRVAIVGAGLAGLSTAVNLADAGWEVEIYESRPFVGGKVGSWVDQDGNHLEMG  53



>ref|WP_010469723.1| zeta-carotene desaturase [Acaryochloris sp. CCMEE 5410]
Length=492

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +3

Query  387  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            ++VAI+GAGLAGM+TAV+L+D GHEV++Y+++ F+GGKV S+VD  GNHIEMG
Sbjct  1    MRVAIVGAGLAGMATAVDLVDAGHEVELYEARPFVGGKVSSWVDDDGNHIEMG  53



>ref|WP_012164067.1| zeta-carotene desaturase [Acaryochloris marina]
 gb|ABW28682.1| carotene 7,8-desaturase/zeta-carotene desaturase [Acaryochloris 
marina MBIC11017]
Length=492

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +3

Query  387  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            ++VAI+GAGLAGM+TAV+L+D GHEV++Y+++ F+GGKV S+VD  GNHIEMG
Sbjct  1    MRVAIVGAGLAGMATAVDLVDAGHEVELYEARPFVGGKVSSWVDDDGNHIEMG  53



>ref|WP_038650792.1| zeta-carotene desaturase [Prochlorococcus sp. MIT 0801]
 gb|AIQ96296.1| Pro-zeta-carotene desaturase [Prochlorococcus sp. MIT 0801]
Length=486

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +3

Query  387  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            +K+AIIGAGLAG++ AV+L+D+GH+VD+Y++K F+GGKVGS+ D  GNHIEMG
Sbjct  1    MKIAIIGAGLAGLTAAVDLVDEGHDVDLYEAKPFMGGKVGSWEDSDGNHIEMG  53



>ref|WP_036479960.1| zeta-carotene desaturase [Myxosarcina sp. GI1]
Length=485

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +3

Query  387  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            ++VAI+GAGLAGM+TA+EL D G EV+I++S+ F+GGKVGS++D+ GNH+EMG
Sbjct  1    MRVAIVGAGLAGMTTAIELADAGAEVEIFESRPFVGGKVGSWIDKDGNHLEMG  53



>ref|WP_011294117.1| zeta-carotene desaturase [Prochlorococcus marinus]
 gb|AAZ58972.1| zeta-carotene desaturase [Prochlorococcus marinus str. NATL2A]
Length=486

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +3

Query  387  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            +K+AIIGAGLAG++ AV+L+D+GH+VD+Y++K F+GGKVGS+ D  GNHIEMG
Sbjct  1    MKIAIIGAGLAGLTAAVDLVDEGHDVDLYEAKPFMGGKVGSWEDSDGNHIEMG  53



>ref|WP_036904745.1| zeta-carotene desaturase [Prochlorococcus marinus]
 gb|KGG21733.1| Pro-zeta-carotene desaturase [Prochlorococcus marinus str. PAC1]
Length=486

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +3

Query  387  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            +K+AIIGAGLAG++ AV+L+D+GH+VD+Y++K F+GGKVGS+ D  GNHIEMG
Sbjct  1    MKIAIIGAGLAGLTAAVDLVDEGHDVDLYEAKPFMGGKVGSWEDSDGNHIEMG  53



>ref|WP_025923867.1| zeta-carotene desaturase [Prochlorococcus sp. scB243_495D8]
Length=484

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = +3

Query  387  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            +K+AI+G+GLAG++ AV L+D+GHEV+IY+S+ F GGKVGS+ D+ GNHIEMG
Sbjct  1    MKIAIVGSGLAGLTAAVNLVDEGHEVEIYESRPFWGGKVGSWEDKEGNHIEMG  53



>ref|WP_015220074.1| zeta-carotene desaturase [Cyanobacterium aponinum]
 gb|AFZ54350.1| zeta-carotene desaturase [Cyanobacterium aponinum PCC 10605]
Length=483

 Score = 80.9 bits (198),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +3

Query  387  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            ++VAI+GAGLAG++TA+EL+D G EV+I++S+ F+GGKVGS+VD  GNHIEMG
Sbjct  1    MRVAIVGAGLAGLATAIELVDAGCEVEIFESRPFVGGKVGSWVDNDGNHIEMG  53



>ref|WP_032515874.1| zeta-carotene desaturase [Prochlorococcus marinus]
 gb|KGG01270.1| Pro-zeta-carotene desaturase [Prochlorococcus marinus str. MIT 
9314]
Length=484

