BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001N14

Length=546
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KDP29212.1|  hypothetical protein JCGZ_16601                         259   2e-82   Jatropha curcas
ref|XP_008442758.1|  PREDICTED: caffeic acid 3-O-methyltransferase      258   1e-81   Cucumis melo [Oriental melon]
ref|XP_004304330.1|  PREDICTED: caffeic acid 3-O-methyltransferase      258   1e-81   Fragaria vesca subsp. vesca
ref|XP_007027514.1|  O-methyltransferase family protein                 251   6e-79   
ref|XP_011101458.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...    250   1e-78   Sesamum indicum [beniseed]
gb|KJB62321.1|  hypothetical protein B456_009G411600                    244   1e-77   Gossypium raimondii
ref|XP_006381360.1|  hypothetical protein POPTR_0006s12160g             244   1e-77   
ref|XP_009341082.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    248   1e-77   Pyrus x bretschneideri [bai li]
gb|KJB62324.1|  hypothetical protein B456_009G411600                    244   2e-77   Gossypium raimondii
gb|KJB62322.1|  hypothetical protein B456_009G411600                    244   2e-77   Gossypium raimondii
ref|XP_006367254.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...    246   5e-77   Solanum tuberosum [potatoes]
ref|XP_006594705.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    244   5e-77   Glycine max [soybeans]
ref|XP_011018830.1|  PREDICTED: caffeic acid 3-O-methyltransferase      246   6e-77   Populus euphratica
ref|XP_004488687.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    245   8e-77   Cicer arietinum [garbanzo]
gb|KGN59032.1|  hypothetical protein Csa_3G747630                       245   1e-76   Cucumis sativus [cucumbers]
ref|XP_007202084.1|  hypothetical protein PRUPE_ppa007420mg             245   1e-76   Prunus persica
ref|XP_006594704.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    245   1e-76   
gb|KJB62323.1|  hypothetical protein B456_009G411600                    244   1e-76   Gossypium raimondii
ref|XP_010267318.1|  PREDICTED: caffeic acid 3-O-methyltransferase      244   2e-76   Nelumbo nucifera [Indian lotus]
ref|XP_008361606.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    242   2e-76   
ref|XP_004137858.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    246   2e-76   
ref|XP_006381361.1|  hypothetical protein POPTR_0006s12160g             244   2e-76   
gb|KJB62320.1|  hypothetical protein B456_009G411600                    244   3e-76   Gossypium raimondii
ref|XP_008241354.1|  PREDICTED: caffeic acid 3-O-methyltransferase      244   3e-76   Prunus mume [ume]
gb|KHG05883.1|  Caffeic acid 3-O-methyltransferase                      244   4e-76   Gossypium arboreum [tree cotton]
ref|XP_002519426.1|  o-methyltransferase, putative                      243   8e-76   Ricinus communis
ref|XP_009341081.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    243   2e-75   Pyrus x bretschneideri [bai li]
gb|AFK33955.1|  unknown                                                 236   2e-75   Medicago truncatula
gb|KEH38506.1|  caffeic acid O-methyltransferase                        241   3e-75   Medicago truncatula
ref|XP_006428524.1|  hypothetical protein CICLE_v10013655mg             238   3e-75   
ref|XP_010312333.1|  PREDICTED: caffeic acid 3-O-methyltransferase 1    240   1e-74   Solanum lycopersicum
emb|CAN65776.1|  hypothetical protein VITISV_030414                     239   2e-74   Vitis vinifera
ref|XP_008361604.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    236   2e-74   
ref|XP_002264566.1|  PREDICTED: caffeic acid 3-O-methyltransferase      239   2e-74   Vitis vinifera
ref|XP_007149437.1|  hypothetical protein PHAVU_005G070300g             238   7e-74   Phaseolus vulgaris [French bean]
ref|XP_006598126.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    237   1e-73   Glycine max [soybeans]
ref|XP_006367255.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    235   6e-73   Solanum tuberosum [potatoes]
ref|XP_009617330.1|  PREDICTED: flavone 3'-O-methyltransferase 1        231   2e-71   Nicotiana tomentosiformis
ref|XP_010050337.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    229   1e-70   Eucalyptus grandis [rose gum]
ref|XP_010504072.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    230   2e-70   Camelina sativa [gold-of-pleasure]
ref|XP_009774776.1|  PREDICTED: caffeic acid 3-O-methyltransferase      224   6e-70   Nicotiana sylvestris
ref|XP_010546519.1|  PREDICTED: flavone 3'-O-methyltransferase 1        227   8e-70   Tarenaya hassleriana [spider flower]
ref|XP_010426946.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    226   2e-69   Camelina sativa [gold-of-pleasure]
ref|XP_006291371.1|  hypothetical protein CARUB_v10017511mg             226   3e-69   Capsella rubella
ref|XP_006403721.1|  hypothetical protein EUTSA_v10010488mg             224   1e-68   Eutrema salsugineum [saltwater cress]
ref|XP_010098845.1|  Caffeic acid 3-O-methyltransferase                 224   2e-68   Morus notabilis
ref|XP_010515802.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    224   2e-68   Camelina sativa [gold-of-pleasure]
ref|XP_006391885.1|  hypothetical protein EUTSA_v10023542mg             223   5e-68   Eutrema salsugineum [saltwater cress]
ref|NP_190882.1|  putative O-diphenol-O-methyl transferase              221   2e-67   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011098295.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...    218   5e-66   Sesamum indicum [beniseed]
ref|XP_010271244.1|  PREDICTED: uncharacterized protein LOC104607...    213   6e-66   Nelumbo nucifera [Indian lotus]
ref|XP_010271241.1|  PREDICTED: uncharacterized protein LOC104607...    213   2e-65   Nelumbo nucifera [Indian lotus]
gb|KFK34550.1|  hypothetical protein AALP_AA5G160800                    214   9e-65   Arabis alpina [alpine rockcress]
ref|XP_011101457.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    213   2e-64   
emb|CDX76223.1|  BnaA04g04870D                                          210   4e-64   
ref|XP_009139429.1|  PREDICTED: caffeic acid 3-O-methyltransferase      210   5e-63   Brassica rapa
emb|CDX95399.1|  BnaC04g27590D                                          208   2e-62   
ref|XP_004502926.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    206   1e-61   Cicer arietinum [garbanzo]
gb|AAP03054.1|  S-adenosyl-L-methionine: beta-alanine N-methyltra...    199   7e-61   Limonium latifolium
gb|KHN47498.1|  Caffeic acid 3-O-methyltransferase                      203   1e-60   Glycine soja [wild soybean]
gb|AAP03058.1|  S-adenosyl-L-methionine: beta-alanine N-methyltra...    197   5e-58   Limonium latifolium
ref|XP_003602597.1|  Caffeic acid 3-O-methyltransferase                 193   2e-56   
emb|CAB65279.1|  O-diphenol-O-methyl transferase                        188   1e-54   Medicago sativa subsp. x varia
gb|AFK47565.1|  unknown                                                 184   1e-54   Medicago truncatula
ref|XP_003602596.1|  Caffeic acid 3-O-methyltransferase                 183   7e-54   
ref|XP_003602595.1|  Caffeic acid 3-O-methyltransferase                 184   6e-53   Medicago truncatula
ref|XP_009382782.1|  PREDICTED: caffeic acid 3-O-methyltransferase      182   2e-52   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAP03053.1|  S-adenosyl-L-methionine: beta-alanine N-methyltra...    171   9e-50   Limonium latifolium
ref|XP_006423903.1|  hypothetical protein CICLE_v10029876mg             173   2e-49   
gb|KDO41959.1|  hypothetical protein CISIN_1g021707mg                   173   3e-49   Citrus sinensis [apfelsine]
gb|KDO38249.1|  hypothetical protein CISIN_1g043063mg                   172   3e-49   Citrus sinensis [apfelsine]
ref|XP_010935842.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    171   3e-48   
gb|AGW45465.1|  beta-alanine n-methyltransferase                        167   3e-48   Reaumuria trigyna
ref|XP_006436414.1|  hypothetical protein CICLE_v10033543mg             170   5e-48   Citrus clementina [clementine]
ref|XP_006485837.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    170   5e-48   Citrus sinensis [apfelsine]
ref|XP_010935841.1|  PREDICTED: quercetin 3-O-methyltransferase 1...    171   1e-47   Elaeis guineensis
ref|XP_006451708.1|  hypothetical protein CICLE_v10010561mg             165   3e-46   
ref|XP_006485822.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    162   1e-45   
dbj|BAJ96291.1|  predicted protein                                      164   2e-45   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010683979.1|  PREDICTED: caffeic acid 3-O-methyltransferase      164   5e-45   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004954455.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    161   2e-44   Setaria italica
ref|XP_002453074.1|  hypothetical protein SORBIDRAFT_04g037820          158   7e-43   Sorghum bicolor [broomcorn]
gb|EEC74273.1|  hypothetical protein OsI_09508                          154   1e-41   Oryza sativa Indica Group [Indian rice]
gb|ACN25427.1|  unknown                                                 154   3e-41   Zea mays [maize]
ref|NP_001149617.1|  LOC100283243                                       154   3e-41   
ref|NP_001048569.1|  Os02g0823400                                       153   3e-41   
ref|XP_003572969.1|  PREDICTED: caffeic acid 3-O-methyltransferase      151   1e-40   Brachypodium distachyon [annual false brome]
ref|XP_010275846.1|  PREDICTED: uncharacterized protein LOC104610771    142   7e-38   
gb|AES72848.2|  caffeic acid O-methyltransferase                        142   3e-37   Medicago truncatula
ref|XP_011101495.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    132   9e-36   
gb|KDO38695.1|  hypothetical protein CISIN_1g037818mg                   130   7e-34   Citrus sinensis [apfelsine]
ref|XP_008387516.1|  PREDICTED: caffeic acid 3-O-methyltransferase      129   1e-32   
ref|XP_006838729.1|  hypothetical protein AMTR_s00002p00253410          129   2e-32   Amborella trichopoda
gb|KCW89310.1|  hypothetical protein EUGRSUZ_A01600                     128   2e-32   Eucalyptus grandis [rose gum]
ref|XP_010243879.1|  PREDICTED: uncharacterized protein LOC104587837    121   3e-31   Nelumbo nucifera [Indian lotus]
ref|XP_006425490.1|  hypothetical protein CICLE_v10027189mg             121   7e-30   
gb|KCW89309.1|  hypothetical protein EUGRSUZ_A01600                     113   1e-26   Eucalyptus grandis [rose gum]
ref|XP_006649184.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...    107   3e-24   
gb|KDO39806.1|  hypothetical protein CISIN_1g025363mg                   105   5e-24   Citrus sinensis [apfelsine]
ref|XP_002986612.1|  hypothetical protein SELMODRAFT_124122           97.8    2e-21   
ref|XP_002965284.1|  hypothetical protein SELMODRAFT_83100            97.4    3e-21   
ref|XP_002986521.1|  hypothetical protein SELMODRAFT_124205           97.1    5e-21   
gb|ADE88153.1|  caffeyl alcohol/5-hydroxyconiferyl alcohol 3/5-O-...  97.4    8e-21   Selaginella moellendorffii
ref|XP_006441597.1|  hypothetical protein CICLE_v10023355mg           93.2    4e-20   
ref|XP_002988275.1|  caffeic acid O-methyltransferase                 95.1    6e-20   Selaginella moellendorffii
ref|XP_002963872.1|  caffeic acid O-methyltransferase                 95.1    6e-20   Selaginella moellendorffii
emb|CCC55423.1|  caffeic acid O-3-methyltransferase                   93.6    2e-19   Pinus pinaster [cluster pine]
gb|AHA44835.1|  caffeate O-methyltransferase                          89.4    6e-18   Larix kaempferi [karamatsu]
gb|ABR18380.1|  unknown                                               89.4    7e-18   Picea sitchensis
emb|CAI30878.1|  caffeate O-methyltransferase                         89.0    8e-18   Picea abies
gb|ABK22490.1|  unknown                                               89.0    9e-18   Picea sitchensis
gb|KDO39478.1|  hypothetical protein CISIN_1g036218mg                 84.0    1e-17   Citrus sinensis [apfelsine]
gb|AAV36348.1|  caffeate O-methyltransferase                          86.7    1e-17   Pinus taeda
ref|XP_002962074.1|  hypothetical protein SELMODRAFT_76630            88.6    1e-17   
ref|XP_002971011.1|  hypothetical protein SELMODRAFT_94918            88.6    1e-17   
gb|KHF97637.1|  Caffeic acid 3-O-methyltransferase                    87.4    2e-17   Gossypium arboreum [tree cotton]
ref|XP_008788729.1|  PREDICTED: tricetin 3',4',5'-O-trimethyltran...  87.4    3e-17   Phoenix dactylifera
gb|AAV36304.1|  caffeate O-methyltransferase                          85.5    4e-17   Pinus taeda
gb|AHY28755.1|  caffeate O-methyltransferase                          85.5    4e-17   Pinus palustris [longleaf pine]
ref|NP_200227.1|  caffeic acid/5-hydroxyferulic acid O-methyltran...  87.0    5e-17   Arabidopsis thaliana [mouse-ear cress]
gb|AAB96879.1|  O-methyltransferase 1                                 86.7    5e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006280681.1|  hypothetical protein CARUB_v10026645mg           86.7    6e-17   Capsella rubella
gb|AAV36354.1|  caffeate O-methyltransferase                          84.7    7e-17   Pinus taeda
gb|AAV36346.1|  caffeate O-methyltransferase                          84.7    7e-17   Pinus taeda
gb|KHF97352.1|  Caffeic acid 3-O-methyltransferase                    85.5    8e-17   Gossypium arboreum [tree cotton]
gb|AER35881.1|  S-adenosyl-L-methionine:flavonoid O-methyltransfe...  86.3    8e-17   Ginkgo biloba [ginkgo]
ref|XP_002864309.1|  O-methyltransferase 1                            86.3    8e-17   
gb|AFM73596.1|  caffeate O-methyltransferase                          85.5    9e-17   Populus simonii
gb|EPS67212.1|  hypothetical protein M569_07558                       86.3    9e-17   Genlisea aurea
gb|ABO41840.1|  putative caffeic acid methyltransferase               85.9    1e-16   Gossypium arboreum [tree cotton]
ref|XP_010241050.1|  PREDICTED: caffeic acid 3-O-methyltransferase 1  85.9    1e-16   Nelumbo nucifera [Indian lotus]
gb|ABO41845.1|  putative caffeic acid methyltransferase               85.5    1e-16   Gossypium hirsutum [American cotton]
gb|KJB16304.1|  hypothetical protein B456_002G222400                  85.9    2e-16   Gossypium raimondii
gb|AAV36308.1|  caffeate O-methyltransferase                          83.6    2e-16   Pinus taeda
gb|ABO41834.1|  putative caffeic acid methyltransferase               85.1    2e-16   Gossypium raimondii
gb|ABO41846.1|  putative caffeic acid methyltransferase               84.7    3e-16   Gossypium hirsutum [American cotton]
gb|AHY28752.1|  caffeate O-methyltransferase                          84.7    3e-16   Pinus echinata [shortleaf pine]
gb|AHY28754.1|  caffeate O-methyltransferase                          84.3    4e-16   Pinus elliottii [American pitch pine]
ref|XP_006401613.1|  hypothetical protein EUTSA_v10013897mg           84.3    4e-16   Eutrema salsugineum [saltwater cress]
dbj|BAJ34520.1|  unnamed protein product                              84.3    4e-16   Eutrema halophilum
gb|ACD56610.1|  putative caffeic acid protein                         84.0    5e-16   Gossypioides kirkii
ref|XP_002864307.1|  O-methyltransferase 1                            83.2    9e-16   Arabidopsis lyrata subsp. lyrata
gb|ABO41852.1|  putative caffeic acid methyltransferase               83.2    9e-16   Gossypium hirsutum [American cotton]
ref|XP_007136428.1|  hypothetical protein PHAVU_009G044400g           83.2    1e-15   Phaseolus vulgaris [French bean]
gb|AHY28757.1|  caffeate O-methyltransferase                          83.2    1e-15   Pinus taeda
gb|ABK21417.1|  unknown                                               82.8    1e-15   Picea sitchensis
dbj|BAK42963.1|  caffeic acid O-methylltransferase                    82.8    1e-15   Chrysanthemum x morifolium [florist's chrysanthemum]
gb|AAD29845.1|AF064697_1  O-methyltransferase                         82.8    1e-15   Thalictrum tuberosum
gb|ABK23795.1|  unknown                                               82.4    2e-15   Picea sitchensis
prf||1906376A  O-methyltransferase                                    82.4    2e-15
ref|XP_009119948.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...  82.4    2e-15   Brassica rapa
gb|AIJ28474.1|  O-methyltransferase                                   82.4    2e-15   Vaccinium corymbosum [American blueberry]
gb|ABU53653.1|  caffeic acid O-3-methyltransferase                    82.4    2e-15   Populus deltoides
ref|XP_008775842.1|  PREDICTED: tricetin 3',4',5'-O-trimethyltran...  82.4    2e-15   Phoenix dactylifera
gb|AAF60951.1|  O-methyltransferase                                   82.4    2e-15   Populus trichocarpa x Populus deltoides
gb|KHG13754.1|  Caffeic acid 3-O-methyltransferase                    82.4    2e-15   Gossypium arboreum [tree cotton]
gb|ACN41351.2|  putative caffeic acid O-methyltransferase             82.0    3e-15   Betula pendula [white birch]
gb|EEC84528.1|  hypothetical protein OsI_31257                        83.2    4e-15   Oryza sativa Indica Group [Indian rice]
gb|AAD29842.1|AF064694_1  catechol O-methyltransferase                81.3    5e-15   Thalictrum tuberosum
gb|KDO40925.1|  hypothetical protein CISIN_1g0357381mg                80.1    5e-15   Citrus sinensis [apfelsine]
gb|ABK25932.1|  unknown                                               80.9    5e-15   Picea sitchensis
sp|Q9XGW0.1|COMT1_OCIBA  RecName: Full=Caffeic acid 3-O-methyltra...  81.3    5e-15   Ocimum basilicum [basil]
gb|AAD29843.1|AF064695_1  catechol O-methyltransferase                81.3    6e-15   Thalictrum tuberosum
prf||2119166A  caffeic acid O-methyltransferase                       81.3    6e-15
gb|ACT32028.1|  caffeic acid O-methyltransferase 1                    81.3    6e-15   Gossypium hirsutum [American cotton]
gb|AAD29844.1|AF064696_1  catechol O-methyltransferase                80.9    6e-15   Thalictrum tuberosum
gb|AGG91492.1|  caffeic acid 3-O-methyltransferase                    80.9    6e-15   Betula platyphylla [Asian white birch]
gb|AAD29841.1|AF064693_1  catechol O-methyltransferase                80.9    6e-15   Thalictrum tuberosum
ref|XP_010671332.1|  PREDICTED: caffeic acid 3-O-methyltransferase    80.9    6e-15   Beta vulgaris subsp. vulgaris [field beet]
gb|AFK40372.1|  unknown                                               80.9    7e-15   Lotus japonicus
emb|CDY43839.1|  BnaC03g14720D                                        80.9    7e-15   Brassica napus [oilseed rape]
gb|KJB52493.1|  hypothetical protein B456_008G264900                  79.7    7e-15   Gossypium raimondii
ref|XP_011043758.1|  PREDICTED: caffeic acid 3-O-methyltransferase 1  80.9    8e-15   Populus euphratica
sp|Q00763.1|COMT1_POPTM  RecName: Full=Caffeic acid 3-O-methyltra...  80.5    8e-15   Populus tremuloides
gb|AFZ78575.1|  caffeic acid O-methyltransferase                      80.5    8e-15   Populus tomentosa [Chinese white poplar]
ref|XP_009132451.1|  PREDICTED: flavone 3'-O-methyltransferase 1      80.5    9e-15   Brassica rapa
ref|XP_002317838.1|  Chain A family protein                           80.5    9e-15   Populus trichocarpa [western balsam poplar]
gb|KFK27028.1|  hypothetical protein AALP_AA8G324800                  80.5    1e-14   Arabis alpina [alpine rockcress]
gb|AAO43609.1|  caffeic acid O-methyltransferase                      80.1    1e-14   Sorghum bicolor [broomcorn]
gb|AAL57301.1|AF387790_1  O-methyltransferase                         80.1    1e-14   Sorghum bicolor [broomcorn]
gb|AFO69477.1|  caffeic acid O-methyltransferase                      80.1    1e-14   Sorghum bicolor [broomcorn]
ref|XP_002525818.1|  o-methyltransferase, putative                    80.1    1e-14   Ricinus communis
ref|XP_010934914.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  80.1    1e-14   Elaeis guineensis
gb|ADO16247.1|  caffeic acid O-methyltransferase                      80.1    1e-14   Ocimum tenuiflorum [holy basil]
sp|Q8W013.1|COMT1_CATRO  RecName: Full=Caffeic acid 3-O-methyltra...  80.1    1e-14   Catharanthus roseus [chatas]
dbj|BAO79380.1|  5-hydroxyconiferylaldehyde O-methyltransferase       79.7    2e-14   Anthriscus sylvestris
gb|AGR85824.1|  caffeic acid O-methyltransferase                      79.0    2e-14   Hibiscus cannabinus [bimli-jute]
gb|AEQ59236.1|  putative S-adenosyl-L-methionine:flavonoid O-meth...  78.6    2e-14   Ginkgo biloba [ginkgo]
gb|KJB52492.1|  hypothetical protein B456_008G264900                  79.7    2e-14   Gossypium raimondii
ref|XP_006441263.1|  hypothetical protein CICLE_v100208142mg          78.2    2e-14   
ref|XP_010103059.1|  Caffeic acid 3-O-methyltransferase               78.6    2e-14   
gb|AET34455.1|  putative S-adenosyl-L-methionine: flavonoid O-met...  78.6    2e-14   Ginkgo biloba [ginkgo]
ref|XP_010934913.1|  PREDICTED: tricetin 3',4',5'-O-trimethyltran...  79.3    2e-14   Elaeis guineensis
ref|XP_006431772.1|  hypothetical protein CICLE_v10001661mg           79.3    2e-14   Citrus clementina [clementine]
gb|AAN03726.1|  caffeic acid O-methyltransferase                      79.0    3e-14   Coffea canephora [robusta coffee]
gb|ABR18103.1|  unknown                                               79.0    3e-14   Picea sitchensis
gb|KDO44005.1|  hypothetical protein CISIN_1g018576mg                 79.0    3e-14   Citrus sinensis [apfelsine]
sp|Q8LL87.1|COMT1_COFCA  RecName: Full=Caffeic acid 3-O-methyltra...  79.0    3e-14   Coffea canephora [robusta coffee]
gb|ABK23414.1|  unknown                                               79.0    3e-14   Picea sitchensis
ref|XP_002445083.1|  hypothetical protein SORBIDRAFT_07g003860        79.0    4e-14   Sorghum bicolor [broomcorn]
gb|AAF63200.1|  caffeic acid O-3-methyltransferase                    79.0    4e-14   Populus tomentosa [Chinese white poplar]
sp|Q6T1F5.1|COMT1_AMMMJ  RecName: Full=Caffeic acid 3-O-methyltra...  79.0    4e-14   Ammi majus [ameo mayor]
ref|XP_009418618.1|  PREDICTED: tricetin 3',4',5'-O-trimethyltran...  78.6    4e-14   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001289246.1|  caffeic acid 3-O-methyltransferase               78.6    5e-14   Pyrus x bretschneideri [bai li]
dbj|BAD18975.1|  phloroglucinol O-methyltransferase                   78.6    5e-14   Rosa chinensis var. spontanea
sp|Q43046.1|COMT1_POPKI  RecName: Full=Caffeic acid 3-O-methyltra...  78.6    5e-14   Populus sieboldii x Populus grandidentata
gb|ADN27527.1|  caffeic acid O-methyltransferase                      78.6    5e-14   Camellia sinensis [black tea]
gb|AAF28353.1|AF220491_1  O-methyltransferase                         78.6    5e-14   Fragaria x ananassa
ref|XP_007223223.1|  hypothetical protein PRUPE_ppa007212mg           78.6    6e-14   Prunus persica
ref|XP_006478090.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  78.2    6e-14   Citrus sinensis [apfelsine]
gb|AGJ84131.1|  putative caffeic acid O-methyltransferase             78.2    6e-14   Hibiscus cannabinus [bimli-jute]
sp|Q8GU25.1|COMT1_ROSCH  RecName: Full=Caffeic acid 3-O-methyltra...  78.2    6e-14   Rosa chinensis [China rose]
gb|KHG13289.1|  Caffeic acid 3-O-methyltransferase                    78.2    7e-14   Gossypium arboreum [tree cotton]
gb|ABI54119.1|  caffeic acid O-methyltransferase                      78.2    7e-14   Malus domestica [apple tree]
dbj|BAC78827.1|  caffeic acid O-methyltransferase                     78.2    7e-14   Rosa chinensis var. spontanea
ref|XP_008376825.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  78.2    7e-14   
gb|KJB23956.1|  hypothetical protein B456_004G125600                  76.6    7e-14   Gossypium raimondii
dbj|BAO79382.1|  hypothetical plant O-methyltransferase               78.2    7e-14   Anthriscus sylvestris
gb|KHN23296.1|  Caffeic acid 3-O-methyltransferase                    77.8    8e-14   Glycine soja [wild soybean]
ref|NP_001242325.1|  uncharacterized protein LOC100805999             77.8    8e-14   
ref|XP_006478241.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  78.6    8e-14   
gb|AHM25237.1|  noraucuparin O-methyltransferase                      77.8    8e-14   Sorbus aucuparia [European mountain ash]
ref|XP_008234634.1|  PREDICTED: caffeic acid 3-O-methyltransferase    77.8    9e-14   Prunus mume [ume]
ref|XP_011075886.1|  PREDICTED: LOW QUALITY PROTEIN: caffeic acid...  77.8    9e-14   
gb|AEV93478.1|  caffeic acid O-methyltransferase                      77.8    9e-14   Caragana korshinskii
ref|XP_008381500.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  78.6    9e-14   
ref|XP_010537046.1|  PREDICTED: flavone 3'-O-methyltransferase 1      77.8    9e-14   Tarenaya hassleriana [spider flower]
ref|XP_008376828.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  77.8    1e-13   Malus domestica [apple tree]
ref|XP_003526767.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  77.8    1e-13   Glycine max [soybeans]
gb|KJB23957.1|  hypothetical protein B456_004G125600                  76.6    1e-13   Gossypium raimondii
ref|XP_004235028.1|  PREDICTED: caffeic acid 3-O-methyltransferase    77.4    1e-13   Solanum lycopersicum
gb|KJB23955.1|  hypothetical protein B456_004G125600                  76.3    1e-13   Gossypium raimondii
ref|XP_009418616.1|  PREDICTED: tricetin 3',4',5'-O-trimethyltran...  77.4    1e-13   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAY86361.1|  caffeic acid O-methyltransferase                      77.4    1e-13   Acacia auriculiformis x Acacia mangium
gb|KDP24164.1|  hypothetical protein JCGZ_25821                       77.4    1e-13   Jatropha curcas
gb|AEO14870.1|  caffeic acid O-methyltransferase                      77.4    1e-13   Salvia miltiorrhiza [Chinese salvia]
ref|XP_002515087.1|  o-methyltransferase, putative                    77.0    1e-13   Ricinus communis
ref|XP_006478243.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  75.5    1e-13   
gb|ACY06328.1|  S-adenosyl-L-methionine: caffeic acid 3-0-methylt...  77.4    1e-13   Medicago sativa [alfalfa]
gb|ADK97702.1|  putative caffeic acid O-methyltransferase             77.4    1e-13   Citrus aurantium [bitter orange]
gb|AEO14871.1|  caffeic acid O-methyltransferase                      77.0    1e-13   Salvia miltiorrhiza [Chinese salvia]
gb|ABG27066.1|  caffeic acid O-methyltransferase                      77.0    1e-13   Boehmeria nivea [Chinese silk-plant]
ref|XP_003602396.1|  Caffeic acid O-methyltransferase                 77.0    2e-13   Medicago truncatula
ref|XP_007039215.1|  Caffeic acid 3-O-methyltransferase 1             77.0    2e-13   
gb|ABI54117.1|  caffeic acid O-methyltransferase                      77.0    2e-13   Malus domestica [apple tree]
gb|AFK39235.1|  unknown                                               77.0    2e-13   Medicago truncatula
pdb|4PGH|A  Chain A, Caffeic Acid O-methyltransferase From Sorghu...  77.0    2e-13   Sorghum bicolor [broomcorn]
dbj|BAE94403.1|  Caffeic acid 3-O-methyltransferase                   77.0    2e-13   Ipomoea nil [qian niu]
ref|NP_001240003.1|  uncharacterized protein LOC100780100             77.0    2e-13   Glycine max [soybeans]
sp|Q9XGV9.1|COMT2_OCIBA  RecName: Full=Caffeic acid 3-O-methyltra...  77.0    2e-13   Ocimum basilicum [basil]
pdb|4PGG|A  Chain A, Caffeic Acid O-methyltransferase From Sorghu...  77.0    2e-13   Sorghum bicolor [broomcorn]
gb|KJB23954.1|  hypothetical protein B456_004G125600                  77.0    2e-13   Gossypium raimondii
dbj|BAE94400.1|  Caffeic acid 3-O-methyltransferase                   77.0    2e-13   Ipomoea nil [qian niu]
ref|XP_009757562.1|  PREDICTED: caffeic acid 3-O-methyltransferase    76.6    2e-13   Nicotiana sylvestris
gb|KDP30064.1|  hypothetical protein JCGZ_18389                       76.6    2e-13   Jatropha curcas
emb|CAA52461.1|  catechol O-methyltransferase                         76.6    2e-13   Nicotiana tabacum [American tobacco]
gb|KDP35860.1|  hypothetical protein JCGZ_10599                       76.6    2e-13   Jatropha curcas
gb|AAC18863.1|  caffeic acid 3-O-methyltransferase                    76.3    2e-13   Mesembryanthemum crystallinum
gb|ACT32029.1|  caffeic acid O-methyltransferase 2                    76.6    2e-13   Gossypium hirsutum [American cotton]
gb|ACT87981.1|  caffeic acid O-methyltransferase                      76.6    2e-13   Jatropha curcas
emb|CDY18306.1|  BnaC09g30560D                                        76.6    2e-13   Brassica napus [oilseed rape]
gb|ADI24332.1|  caffeic acid 3-O-methyltransferase                    76.6    3e-13   Miscanthus sinensis
ref|XP_010442991.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...  76.6    3e-13   Camelina sativa [gold-of-pleasure]
ref|XP_004307899.1|  PREDICTED: caffeic acid 3-O-methyltransferase    76.6    3e-13   Fragaria vesca subsp. vesca
ref|XP_006436320.1|  hypothetical protein CICLE_v10031951mg           75.1    3e-13   
gb|KDO44721.1|  hypothetical protein CISIN_1g036188mg                 74.7    3e-13   Citrus sinensis [apfelsine]
sp|P46484.1|COMT1_EUCGU  RecName: Full=Caffeic acid 3-O-methyltra...  76.3    3e-13   Eucalyptus gunnii
sp|P28002.1|COMT1_MEDSA  RecName: Full=Caffeic acid 3-O-methyltra...  76.3    3e-13   Medicago sativa [alfalfa]
ref|XP_010482824.1|  PREDICTED: flavone 3'-O-methyltransferase 1      76.3    3e-13   Camelina sativa [gold-of-pleasure]
gb|ABS57468.1|  caffeic acid O-methyl transferase                     76.3    4e-13   Leucaena leucocephala [cassie]
sp|O23760.1|COMT1_CLABR  RecName: Full=Caffeic acid 3-O-methyltra...  76.3    4e-13   Clarkia breweri [fairy fans]
ref|XP_004502769.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  76.3    4e-13   Cicer arietinum [garbanzo]
gb|KCW89068.1|  hypothetical protein EUGRSUZ_A01397                   76.6    4e-13   Eucalyptus grandis [rose gum]
ref|XP_008462913.1|  PREDICTED: caffeic acid 3-O-methyltransferase 1  75.9    4e-13   Cucumis melo [Oriental melon]
ref|XP_010446534.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...  75.9    4e-13   Camelina sativa [gold-of-pleasure]
ref|XP_009119951.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...  75.9    4e-13   Brassica rapa
gb|ADB82906.1|  caffeic O-methyltransferase1                          75.9    5e-13   Eucalyptus camaldulensis
ref|XP_010048429.1|  PREDICTED: caffeic acid 3-O-methyltransferase    75.9    5e-13   Eucalyptus grandis [rose gum]
gb|ACY66932.1|  caffeic O-methyltransferase 1                         75.9    5e-13   Eucalyptus camaldulensis
gb|KHN23295.1|  Caffeic acid 3-O-methyltransferase                    75.5    5e-13   
sp|Q43609.1|COMT1_PRUDU  RecName: Full=Caffeic acid 3-O-methyltra...  75.9    5e-13   
ref|XP_006478225.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  74.3    5e-13   
gb|KDP28404.1|  hypothetical protein JCGZ_14175                       75.9    5e-13   
ref|XP_009608171.1|  PREDICTED: caffeic acid 3-O-methyltransferase    75.5    5e-13   
ref|XP_010261275.1|  PREDICTED: LOW QUALITY PROTEIN: (S)-scouleri...  75.5    6e-13   
ref|XP_006436417.1|  hypothetical protein CICLE_v10031953mg           74.3    6e-13   
ref|XP_006478224.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  74.3    6e-13   
ref|XP_003528001.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  75.5    6e-13   
ref|XP_010911558.1|  PREDICTED: tricetin 3',4',5'-O-trimethyltran...  75.5    6e-13   
ref|XP_009352092.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  73.9    7e-13   
gb|ACO90249.1|  scoulerine 9-O-methyltransferase                      73.6    7e-13   
emb|CAA52462.1|  catechol O-methyltransferase                         75.1    7e-13   
ref|XP_006436317.1|  hypothetical protein CICLE_v10031952mg           73.9    8e-13   
ref|XP_006478347.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  75.1    8e-13   
ref|XP_010520933.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...  75.1    8e-13   
gb|AFX98069.1|  caffeic acid O-methyltransferase                      75.1    8e-13   
ref|XP_006441603.1|  hypothetical protein CICLE_v10020875mg           75.1    8e-13   
ref|XP_006441599.1|  hypothetical protein CICLE_v10020870mg           75.1    8e-13   
dbj|BAM05584.1|  caffeic acid O-methyltransferase 2                   74.3    8e-13   
ref|XP_006436319.1|  hypothetical protein CICLE_v10031951mg           74.7    9e-13   
ref|XP_007218166.1|  hypothetical protein PRUPE_ppa007511mg           75.1    9e-13   
sp|P59049.1|OMT1_CHRAE  RecName: Full=Quercetin 3-O-methyltransfe...  74.7    9e-13   
ref|XP_006478221.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  74.7    9e-13   
ref|XP_007218167.1|  hypothetical protein PRUPE_ppa007511mg           75.1    9e-13   
sp|O82054.1|COMT1_SACOF  RecName: Full=Caffeic acid 3-O-methyltra...  75.1    9e-13   
gb|AAQ67347.1|  caffeic acid 3-O-methyltransferase                    74.7    1e-12   
ref|XP_006485684.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  74.7    1e-12   
ref|XP_011084580.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  74.7    1e-12   
ref|XP_006478222.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  74.7    1e-12   
ref|XP_006436416.1|  hypothetical protein CICLE_v10031953mg           74.7    1e-12   
ref|XP_007019090.1|  Caffeic acid 3-O-methyltransferase 1             74.7    1e-12   
gb|AEI54336.1|  S-adenosyl-L-methionine: caffeic acid 3-0-methylt...  74.7    1e-12   
sp|Q42653.1|OMT2_CHRAE  RecName: Full=Quercetin 3-O-methyltransfe...  74.3    1e-12   
ref|XP_002320237.1|  eugenol O-methyltransferase family protein       74.3    1e-12   
ref|XP_008347272.1|  PREDICTED: caffeic acid 3-O-methyltransferase    74.3    1e-12   
ref|XP_008803441.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  74.3    1e-12   
gb|AAS64572.1|  caffeic acid O-methyltransferase                      74.3    2e-12   
ref|XP_006441596.1|  hypothetical protein CICLE_v10023568mg           73.9    2e-12   
ref|XP_008219627.1|  PREDICTED: LOW QUALITY PROTEIN: caffeic acid...  74.3    2e-12   
ref|XP_003634161.1|  PREDICTED: caffeic acid 3-O-methyltransferase    74.3    2e-12   
gb|KDO41090.1|  hypothetical protein CISIN_1g018681mg                 73.9    2e-12   
ref|XP_009361271.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  74.3    2e-12   
ref|XP_006436316.1|  hypothetical protein CICLE_v10031952mg           73.9    2e-12   
ref|XP_006494578.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  73.9    2e-12   
dbj|BAO31651.1|  O-methyltransferase                                  73.9    2e-12   
ref|XP_008358297.1|  PREDICTED: anthranilate N-methyltransferase-...  73.9    2e-12   
ref|XP_004137204.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  73.9    2e-12   
ref|XP_008348753.1|  PREDICTED: anthranilate N-methyltransferase-...  73.9    2e-12   
sp|Q9FQY8.2|COMT1_CAPAN  RecName: Full=Caffeic acid 3-O-methyltra...  73.6    2e-12   
gb|AGS49216.1|  O-methyltransferase                                   73.6    2e-12   
gb|AAG43822.1|AF212316_1  caffeic acid O-methyltransferase            73.6    3e-12   
ref|XP_006442371.1|  hypothetical protein CICLE_v10024037mg           73.6    3e-12   
emb|CDX78145.1|  BnaA09g33400D                                        74.7    3e-12   
ref|XP_010918594.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  73.6    3e-12   
dbj|BAM05583.1|  caffeic acid O-methyltransferase 2                   72.8    3e-12   
ref|XP_011039447.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  73.2    3e-12   
dbj|BAD87408.1|  O-diphenol-O-methyl transferase-like                 70.1    4e-12   
dbj|BAM05582.1|  caffeic acid O-methyltransferase 2                   72.4    4e-12   
dbj|BAA13683.1|  O-methyltransferase                                  73.2    4e-12   
ref|XP_010520935.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  73.2    4e-12   
gb|AAD50440.1|AF168777_1  caffeic acid O-methyltransferase            72.4    4e-12   
ref|XP_006829216.1|  hypothetical protein AMTR_s00001p00272250        72.8    4e-12   
ref|XP_009418619.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  71.2    4e-12   
ref|XP_006436309.1|  hypothetical protein CICLE_v10031949mg           71.6    5e-12   
gb|AAD48913.1|AF139533_1  caffeate O-methyltransferase                73.2    5e-12   
dbj|BAO31650.1|  O-methyltransferase                                  72.8    5e-12   
gb|AAU20770.1|  (S)-scoulerine 9-O-methyltransferase                  72.8    5e-12   
ref|XP_008376824.1|  PREDICTED: caffeic acid 3-O-methyltransferase    72.8    6e-12   
ref|XP_010069184.1|  PREDICTED: uncharacterized protein LOC104456144  70.1    6e-12   
ref|XP_001762717.1|  predicted protein                                72.8    6e-12   
ref|XP_002966220.1|  hypothetical protein SELMODRAFT_85878            72.4    6e-12   
ref|XP_007032646.1|  Caffeic acid 3-O-methyltransferase 1             72.8    6e-12   
ref|XP_006441468.1|  hypothetical protein CICLE_v10020874mg           72.4    7e-12   
sp|O81646.1|COMT1_CAPCH  RecName: Full=Caffeic acid 3-O-methyltra...  72.4    7e-12   
ref|XP_002992222.1|  hypothetical protein SELMODRAFT_134972           71.2    7e-12   
gb|AFD61598.1|  caffeic acid 3-O-methyltransferase                    72.4    8e-12   
ref|XP_006436307.1|  hypothetical protein CICLE_v10031949mg           72.0    8e-12   
ref|XP_002966107.1|  hypothetical protein SELMODRAFT_85724            71.2    8e-12   
ref|XP_006478226.1|  PREDICTED: anthranilate N-methyltransferase-...  72.4    8e-12   
ref|XP_002869549.1|  hypothetical protein ARALYDRAFT_354029           72.4    9e-12   
gb|ABP94018.1|  O-methyltransferase                                   72.0    9e-12   
gb|KDP36008.1|  hypothetical protein JCGZ_10407                       72.0    9e-12   
dbj|BAD83867.1|  Caffeic acid O-methyltransferase                     72.0    9e-12   
ref|XP_004150934.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  72.0    9e-12   
ref|XP_008362805.1|  PREDICTED: caffeic acid 3-O-methyltransferase    72.0    1e-11   
ref|XP_002302676.2|  eugenol O-methyltransferase family protein       72.0    1e-11   
ref|XP_006436308.1|  hypothetical protein CICLE_v10031949mg           72.0    1e-11   
ref|XP_004156527.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  72.0    1e-11   
gb|AAQ01670.1|  catechol O-methyltransferase                          72.0    1e-11   
gb|KDP37670.1|  hypothetical protein JCGZ_06898                       72.0    1e-11   
gb|AGO50639.1|  caffeic acid O-methyltransferase                      72.0    1e-11   
ref|XP_009384375.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  71.6    1e-11   
ref|XP_008244204.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  72.0    1e-11   
ref|XP_010112212.1|  Caffeic acid 3-O-methyltransferase               72.0    1e-11   
ref|XP_004164570.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  72.0    1e-11   
gb|AGS49187.1|  O-methyltransferase                                   71.6    1e-11   
ref|XP_006495276.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  70.1    1e-11   
gb|ACJ76442.1|  caffeic acid 3-O-methyltransferase 2                  71.6    1e-11   
ref|XP_002321948.1|  Chain A family protein                           71.6    1e-11   
ref|XP_006401618.1|  hypothetical protein EUTSA_v10013896mg           71.6    1e-11   
ref|XP_008380838.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  71.6    1e-11   
ref|XP_011025357.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  71.6    1e-11   
gb|AGS49199.1|  O-methyltransferase                                   71.6    1e-11   
sp|Q43047.1|COMT3_POPKI  RecName: Full=Caffeic acid 3-O-methyltra...  71.2    2e-11   
ref|XP_008352782.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  71.2    2e-11   
ref|XP_009384387.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  71.2    2e-11   
gb|ADP00412.1|  putative methyltransferase                            71.2    2e-11   
ref|XP_007015113.1|  Caffeic acid 3-O-methyltransferase 1 isoform 1   71.6    2e-11   
ref|XP_008803442.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  70.9    2e-11   
ref|XP_009392797.1|  PREDICTED: flavone O-methyltransferase 1-like    71.2    2e-11   
ref|XP_007015114.1|  Caffeic acid 3-O-methyltransferase 1 isoform 2   71.6    2e-11   
gb|ABI54118.1|  caffeic acid O-methyltransferase                      71.2    2e-11   
ref|XP_006401615.1|  hypothetical protein EUTSA_v10013908mg           71.2    2e-11   
ref|XP_002869540.1|  hypothetical protein ARALYDRAFT_913747           71.2    2e-11   
gb|AFK39562.1|  unknown                                               70.9    2e-11   
gb|AGS49184.1|  O-methyltransferase                                   70.9    2e-11   
gb|AGS49186.1|  O-methyltransferase                                   70.9    2e-11   
gb|AGS49209.1|  O-methyltransferase                                   70.9    2e-11   
ref|XP_011084578.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  68.2    2e-11   
gb|ABI54120.1|  caffeic acid O-methyltransferase                      70.9    2e-11   
ref|XP_010230425.1|  PREDICTED: tricetin 3',4',5'-O-trimethyltran...  70.9    2e-11   
ref|XP_006386659.1|  hypothetical protein POPTR_0002s18120g           70.9    2e-11   
ref|XP_006386660.1|  hypothetical protein POPTR_0002s18130g           70.9    3e-11   
dbj|BAG71895.1|  5-hydroxyconiferaldehyde O-methyltransferase         70.5    3e-11   
ref|XP_008353353.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  70.5    3e-11   
ref|XP_004509701.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  70.5    4e-11   
ref|XP_010107139.1|  Caffeic acid 3-O-methyltransferase               70.5    4e-11   
gb|ACF04799.1|  caffeic acid 3-O-methytransferase                     70.5    4e-11   
gb|AGS49206.1|  O-methyltransferase                                   70.5    4e-11   
gb|AFZ78574.1|  caffeic acid O-methyltransferase                      70.5    4e-11   
ref|XP_010048410.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  70.5    4e-11   
ref|XP_006443200.1|  hypothetical protein CICLE_v10020377mg           69.7    4e-11   
ref|XP_006494834.1|  PREDICTED: anthranilate N-methyltransferase-...  70.1    4e-11   
ref|XP_006441607.1|  hypothetical protein CICLE_v10020880mg           70.1    4e-11   
ref|XP_011003285.1|  PREDICTED: caffeic acid 3-O-methyltransferase 3  70.1    4e-11   
gb|AET00984.2|  caffeic acid O-methyltransferase                      70.1    5e-11   
gb|AAA80579.1|  3' flavonoid O-methyltransferase                      69.7    5e-11   
gb|EYU19261.1|  hypothetical protein MIMGU_mgv1a026228mg              68.6    5e-11   
ref|XP_006443201.1|  hypothetical protein CICLE_v10020377mg           69.3    6e-11   
gb|AFK45226.1|  unknown                                               69.7    6e-11   
ref|XP_010662844.1|  PREDICTED: caffeic acid O-methyltransferase ...  69.7    6e-11   
ref|XP_010034911.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  69.7    7e-11   
gb|EYU35612.1|  hypothetical protein MIMGU_mgv1a021833mg              68.2    7e-11   
ref|XP_007212477.1|  hypothetical protein PRUPE_ppa015120mg           69.3    7e-11   
emb|CDP21556.1|  unnamed protein product                              68.2    8e-11   
gb|AGS49214.1|  O-methyltransferase                                   69.3    8e-11   
gb|AAQ24361.1|  O-methyltransferase                                   69.3    8e-11   
ref|XP_006413044.1|  hypothetical protein EUTSA_v10027501mg           69.3    8e-11   
gb|AAQ24339.1|  O-methyltransferase                                   69.3    8e-11   
ref|NP_001266643.1|  quercetin 3-O-methyltransferase 1                69.3    8e-11   
gb|AAQ24348.1|  O-methyltransferase                                   69.3    8e-11   
gb|AAQ24338.1|  O-methyltransferase                                   69.3    8e-11   
gb|AGS49183.1|  O-methyltransferase                                   69.3    8e-11   
ref|XP_007143654.1|  hypothetical protein PHAVU_007G090100g           69.3    8e-11   
gb|AAQ24345.1|  O-methyltransferase                                   69.3    8e-11   
ref|XP_009361268.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  69.3    8e-11   
gb|AAQ24343.1|  O-methyltransferase                                   69.3    8e-11   
gb|AGS49200.1|  O-methyltransferase                                   69.3    8e-11   
ref|XP_006434355.1|  hypothetical protein CICLE_v10003445mg           67.0    8e-11   
gb|AAQ24355.1|  O-methyltransferase                                   69.3    8e-11   
gb|AGS49202.1|  O-methyltransferase                                   69.3    8e-11   
gb|AGS49188.1|  O-methyltransferase                                   69.3    8e-11   
gb|AAQ24351.1|  O-methyltransferase                                   69.3    9e-11   
gb|AGS49207.1|  O-methyltransferase                                   69.3    9e-11   
ref|XP_010107138.1|  Caffeic acid 3-O-methyltransferase               68.2    9e-11   
gb|AGS49210.1|  O-methyltransferase                                   69.3    9e-11   
gb|AGS49204.1|  O-methyltransferase                                   69.3    9e-11   
gb|AGS49182.1|  O-methyltransferase                                   69.3    9e-11   
gb|AAQ24342.1|  O-methyltransferase                                   69.3    9e-11   
gb|AAQ24344.1|  O-methyltransferase                                   69.3    9e-11   
gb|AGF25396.1|  caffeic acid 3-O-methyltransferase                    69.3    9e-11   
sp|Q06509.1|COMT1_MAIZE  RecName: Full=Caffeic acid 3-O-methyltra...  69.3    9e-11   
gb|AAQ24337.1|  O-methyltransferase                                   69.3    9e-11   
ref|NP_001106047.1|  catechol O-methyltransferase                     69.3    9e-11   
gb|AGS49181.1|  O-methyltransferase                                   69.3    9e-11   
gb|AGS49217.1|  O-methyltransferase                                   69.3    9e-11   
gb|AGS49208.1|  O-methyltransferase                                   69.3    9e-11   
gb|AGS49201.1|  O-methyltransferase                                   69.3    9e-11   
gb|AGS49185.1|  O-methyltransferase                                   69.3    9e-11   
ref|XP_004169230.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  67.8    1e-10   
ref|XP_006443203.1|  hypothetical protein CICLE_v10020377mg           69.3    1e-10   
ref|XP_003618025.1|  Caffeic acid 3-O-methyltransferase               68.9    1e-10   
gb|ACB59042.1|  caffeic acid O-3-methyltransferase-like protein       65.9    1e-10   
gb|AFK41218.1|  unknown                                               68.9    1e-10   
ref|XP_003621323.1|  Isoliquiritigenin 2'-O-methyltransferase         68.9    1e-10   
gb|ADA61114.1|  caffeic acid o-methyltransferase                      68.6    1e-10   
gb|ACB59038.1|  caffeic acid O-3-methyltransferase-like protein       65.9    1e-10   
ref|XP_008367482.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  68.6    2e-10   
gb|AGS49196.1|  O-methyltransferase                                   68.6    2e-10   
gb|AGS49205.1|  O-methyltransferase                                   68.6    2e-10   
ref|XP_010100665.1|  Anthranilate N-methyltransferase                 68.6    2e-10   
sp|Q39522.1|SMT_COPJA  RecName: Full=(S)-scoulerine 9-O-methyltra...  68.6    2e-10   
ref|XP_008357058.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  68.6    2e-10   
gb|ABQ58825.1|  flavonoid O-methyltransferase                         68.2    2e-10   
ref|XP_003573470.1|  PREDICTED: flavone O-methyltransferase 1         68.2    2e-10   
emb|CDY19037.1|  BnaC01g20310D                                        68.2    2e-10   
gb|ACB59041.1|  caffeic acid O-3-methyltransferase-like protein       65.9    2e-10   
gb|ACB59039.1|  caffeic acid O-3-methyltransferase-like protein       65.9    2e-10   
gb|KDP32877.1|  hypothetical protein JCGZ_12169                       68.2    2e-10   
ref|XP_009361272.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  68.2    2e-10   
ref|XP_010520934.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  68.2    2e-10   
gb|AGS49191.1|  O-methyltransferase                                   68.2    2e-10   
ref|XP_004148286.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  68.2    2e-10   
gb|AJK93386.1|  caffeic acid O-methyltransferase                      68.2    2e-10   
ref|XP_006441606.1|  hypothetical protein CICLE_v10023994mg           67.8    2e-10   
sp|Q43239.1|COMT1_ZINVI  RecName: Full=Caffeic acid 3-O-methyltra...  67.8    3e-10   
gb|EMT17011.1|  Caffeic acid 3-O-methyltransferase                    67.8    3e-10   
ref|XP_010061962.1|  PREDICTED: caffeic acid 3-O-methyltransferase    67.8    3e-10   
emb|CDY41780.1|  BnaC02g13760D                                        66.6    3e-10   
gb|ABP63535.1|  caffeic acid 3-O-methyltransferase                    67.8    3e-10   
ref|XP_010527383.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  67.8    3e-10   
sp|Q38J50.1|FOMT2_WHEAT  RecName: Full=Tricetin 3',4',5'-O-trimet...  67.8    3e-10   
gb|KCW90804.1|  hypothetical protein EUGRSUZ_A02870                   67.8    3e-10   
ref|XP_004496361.1|  PREDICTED: isoliquiritigenin 2'-O-methyltran...  67.8    3e-10   
ref|XP_008343466.1|  PREDICTED: anthranilate N-methyltransferase-...  67.8    3e-10   
ref|XP_010660322.1|  PREDICTED: caffeic acid 3-O-methyltransferase    67.8    3e-10   
gb|AGS49219.1|  O-methyltransferase                                   67.8    3e-10   
emb|CDM87233.1|  unnamed protein product                              67.4    3e-10   
ref|XP_006659136.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...  67.4    3e-10   
gb|AGS49190.1|  O-methyltransferase                                   67.4    4e-10   