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +3

Query  387  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            +K+AI+G+GLAG++ AV L+D+GHEV+I++S+SF GGKVGS+ D+ GNHIEMG
Sbjct  1    MKIAIVGSGLAGLTAAVNLVDEGHEVEIFESRSFWGGKVGSWEDKDGNHIEMG  53



>ref|WP_025957514.1| zeta-carotene desaturase [Prochlorococcus sp. scB245a_518J7]
Length=484

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +3

Query  387  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            +K+AI+G+GLAG++ AV L+D+GHEV+I++S+SF GGKVGS+ D+ GNHIEMG
Sbjct  1    MKIAIVGSGLAGLTAAVNLVDEGHEVEIFESRSFWGGKVGSWEDKDGNHIEMG  53



>ref|WP_025924062.1| MULTISPECIES: zeta-carotene desaturase [Prochlorococcus]
Length=484

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +3

Query  387  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            +K+AI+G+GLAG++ AV L+D+GHEV+I++S+SF GGKVGS+ D+ GNHIEMG
Sbjct  1    MKIAIVGSGLAGLTAAVNLVDEGHEVEIFESRSFWGGKVGSWEDKDGNHIEMG  53



>ref|WP_011817608.1| zeta-carotene desaturase [Prochlorococcus marinus]
 gb|ABM69421.1| zeta-carotene desaturase [Prochlorococcus marinus str. AS9601]
Length=484

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +3

Query  387  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            +K+AI+G+GLAG++ AV L+D+GHEV+I++S+SF GGKVGS+ D+ GNHIEMG
Sbjct  1    MKIAIVGSGLAGLTAAVNLVDEGHEVEIFESRSFWGGKVGSWEDKDGNHIEMG  53



>ref|WP_025922039.1| MULTISPECIES: zeta-carotene desaturase [Prochlorococcus]
Length=484

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +3

Query  387  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            +K+AI+G+GLAG++ AV L+D+GHEV+I++S+SF GGKVGS+ D+ GNHIEMG
Sbjct  1    MKIAIVGSGLAGLTAAVNLVDEGHEVEIFESRSFWGGKVGSWEDKDGNHIEMG  53



>ref|WP_012598084.1| zeta-carotene desaturase [Cyanothece sp. PCC 7424]
 gb|ACK69137.1| carotene 7,8-desaturase [Cyanothece sp. PCC 7424]
Length=489

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +3

Query  387  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            ++VAI+GAGLAGM+TA++L+D G EV+I++S+ F+GGKVGS++D  GNHIEMG
Sbjct  1    MRVAIVGAGLAGMATAIDLVDAGCEVEIFESRPFVGGKVGSWIDSEGNHIEMG  53



>ref|WP_017717674.1| zeta-carotene desaturase [Oscillatoria sp. PCC 10802]
Length=489

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = +3

Query  387  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            ++VAI GAGLAGM+TAV+L+D GHEV+I++S+ F+GGKVGS+ D  GNHIEMG
Sbjct  1    MRVAIAGAGLAGMATAVDLVDAGHEVEIFESRPFVGGKVGSWTDADGNHIEMG  53



>ref|WP_019477173.1| zeta-carotene desaturase [Prochlorococcus sp. W7]
Length=485

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = +3

Query  387  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            +K+AI+G+GLAG++ AV+L+D GH+V+IY+S+ F GGKVGS+VD  GNHIEMG
Sbjct  1    MKIAIVGSGLAGLTAAVDLVDNGHKVEIYESRPFWGGKVGSWVDEEGNHIEMG  53



>ref|WP_009626851.1| zeta-carotene desaturase [Pseudanabaena biceps]
 gb|ELS33038.1| zeta-carotene desaturase [Pseudanabaena biceps PCC 7429]
Length=467

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +3

Query  387  LKVAIIGAGLAGMSTAVELLDQGHEVDIYDSKSFIGGKVGSFVDRRGNHIEMG  545
            +K AIIGAGLAGMSTAVEL +QG+EV++++S+ F+GGKV S++D+ GNHIEMG
Sbjct  1    MKAAIIGAGLAGMSTAVELSEQGYEVELFESRPFVGGKVSSWLDKDGNHIEMG  53



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 579015689490