>gb|KDP29212.1| hypothetical protein JCGZ_16601 [Jatropha curcas]
Length=357

 Score =   259 bits (663),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 123/159 (77%), Positives = 140/159 (88%), Gaps = 1/159 (1%)
 Frame = +1

Query  70   AMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSV  249
            AM  ES  ++  ARL I+ELANMISVPMSLNA+VRLNVAD IWQGG+NAPLSASEIL+ V
Sbjct  2    AMEDESSESRNRARLAILELANMISVPMSLNAIVRLNVADVIWQGGANAPLSASEILARV  61

Query  250  LPSGGGDAQNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGAYVL  429
             PSGG D +NLQRILRMLTSY VF EH+N+DA+ERRYSL E+GKTLVTD +GLSY +YVL
Sbjct  62   HPSGG-DPENLQRILRMLTSYDVFTEHVNSDATERRYSLTEIGKTLVTDSEGLSYASYVL  120

Query  430  QHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
            QHHQDALM+AWPLVHEAVVD ++EPFVKAN EPAY+YYG
Sbjct  121  QHHQDALMRAWPLVHEAVVDPTTEPFVKANDEPAYAYYG  159



>ref|XP_008442758.1| PREDICTED: caffeic acid 3-O-methyltransferase [Cucumis melo]
Length=371

 Score =   258 bits (659),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 118/150 (79%), Positives = 134/150 (89%), Gaps = 0/150 (0%)
 Frame = +1

Query  97   QKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQ  276
            Q  ARL I+ELANMISVPMSLNA+VRLNVADAIWQ GSN+PLSASEIL+ V+PSGGGDA 
Sbjct  24   QNKARLAILELANMISVPMSLNAIVRLNVADAIWQNGSNSPLSASEILARVVPSGGGDAH  83

Query  277  NLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQDALMK  456
            NL+RILRMLTSYGVF EH++ ++S  RYSL +VGKTLVTD DGLSY  YVLQHHQDALM+
Sbjct  84   NLERILRMLTSYGVFEEHLSPNSSNHRYSLTDVGKTLVTDTDGLSYAPYVLQHHQDALMR  143

Query  457  AWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
            AWP VHEA +DS++EPFV+ANGEPAYSYYG
Sbjct  144  AWPRVHEAAIDSTTEPFVRANGEPAYSYYG  173



>ref|XP_004304330.1| PREDICTED: caffeic acid 3-O-methyltransferase [Fragaria vesca 
subsp. vesca]
Length=358

 Score =   258 bits (658),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 121/153 (79%), Positives = 133/153 (87%), Gaps = 0/153 (0%)
 Frame = +1

Query  88   ESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGG  267
            + A   AR+ I+ELANMISVPMSLNAVVRLNVADAIWQ GSN PLSAS+IL  VLP+G G
Sbjct  8    KEASNEARIAILELANMISVPMSLNAVVRLNVADAIWQKGSNTPLSASQILERVLPTGSG  67

Query  268  DAQNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQDA  447
            DA+NLQRILRMLTSYGVF EH NAD SER++SL EVG+TLVT++DGLSYG YVLQHHQD 
Sbjct  68   DAENLQRILRMLTSYGVFSEHFNADGSERKFSLTEVGQTLVTNQDGLSYGDYVLQHHQDV  127

Query  448  LMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
            LM AWPLVHEAV+D S EPFVKANGEPAY YYG
Sbjct  128  LMGAWPLVHEAVIDPSVEPFVKANGEPAYQYYG  160



>ref|XP_007027514.1| O-methyltransferase family protein [Theobroma cacao]
 gb|EOY08016.1| O-methyltransferase family protein [Theobroma cacao]
Length=356

 Score =   251 bits (640),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 115/158 (73%), Positives = 135/158 (85%), Gaps = 0/158 (0%)
 Frame = +1

Query  73   MGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVL  252
            M  E+  ++  ARL I+ELANM+SVPMSLNAVVRLNV DAIWQGG+N PLSA++ILS VL
Sbjct  1    MEDETADSRNKARLAILELANMMSVPMSLNAVVRLNVPDAIWQGGANTPLSATQILSRVL  60

Query  253  PSGGGDAQNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGAYVLQ  432
            PSGGGD +NLQRILRMLTSYGVF EH++++  ERR+SL ++GKTLVTD DGLS   YVLQ
Sbjct  61   PSGGGDPENLQRILRMLTSYGVFAEHLDSECPERRFSLTDIGKTLVTDADGLSCAPYVLQ  120

Query  433  HHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
            HHQDALM+ WPL+HEAV+D +SEPFVK NGE AYSYYG
Sbjct  121  HHQDALMRVWPLMHEAVLDPTSEPFVKVNGEAAYSYYG  158



>ref|XP_011101458.1| PREDICTED: flavone 3'-O-methyltransferase 1-like [Sesamum indicum]
Length=354

 Score =   250 bits (639),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 122/154 (79%), Positives = 138/154 (90%), Gaps = 1/154 (1%)
 Frame = +1

Query  88   ESAQKNARLT-IMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGG  264
            E++Q N+  T IMELANMISVPM+LNAVVRLNVADAIWQGGSN PLSA+EILS+     G
Sbjct  2    ENSQTNSPTTAIMELANMISVPMALNAVVRLNVADAIWQGGSNNPLSAAEILSAAAVGPG  61

Query  265  GDAQNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQD  444
            GDA+NLQRILR+LTS+GVF EH+NADA++RRYSL EVGKTL TD++GLSYGAYVLQHHQD
Sbjct  62   GDAENLQRILRLLTSFGVFEEHLNADATKRRYSLTEVGKTLATDENGLSYGAYVLQHHQD  121

Query  445  ALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
            ALM+AW LVHEAV+D SSEPFVKANGE AYSYYG
Sbjct  122  ALMRAWTLVHEAVLDPSSEPFVKANGEGAYSYYG  155



>gb|KJB62321.1| hypothetical protein B456_009G411600 [Gossypium raimondii]
Length=248

 Score =   244 bits (622),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 119/160 (74%), Positives = 135/160 (84%), Gaps = 6/160 (4%)
 Frame = +1

Query  82   ESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSG  261
             +ES+ K ARL IMELANMISVPMSLNA+VRLNV DAIWQGG+N PLS  +ILS VLPSG
Sbjct  6    RAESSNK-ARLAIMELANMISVPMSLNAIVRLNVPDAIWQGGANTPLSVVQILSRVLPSG  64

Query  262  GGDAQNLQRILRMLTSYGVFREHINAD-----ASERRYSLGEVGKTLVTDKDGLSYGAYV  426
            GGD +NLQRILRMLTSYGVF EH+N       + ER+YSL ++GKTLVTD +GLSY  YV
Sbjct  65   GGDPENLQRILRMLTSYGVFDEHLNCSGDDSHSPERKYSLTDIGKTLVTDAEGLSYAPYV  124

Query  427  LQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
            LQHHQDALM+AWPLVHEAV++ +SEPFVKANGE AYSYYG
Sbjct  125  LQHHQDALMRAWPLVHEAVLNPTSEPFVKANGEGAYSYYG  164



>ref|XP_006381360.1| hypothetical protein POPTR_0006s12160g [Populus trichocarpa]
 gb|ERP59157.1| hypothetical protein POPTR_0006s12160g [Populus trichocarpa]
Length=270

 Score =   244 bits (624),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 120/166 (72%), Positives = 135/166 (81%), Gaps = 8/166 (5%)
 Frame = +1

Query  70   AMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSV  249
            A+  ES   +K+ARL I ELANMISVPMSLNA+VRL VADAIWQGGSNAPLSAS+IL  +
Sbjct  2    ALNEESAEKRKSARLAIFELANMISVPMSLNAIVRLKVADAIWQGGSNAPLSASQILQRI  61

Query  250  LPSGGGDAQNLQRILRMLTSYGVFREHINADAS-------ERRYSLGEVGKTLVTDKDGL  408
              S G D +NLQRILRMLTSYGVF EH+  ++S       ER+YSL EVGKTLVTD +GL
Sbjct  62   A-STGSDPENLQRILRMLTSYGVFEEHLTIESSPLDGSVSERKYSLTEVGKTLVTDTEGL  120

Query  409  SYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
            SY  YVLQHHQDALMKAWPLVHEAV+D ++EPFVKANGEPAY YYG
Sbjct  121  SYAPYVLQHHQDALMKAWPLVHEAVLDPTTEPFVKANGEPAYDYYG  166



>ref|XP_009341082.1| PREDICTED: caffeic acid 3-O-methyltransferase isoform X2 [Pyrus 
x bretschneideri]
Length=369

 Score =   248 bits (632),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 119/157 (76%), Positives = 136/157 (87%), Gaps = 3/157 (2%)
 Frame = +1

Query  85   SESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGG  264
            S S+   ARL I+ELANMISVPMSLNAVVRLNVADAIWQGG N PLSAS+IL+ VLP+GG
Sbjct  15   SSSSSNEARLAILELANMISVPMSLNAVVRLNVADAIWQGGCNTPLSASDILARVLPNGG  74

Query  265  GDAQNLQRILRMLTSYGVFREHI-NAD--ASERRYSLGEVGKTLVTDKDGLSYGAYVLQH  435
            GDA+NLQRILRMLTSYGVF EH+ N D  + +R++SL  +G+TLVTD++GLSYG YVLQH
Sbjct  75   GDAENLQRILRMLTSYGVFEEHLSNLDDGSDDRKFSLTPIGQTLVTDQNGLSYGPYVLQH  134

Query  436  HQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
            HQD LM AWP+VHEAVVDS+ EPFVKANGEPAY YYG
Sbjct  135  HQDVLMGAWPMVHEAVVDSTVEPFVKANGEPAYEYYG  171



>gb|KJB62324.1| hypothetical protein B456_009G411600 [Gossypium raimondii]
Length=269

 Score =   244 bits (623),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 119/160 (74%), Positives = 135/160 (84%), Gaps = 6/160 (4%)
 Frame = +1

Query  82   ESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSG  261
             +ES+ K ARL IMELANMISVPMSLNA+VRLNV DAIWQGG+N PLS  +ILS VLPSG
Sbjct  6    RAESSNK-ARLAIMELANMISVPMSLNAIVRLNVPDAIWQGGANTPLSVVQILSRVLPSG  64

Query  262  GGDAQNLQRILRMLTSYGVFREHINAD-----ASERRYSLGEVGKTLVTDKDGLSYGAYV  426
            GGD +NLQRILRMLTSYGVF EH+N       + ER+YSL ++GKTLVTD +GLSY  YV
Sbjct  65   GGDPENLQRILRMLTSYGVFDEHLNCSGDDSHSPERKYSLTDIGKTLVTDAEGLSYAPYV  124

Query  427  LQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
            LQHHQDALM+AWPLVHEAV++ +SEPFVKANGE AYSYYG
Sbjct  125  LQHHQDALMRAWPLVHEAVLNPTSEPFVKANGEGAYSYYG  164



>gb|KJB62322.1| hypothetical protein B456_009G411600 [Gossypium raimondii]
Length=258

 Score =   244 bits (622),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 119/160 (74%), Positives = 135/160 (84%), Gaps = 6/160 (4%)
 Frame = +1

Query  82   ESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSG  261
             +ES+ K ARL IMELANMISVPMSLNA+VRLNV DAIWQGG+N PLS  +ILS VLPSG
Sbjct  6    RAESSNK-ARLAIMELANMISVPMSLNAIVRLNVPDAIWQGGANTPLSVVQILSRVLPSG  64

Query  262  GGDAQNLQRILRMLTSYGVFREHINAD-----ASERRYSLGEVGKTLVTDKDGLSYGAYV  426
            GGD +NLQRILRMLTSYGVF EH+N       + ER+YSL ++GKTLVTD +GLSY  YV
Sbjct  65   GGDPENLQRILRMLTSYGVFDEHLNCSGDDSHSPERKYSLTDIGKTLVTDAEGLSYAPYV  124

Query  427  LQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
            LQHHQDALM+AWPLVHEAV++ +SEPFVKANGE AYSYYG
Sbjct  125  LQHHQDALMRAWPLVHEAVLNPTSEPFVKANGEGAYSYYG  164



>ref|XP_006367254.1| PREDICTED: flavone 3'-O-methyltransferase 1-like [Solanum tuberosum]
Length=361

 Score =   246 bits (628),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 118/148 (80%), Positives = 133/148 (90%), Gaps = 1/148 (1%)
 Frame = +1

Query  106  ARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVL-PSGGGDAQNL  282
            ARL IMELANMISVPMSLNAVV+L VADAIWQ GSNAPLS  EIL+ +  P GGGDA+NL
Sbjct  15   ARLAIMELANMISVPMSLNAVVKLKVADAIWQNGSNAPLSPVEILAKIRGPQGGGDAENL  74

Query  283  QRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQDALMKAW  462
            QRILRMLTSYGVF+EH+  D+S+RRYSL EVGKTLVTD++GLS+G+YVLQHHQDALM+AW
Sbjct  75   QRILRMLTSYGVFKEHVVDDSSQRRYSLTEVGKTLVTDENGLSHGSYVLQHHQDALMRAW  134

Query  463  PLVHEAVVDSSSEPFVKANGEPAYSYYG  546
             +VHEAV DSS EPFVKANGEPAY+YYG
Sbjct  135  TMVHEAVNDSSIEPFVKANGEPAYNYYG  162



>ref|XP_006594705.1| PREDICTED: caffeic acid 3-O-methyltransferase-like isoform X2 
[Glycine max]
Length=298

 Score =   244 bits (622),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 116/154 (75%), Positives = 133/154 (86%), Gaps = 2/154 (1%)
 Frame = +1

Query  82   ESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSG  261
            ES   +K ARL IMELANMISVPM+LNAVVRLNVADAIWQGG+N PLSA+EIL  +LP+G
Sbjct  5    ESTEQRKQARLAIMELANMISVPMALNAVVRLNVADAIWQGGANNPLSAAEILPRLLPAG  64

Query  262  GGDAQNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQ  441
            GGDA+NLQR+LRML SYGVF EH++  A ER+YSL +VGKTLVTD+ GLSY  YVLQHHQ
Sbjct  65   GGDAENLQRLLRMLASYGVFYEHLS--AGERKYSLTDVGKTLVTDEQGLSYAHYVLQHHQ  122

Query  442  DALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYY  543
            DALM+AWP+VHEAVVD + EPF +ANGEPAY YY
Sbjct  123  DALMRAWPMVHEAVVDPTKEPFERANGEPAYGYY  156



>ref|XP_011018830.1| PREDICTED: caffeic acid 3-O-methyltransferase [Populus euphratica]
Length=364

 Score =   246 bits (628),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 121/166 (73%), Positives = 136/166 (82%), Gaps = 8/166 (5%)
 Frame = +1

Query  70   AMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSV  249
            A+  ES   +K+ARL I+ELANMISVPMSLNA+VRL VADAIWQGGSNAPLSAS+IL  +
Sbjct  2    ALNEESAEKRKSARLAILELANMISVPMSLNAIVRLKVADAIWQGGSNAPLSASQILQRI  61

Query  250  LPSGGGDAQNLQRILRMLTSYGVFREHI-------NADASERRYSLGEVGKTLVTDKDGL  408
              S G D +NLQRILRMLTSYGVF EH+       +  ASER+YSL EVGKTLVTD +GL
Sbjct  62   -ASTGSDPENLQRILRMLTSYGVFEEHLTNESSPLDGSASERKYSLTEVGKTLVTDTEGL  120

Query  409  SYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
            SY  YVLQHHQDALMKAWPLVHEAV+D ++EPFVKANGEPAY YYG
Sbjct  121  SYAPYVLQHHQDALMKAWPLVHEAVLDPTTEPFVKANGEPAYDYYG  166



>ref|XP_004488687.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Cicer arietinum]
Length=353

 Score =   245 bits (626),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 117/154 (76%), Positives = 132/154 (86%), Gaps = 2/154 (1%)
 Frame = +1

Query  82   ESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSG  261
            E   ++K ARL+I+ELANMISVPMSLNAVVRLNVADAIW+GGSNAPLSA +IL  VLP G
Sbjct  3    EDTDSRKQARLSILELANMISVPMSLNAVVRLNVADAIWEGGSNAPLSADQILKRVLPGG  62

Query  262  GGDAQNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQ  441
            GGDA+NLQR+LRMLTSY VF EH+     ER+YSL +VGKTLVTD+ GLSYG+YVLQHHQ
Sbjct  63   GGDAENLQRVLRMLTSYDVFEEHLG--GGERKYSLTDVGKTLVTDEQGLSYGSYVLQHHQ  120

Query  442  DALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYY  543
            DALM+AWPLVHEAVVD S EPF +ANGE AY YY
Sbjct  121  DALMRAWPLVHEAVVDPSKEPFERANGEAAYDYY  154



>gb|KGN59032.1| hypothetical protein Csa_3G747630 [Cucumis sativus]
Length=370

 Score =   245 bits (626),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 116/150 (77%), Positives = 132/150 (88%), Gaps = 1/150 (1%)
 Frame = +1

Query  97   QKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQ  276
            Q  ARL I+ELANMISVPMSLNA+VRLNVADAIWQ GSN+PLSASEIL+ V+PSGG DA 
Sbjct  24   QNKARLAIIELANMISVPMSLNAIVRLNVADAIWQNGSNSPLSASEILARVVPSGG-DAH  82

Query  277  NLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQDALMK  456
            NL+RILRMLTSYGVF EH++ ++S  RYSL +VGKTLVTD DGLSY  YVLQHHQDALM+
Sbjct  83   NLERILRMLTSYGVFEEHLSPNSSNHRYSLTDVGKTLVTDSDGLSYAPYVLQHHQDALMR  142

Query  457  AWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
            AWP VHEA +DS++EPFV+ANGE AYSYYG
Sbjct  143  AWPRVHEAAIDSTTEPFVRANGEAAYSYYG  172



>ref|XP_007202084.1| hypothetical protein PRUPE_ppa007420mg [Prunus persica]
 gb|EMJ03283.1| hypothetical protein PRUPE_ppa007420mg [Prunus persica]
Length=368

 Score =   245 bits (626),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 118/161 (73%), Positives = 135/161 (84%), Gaps = 5/161 (3%)
 Frame = +1

Query  79   SESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPS  258
            + +E     ARL I+ELANMISVPMSLNAVVRLNV DAIWQGGSN+PLSAS ILS VLP 
Sbjct  10   TTAEQPSNEARLGILELANMISVPMSLNAVVRLNVPDAIWQGGSNSPLSASAILSHVLPD  69

Query  259  GGGDAQNLQRILRMLTSYGVFREH-INAD----ASERRYSLGEVGKTLVTDKDGLSYGAY  423
            GGGDA+NLQRILRMLTSYGVF EH ++AD    + +R++SL E+GKTLVTD++GLSYG Y
Sbjct  70   GGGDAENLQRILRMLTSYGVFAEHLVSADDDGGSHQRKFSLTEIGKTLVTDQNGLSYGPY  129

Query  424  VLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
            +LQHHQD LM AWP+VHEAVVD + EPFVK NGEPAY YYG
Sbjct  130  ILQHHQDVLMGAWPMVHEAVVDPTIEPFVKVNGEPAYEYYG  170



>ref|XP_006594704.1| PREDICTED: caffeic acid 3-O-methyltransferase-like isoform X1 
[Glycine max]
Length=355

 Score =   245 bits (625),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 116/155 (75%), Positives = 133/155 (86%), Gaps = 2/155 (1%)
 Frame = +1

Query  79   SESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPS  258
             ES   +K ARL IMELANMISVPM+LNAVVRLNVADAIWQGG+N PLSA+EIL  +LP+
Sbjct  4    EESTEQRKQARLAIMELANMISVPMALNAVVRLNVADAIWQGGANNPLSAAEILPRLLPA  63

Query  259  GGGDAQNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGAYVLQHH  438
            GGGDA+NLQR+LRML SYGVF EH++  A ER+YSL +VGKTLVTD+ GLSY  YVLQHH
Sbjct  64   GGGDAENLQRLLRMLASYGVFYEHLS--AGERKYSLTDVGKTLVTDEQGLSYAHYVLQHH  121

Query  439  QDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYY  543
            QDALM+AWP+VHEAVVD + EPF +ANGEPAY YY
Sbjct  122  QDALMRAWPMVHEAVVDPTKEPFERANGEPAYGYY  156



>gb|KJB62323.1| hypothetical protein B456_009G411600 [Gossypium raimondii]
Length=347

 Score =   244 bits (624),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 119/159 (75%), Positives = 135/159 (85%), Gaps = 6/159 (4%)
 Frame = +1

Query  85   SESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGG  264
            +ES+ K ARL IMELANMISVPMSLNA+VRLNV DAIWQGG+N PLS  +ILS VLPSGG
Sbjct  7    AESSNK-ARLAIMELANMISVPMSLNAIVRLNVPDAIWQGGANTPLSVVQILSRVLPSGG  65

Query  265  GDAQNLQRILRMLTSYGVFREHINAD-----ASERRYSLGEVGKTLVTDKDGLSYGAYVL  429
            GD +NLQRILRMLTSYGVF EH+N       + ER+YSL ++GKTLVTD +GLSY  YVL
Sbjct  66   GDPENLQRILRMLTSYGVFDEHLNCSGDDSHSPERKYSLTDIGKTLVTDAEGLSYAPYVL  125

Query  430  QHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
            QHHQDALM+AWPLVHEAV++ +SEPFVKANGE AYSYYG
Sbjct  126  QHHQDALMRAWPLVHEAVLNPTSEPFVKANGEGAYSYYG  164



>ref|XP_010267318.1| PREDICTED: caffeic acid 3-O-methyltransferase [Nelumbo nucifera]
Length=354

 Score =   244 bits (624),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 117/158 (74%), Positives = 131/158 (83%), Gaps = 2/158 (1%)
 Frame = +1

Query  73   MGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVL  252
            M  E+   + NARL I+ELANMISVPMSLNA+VRL V DAIWQ GSN PLSASEIL+  L
Sbjct  1    MADETTEIRNNARLAILELANMISVPMSLNAIVRLKVPDAIWQSGSNVPLSASEILARAL  60

Query  253  PSGGGDAQNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGAYVLQ  432
            P+G  D +NLQRILRMLT+Y VF EHI   +SER+YSL E+GKTLVTD +GLSY AYVLQ
Sbjct  61   PTG--DPENLQRILRMLTTYDVFSEHIADGSSERKYSLTEIGKTLVTDGEGLSYAAYVLQ  118

Query  433  HHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
            HHQDALMKAWP++HEAVVD   EPFVKANGEPAYSYYG
Sbjct  119  HHQDALMKAWPILHEAVVDPKEEPFVKANGEPAYSYYG  156



>ref|XP_008361606.1| PREDICTED: caffeic acid 3-O-methyltransferase 1-like isoform 
X2 [Malus domestica]
Length=278

 Score =   242 bits (617),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 115/170 (68%), Positives = 139/170 (82%), Gaps = 3/170 (2%)
 Frame = +1

Query  46   ITGKKEIEAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLS  225
            + G  ++  + +   S+   ARL I+ELANMISVPMSLNAVVRLNV DAIWQGG N PLS
Sbjct  1    MEGNNQVSNVTAGPSSSNNEARLAILELANMISVPMSLNAVVRLNVPDAIWQGGCNTPLS  60

Query  226  ASEILSSVLPSGGGDAQNLQRILRMLTSYGVFREHI-NAD--ASERRYSLGEVGKTLVTD  396
            AS++L+ V+P+GGGDA+NLQRILRMLTSYGVF EH+ N D  + +R++SL  +G+TLVTD
Sbjct  61   ASDVLARVIPNGGGDAENLQRILRMLTSYGVFEEHLSNLDDGSDDRKFSLTPIGQTLVTD  120

Query  397  KDGLSYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
            ++GLSYG YVLQHHQD LM AWP+VHEAVVDS+ EPFVKANGE AY YYG
Sbjct  121  QNGLSYGPYVLQHHQDVLMGAWPMVHEAVVDSTVEPFVKANGELAYEYYG  170



>ref|XP_004137858.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Cucumis sativus]
 ref|XP_004169388.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Cucumis sativus]
Length=409

 Score =   246 bits (627),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 116/150 (77%), Positives = 132/150 (88%), Gaps = 1/150 (1%)
 Frame = +1

Query  97   QKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQ  276
            Q  ARL I+ELANMISVPMSLNA+VRLNVADAIWQ GSN+PLSASEIL+ V+PSGG DA 
Sbjct  61   QNKARLAIIELANMISVPMSLNAIVRLNVADAIWQNGSNSPLSASEILARVVPSGG-DAH  119

Query  277  NLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQDALMK  456
            NL+RILRMLTSYGVF EH++ ++S  RYSL +VGKTLVTD DGLSY  YVLQHHQDALM+
Sbjct  120  NLERILRMLTSYGVFEEHLSPNSSNHRYSLTDVGKTLVTDSDGLSYAPYVLQHHQDALMR  179

Query  457  AWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
            AWP VHEA +DS++EPFV+ANGE AYSYYG
Sbjct  180  AWPRVHEAAIDSTTEPFVRANGEAAYSYYG  209



>ref|XP_006381361.1| hypothetical protein POPTR_0006s12160g [Populus trichocarpa]
 gb|ERP59158.1| hypothetical protein POPTR_0006s12160g [Populus trichocarpa]
Length=364

 Score =   244 bits (624),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 120/166 (72%), Positives = 135/166 (81%), Gaps = 8/166 (5%)
 Frame = +1

Query  70   AMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSV  249
            A+  ES   +K+ARL I ELANMISVPMSLNA+VRL VADAIWQGGSNAPLSAS+IL  +
Sbjct  2    ALNEESAEKRKSARLAIFELANMISVPMSLNAIVRLKVADAIWQGGSNAPLSASQILQRI  61

Query  250  LPSGGGDAQNLQRILRMLTSYGVFREHINADAS-------ERRYSLGEVGKTLVTDKDGL  408
              S G D +NLQRILRMLTSYGVF EH+  ++S       ER+YSL EVGKTLVTD +GL
Sbjct  62   -ASTGSDPENLQRILRMLTSYGVFEEHLTIESSPLDGSVSERKYSLTEVGKTLVTDTEGL  120

Query  409  SYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
            SY  YVLQHHQDALMKAWPLVHEAV+D ++EPFVKANGEPAY YYG
Sbjct  121  SYAPYVLQHHQDALMKAWPLVHEAVLDPTTEPFVKANGEPAYDYYG  166



>gb|KJB62320.1| hypothetical protein B456_009G411600 [Gossypium raimondii]
Length=361

 Score =   244 bits (623),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 119/159 (75%), Positives = 135/159 (85%), Gaps = 6/159 (4%)
 Frame = +1

Query  85   SESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGG  264
            +ES+ K ARL IMELANMISVPMSLNA+VRLNV DAIWQGG+N PLS  +ILS VLPSGG
Sbjct  7    AESSNK-ARLAIMELANMISVPMSLNAIVRLNVPDAIWQGGANTPLSVVQILSRVLPSGG  65

Query  265  GDAQNLQRILRMLTSYGVFREHINAD-----ASERRYSLGEVGKTLVTDKDGLSYGAYVL  429
            GD +NLQRILRMLTSYGVF EH+N       + ER+YSL ++GKTLVTD +GLSY  YVL
Sbjct  66   GDPENLQRILRMLTSYGVFDEHLNCSGDDSHSPERKYSLTDIGKTLVTDAEGLSYAPYVL  125

Query  430  QHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
            QHHQDALM+AWPLVHEAV++ +SEPFVKANGE AYSYYG
Sbjct  126  QHHQDALMRAWPLVHEAVLNPTSEPFVKANGEGAYSYYG  164



>ref|XP_008241354.1| PREDICTED: caffeic acid 3-O-methyltransferase [Prunus mume]
Length=368

 Score =   244 bits (623),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 115/161 (71%), Positives = 132/161 (82%), Gaps = 5/161 (3%)
 Frame = +1

Query  79   SESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPS  258
            + +E     ARL I+ELANMISVPMSLNAVVRLNV DAIWQ GSN PLSAS IL+ VLP 
Sbjct  10   TTAEQPSNEARLGILELANMISVPMSLNAVVRLNVPDAIWQAGSNTPLSASAILARVLPD  69

Query  259  GGGDAQNLQRILRMLTSYGVFREHI-----NADASERRYSLGEVGKTLVTDKDGLSYGAY  423
            GGGDA+NLQRILRMLTSYGVF EH+     +  + +R++SL E+GKTLVTD++GLSYG Y
Sbjct  70   GGGDAENLQRILRMLTSYGVFEEHLIKEDDDGGSQQRKFSLTEIGKTLVTDQNGLSYGPY  129

Query  424  VLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
            +LQHHQD LM AWP+VHEAVVD + EPFVKANGEPAY YYG
Sbjct  130  ILQHHQDVLMGAWPMVHEAVVDPTVEPFVKANGEPAYEYYG  170



>gb|KHG05883.1| Caffeic acid 3-O-methyltransferase [Gossypium arboreum]
Length=361

 Score =   244 bits (622),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 119/159 (75%), Positives = 135/159 (85%), Gaps = 6/159 (4%)
 Frame = +1

Query  85   SESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGG  264
            +ES+ K ARL IMELANMISVPMSLNA+VRLNV DAIWQGG+N PLSA +ILS VLP GG
Sbjct  7    AESSNK-ARLAIMELANMISVPMSLNAIVRLNVPDAIWQGGANTPLSAVQILSRVLPYGG  65

Query  265  GDAQNLQRILRMLTSYGVFREHINAD-----ASERRYSLGEVGKTLVTDKDGLSYGAYVL  429
            GD +NLQRILRMLTSYGVF EH+N       + ER+YSL ++GKTLVTD +GLSY  YVL
Sbjct  66   GDPENLQRILRMLTSYGVFDEHLNCSGDDSHSPERKYSLTDIGKTLVTDAEGLSYAPYVL  125

Query  430  QHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
            QHHQDALM+AWPLVHEAV++ +SEPFVKANGE AYSYYG
Sbjct  126  QHHQDALMRAWPLVHEAVLNPTSEPFVKANGEGAYSYYG  164



>ref|XP_002519426.1| o-methyltransferase, putative [Ricinus communis]
 gb|EEF42840.1| o-methyltransferase, putative [Ricinus communis]
Length=357

 Score =   243 bits (619),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 120/160 (75%), Positives = 137/160 (86%), Gaps = 3/160 (2%)
 Frame = +1

Query  73   MGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVL  252
            M +ES   +KNA+L I+ELANMISVPMSLNAVV+LNVADAIWQ G N+PLSASEILS + 
Sbjct  1    MENESSETRKNAKLAIIELANMISVPMSLNAVVQLNVADAIWQNGVNSPLSASEILSRIN  60

Query  253  PSGGGDAQNLQRILRMLTSYGVFREHINA--DASERRYSLGEVGKTLVTDKDGLSYGAYV  426
             SGG D  NLQRILRML+SY VF EH++A    +ERRYSL E+GKTLVTD +GLSYGAYV
Sbjct  61   LSGG-DPDNLQRILRMLSSYNVFTEHLSAVDGVTERRYSLTEIGKTLVTDVNGLSYGAYV  119

Query  427  LQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
            LQHHQDALM+AWPLVHEAV+DS++EPF KANGEPAY YYG
Sbjct  120  LQHHQDALMRAWPLVHEAVLDSTTEPFAKANGEPAYDYYG  159



>ref|XP_009341081.1| PREDICTED: caffeic acid 3-O-methyltransferase isoform X1 [Pyrus 
x bretschneideri]
Length=372

 Score =   243 bits (619),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 119/160 (74%), Positives = 136/160 (85%), Gaps = 6/160 (4%)
 Frame = +1

Query  85   SESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGG  264
            S S+   ARL I+ELANMISVPMSLNAVVRLNVADAIWQGG N PLSAS+IL+ VLP+GG
Sbjct  15   SSSSSNEARLAILELANMISVPMSLNAVVRLNVADAIWQGGCNTPLSASDILARVLPNGG  74

Query  265  GDAQNLQRILRMLTSYGVFREHI-NAD--ASERRYSLGEVGKTLVTDKDGLSYGAYVLQH  435
            GDA+NLQRILRMLTSYGVF EH+ N D  + +R++SL  +G+TLVTD++GLSYG YVLQH
Sbjct  75   GDAENLQRILRMLTSYGVFEEHLSNLDDGSDDRKFSLTPIGQTLVTDQNGLSYGPYVLQH  134

Query  436  HQ---DALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
            HQ   D LM AWP+VHEAVVDS+ EPFVKANGEPAY YYG
Sbjct  135  HQLFKDVLMGAWPMVHEAVVDSTVEPFVKANGEPAYEYYG  174



>gb|AFK33955.1| unknown [Medicago truncatula]
Length=201

 Score =   236 bits (603),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 113/157 (72%), Positives = 133/157 (85%), Gaps = 2/157 (1%)
 Frame = +1

Query  73   MGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVL  252
            M   +  AQK ARL I+ELANMIS+PMSL+AVVRLNVADAIW+GG+NAPLSA++IL+ V+
Sbjct  1    MAETNTEAQKQARLAILELANMISIPMSLHAVVRLNVADAIWEGGANAPLSAAQILARVV  60

Query  253  PSGGGDAQNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGAYVLQ  432
            P GGGDA+NLQR+LRML SYGVF EHI     ER+YSL  VGKTLV+D++G+SYGAYVLQ
Sbjct  61   PGGGGDAENLQRVLRMLASYGVFEEHIG--DGERKYSLTNVGKTLVSDENGVSYGAYVLQ  118

Query  433  HHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYY  543
             HQDALM+AWPLVHEAV+D S EPF +ANGE AY YY
Sbjct  119  LHQDALMRAWPLVHEAVLDPSKEPFERANGEGAYDYY  155



>gb|KEH38506.1| caffeic acid O-methyltransferase [Medicago truncatula]
Length=354

 Score =   241 bits (615),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 114/157 (73%), Positives = 134/157 (85%), Gaps = 2/157 (1%)
 Frame = +1

Query  73   MGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVL  252
            M   +  AQK ARL I+ELANMIS+PMSL+AVVRLNVADAIW+GG+NAPLSA++IL+ V+
Sbjct  1    MAETNTEAQKQARLAILELANMISIPMSLHAVVRLNVADAIWEGGANAPLSAAQILARVV  60

Query  253  PSGGGDAQNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGAYVLQ  432
            P GGGDA+NLQR+LRML SYGVF EHI     ER+YSL  VGKTLV+D++G+SYGAYVLQ
Sbjct  61   PGGGGDAENLQRVLRMLASYGVFEEHIG--DGERKYSLTNVGKTLVSDENGVSYGAYVLQ  118

Query  433  HHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYY  543
            HHQDALM+AWPLVHEAV+D S EPF +ANGE AY YY
Sbjct  119  HHQDALMRAWPLVHEAVLDPSKEPFERANGEGAYDYY  155



>ref|XP_006428524.1| hypothetical protein CICLE_v10013655mg [Citrus clementina]
 gb|ESR41764.1| hypothetical protein CICLE_v10013655mg [Citrus clementina]
Length=261

 Score =   238 bits (607),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 112/156 (72%), Positives = 128/156 (82%), Gaps = 1/156 (1%)
 Frame = +1

Query  79   SESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPS  258
            +E     K  RL IMELANMISVPMSL A +RL+V DAIWQGG+N PLSAS+IL+ +LPS
Sbjct  4    NECRDGGKKVRLAIMELANMISVPMSLTAAIRLHVPDAIWQGGANTPLSASQILTRILPS  63

Query  259  GGGDAQNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGAYVLQHH  438
            GGGDA+NLQRILR+LTSYGVF EH      ER+YSL E+GK+LVTD +GLSY  YVLQHH
Sbjct  64   GGGDAENLQRILRLLTSYGVFSEH-REFGGERKYSLTEIGKSLVTDAEGLSYAPYVLQHH  122

Query  439  QDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
            QDALM AWPLVHEAV+D + EPFVK +GEPAYSYYG
Sbjct  123  QDALMSAWPLVHEAVLDPTIEPFVKVHGEPAYSYYG  158



>ref|XP_010312333.1| PREDICTED: caffeic acid 3-O-methyltransferase 1 [Solanum lycopersicum]
Length=361

 Score =   240 bits (612),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 117/160 (73%), Positives = 135/160 (84%), Gaps = 2/160 (1%)
 Frame = +1

Query  70   AMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSV  249
            A G  S +   + RL IMELANMISVPMSLNAVV+L V DA+W+ GSNAPLS  EIL+ +
Sbjct  4    ANGEPSNNNNNDERLAIMELANMISVPMSLNAVVKLKVTDAVWENGSNAPLSPVEILAKI  63

Query  250  L-PSGGGDAQNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGAYV  426
              P GGGDA+NLQRILRMLTSYGVF+EH++ D S+RRYSL +VGKTLVTD++GLS+G+YV
Sbjct  64   RGPQGGGDAENLQRILRMLTSYGVFKEHVD-DGSQRRYSLTKVGKTLVTDENGLSHGSYV  122

Query  427  LQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
            LQHHQDALMKAW +VHEAV DSS EPF KANGEPAYSYYG
Sbjct  123  LQHHQDALMKAWTMVHEAVNDSSIEPFAKANGEPAYSYYG  162



>emb|CAN65776.1| hypothetical protein VITISV_030414 [Vitis vinifera]
Length=358

 Score =   239 bits (610),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 116/162 (72%), Positives = 134/162 (83%), Gaps = 6/162 (4%)
 Frame = +1

Query  73   MGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVL  252
            M  E+  ++  ARL I+EL NMISVPM L+A+VRLNV DAIWQGGSNAPLSAS+IL+ VL
Sbjct  1    MEDETLESRNQARLAILELTNMISVPMCLHAIVRLNVPDAIWQGGSNAPLSASQILTRVL  60

Query  253  PSGGGDAQNLQRILRMLTSYGVFREHINADASE----RRYSLGEVGKTLVTDKDGLSYGA  420
            PSG  D  NLQRILR+LT+YGVF EH+  D S     R+YSL ++GKTLVTD DGLSYGA
Sbjct  61   PSG--DPHNLQRILRLLTTYGVFAEHLLTDPSSDQVLRKYSLTDIGKTLVTDADGLSYGA  118

Query  421  YVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
            YVLQH+Q+ LM AWPLVHEAVVDS++EPFVKANGEPAYSYYG
Sbjct  119  YVLQHYQEELMTAWPLVHEAVVDSTTEPFVKANGEPAYSYYG  160



>ref|XP_008361604.1| PREDICTED: caffeic acid 3-O-methyltransferase 1-like isoform 
X1 [Malus domestica]
Length=281

 Score =   236 bits (603),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 115/173 (66%), Positives = 139/173 (80%), Gaps = 6/173 (3%)
 Frame = +1

Query  46   ITGKKEIEAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLS  225
            + G  ++  + +   S+   ARL I+ELANMISVPMSLNAVVRLNV DAIWQGG N PLS
Sbjct  1    MEGNNQVSNVTAGPSSSNNEARLAILELANMISVPMSLNAVVRLNVPDAIWQGGCNTPLS  60

Query  226  ASEILSSVLPSGGGDAQNLQRILRMLTSYGVFREHI-NAD--ASERRYSLGEVGKTLVTD  396
            AS++L+ V+P+GGGDA+NLQRILRMLTSYGVF EH+ N D  + +R++SL  +G+TLVTD
Sbjct  61   ASDVLARVIPNGGGDAENLQRILRMLTSYGVFEEHLSNLDDGSDDRKFSLTPIGQTLVTD  120

Query  397  KDGLSYGAYVLQHHQ---DALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
            ++GLSYG YVLQHHQ   D LM AWP+VHEAVVDS+ EPFVKANGE AY YYG
Sbjct  121  QNGLSYGPYVLQHHQLFKDVLMGAWPMVHEAVVDSTVEPFVKANGELAYEYYG  173



>ref|XP_002264566.1| PREDICTED: caffeic acid 3-O-methyltransferase [Vitis vinifera]
Length=358

 Score =   239 bits (610),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 116/162 (72%), Positives = 134/162 (83%), Gaps = 6/162 (4%)
 Frame = +1

Query  73   MGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVL  252
            M  E+  ++  ARL I+EL NMISVPM L+A+VRLNV DAIWQGGSNAPLSAS+IL+ VL
Sbjct  1    MEDETLESRNQARLAILELTNMISVPMCLHAIVRLNVPDAIWQGGSNAPLSASQILTRVL  60

Query  253  PSGGGDAQNLQRILRMLTSYGVFREHINADASE----RRYSLGEVGKTLVTDKDGLSYGA  420
            PSG  D  NLQRILR+LT+YGVF EH+  D S     R+YSL ++GKTLVTD DGLSYGA
Sbjct  61   PSG--DPHNLQRILRLLTTYGVFAEHLLTDPSSDQVLRKYSLTDIGKTLVTDADGLSYGA  118

Query  421  YVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
            YVLQH+Q+ LM AWPLVHEAVVDS++EPFVKANGEPAYSYYG
Sbjct  119  YVLQHYQEELMTAWPLVHEAVVDSTTEPFVKANGEPAYSYYG  160



>ref|XP_007149437.1| hypothetical protein PHAVU_005G070300g [Phaseolus vulgaris]
 gb|ESW21431.1| hypothetical protein PHAVU_005G070300g [Phaseolus vulgaris]
Length=354

 Score =   238 bits (606),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 114/157 (73%), Positives = 133/157 (85%), Gaps = 2/157 (1%)
 Frame = +1

Query  73   MGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVL  252
            M  ES  ++K +RL IMELANMISVPM+LNAVVRLNVADAIW GG+NAPLSA++IL  +L
Sbjct  1    MEEESTDSRKQSRLAIMELANMISVPMALNAVVRLNVADAIWNGGANAPLSAAQILPRIL  60

Query  253  PSGGGDAQNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGAYVLQ  432
            P G GDA+NLQR+LR+LTSYGVF EH+   A ER+YSL +VGK LVTD+ GLSYGAYVLQ
Sbjct  61   PVGDGDAENLQRLLRILTSYGVFHEHLA--AGERKYSLTDVGKALVTDEQGLSYGAYVLQ  118

Query  433  HHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYY  543
            HHQDALM+AW LVHEAVVD + EPF +ANGE AY+YY
Sbjct  119  HHQDALMRAWTLVHEAVVDPTKEPFERANGEGAYAYY  155



>ref|XP_006598126.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Glycine max]
Length=356

 Score =   237 bits (605),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 117/155 (75%), Positives = 129/155 (83%), Gaps = 3/155 (2%)
 Frame = +1

Query  82   ESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLP-S  258
            ES   +K A L IMELANMISVPM+LNAVVRLNVADA+WQGG+NAPLSASEIL  +LP +
Sbjct  5    ESTEQRKQAMLAIMELANMISVPMALNAVVRLNVADALWQGGANAPLSASEILPRILPGA  64

Query  259  GGGDAQNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGAYVLQHH  438
             G DA+NLQR+LRML SYGVFREH+ A   ER YSL EVGKTLVTD+ GLSY  YVLQHH
Sbjct  65   DGADAENLQRLLRMLASYGVFREHLAA--GERNYSLTEVGKTLVTDEQGLSYAHYVLQHH  122

Query  439  QDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYY  543
            QDALM+AWPLVHEAVVD + EPF  ANGEPAY YY
Sbjct  123  QDALMRAWPLVHEAVVDPTKEPFEMANGEPAYGYY  157



>ref|XP_006367255.1| PREDICTED: caffeic acid 3-O-methyltransferase 2-like [Solanum 
tuberosum]
Length=360

 Score =   235 bits (600),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 110/147 (75%), Positives = 126/147 (86%), Gaps = 0/147 (0%)
 Frame = +1

Query  106  ARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQNLQ  285
            ARL IMELANMISVPMSLNA+++L VADAIW+GGSNAPLS +EIL+ + P GGGDA+NLQ
Sbjct  16   ARLAIMELANMISVPMSLNAIIKLKVADAIWEGGSNAPLSPAEILAKIRPQGGGDAENLQ  75

Query  286  RILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQDALMKAWP  465
            RILRMLTSY VF EH+  D S+RRYSL EVGKTLVTD++GLS+G YVLQHHQDALM+ W 
Sbjct  76   RILRMLTSYRVFEEHVVDDGSQRRYSLTEVGKTLVTDENGLSHGLYVLQHHQDALMRVWT  135

Query  466  LVHEAVVDSSSEPFVKANGEPAYSYYG  546
            +VHE V DSSS+PFVK  GE  YSYYG
Sbjct  136  MVHETVNDSSSDPFVKVYGEQPYSYYG  162



>ref|XP_009617330.1| PREDICTED: flavone 3'-O-methyltransferase 1 [Nicotiana tomentosiformis]
Length=366

 Score =   231 bits (590),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 120/162 (74%), Positives = 134/162 (83%), Gaps = 6/162 (4%)
 Frame = +1

Query  79   SESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPS  258
             E+ +   NARL IMELANMISVPMSLNA+VRL VADAIW+GGSNAPLS +EILS +  S
Sbjct  6    CEASNNNNNARLAIMELANMISVPMSLNAIVRLKVADAIWEGGSNAPLSPTEILSKIRAS  65

Query  259  ------GGGDAQNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGA  420
                  GGGDA+NLQRILRMLTSY VF EHI  D S+RRYSL EVGKTLVTD++GLSYG+
Sbjct  66   EGGGGGGGGDAENLQRILRMLTSYDVFAEHIVDDGSQRRYSLTEVGKTLVTDENGLSYGS  125

Query  421  YVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
            YVLQHHQDALM AW +V EAV DSS+EPF KANGEPAY+YYG
Sbjct  126  YVLQHHQDALMSAWTMVDEAVNDSSTEPFAKANGEPAYNYYG  167



>ref|XP_010050337.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Eucalyptus 
grandis]
Length=360

 Score =   229 bits (585),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 113/162 (70%), Positives = 134/162 (83%), Gaps = 4/162 (2%)
 Frame = +1

Query  73   MGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVL  252
            M  E+  A+  ARL I+ELANMISVPMSLNAVVRL V DA+WQGGSNAPLSASEIL+   
Sbjct  1    MADETSDARNAARLRILELANMISVPMSLNAVVRLGVPDALWQGGSNAPLSASEILARSP  60

Query  253  PSGGGDAQNLQRILRMLTSYGVFREHI----NADASERRYSLGEVGKTLVTDKDGLSYGA  420
             +  GDA+NLQR+LRML S+GVF EH+    ++ +SERRYSL EVGKTLVTD +GLSY  
Sbjct  61   AAPAGDAENLQRLLRMLASHGVFEEHVAPAASSASSERRYSLTEVGKTLVTDAEGLSYAP  120

Query  421  YVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
            YVLQHHQDALM+AWPLVHEAV+D ++EPFVKANG+ AY++YG
Sbjct  121  YVLQHHQDALMRAWPLVHEAVLDPATEPFVKANGDTAYAHYG  162



>ref|XP_010504072.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Camelina 
sativa]
Length=385

 Score =   230 bits (586),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 113/170 (66%), Positives = 137/170 (81%), Gaps = 2/170 (1%)
 Frame = +1

Query  37   EKQITGKKEIEAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNA  216
            E++IT K++ + M  ES  ++  ARL I+ELANMISVPMSLNA V+L +ADAIW GG+N+
Sbjct  20   EEKITNKQK-KKMEKESSESRNRARLAILELANMISVPMSLNAAVKLGIADAIWNGGANS  78

Query  217  PLSASEILSSVLPSGGGDAQNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTD  396
            PLSA+EILS +L   GGD +NLQRILR LTSYGVF EH+   ++ER+YSL +VGKTLVTD
Sbjct  79   PLSAAEILSRLLLQSGGDPENLQRILRTLTSYGVFSEHL-VGSTERKYSLTDVGKTLVTD  137

Query  397  KDGLSYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
              GLSY AYVLQHHQDALM+AWPLVH AVV+  +EP+VKANGE AY  YG
Sbjct  138  SGGLSYAAYVLQHHQDALMRAWPLVHTAVVEPETEPYVKANGEAAYVQYG  187



>ref|XP_009774776.1| PREDICTED: caffeic acid 3-O-methyltransferase [Nicotiana sylvestris]
Length=252

 Score =   224 bits (571),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 117/167 (70%), Positives = 131/167 (78%), Gaps = 6/167 (4%)
 Frame = +1

Query  64   IEAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILS  243
            +E    E+ +   NARL IMELANMISVPMSLNAVVRL VADAIW+GGSNAPLS +EIL+
Sbjct  1    MENRNGEASNNNNNARLAIMELANMISVPMSLNAVVRLKVADAIWEGGSNAPLSPTEILA  60

Query  244  SVLPSGGGDAQ------NLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDG  405
             +  S GG         NLQRILRMLTSY VF EHI  D  +RRYSL EVGKTLVTDK+G
Sbjct  61   KISGSEGGGGAGGGDAENLQRILRMLTSYDVFAEHIVDDGPQRRYSLTEVGKTLVTDKNG  120

Query  406  LSYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
            LSYG+Y+LQHHQDALM AW +V EAV DSS+EPF KANGEPAY+YYG
Sbjct  121  LSYGSYILQHHQDALMSAWTMVDEAVNDSSTEPFAKANGEPAYNYYG  167



>ref|XP_010546519.1| PREDICTED: flavone 3'-O-methyltransferase 1 [Tarenaya hassleriana]
Length=354

 Score =   227 bits (579),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 112/158 (71%), Positives = 128/158 (81%), Gaps = 2/158 (1%)
 Frame = +1

Query  73   MGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVL  252
            M  ES   +  ARL IMELANMISVPMSLNA V+L VADAIW GG+N+P+SA+EILS   
Sbjct  1    MEHESSERRNRARLAIMELANMISVPMSLNAAVKLGVADAIWCGGANSPISAAEILSRCC  60

Query  253  PSGGGDAQNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGAYVLQ  432
              G G  +NLQRILRMLTSYGVF EH + D SER+YSL +VGKTLVTD DGLSYG+YVLQ
Sbjct  61   -GGAGGPENLQRILRMLTSYGVFSEHFSGD-SERKYSLTDVGKTLVTDSDGLSYGSYVLQ  118

Query  433  HHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
            HHQ+ALM+AWPLVH AV D + EP+VKANGEPAY+ YG
Sbjct  119  HHQEALMRAWPLVHTAVEDPTREPYVKANGEPAYAQYG  156



>ref|XP_010426946.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Camelina 
sativa]
Length=356

 Score =   226 bits (576),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 111/159 (70%), Positives = 130/159 (82%), Gaps = 2/159 (1%)
 Frame = +1

Query  73   MGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVL  252
            M  ES  ++  ARL I+ELANMISVPMSLNA V+L +ADAIW  G+N+PLSA+EIL  +L
Sbjct  1    MEKESSESRNRARLAILELANMISVPMSLNAAVKLGIADAIWNDGTNSPLSAAEILPRLL  60

Query  253  -PSGGGDAQNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGAYVL  429
             PSGGGD +NLQRILRMLTSYGVF EH+   ++ER+YSL +VGKTLVTD  GLSY AYVL
Sbjct  61   LPSGGGDPENLQRILRMLTSYGVFSEHL-VGSTERKYSLTDVGKTLVTDSGGLSYAAYVL  119

Query  430  QHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
            QHHQDALM+AWPLVH AVV+  +EP+VKANGE AY  YG
Sbjct  120  QHHQDALMRAWPLVHTAVVEPETEPYVKANGEGAYVQYG  158



>ref|XP_006291371.1| hypothetical protein CARUB_v10017511mg [Capsella rubella]
 gb|EOA24269.1| hypothetical protein CARUB_v10017511mg [Capsella rubella]
Length=359

 Score =   226 bits (575),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 113/162 (70%), Positives = 131/162 (81%), Gaps = 5/162 (3%)
 Frame = +1

Query  73   MGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVL  252
            M  ES  ++  ARL IMELANMISVPMSLNA VRL +ADAIW GG+N+PLSASEIL  +L
Sbjct  1    MEKESSESRNRARLAIMELANMISVPMSLNAAVRLGIADAIWNGGANSPLSASEILPRLL  60

Query  253  -PSG---GGDAQNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGA  420
             PS    GGD +NLQRILRMLTSYGVF EH+   +SER++SL +VGKTLVTD DGLSY A
Sbjct  61   IPSATTTGGDPENLQRILRMLTSYGVFSEHL-VGSSERKFSLTDVGKTLVTDSDGLSYAA  119

Query  421  YVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
            Y+LQHHQ+ALM+AWPLVH AVV+  +EP+VKANGE AY  YG
Sbjct  120  YILQHHQEALMRAWPLVHTAVVEPETEPYVKANGEAAYVQYG  161



>ref|XP_006403721.1| hypothetical protein EUTSA_v10010488mg [Eutrema salsugineum]
 gb|ESQ45174.1| hypothetical protein EUTSA_v10010488mg [Eutrema salsugineum]
Length=361

 Score =   224 bits (571),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 110/163 (67%), Positives = 128/163 (79%), Gaps = 5/163 (3%)
 Frame = +1

Query  73   MGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVL  252
            M  ES  ++  ARL IMELANMISVPMSLNA V+L +ADAIW  G+N+PLSA+EIL  +L
Sbjct  1    MEDESSESRNKARLAIMELANMISVPMSLNAAVKLGIADAIWNAGANSPLSAAEILPRLL  60

Query  253  PSG-----GGDAQNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYG  417
             S       GD +NLQRILRMLTSYGVF EHIN  + ER+YSL +VGKTLVTD  GLSY 
Sbjct  61   LSSSTTTIAGDPENLQRILRMLTSYGVFSEHINGSSVERKYSLTDVGKTLVTDSGGLSYA  120

Query  418  AYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
            AYVLQHHQ+ALM+AWPLVH AV++  +EP+VKANGE AYS YG
Sbjct  121  AYVLQHHQEALMRAWPLVHTAVMEPETEPYVKANGEAAYSQYG  163



>ref|XP_010098845.1| Caffeic acid 3-O-methyltransferase [Morus notabilis]
 gb|EXB75933.1| Caffeic acid 3-O-methyltransferase [Morus notabilis]
Length=359

 Score =   224 bits (570),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 112/163 (69%), Positives = 127/163 (78%), Gaps = 7/163 (4%)
 Frame = +1

Query  73   MGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVL  252
            M  ES   +  ARL ++ELANMISVPMSLNAVVRL V DAIWQ GSN+PLSAS+IL+ VL
Sbjct  1    MEDESSEKRNQARLKVLELANMISVPMSLNAVVRLGVPDAIWQSGSNSPLSASQILTRVL  60

Query  253  PSGGG-----DAQNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYG  417
            PS        D  NLQR+LR LTSYGVF EHI+ +   R+YSL +VGKTLVTD DGLSY 
Sbjct  61   PSSSSSAASADPDNLQRLLRTLTSYGVFSEHISGEI--RKYSLTDVGKTLVTDSDGLSYA  118

Query  418  AYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
             YVLQHHQDALM+AW L+HEAVVD ++EPF KANGEPAY YYG
Sbjct  119  PYVLQHHQDALMRAWSLLHEAVVDPTTEPFAKANGEPAYKYYG  161



>ref|XP_010515802.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Camelina 
sativa]
Length=355

 Score =   224 bits (570),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 107/158 (68%), Positives = 128/158 (81%), Gaps = 1/158 (1%)
 Frame = +1

Query  73   MGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVL  252
            M  ES  ++  ARL I+ELANMISVPMSLNA V+L +ADA+W GG+N+PLSA+EIL+ +L
Sbjct  1    MEKESSESRNRARLAILELANMISVPMSLNAAVKLGIADAVWNGGTNSPLSAAEILTRLL  60

Query  253  PSGGGDAQNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGAYVLQ  432
               GGD +NLQRILRMLTSYGVF EH+   ++ER+YSL +VGKTLVTD  GLSY AYVLQ
Sbjct  61   LPSGGDPENLQRILRMLTSYGVFSEHL-VGSTERKYSLTDVGKTLVTDSGGLSYAAYVLQ  119

Query  433  HHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
            HHQDALM+AWPLVH AVV+  +EP+VKAN E AY  YG
Sbjct  120  HHQDALMRAWPLVHTAVVEPETEPYVKANSEAAYVQYG  157



>ref|XP_006391885.1| hypothetical protein EUTSA_v10023542mg [Eutrema salsugineum]
 gb|ESQ29171.1| hypothetical protein EUTSA_v10023542mg [Eutrema salsugineum]
Length=363

 Score =   223 bits (568),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 114/165 (69%), Positives = 129/165 (78%), Gaps = 7/165 (4%)
 Frame = +1

Query  73   MGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVL  252
            M  ES  ++  ARL IMELANMISVPMSLNA VRL +ADAIW  G+N+PLSASEIL  +L
Sbjct  1    MEDESSESRNKARLAIMELANMISVPMSLNAAVRLGIADAIWNSGANSPLSASEILPRLL  60

Query  253  -PSG----GGDAQNLQRILRMLTSYGVFREHINADAS--ERRYSLGEVGKTLVTDKDGLS  411
             PS     GGD +NLQRILRMLTSYGVF EH+N DA   ER+YSL  VGKTLVTD  GLS
Sbjct  61   LPSRDSTIGGDPENLQRILRMLTSYGVFSEHLNGDAGSVERKYSLTNVGKTLVTDSGGLS  120

Query  412  YGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
            Y AYVLQHHQ++LM+AWPLVH AVV+  +EP+VKANGE AY  YG
Sbjct  121  YAAYVLQHHQESLMRAWPLVHTAVVEPETEPYVKANGEAAYVQYG  165



>ref|NP_190882.1| putative O-diphenol-O-methyl transferase [Arabidopsis thaliana]
 gb|AAK56277.1|AF367289_1 AT3g53140/T4D2_70 [Arabidopsis thaliana]
 emb|CAB64217.1| caffeic acid O-methyltransferase-like protein [Arabidopsis thaliana]
 gb|AAM91448.1| AT3g53140/T4D2_70 [Arabidopsis thaliana]
 gb|AEE79041.1| putative O-diphenol-O-methyl transferase [Arabidopsis thaliana]
Length=359

 Score =   221 bits (563),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 112/162 (69%), Positives = 131/162 (81%), Gaps = 5/162 (3%)
 Frame = +1

Query  73   MGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSV-  249
            M +ES  ++  ARL IMELANMISVPMSLNA VRL +ADAIW GG+N+PLSA+EIL  + 
Sbjct  1    MENESSESRNRARLAIMELANMISVPMSLNAAVRLGIADAIWNGGANSPLSAAEILPRLH  60

Query  250  LPSG---GGDAQNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGA  420
            LPS    GGD +NLQRILRMLTSYGVF EH+   + ER+YSL +VGKTLVTD  GLSY A
Sbjct  61   LPSHTTIGGDPENLQRILRMLTSYGVFSEHL-VGSIERKYSLTDVGKTLVTDSGGLSYAA  119

Query  421  YVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
            YVLQHHQ+ALM+AWPLVH AVV+  +EP+VKANGE AY+ YG
Sbjct  120  YVLQHHQEALMRAWPLVHTAVVEPETEPYVKANGEAAYAQYG  161



>ref|XP_011098295.1| PREDICTED: flavone 3'-O-methyltransferase 1-like [Sesamum indicum]
Length=355

 Score =   218 bits (554),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 106/154 (69%), Positives = 121/154 (79%), Gaps = 1/154 (1%)
 Frame = +1

Query  88   ESAQKNAR-LTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGG  264
            E  Q N+  L IMELAN++SVPMSLNAV++L V D IWQ GSN PLSA+EILS++     
Sbjct  2    ERIQTNSPILAIMELANLVSVPMSLNAVIKLKVLDTIWQDGSNNPLSAAEILSAIALGPA  61

Query  265  GDAQNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQD  444
            GDA+NLQRILR+LTSYGVF EHI  D  ERRYSL EVGK L  D++GLSY  Y+LQHHQD
Sbjct  62   GDAENLQRILRLLTSYGVFDEHIGKDGRERRYSLTEVGKALAADENGLSYAPYILQHHQD  121

Query  445  ALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
            ALM AWP VHEAV+D SSEPFVK +GE  YSYYG
Sbjct  122  ALMLAWPRVHEAVLDPSSEPFVKVHGELPYSYYG  155



>ref|XP_010271244.1| PREDICTED: uncharacterized protein LOC104607311 isoform X2 [Nelumbo 
nucifera]
Length=210

 Score =   213 bits (541),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 105/158 (66%), Positives = 120/158 (76%), Gaps = 7/158 (4%)
 Frame = +1

Query  73   MGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVL  252
            M  E    + NARL I+ELANMISVPMSLNA+V L V DAIWQG SN PLSASE+L+ VL
Sbjct  1    MADEKTETRNNARLAILELANMISVPMSLNAIVCLKVPDAIWQGSSNIPLSASEVLAHVL  60

Query  253  PSGGGDAQNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGAYVLQ  432
            P+G  +++NL+RILRM TSY VF EHI    SER+YSL E+GK LVTD +GLSY  YVLQ
Sbjct  61   PTG--NSENLRRILRMFTSYDVFSEHIADGFSERKYSLTEIGKILVTDGEGLSYAVYVLQ  118

Query  433  HHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
            HHQD L+KAWPL HEAVVD   EPFVKAN     +YYG
Sbjct  119  HHQDTLVKAWPLQHEAVVDLKEEPFVKAN-----AYYG  151



>ref|XP_010271241.1| PREDICTED: uncharacterized protein LOC104607311 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010271242.1| PREDICTED: uncharacterized protein LOC104607311 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010271243.1| PREDICTED: uncharacterized protein LOC104607311 isoform X1 [Nelumbo 
nucifera]
Length=248

 Score =   213 bits (541),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 105/158 (66%), Positives = 120/158 (76%), Gaps = 7/158 (4%)
 Frame = +1

Query  73   MGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVL  252
            M  E    + NARL I+ELANMISVPMSLNA+V L V DAIWQG SN PLSASE+L+ VL
Sbjct  1    MADEKTETRNNARLAILELANMISVPMSLNAIVCLKVPDAIWQGSSNIPLSASEVLAHVL  60

Query  253  PSGGGDAQNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGAYVLQ  432
            P+G  +++NL+RILRM TSY VF EHI    SER+YSL E+GK LVTD +GLSY  YVLQ
Sbjct  61   PTG--NSENLRRILRMFTSYDVFSEHIADGFSERKYSLTEIGKILVTDGEGLSYAVYVLQ  118

Query  433  HHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
            HHQD L+KAWPL HEAVVD   EPFVKAN     +YYG
Sbjct  119  HHQDTLVKAWPLQHEAVVDLKEEPFVKAN-----AYYG  151



>gb|KFK34550.1| hypothetical protein AALP_AA5G160800 [Arabis alpina]
Length=360

 Score =   214 bits (546),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 108/162 (67%), Positives = 124/162 (77%), Gaps = 4/162 (2%)
 Frame = +1

Query  73   MGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVL  252
            M  ES   +  ARL IMELANMISVPMSLNA VRL +AD IW  G N+PLSA+EIL  +L
Sbjct  1    MEDESSERRNKARLAIMELANMISVPMSLNAAVRLGIADVIWNDGENSPLSAAEILPRLL  60

Query  253  -PSGG---GDAQNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGA  420
             PS     GD +NLQRILRMLTSY VF EH+ A + ER+YSL +VGKTLVTD  GLSY A
Sbjct  61   LPSDTTITGDPENLQRILRMLTSYDVFSEHLAAGSVERKYSLTDVGKTLVTDSGGLSYAA  120

Query  421  YVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
            YVLQHHQ+ALM+AWPLVH AVV   +EP++KANGE AY+ YG
Sbjct  121  YVLQHHQEALMRAWPLVHTAVVQPETEPYMKANGETAYAQYG  162



>ref|XP_011101457.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Sesamum indicum]
Length=360

 Score =   213 bits (543),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 103/142 (73%), Positives = 116/142 (82%), Gaps = 0/142 (0%)
 Frame = +1

Query  121  MELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQNLQRILRM  300
            MELAN++SVPMSLNAV++L V D IWQ G N PLSA+EILS+V      DA+NLQRILR+
Sbjct  1    MELANLVSVPMSLNAVIKLKVLDTIWQDGFNNPLSAAEILSAVAVGPHADAENLQRILRL  60

Query  301  LTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQDALMKAWPLVHEA  480
            LTSYGVF EHI  D S RRYSL EVGK L TD++GLSY  YVLQHHQDA+M AWPLVHEA
Sbjct  61   LTSYGVFNEHIAGDGSGRRYSLTEVGKALATDENGLSYAPYVLQHHQDAIMLAWPLVHEA  120

Query  481  VVDSSSEPFVKANGEPAYSYYG  546
            V+D SSEPFVK +GE AYSYYG
Sbjct  121  VLDPSSEPFVKVHGELAYSYYG  142



>emb|CDX76223.1| BnaA04g04870D [Brassica napus]
Length=268

 Score =   210 bits (534),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 107/163 (66%), Positives = 127/163 (78%), Gaps = 7/163 (4%)
 Frame = +1

Query  73   MGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSV-  249
            M + S  ++  ARL IMELANMISVPMSLNA VRL +ADAIW  G N+PLSA+EIL  + 
Sbjct  1    MENGSSESRNKARLAIMELANMISVPMSLNAAVRLGLADAIWNDGDNSPLSATEILPRLH  60

Query  250  --LPSG--GGDAQNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYG  417
                +G  GGD +NLQRILRMLTSYGVF EH+    + R+YS+ +VGKTLVTD DGLSY 
Sbjct  61   LTYQNGTIGGDPENLQRILRMLTSYGVFSEHLTN--AGRKYSITDVGKTLVTDSDGLSYA  118

Query  418  AYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
            AYVLQHHQ+ALM+AWPLVH AVV+  +EP+VKANGE AY+ YG
Sbjct  119  AYVLQHHQEALMRAWPLVHTAVVEPETEPYVKANGEAAYAQYG  161



>ref|XP_009139429.1| PREDICTED: caffeic acid 3-O-methyltransferase [Brassica rapa]
Length=359

 Score =   210 bits (534),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 107/163 (66%), Positives = 127/163 (78%), Gaps = 7/163 (4%)
 Frame = +1

Query  73   MGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSV-  249
            M + S  ++  ARL IMELANMISVPMSLNA VRL +ADAIW  G N+PLSA+EIL  + 
Sbjct  1    MENGSSESRNKARLAIMELANMISVPMSLNAAVRLGLADAIWNDGDNSPLSAAEILPRLH  60

Query  250  --LPSG--GGDAQNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYG  417
                +G  GGD +NLQRILRMLTSYGVF EH+    + R+YS+ +VGKTLVTD DGLSY 
Sbjct  61   LTYQNGTIGGDPENLQRILRMLTSYGVFSEHLTN--AGRKYSITDVGKTLVTDSDGLSYA  118

Query  418  AYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
            AYVLQHHQ+ALM+AWPLVH AVV+  +EP+VKANGE AY+ YG
Sbjct  119  AYVLQHHQEALMRAWPLVHTAVVEPETEPYVKANGEAAYAQYG  161



>emb|CDX95399.1| BnaC04g27590D [Brassica napus]
Length=359

 Score =   208 bits (530),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 106/163 (65%), Positives = 127/163 (78%), Gaps = 7/163 (4%)
 Frame = +1

Query  73   MGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSV-  249
            M + S  ++  ARL IMELANMISVPMSLNA VRL +ADAIW  G N+P+SA+EIL  + 
Sbjct  1    MENGSSESRNKARLAIMELANMISVPMSLNAAVRLGLADAIWNDGDNSPVSAAEILPRLH  60

Query  250  --LPSG--GGDAQNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYG  417
                +G  GGD +NLQRILRMLTSYGVF EH+    + R+YS+ +VGKTLVTD DGLSY 
Sbjct  61   LTYQNGTIGGDPENLQRILRMLTSYGVFSEHLTN--AGRKYSITDVGKTLVTDSDGLSYA  118

Query  418  AYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
            AYVLQHHQ+ALM+AWPLVH AVV+  +EP+VKANGE AY+ YG
Sbjct  119  AYVLQHHQEALMRAWPLVHTAVVEPETEPYVKANGEAAYAQYG  161



>ref|XP_004502926.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Cicer arietinum]
Length=361

 Score =   206 bits (525),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 99/151 (66%), Positives = 121/151 (80%), Gaps = 1/151 (1%)
 Frame = +1

Query  91   SAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGD  270
             AQ   RL I+E+A+M+SVPMSL AV+ + V DAIWQGG+N PLSASEIL+ V P+GGGD
Sbjct  13   KAQSKERLAILEVAHMMSVPMSLVAVLNMKVPDAIWQGGNNTPLSASEILAVVRPNGGGD  72

Query  271  AQNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQDAL  450
            A+NLQRILR+LT+Y +F E +N+   ER+YSL +VGKTL+ D DGLSY AYVLQHHQ+AL
Sbjct  73   AENLQRILRLLTTYDIFDEQLNSKG-ERKYSLSDVGKTLIADADGLSYAAYVLQHHQEAL  131

Query  451  MKAWPLVHEAVVDSSSEPFVKANGEPAYSYY  543
            M+AW LV EAV D + EPF KANGE A +YY
Sbjct  132  MRAWALVGEAVEDPTVEPFEKANGESAVAYY  162



>gb|AAP03054.1| S-adenosyl-L-methionine: beta-alanine N-methyltransferase [Limonium 
latifolium]
Length=181

 Score =   199 bits (505),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 98/164 (60%), Positives = 125/164 (76%), Gaps = 10/164 (6%)
 Frame = +1

Query  82   ESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSG  261
            E+  A+ NARL I+ELAN+ISVPMSL A+VRL V +AIW  GSN P+SA+EILS  LP  
Sbjct  14   ETSEARNNARLKIIELANLISVPMSLTAIVRLKVPEAIWSNGSNTPVSAAEILSR-LPDA  72

Query  262  --GGDAQNLQRILRMLTSYGVFREHINADAS------ERRYSLGEVGKTLVT-DKDGLSY  414
                DA+NLQR+LR+LTS+GVF EH++  +S      ERRY L EVG+TLV+ D+   S+
Sbjct  73   PATADAENLQRLLRVLTSFGVFSEHLDTTSSSSSSTSERRYCLTEVGQTLVSFDESCPSH  132

Query  415  GAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
            GAYVLQHHQ+ L+KAWP +H A++D+S+EPF + NGEPAY YYG
Sbjct  133  GAYVLQHHQETLLKAWPFLHTAILDASTEPFARVNGEPAYQYYG  176



>gb|KHN47498.1| Caffeic acid 3-O-methyltransferase [Glycine soja]
Length=337

 Score =   203 bits (516),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 104/154 (68%), Positives = 113/154 (73%), Gaps = 20/154 (13%)
 Frame = +1

Query  82   ESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSG  261
            ES   +K A L IMELANMISVPM+LNAVVRLNVADA+WQGG+NAPLSASEIL  +LP G
Sbjct  5    ESTEQRKQAMLAIMELANMISVPMALNAVVRLNVADALWQGGANAPLSASEILPRILPGG  64

Query  262  GGDAQNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQ  441
                              VFREH+ A   ER YSL EVGKTLVTD+ GLSY  YVLQHHQ
Sbjct  65   ------------------VFREHLAA--GERNYSLTEVGKTLVTDEQGLSYAHYVLQHHQ  104

Query  442  DALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYY  543
            DALM+AWPLVHEAVVD + EPF  ANGEPAY YY
Sbjct  105  DALMRAWPLVHEAVVDPTKEPFEMANGEPAYGYY  138



>gb|AAP03058.1| S-adenosyl-L-methionine: beta-alanine N-methyltransferase [Limonium 
latifolium]
Length=375

 Score =   197 bits (501),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 98/164 (60%), Positives = 125/164 (76%), Gaps = 10/164 (6%)
 Frame = +1

Query  82   ESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSG  261
            E+  A+ NARL I+ELAN+ISVPMSL A+VRL V +AIW  GSN P+SA+EILS  LP  
Sbjct  14   ETSEARNNARLKIIELANLISVPMSLTAIVRLKVPEAIWSNGSNTPVSAAEILSR-LPDA  72

Query  262  --GGDAQNLQRILRMLTSYGVFREHINADAS------ERRYSLGEVGKTLVT-DKDGLSY  414
                DA+NLQR+LR+LTS+GVF EH++  +S      ERRY L EVG+TLV+ D+   S+
Sbjct  73   PATADAENLQRLLRVLTSFGVFSEHLDTTSSSSSSTSERRYCLTEVGQTLVSFDESCPSH  132

Query  415  GAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
            GAYVLQHHQ+ L+KAWP +H A++D+S+EPF + NGEPAY YYG
Sbjct  133  GAYVLQHHQETLLKAWPFLHTAILDASTEPFARVNGEPAYQYYG  176



>ref|XP_003602597.1| Caffeic acid 3-O-methyltransferase [Medicago truncatula]
Length=358

 Score =   193 bits (490),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 92/150 (61%), Positives = 120/150 (80%), Gaps = 1/150 (1%)
 Frame = +1

Query  91   SAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGD  270
             +Q  ARL I+ELA+++SVP SL AV+++ V +AIWQGG+N PLSAS+ILS V P+GGGD
Sbjct  10   KSQSEARLAILELAHIMSVPTSLVAVLKMKVPEAIWQGGNNTPLSASQILSIVRPNGGGD  69

Query  271  AQNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQDAL  450
            A+NLQRILR+LT+Y +F E ++++  +R+YSL EVGK LV D DGLSYG YVLQH+QD  
Sbjct  70   AENLQRILRLLTTYAIFAEDLSSNG-KRKYSLTEVGKALVPDDDGLSYGTYVLQHYQDQY  128

Query  451  MKAWPLVHEAVVDSSSEPFVKANGEPAYSY  540
            ++AWPLV EAV D + EPF K +GE AY+Y
Sbjct  129  LRAWPLVGEAVEDPTVEPFEKLHGEGAYAY  158



>emb|CAB65279.1| O-diphenol-O-methyl transferase [Medicago sativa subsp. x varia]
Length=358

 Score =   188 bits (477),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 89/148 (60%), Positives = 118/148 (80%), Gaps = 1/148 (1%)
 Frame = +1

Query  97   QKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQ  276
            Q  ARL I+ELA+++SVP SL AV+++ V +AIWQGG N PLSAS+ILS V P+GGGDA+
Sbjct  12   QSEARLAILELAHIMSVPTSLVAVLKMKVPEAIWQGGKNTPLSASQILSIVRPNGGGDAE  71

Query  277  NLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQDALMK  456
            NLQRILR+LT+Y +F E ++++  +R+YSL ++GK LV D DGLSY  YVLQH+QD  ++
Sbjct  72   NLQRILRLLTTYAIFAEDLSSNG-KRKYSLTDIGKALVPDDDGLSYATYVLQHYQDQYLR  130

Query  457  AWPLVHEAVVDSSSEPFVKANGEPAYSY  540
            AWPLV +AV D+S EPF K +GE AY+Y
Sbjct  131  AWPLVGDAVEDASVEPFEKLHGEGAYAY  158



>gb|AFK47565.1| unknown [Medicago truncatula]
Length=224

 Score =   184 bits (467),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 86/148 (58%), Positives = 116/148 (78%), Gaps = 1/148 (1%)
 Frame = +1

Query  97   QKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQ  276
            Q  ARL I+ELA+++SVP SLNAV+++ V +AIWQGG N PLSAS+ILS V P+GGGDA+
Sbjct  12   QSEARLAILELAHIMSVPTSLNAVLKMKVPEAIWQGGKNTPLSASQILSIVRPNGGGDAE  71

Query  277  NLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQDALMK  456
            NLQRILR+LT+Y +F E ++++  ER+YSL +VGK LV D  GL+  ++ +QHHQD  ++
Sbjct  72   NLQRILRLLTTYTIFVEDLSSNG-ERKYSLTDVGKALVPDDHGLTCASFFVQHHQDPYLR  130

Query  457  AWPLVHEAVVDSSSEPFVKANGEPAYSY  540
            AWPLV +AV D + EPF K +GE AY+Y
Sbjct  131  AWPLVGDAVEDPTVEPFEKLHGEAAYAY  158



>ref|XP_003602596.1| Caffeic acid 3-O-methyltransferase [Medicago truncatula]
 gb|AES72847.1| caffeic acid O-methyltransferase [Medicago truncatula]
Length=264

 Score =   183 bits (465),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 86/148 (58%), Positives = 116/148 (78%), Gaps = 1/148 (1%)
 Frame = +1

Query  97   QKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQ  276
            Q  ARL I+ELA+++SVP SLNAV+++ V +AIWQGG N PLSAS+ILS V P+GGGDA+
Sbjct  12   QSEARLAILELAHIMSVPTSLNAVLKMKVPEAIWQGGKNTPLSASQILSIVRPNGGGDAE  71

Query  277  NLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQDALMK  456
            NLQRILR+LT+Y +F E ++++  ER+YSL +VGK LV D  GL+  ++ +QHHQD  ++
Sbjct  72   NLQRILRLLTTYTIFVEDLSSNG-ERKYSLTDVGKALVPDDHGLTCASFFVQHHQDPYLR  130

Query  457  AWPLVHEAVVDSSSEPFVKANGEPAYSY  540
            AWPLV +AV D + EPF K +GE AY+Y
Sbjct  131  AWPLVGDAVEDPTVEPFEKLHGEAAYAY  158



>ref|XP_003602595.1| Caffeic acid 3-O-methyltransferase [Medicago truncatula]
 gb|ACJ84599.1| unknown [Medicago truncatula]
 gb|AES72846.1| caffeic acid O-methyltransferase [Medicago truncatula]
 gb|AFK37235.1| unknown [Medicago truncatula]
Length=358

 Score =   184 bits (466),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 86/148 (58%), Positives = 116/148 (78%), Gaps = 1/148 (1%)
 Frame = +1

Query  97   QKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQ  276
            Q  ARL I+ELA+++SVP SLNAV+++ V +AIWQGG N PLSAS+ILS V P+GGGDA+
Sbjct  12   QSEARLAILELAHIMSVPTSLNAVLKMKVPEAIWQGGKNTPLSASQILSIVRPNGGGDAE  71

Query  277  NLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQDALMK  456
            NLQRILR+LT+Y +F E ++++  ER+YSL +VGK LV D  GL+  ++ +QHHQD  ++
Sbjct  72   NLQRILRLLTTYTIFVEDLSSNG-ERKYSLTDVGKALVPDDHGLTCASFFVQHHQDPYLR  130

Query  457  AWPLVHEAVVDSSSEPFVKANGEPAYSY  540
            AWPLV +AV D + EPF K +GE AY+Y
Sbjct  131  AWPLVGDAVEDPTVEPFEKLHGEAAYAY  158



>ref|XP_009382782.1| PREDICTED: caffeic acid 3-O-methyltransferase [Musa acuminata 
subsp. malaccensis]
Length=370

 Score =   182 bits (463),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 95/153 (62%), Positives = 117/153 (76%), Gaps = 4/153 (3%)
 Frame = +1

Query  100  KNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQN  279
            K  RL +MELANMISVPM+LNAVVRLNV DAIWQ GSN+PL+A+EIL+ + P     +  
Sbjct  18   KQGRLAMMELANMISVPMALNAVVRLNVPDAIWQSGSNSPLTAAEILALLRPPPPSSSDP  77

Query  280  --LQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQDALM  453
              LQR+LR+L S+GVF E+  A +  RRYSL +VG+TLV   DG SY AYVLQHHQDAL+
Sbjct  78   SVLQRLLRLLASHGVFAENRCATSGARRYSLTDVGRTLVPSGDGASYAAYVLQHHQDALV  137

Query  454  KAWPLVHEAVVD-SSSEPFVKANGE-PAYSYYG  546
            +AWP +HEAV+D +  EPF +ANG  PAY+YYG
Sbjct  138  RAWPRLHEAVLDPAGPEPFARANGGVPAYAYYG  170



>gb|AAP03053.1| S-adenosyl-L-methionine: beta-alanine N-methyltransferase [Limonium 
latifolium]
Length=191

 Score =   171 bits (432),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 85/144 (59%), Positives = 109/144 (76%), Gaps = 10/144 (7%)
 Frame = +1

Query  142  SVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSG--GGDAQNLQRILRMLTSYG  315
            +VPMSL A+VRL V +AIW  GSN P+SA+EILS  LP      DA+NLQR+LR+LTS+G
Sbjct  6    NVPMSLTAIVRLKVPEAIWSNGSNTPVSAAEILSR-LPDAPPTADAENLQRLLRVLTSFG  64

Query  316  VFREHINADAS------ERRYSLGEVGKTLVT-DKDGLSYGAYVLQHHQDALMKAWPLVH  474
            VF EH++  +S      ERRY L EVG+TLV+ D+   S+GAYVLQHHQ+ L+KAWP +H
Sbjct  65   VFSEHLDTTSSSSSSTSERRYCLTEVGQTLVSFDESCPSHGAYVLQHHQETLLKAWPFLH  124

Query  475  EAVVDSSSEPFVKANGEPAYSYYG  546
             A++D+S+EPF + NGEPAY YYG
Sbjct  125  TAILDASTEPFARVNGEPAYQYYG  148



>ref|XP_006423903.1| hypothetical protein CICLE_v10029876mg [Citrus clementina]
 gb|ESR37143.1| hypothetical protein CICLE_v10029876mg [Citrus clementina]
Length=294

 Score =   173 bits (438),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 80/113 (71%), Positives = 93/113 (82%), Gaps = 1/113 (1%)
 Frame = +1

Query  208  SNAPLSASEILSSVLPSGGGDAQNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTL  387
            +N PLS S+IL+ +LPSGGGDA+NLQ ILR+LTSYGVF EH      ER+YSL E+GK+L
Sbjct  16   ANTPLSVSQILTCILPSGGGDAENLQCILRLLTSYGVFSEH-REFRGERKYSLTEIGKSL  74

Query  388  VTDKDGLSYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
            VTD +GLSY  YVLQHHQDA M AWPLVHEAV+D + EPFVK +GEPAYSYYG
Sbjct  75   VTDAEGLSYAPYVLQHHQDAFMSAWPLVHEAVLDPTIEPFVKVHGEPAYSYYG  127



>gb|KDO41959.1| hypothetical protein CISIN_1g021707mg [Citrus sinensis]
Length=309

 Score =   173 bits (438),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 80/113 (71%), Positives = 93/113 (82%), Gaps = 1/113 (1%)
 Frame = +1

Query  208  SNAPLSASEILSSVLPSGGGDAQNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTL  387
            +N PLS S+IL+ +LPSGGGDA+NLQ ILR+LTSYGVF EH      ER+YSL E+GK+L
Sbjct  16   ANTPLSVSQILTCILPSGGGDAENLQCILRLLTSYGVFSEH-REFRGERKYSLTEIGKSL  74

Query  388  VTDKDGLSYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
            VTD +GLSY  YVLQHHQDA M AWPLVHEAV+D + EPFVK +GEPAYSYYG
Sbjct  75   VTDAEGLSYAPYVLQHHQDAFMSAWPLVHEAVLDPTIEPFVKVHGEPAYSYYG  127



>gb|KDO38249.1| hypothetical protein CISIN_1g043063mg [Citrus sinensis]
Length=301

 Score =   172 bits (437),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 94/113 (83%), Gaps = 1/113 (1%)
 Frame = +1

Query  208  SNAPLSASEILSSVLPSGGGDAQNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTL  387
            +N PLSAS+IL+ +LPSGGGDA+NLQRILR+LT+YGVF EH      ER+YSL E+GK+L
Sbjct  16   ANTPLSASQILTRILPSGGGDAENLQRILRLLTNYGVFSEH-REFGGERKYSLTEIGKSL  74

Query  388  VTDKDGLSYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
            VTD +G SY  YVLQHHQDALM AWPLVHEA++D + EPFVK +GEP YSYYG
Sbjct  75   VTDAEGQSYAPYVLQHHQDALMSAWPLVHEAILDPTIEPFVKVHGEPTYSYYG  127



>ref|XP_010935842.1| PREDICTED: caffeic acid 3-O-methyltransferase isoform X2 [Elaeis 
guineensis]
Length=346

 Score =   171 bits (433),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 94/161 (58%), Positives = 118/161 (73%), Gaps = 12/161 (7%)
 Frame = +1

Query  97   QKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEI--LSSVLPSGGGD  270
            QK A L +MEL+NMI+VPMSL+AVVRLNV  AIWQ G+N+PLSA+EI  L    P    D
Sbjct  51   QKKANLAMMELSNMIAVPMSLHAVVRLNVPAAIWQSGTNSPLSAAEILPLLRPPPPPSTD  110

Query  271  AQNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVT-------DKDGLSYGAYVL  429
              NLQR+LR+L S+GVF EH++  +  RR+SL  VG+TLV+        +DG SY AYVL
Sbjct  111  PGNLQRLLRLLASHGVFTEHLSP-SGVRRFSLTPVGQTLVSAASSNGGGEDGPSYAAYVL  169

Query  430  QHHQDALMKAWPLVHEAVVD-SSSEPFVKAN-GEPAYSYYG  546
            QHHQDAL++AWP +HEAV+D +  EPF +AN G PAY+YYG
Sbjct  170  QHHQDALVRAWPRLHEAVLDPAGPEPFARANGGTPAYAYYG  210



>gb|AGW45465.1| beta-alanine n-methyltransferase, partial [Reaumuria trigyna]
Length=204

 Score =   167 bits (422),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 79/126 (63%), Positives = 99/126 (79%), Gaps = 2/126 (2%)
 Frame = +1

Query  175  LNVADAIWQGGSNAPLSASEILSSVLP-SGGGDAQNLQRILRMLTSYGVFREHI-NADAS  348
            L V +AIW  GSN PL+A+EILS +LP S   D +NLQR+LR+LT+Y +F EH+ +    
Sbjct  1    LKVPEAIWAHGSNKPLTATEILSHILPNSPTADPENLQRMLRLLTTYNIFVEHLSDTTPV  60

Query  349  ERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEP  528
            +RRYSL EVG+TLV D DGLSYG Y++QHHQDAL+++WPLVH AVVD  +EPFV+ANGE 
Sbjct  61   QRRYSLTEVGETLVPDSDGLSYGDYIMQHHQDALVRSWPLVHMAVVDPVTEPFVRANGES  120

Query  529  AYSYYG  546
            AY YYG
Sbjct  121  AYWYYG  126



>ref|XP_006436414.1| hypothetical protein CICLE_v10033543mg [Citrus clementina]
 gb|ESR49654.1| hypothetical protein CICLE_v10033543mg [Citrus clementina]
Length=317

 Score =   170 bits (430),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 78/113 (69%), Positives = 94/113 (83%), Gaps = 1/113 (1%)
 Frame = +1

Query  208  SNAPLSASEILSSVLPSGGGDAQNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTL  387
            +N PLSAS+IL+ +LPSGGGDA+NLQRILR+LTSYGVF EH      +R YSL E+GK+L
Sbjct  16   ANTPLSASQILTRILPSGGGDAENLQRILRLLTSYGVFSEH-REFGGKRMYSLTEIGKSL  74

Query  388  VTDKDGLSYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
            VTD +GLSY  YVLQHHQDALM  WPLVH+A++D + EPF+K +GEPAYSYYG
Sbjct  75   VTDVEGLSYAPYVLQHHQDALMSMWPLVHKAILDPTIEPFLKVHGEPAYSYYG  127



>ref|XP_006485837.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Citrus sinensis]
Length=337

 Score =   170 bits (431),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 78/113 (69%), Positives = 94/113 (83%), Gaps = 1/113 (1%)
 Frame = +1

Query  208  SNAPLSASEILSSVLPSGGGDAQNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTL  387
            +N PLSAS+IL+ +LPSGGGDA+NLQRILR+LTSYGVF EH      +R YSL E+GK+L
Sbjct  16   ANTPLSASQILTRILPSGGGDAENLQRILRLLTSYGVFSEH-REFGGKRMYSLTEIGKSL  74

Query  388  VTDKDGLSYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
            VTD +GLSY  YVLQHHQDALM  WPLVH+A++D + EPF+K +GEPAYSYYG
Sbjct  75   VTDVEGLSYAPYVLQHHQDALMSMWPLVHKAILDPTIEPFLKVHGEPAYSYYG  127



>ref|XP_010935841.1| PREDICTED: quercetin 3-O-methyltransferase 1 isoform X1 [Elaeis 
guineensis]
Length=409

 Score =   171 bits (433),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 94/161 (58%), Positives = 118/161 (73%), Gaps = 12/161 (7%)
 Frame = +1

Query  97   QKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEI--LSSVLPSGGGD  270
            QK A L +MEL+NMI+VPMSL+AVVRLNV  AIWQ G+N+PLSA+EI  L    P    D
Sbjct  51   QKKANLAMMELSNMIAVPMSLHAVVRLNVPAAIWQSGTNSPLSAAEILPLLRPPPPPSTD  110

Query  271  AQNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVT-------DKDGLSYGAYVL  429
              NLQR+LR+L S+GVF EH++  +  RR+SL  VG+TLV+        +DG SY AYVL
Sbjct  111  PGNLQRLLRLLASHGVFTEHLSP-SGVRRFSLTPVGQTLVSAASSNGGGEDGPSYAAYVL  169

Query  430  QHHQDALMKAWPLVHEAVVD-SSSEPFVKAN-GEPAYSYYG  546
            QHHQDAL++AWP +HEAV+D +  EPF +AN G PAY+YYG
Sbjct  170  QHHQDALVRAWPRLHEAVLDPAGPEPFARANGGTPAYAYYG  210



>ref|XP_006451708.1| hypothetical protein CICLE_v10010561mg, partial [Citrus clementina]
 gb|ESR64948.1| hypothetical protein CICLE_v10010561mg, partial [Citrus clementina]
Length=305

 Score =   165 bits (417),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 76/113 (67%), Positives = 92/113 (81%), Gaps = 1/113 (1%)
 Frame = +1

Query  208  SNAPLSASEILSSVLPSGGGDAQNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTL  387
            +N PLSAS+IL+ +LPSG GDA+NLQRILR+LTSYGVF EH      + +YS+ E+GK+L
Sbjct  4    ANTPLSASQILTHILPSGSGDAENLQRILRLLTSYGVFSEH-REFGGQMKYSITEIGKSL  62

Query  388  VTDKDGLSYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
            VTD +GLSY  YVLQHHQDALM  WPLVHEAV+D + EP VK +G+PAYSYYG
Sbjct  63   VTDAEGLSYAPYVLQHHQDALMSMWPLVHEAVLDPTIEPLVKVHGKPAYSYYG  115



>ref|XP_006485822.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Citrus sinensis]
Length=274

 Score =   162 bits (410),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 75/113 (66%), Positives = 92/113 (81%), Gaps = 1/113 (1%)
 Frame = +1

Query  208  SNAPLSASEILSSVLPSGGGDAQNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTL  387
            +N PLSAS+IL+ +LPSG GDA+NLQRILR+LTSYGVF EH      + +YS+ E+GK+L
Sbjct  16   ANTPLSASQILTHILPSGSGDAENLQRILRLLTSYGVFSEH-REFGGQMKYSITEIGKSL  74

Query  388  VTDKDGLSYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
            VTD +GLSY  YVLQHHQDALM  WPLV+EAV+D + EP VK +G+PAYSYYG
Sbjct  75   VTDAEGLSYAPYVLQHHQDALMSMWPLVYEAVLDPTIEPLVKVHGKPAYSYYG  127



>dbj|BAJ96291.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK00225.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=367

 Score =   164 bits (416),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 86/151 (57%), Positives = 108/151 (72%), Gaps = 7/151 (5%)
 Frame = +1

Query  103  NARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQNL  282
             ARL +MELANMI+VPM+L AV+RL V  A+W GG+N PLSA+E+    LP+G  D   L
Sbjct  22   EARLAMMELANMIAVPMALTAVIRLGVPAAVWAGGANLPLSAAEL----LPAGHPDPSVL  77

Query  283  QRILRMLTSYGVFREHINADASERRYSLGEVGKTLV-TDKDGLSYGAYVLQHHQDALMKA  459
            +R+LR+L S GVF EH      ERRY+L  VG+TLV +   G SY  YVLQHHQDAL+ A
Sbjct  78   ERLLRLLASRGVFSEHAADGGRERRYALTAVGRTLVPSAPSGASYADYVLQHHQDALVLA  137

Query  460  WPLVHEAVVD-SSSEPFVKAN-GEPAYSYYG  546
            WP +HEAV+D +  EPF +A+ G PAY+YYG
Sbjct  138  WPRLHEAVLDPAGPEPFARAHAGVPAYAYYG  168



>ref|XP_010683979.1| PREDICTED: caffeic acid 3-O-methyltransferase [Beta vulgaris 
subsp. vulgaris]
Length=383

 Score =   164 bits (414),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 93/168 (55%), Positives = 114/168 (68%), Gaps = 14/168 (8%)
 Frame = +1

Query  82   ESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSG  261
            E+   +  ARL IMELANMISVPM+LNAVVRL V  AIW  G+N PL+A+ I+S +LP+ 
Sbjct  18   ETSETRNKARLAIMELANMISVPMALNAVVRLKVPAAIWSCGANTPLTAAAIISLILPNN  77

Query  262  G-GDAQNLQRILRMLTSYGVFREH--INADASERRYSLGEVGKTLVTDKDGL--------  408
               DA NL R+LR+L++YGVF EH  +  D   RRYSL EVG+TLV    G         
Sbjct  78   PEADADNLARLLRLLSTYGVFSEHPPLYGDIF-RRYSLTEVGRTLVAGDGGGGGGDDGGG  136

Query  409  -SYGAYVLQHHQDALMKAWPLVHEAVVDSSSE-PFVKANGEPAYSYYG  546
             S+G YVLQHHQ+AL++AW  V  AVV  +S+ PF  ANGEPAY YYG
Sbjct  137  SSHGEYVLQHHQEALVRAWLQVDRAVVGPTSKTPFEVANGEPAYDYYG  184



>ref|XP_004954455.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Setaria italica]
Length=344

 Score =   161 bits (407),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 86/147 (59%), Positives = 106/147 (72%), Gaps = 8/147 (5%)
 Frame = +1

Query  118  IMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQNLQRILR  297
            +MELANMISVPM+L AV+RL V  A+W GG+NAPLSA+E+    LP G  D   L+R+LR
Sbjct  1    MMELANMISVPMALTAVIRLGVPSAVWAGGANAPLSAAEL----LPEGHPDPSVLERLLR  56

Query  298  MLTSYGVFREHINADA-SERRYSLGEVGKTLV-TDKDGLSYGAYVLQHHQDALMKAWPLV  471
            +L S GVF EH    A S RR++L  VG+TLV +   G SY  YVLQHHQDAL+ AWP +
Sbjct  57   LLASRGVFSEHGGGSAGSPRRFALTAVGRTLVPSGPSGASYADYVLQHHQDALVSAWPRL  116

Query  472  HEAVVD-SSSEPFVKAN-GEPAYSYYG  546
            HEAV+D +  EPF +AN G PAY+YYG
Sbjct  117  HEAVLDPAGPEPFARANAGVPAYAYYG  143



>ref|XP_002453074.1| hypothetical protein SORBIDRAFT_04g037820 [Sorghum bicolor]
 gb|EES06050.1| hypothetical protein SORBIDRAFT_04g037820 [Sorghum bicolor]
Length=377

 Score =   158 bits (399),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 85/155 (55%), Positives = 107/155 (69%), Gaps = 11/155 (7%)
 Frame = +1

Query  103  NARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQNL  282
             ARL +MELANM+SVPM+L AV+RL V  AIW GG+NAP SA+E+    LP+G  D   L
Sbjct  26   EARLAMMELANMVSVPMALTAVIRLGVPAAIWAGGANAPRSAAEL----LPAGHPDPSVL  81

Query  283  QRILRMLTSYGVFREHINAD----ASERRYSLGEVGKTLVTD-KDGLSYGAYVLQHHQDA  447
            +R+LR+L S GVF E  +       + RR++L  VG+TLV +   G SY  YVLQHHQDA
Sbjct  82   ERLLRLLASRGVFSESTSTSEDRTTTTRRFALTAVGRTLVPEGASGASYADYVLQHHQDA  141

Query  448  LMKAWPLVHEAVVDS-SSEPFVKAN-GEPAYSYYG  546
            L+ AWP +HEAV+D    EPF +AN G PAY+YYG
Sbjct  142  LVAAWPRLHEAVLDPRGPEPFARANAGVPAYAYYG  176



>gb|EEC74273.1| hypothetical protein OsI_09508 [Oryza sativa Indica Group]
Length=345

 Score =   154 bits (388),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 90/166 (54%), Positives = 114/166 (69%), Gaps = 13/166 (8%)
 Frame = +1

Query  76   GSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLP  255
            G + E +   ARL +MELANMISVPM+L AV+RL V   +W GG+NAPL+A+++    LP
Sbjct  4    GGDGELSPAEARLAMMELANMISVPMALTAVIRLGVPAKLWAGGANAPLTAADL----LP  59

Query  256  SGGGDAQNLQRILRMLTSYGVFREHIN-ADASERRYSLGEVGKTLVTDKDGL------SY  414
            +G  D   L+R+LR+L S GVF EH   +  S RR+SL  VG+TLV    G       SY
Sbjct  60   AGHPDPSVLERLLRLLASRGVFSEHTGSSSPSPRRFSLTAVGRTLVPGGGGSPSGSGASY  119

Query  415  GAYVLQHHQDALMKAWPLVHEAVVD-SSSEPFVKAN-GEPAYSYYG  546
              YVLQHHQDAL++AWPL+HEAV+D S  EPF +AN G PAY+YYG
Sbjct  120  ADYVLQHHQDALVRAWPLLHEAVLDPSGPEPFARANAGVPAYAYYG  165



>gb|ACN25427.1| unknown [Zea mays]
 gb|AFW63931.1| caffeic acid 3-O-methyltransferase [Zea mays]
Length=374

 Score =   154 bits (388),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 82/153 (54%), Positives = 106/153 (69%), Gaps = 9/153 (6%)
 Frame = +1

Query  103  NARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQNL  282
             ARL +MELANM+SVPM+L AV+RL V  A+W GG+NAP+SA+++    LP G  D   L
Sbjct  24   EARLAMMELANMVSVPMALAAVIRLGVPAAVWAGGANAPMSAADL----LPPGHPDPSVL  79

Query  283  QRILRMLTSYGVFREHINADASERR--YSLGEVGKTLVT-DKDGLSYGAYVLQHHQDALM  453
            +R+LR+L S GVF E   +  + RR  ++L  VG+TLV     G SY  YVLQHHQDAL+
Sbjct  80   ERLLRLLASRGVFSESTESTPTTRRRLFALTAVGRTLVPGPASGASYADYVLQHHQDALV  139

Query  454  KAWPLVHEAVVDSS-SEPFVKAN-GEPAYSYYG  546
             AWP +HEAV+D +  EPF +AN G  AY+YYG
Sbjct  140  AAWPRLHEAVLDPAGPEPFARANAGVTAYAYYG  172



>ref|NP_001149617.1| LOC100283243 [Zea mays]
 gb|ACG36095.1| caffeic acid 3-O-methyltransferase [Zea mays]
Length=374

 Score =   154 bits (388),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 82/153 (54%), Positives = 106/153 (69%), Gaps = 9/153 (6%)
 Frame = +1

Query  103  NARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQNL  282
             ARL +MELANM+SVPM+L AV+RL V  A+W GG+NAP+SA+++    LP G  D   L
Sbjct  24   EARLAMMELANMVSVPMALAAVIRLGVPXAVWAGGANAPMSAADL----LPPGHPDPSVL  79

Query  283  QRILRMLTSYGVFREHINADASERR--YSLGEVGKTLVT-DKDGLSYGAYVLQHHQDALM  453
            +R+LR+L S GVF E   +  + RR  ++L  VG+TLV     G SY  YVLQHHQDAL+
Sbjct  80   ERLLRLLASRGVFSESTESTPTTRRRLFALTAVGRTLVPGPASGASYADYVLQHHQDALV  139

Query  454  KAWPLVHEAVVDSS-SEPFVKAN-GEPAYSYYG  546
             AWP +HEAV+D +  EPF +AN G  AY+YYG
Sbjct  140  AAWPRLHEAVLDPAGPEPFARANAGVTAYAYYG  172



>ref|NP_001048569.1| Os02g0823400 [Oryza sativa Japonica Group]
 dbj|BAD22923.1| putative O-diphenol-O-methyl transferase [Oryza sativa Japonica 
Group]
 dbj|BAD22855.1| putative O-diphenol-O-methyl transferase [Oryza sativa Japonica 
Group]
 dbj|BAF10483.1| Os02g0823400 [Oryza sativa Japonica Group]
 dbj|BAG97074.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE58073.1| hypothetical protein OsJ_08933 [Oryza sativa Japonica Group]
Length=365

 Score =   153 bits (387),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 90/166 (54%), Positives = 114/166 (69%), Gaps = 13/166 (8%)
 Frame = +1

Query  76   GSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLP  255
            G + E +   ARL +MELANMISVPM+L AV+RL V   +W GG+NAPL+A+++    LP
Sbjct  4    GGDGELSPAEARLAMMELANMISVPMALTAVIRLGVPAKLWAGGANAPLAAADL----LP  59

Query  256  SGGGDAQNLQRILRMLTSYGVFREHIN-ADASERRYSLGEVGKTLVTDKDGL------SY  414
            +G  D   L+R+LR+L S GVF EH   +  S RR+SL  VG+TLV    G       SY
Sbjct  60   AGHPDPSVLERLLRLLASRGVFSEHTGSSSPSPRRFSLTAVGRTLVPGGGGSPSGSGASY  119

Query  415  GAYVLQHHQDALMKAWPLVHEAVVD-SSSEPFVKAN-GEPAYSYYG  546
              YVLQHHQDAL++AWPL+HEAV+D S  EPF +AN G PAY+YYG
Sbjct  120  ADYVLQHHQDALVRAWPLLHEAVLDPSGPEPFARANAGVPAYAYYG  165



>ref|XP_003572969.1| PREDICTED: caffeic acid 3-O-methyltransferase [Brachypodium distachyon]
Length=362

 Score =   151 bits (382),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 83/163 (51%), Positives = 109/163 (67%), Gaps = 9/163 (6%)
 Frame = +1

Query  70   AMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSV  249
            A   + E +   ARL +MELANMISVPM+L A +RL V  AIW  G+NAPLSA+++    
Sbjct  4    AASEDEELSPAEARLAMMELANMISVPMALTAAIRLGVPGAIWADGANAPLSAADL----  59

Query  250  LPSGGGDAQNLQRILRMLTSYGVFREHINADASE--RRYSLGEVGKTLV-TDKDGLSYGA  420
            LP+   D   L+R+LR+L S GVF EH     +E  RR++L  VG+TLV     G SY  
Sbjct  60   LPADHPDPSVLERVLRLLASRGVFSEHHGPGPAEPTRRFALTAVGRTLVPAGPSGASYAD  119

Query  421  YVLQHHQDALMKAWPLVHEAVVDSS-SEPFVKAN-GEPAYSYY  543
            YVLQHHQDAL+ AWP +HEA++D +  EPF +A+ G PAY++Y
Sbjct  120  YVLQHHQDALVLAWPRLHEALLDPAGPEPFARAHRGLPAYAFY  162



>ref|XP_010275846.1| PREDICTED: uncharacterized protein LOC104610771 [Nelumbo nucifera]
Length=277

 Score =   142 bits (358),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 82/183 (45%), Positives = 100/183 (55%), Gaps = 45/183 (25%)
 Frame = +1

Query  73   MGSESESAQKNARLTIMELANMISVP------MSLNAVVRLNVAD---------------  189
            M  E+   + N RL I+ELANMI  P          A  R+                   
Sbjct  1    MADETMETRDNGRLAILELANMIKSPNVPQRHHPPQASKRIKACPGQPWPGRRTGFFRCR  60

Query  190  ----AIWQGGSNAPLSASEILSSVLPSGGGDAQNLQRILRMLTSYGVFREHINADASERR  357
                 IWQGGSN PLSASEIL+ VLP    D +N Q IL+ML+SYG+F EHI        
Sbjct  61   TTLVTIWQGGSNVPLSASEILAYVLPIS--DPENFQHILQMLSSYGIFSEHI--------  110

Query  358  YSLGEVGKTLVTDKDGLSYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYS  537
                      VT+++GL Y AY+L+HHQDAL+KAWP++HEAVVD   E  VK+NGEP  S
Sbjct  111  ----------VTNREGLFYVAYILKHHQDALVKAWPILHEAVVDLEEELLVKSNGEPVRS  160

Query  538  YYG  546
            YYG
Sbjct  161  YYG  163



>gb|AES72848.2| caffeic acid O-methyltransferase [Medicago truncatula]
Length=335

 Score =   142 bits (358),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 74/150 (49%), Positives = 101/150 (67%), Gaps = 24/150 (16%)
 Frame = +1

Query  91   SAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGD  270
             +Q  ARL I+ELA+++SVP SL AV+++ V +AIWQGG+N PLSAS+ILS V P+GGGD
Sbjct  10   KSQSEARLAILELAHIMSVPTSLVAVLKMKVPEAIWQGGNNTPLSASQILSIVRPNGGGD  69

Query  271  AQNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQDAL  450
            A+NLQRILR+LT+Y +F E ++++  +R+YSL E                       D  
Sbjct  70   AENLQRILRLLTTYAIFAEDLSSNG-KRKYSLTE-----------------------DQY  105

Query  451  MKAWPLVHEAVVDSSSEPFVKANGEPAYSY  540
            ++AWPLV EAV D + EPF K +GE AY+Y
Sbjct  106  LRAWPLVGEAVEDPTVEPFEKLHGEGAYAY  135



>ref|XP_011101495.1| PREDICTED: caffeic acid 3-O-methyltransferase-like, partial [Sesamum 
indicum]
Length=113

 Score =   132 bits (332),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 70/105 (67%), Positives = 78/105 (74%), Gaps = 5/105 (5%)
 Frame = +1

Query  112  LTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSG---GGDAQNL  282
            L IMEL N++SVPMSL AV++L V D I Q GSN PLS +EI  S LPS      DA+NL
Sbjct  11   LAIMELVNLVSVPMSLKAVIQLKVLDTIRQDGSNNPLSPAEI--SYLPSRLALARDAENL  68

Query  283  QRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYG  417
            QRILR+LTSYGVF EHI AD SERRYSL EVGK L  DK+GLSY 
Sbjct  69   QRILRLLTSYGVFNEHIGADGSERRYSLKEVGKALAADKNGLSYA  113



>gb|KDO38695.1| hypothetical protein CISIN_1g037818mg, partial [Citrus sinensis]
Length=199

 Score =   130 bits (326),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 65/113 (58%), Positives = 75/113 (66%), Gaps = 29/113 (26%)
 Frame = +1

Query  208  SNAPLSASEILSSVLPSGGGDAQNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTL  387
            +N PLSAS+IL+ +LPSG GDA+NLQRILR+LTSYG                        
Sbjct  16   ANTPLSASQILTRILPSGDGDAENLQRILRLLTSYG------------------------  51

Query  388  VTDKDGLSYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
                 GLSY  Y+LQHHQDALM AWPLVHEAV+D + EPFVK +GEPAYSYYG
Sbjct  52   -----GLSYAPYMLQHHQDALMSAWPLVHEAVLDPTIEPFVKVHGEPAYSYYG  99



>ref|XP_008387516.1| PREDICTED: caffeic acid 3-O-methyltransferase [Malus domestica]
Length=284

 Score =   129 bits (324),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 61/86 (71%), Positives = 72/86 (84%), Gaps = 3/86 (3%)
 Frame = +1

Query  298  MLTSYGVFREHI-NAD--ASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQDALMKAWPL  468
            MLTSYGVF EH+ N D  + +R++SL  +G+TLVTD++GLSYG YVLQHHQD LM AWP+
Sbjct  1    MLTSYGVFEEHLSNLDDGSDDRKFSLTPIGQTLVTDQNGLSYGPYVLQHHQDVLMGAWPM  60

Query  469  VHEAVVDSSSEPFVKANGEPAYSYYG  546
            VHEAVVDS+ EPFVKANGE AY YYG
Sbjct  61   VHEAVVDSTVEPFVKANGELAYEYYG  86



>ref|XP_006838729.1| hypothetical protein AMTR_s00002p00253410 [Amborella trichopoda]
 gb|ERN01298.1| hypothetical protein AMTR_s00002p00253410 [Amborella trichopoda]
Length=352

 Score =   129 bits (325),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 68/160 (43%), Positives = 104/160 (65%), Gaps = 6/160 (4%)
 Frame = +1

Query  64   IEAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILS  243
            +E + +   +   +    +MEL N I+V MSL A+ +L+V   IWQ G N PL+A EI +
Sbjct  1    MEGVSNNGSNGASHTTWAMMELTNSIAVSMSLRAMAKLDVPKIIWQNGENTPLTALEIAT  60

Query  244  SVLPSGGGDAQNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGAY  423
             +    G  + NL+R+LR+LT++GVF E +   +  RR+SL  +G+ +V D+   S GA+
Sbjct  61   KLGSEAG--SSNLERMLRLLTAHGVFNETMLGPSEGRRFSLTGLGREIV-DR---SMGAF  114

Query  424  VLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYY  543
            +L    DAL+ AW L+HEAV++ SSEPF+KA+G+PAY Y+
Sbjct  115  ILYRLDDALLDAWRLLHEAVLEPSSEPFIKAHGKPAYHYH  154



>gb|KCW89310.1| hypothetical protein EUGRSUZ_A01600 [Eucalyptus grandis]
Length=285

 Score =   128 bits (321),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 62/87 (71%), Positives = 72/87 (83%), Gaps = 4/87 (5%)
 Frame = +1

Query  298  MLTSYGVFREHINADAS----ERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQDALMKAWP  465
            ML S+GVF EH+   AS    ERRYSL EVGKTLVTD +GLSY  YVLQHHQDALM+AWP
Sbjct  1    MLASHGVFEEHVAPAASSASSERRYSLTEVGKTLVTDAEGLSYAPYVLQHHQDALMRAWP  60

Query  466  LVHEAVVDSSSEPFVKANGEPAYSYYG  546
            LVHEAV+D ++EPFVKANG+ AY++YG
Sbjct  61   LVHEAVLDPATEPFVKANGDTAYAHYG  87



>ref|XP_010243879.1| PREDICTED: uncharacterized protein LOC104587837 [Nelumbo nucifera]
Length=130

 Score =   121 bits (303),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 61/94 (65%), Positives = 70/94 (74%), Gaps = 2/94 (2%)
 Frame = +1

Query  73   MGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVL  252
            M  E    Q N RL I+ELAN+I+VPMSLNA+V L VADAI QG SN PLSASEIL+ VL
Sbjct  1    MADEKTKTQNNTRLAILELANIINVPMSLNAIVCLKVADAIQQGSSNVPLSASEILACVL  60

Query  253  PSGGGDAQNLQRILRMLTSYGVFREHINADASER  354
            P+  GD  NLQ ILRMLTSY VF EHI  D+S++
Sbjct  61   PT--GDPDNLQCILRMLTSYDVFSEHIVDDSSKQ  92



>ref|XP_006425490.1| hypothetical protein CICLE_v10027189mg, partial [Citrus clementina]
 gb|ESR38730.1| hypothetical protein CICLE_v10027189mg, partial [Citrus clementina]
Length=298

 Score =   121 bits (304),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 63/113 (56%), Positives = 74/113 (65%), Gaps = 21/113 (19%)
 Frame = +1

Query  208  SNAPLSASEILSSVLPSGGGDAQNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTL  387
            +N  LSAS+IL+ +L SGGGDA+NLQRIL   T                     E+GK+L
Sbjct  4    ANTHLSASQILTRILSSGGGDAENLQRILLQPT---------------------EIGKSL  42

Query  388  VTDKDGLSYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
            VTD +GLSY  YVLQHH DALM AWPLVHE V+D + E FVK +G PAYSYYG
Sbjct  43   VTDAEGLSYAPYVLQHHHDALMSAWPLVHEVVLDPTIELFVKVHGVPAYSYYG  95



>gb|KCW89309.1| hypothetical protein EUGRSUZ_A01600 [Eucalyptus grandis]
Length=345

 Score =   113 bits (283),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 62/128 (48%), Positives = 75/128 (59%), Gaps = 34/128 (27%)
 Frame = +1

Query  265  GDAQNLQRILRMLTSYGVFREHINAD--------ASERRYSLGEVGKTLVTDKDGLSYGA  420
            GDA+NLQR+LRML S+G F E   A           ERR+SL EV KTLVTD +GLSY A
Sbjct  20   GDAENLQRLLRMLASHGAFEERFPATSASSASSGCFERRFSLTEVRKTLVTDAEGLSYAA  79

Query  421  YV--------------------------LQHHQDALMKAWPLVHEAVVDSSSEPFVKANG  522
            YV                           +   DALM+AWPLVHEAV+D ++EPFVKANG
Sbjct  80   YVSSSTTRPKKAMERREICLPESRKKRRQKKASDALMRAWPLVHEAVLDPATEPFVKANG  139

Query  523  EPAYSYYG  546
            + AY++YG
Sbjct  140  DTAYAHYG  147



>ref|XP_006649184.1| PREDICTED: flavone 3'-O-methyltransferase 1-like [Oryza brachyantha]
Length=313

 Score =   107 bits (266),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 66/160 (41%), Positives = 83/160 (52%), Gaps = 48/160 (30%)
 Frame = +1

Query  73   MGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVL  252
            M +  + +   ARL +MELANMISVPM+L AV+RL                      S  
Sbjct  1    MAAGDDLSPAEARLAMMELANMISVPMALTAVIRLGF--------------------SPD  40

Query  253  PSGGGDAQNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGAYVLQ  432
            P+G G                          S RR++L  VG+TLV    G SY  YVLQ
Sbjct  41   PAGSG--------------------------SLRRFALTAVGRTLVPGPSGASYADYVLQ  74

Query  433  HHQDALMKAWPLVHEAVVD-SSSEPFVKAN-GEPAYSYYG  546
            HHQDAL++AWP +HEAV+D +  EPF +AN G PAY+YYG
Sbjct  75   HHQDALVRAWPRLHEAVLDPAGPEPFARANAGVPAYAYYG  114



>gb|KDO39806.1| hypothetical protein CISIN_1g025363mg [Citrus sinensis]
Length=254

 Score =   105 bits (262),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = +1

Query  358  YSLGEVGKTLVTDKDGLSYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYS  537
            YSL E+GK+LVTD +GLSY  YVLQHHQDALM  WPLVH+A++D + EPF+K +GEPAYS
Sbjct  2    YSLTEIGKSLVTDVEGLSYAPYVLQHHQDALMSMWPLVHKAILDPTIEPFLKVHGEPAYS  61

Query  538  YYG  546
            YYG
Sbjct  62   YYG  64



>ref|XP_002986612.1| hypothetical protein SELMODRAFT_124122 [Selaginella moellendorffii]
 gb|EFJ12469.1| hypothetical protein SELMODRAFT_124122 [Selaginella moellendorffii]
Length=235

 Score = 97.8 bits (242),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 53/149 (36%), Positives = 89/149 (60%), Gaps = 6/149 (4%)
 Frame = +1

Query  97   QKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGG-GDA  273
            Q + RL IME   M  +P +LNAV++L + D I     +APLS++EI++ +   G  G  
Sbjct  7    QDDDRLRIMEFGTMCGIPSALNAVIKLGIPD-ILSSSQDAPLSSAEIIAQIPACGSSGSG  65

Query  274  QNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKD--GLSYGAYVLQHHQDA  447
             NL RILR+L+S GVF+E ++ D   R+Y +  + + LVT+    GL   ++V+ +    
Sbjct  66   ANLDRILRVLSSVGVFQESLH-DGGIRKYGVTPLCRYLVTNPSNGGLPLSSWVIANQDVV  124

Query  448  LMKAWPLVHEAVVDSSSEPFVKANGEPAY  534
             MK W  ++++V  + ++PF  A+G+P +
Sbjct  125  FMKTWEFLYQSVT-TGADPFTAAHGKPLF  152



>ref|XP_002965284.1| hypothetical protein SELMODRAFT_83100 [Selaginella moellendorffii]
 gb|EFJ34122.1| hypothetical protein SELMODRAFT_83100 [Selaginella moellendorffii]
Length=235

 Score = 97.4 bits (241),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 53/149 (36%), Positives = 89/149 (60%), Gaps = 6/149 (4%)
 Frame = +1

Query  97   QKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGG-GDA  273
            Q + RL IME   M  +P +LNAV++L + D I     +APLS++EI++ +   G  G  
Sbjct  7    QDDDRLRIMEFGTMCGIPSALNAVIKLGIPD-ILSSSQDAPLSSAEIIAQIPACGSSGSG  65

Query  274  QNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKD--GLSYGAYVLQHHQDA  447
             NL RILR+L+S GVF+E ++ D   R+Y +  + + LVT+    GL   ++V+ +    
Sbjct  66   ANLDRILRVLSSIGVFQESLH-DGGIRKYGVTPLCRYLVTNPSNGGLPLSSWVIVNQDVV  124

Query  448  LMKAWPLVHEAVVDSSSEPFVKANGEPAY  534
             MK W  ++++V  + ++PF  A+G+P +
Sbjct  125  FMKTWEFLYQSVT-TGADPFTAAHGKPLF  152



>ref|XP_002986521.1| hypothetical protein SELMODRAFT_124205 [Selaginella moellendorffii]
 gb|EFJ12378.1| hypothetical protein SELMODRAFT_124205 [Selaginella moellendorffii]
Length=238

 Score = 97.1 bits (240),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 53/149 (36%), Positives = 88/149 (59%), Gaps = 6/149 (4%)
 Frame = +1

Query  97   QKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGG-GDA  273
            Q + RL IME   M  +P +LNAV++L + D I     +APLS++EI++ +   G  G  
Sbjct  10   QDDDRLRIMEFGTMCGIPSALNAVIKLGIPD-ILSSSQDAPLSSAEIIAQIPACGSSGSG  68

Query  274  QNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTD--KDGLSYGAYVLQHHQDA  447
             NL RILR+L+S GVF+E ++ D   R+Y +  + + LVT+    GL   ++V  +    
Sbjct  69   ANLDRILRVLSSVGVFQESLH-DGGIRKYGVTPLCRYLVTNPSNSGLPLSSWVTLNQDVV  127

Query  448  LMKAWPLVHEAVVDSSSEPFVKANGEPAY  534
             MK W  ++++V  + ++PF  A+G+P +
Sbjct  128  FMKTWEFLYQSVT-TGADPFTAAHGKPVF  155



>gb|ADE88153.1| caffeyl alcohol/5-hydroxyconiferyl alcohol 3/5-O-methyltransferase-like 
2 [Selaginella moellendorffii]
Length=357

 Score = 97.4 bits (241),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 53/149 (36%), Positives = 89/149 (60%), Gaps = 6/149 (4%)
 Frame = +1

Query  97   QKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGG-GDA  273
            Q + RL IME   M  +P +LNAV++L + D I     +APLS++EI++ +   G  G  
Sbjct  7    QDDDRLRIMEFGTMCGIPSALNAVIKLGIPD-ILSSSQDAPLSSAEIIAQIPACGSSGSG  65

Query  274  QNLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKD--GLSYGAYVLQHHQDA  447
             NL RILR+L+S GVF+E ++ D   R+Y +  + + LVT+    GL   ++V+ +    
Sbjct  66   ANLDRILRVLSSIGVFQESLH-DGGIRKYGVTPLCRYLVTNPSNGGLPLSSWVIVNQDVV  124

Query  448  LMKAWPLVHEAVVDSSSEPFVKANGEPAY  534
             MK W  ++++V  + ++PF  A+G+P +
Sbjct  125  FMKTWEFLYQSVT-TGADPFTAAHGKPLF  152



>ref|XP_006441597.1| hypothetical protein CICLE_v10023355mg [Citrus clementina]
 gb|ESR54837.1| hypothetical protein CICLE_v10023355mg [Citrus clementina]
Length=181

 Score = 93.2 bits (230),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 43/56 (77%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = +1

Query  121  MELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQNLQR  288
            MELANMISVPMSL A +RL+V DAI QGG+N PLSAS+IL+ +LPSGGGDA+NLQR
Sbjct  1    MELANMISVPMSLTAAIRLHVPDAIRQGGANTPLSASQILTCILPSGGGDAENLQR  56



>ref|XP_002988275.1| caffeic acid O-methyltransferase [Selaginella moellendorffii]
 gb|EFJ10694.1| caffeic acid O-methyltransferase [Selaginella moellendorffii]
Length=353

 Score = 95.1 bits (235),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 56/144 (39%), Positives = 81/144 (56%), Gaps = 6/144 (4%)
 Frame = +1

Query  109  RLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQN--L  282
            RL IMELA M SVPM+L   V ++VA+ I + G    LSA+EI+S + P          L
Sbjct  14   RLQIMELATMCSVPMALKVAVEMDVAERIEKAGPGGLLSAAEIVSQI-PECSSPMSPIYL  72

Query  283  QRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQDALMKAW  462
             RI+R+L S  +F+E    +   R+Y L  + K L+ D+ G+S   +VL +     M+ W
Sbjct  73   DRIMRVLASRKIFKE--VDEGGVRKYGLTSMCKHLIKDERGVSLAHHVLMNQDKVFMETW  130

Query  463  PLVHEAVVDSSSEPFVKANGEPAY  534
              +HEAV+D   EPF KA G+  +
Sbjct  131  QYLHEAVLD-GGEPFTKAFGQTEF  153



>ref|XP_002963872.1| caffeic acid O-methyltransferase [Selaginella moellendorffii]
 gb|ADE88151.1| caffeyl alcohol/5-hydroxyconiferyl alcohol 3/5-O-methyltransferase 
[Selaginella moellendorffii]
 gb|EFJ35743.1| caffeic acid O-methyltransferase [Selaginella moellendorffii]
Length=353

 Score = 95.1 bits (235),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 56/144 (39%), Positives = 81/144 (56%), Gaps = 6/144 (4%)
 Frame = +1

Query  109  RLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQN--L  282
            RL IMELA M SVPM+L   V ++VA+ I + G    LSA+EI+S + P          L
Sbjct  14   RLQIMELATMCSVPMALKVAVEMDVAERIEKAGPGGLLSAAEIVSQI-PECSSPMSPIYL  72

Query  283  QRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQDALMKAW  462
             RI+R+L S  +F+E    +   R+Y L  + K L+ D+ G+S   +VL +     M+ W
Sbjct  73   DRIMRVLASRKIFKE--VDEGGVRKYGLTSMCKHLIKDERGVSLAHHVLMNQDKVFMETW  130

Query  463  PLVHEAVVDSSSEPFVKANGEPAY  534
              +HEAV+D   EPF KA G+  +
Sbjct  131  QYLHEAVLD-GGEPFTKAFGQTEF  153



>emb|CCC55423.1| caffeic acid O-3-methyltransferase [Pinus pinaster]
Length=364

 Score = 93.6 bits (231),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 59/166 (36%), Positives = 89/166 (54%), Gaps = 11/166 (7%)
 Frame = +1

Query  73   MGSESESAQKNAR-------LTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSAS  231
            MGS SES++ NA+       L  MEL N   +PM++ A + L+V   I   G+   LS  
Sbjct  1    MGSASESSEMNAKIVNEDEWLLGMELGNFSCLPMAMKAAIELDVLQIIANAGNGVQLSPR  60

Query  232  EILSSVLPSGGGDAQNLQRILRMLTSYGVFREHINAD---ASERRYSLGEVGKTLVTDKD  402
            +I++ +  +    A  L RILR L S+ V    +  D    +ER Y L  + K LV ++D
Sbjct  61   QIVAHIPTTNPDAAITLDRILRALASHSVLSCSVTTDENGKAERLYGLTPLCKYLVKNQD  120

Query  403  GLSYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSY  540
            G+S    VL +    LM++W  + +AV+D  S+PF KA+G  A+ Y
Sbjct  121  GVSLAPLVLMNQDKVLMESWYYLKDAVLD-GSQPFTKAHGMNAFEY  165



>gb|AHA44835.1| caffeate O-methyltransferase [Larix kaempferi]
Length=364

 Score = 89.4 bits (220),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 54/166 (33%), Positives = 89/166 (54%), Gaps = 11/166 (7%)
 Frame = +1

Query  73   MGSESESAQKNAR-------LTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSAS  231
            MGS +E+++ N +       L  MEL N   +PM++ A + L+V   I   G+   LS  
Sbjct  1    MGSAAENSEMNTKIVNEDEWLLGMELGNFSCLPMAMKAAIELDVLQIIANAGNGVQLSPR  60

Query  232  EILSSVLPSGGGDAQNLQRILRMLTSYGVFREHINAD---ASERRYSLGEVGKTLVTDKD  402
            +I++ +  +    A  L RILR+L S+ V    +  D    +ER Y L  + K LV ++D
Sbjct  61   QIVAHIPTTNPDAAITLDRILRVLASHSVLSCSVTTDENGKAERLYGLTALCKYLVKNQD  120

Query  403  GLSYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSY  540
            G+S    VL +    LM+ W  + +AV++  ++PF+KA+G  A+ Y
Sbjct  121  GVSLAPLVLMNQDKVLMECWYYLKDAVLE-GAQPFIKAHGMNAFEY  165



>gb|ABR18380.1| unknown [Picea sitchensis]
Length=365

 Score = 89.4 bits (220),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 56/166 (34%), Positives = 87/166 (52%), Gaps = 11/166 (7%)
 Frame = +1

Query  73   MGSESESAQKNAR-------LTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSAS  231
            MGS SE+++ N +       L  MEL N   +PM + A + L+V   I   G+   LS  
Sbjct  1    MGSASENSEMNMKIVNEDEWLLGMELGNFSCLPMGMKAAIELDVLQIIANAGNGVQLSPR  60

Query  232  EILSSVLPSGGGDAQNLQRILRMLTSYGVFREHINAD---ASERRYSLGEVGKTLVTDKD  402
            +I++ +  +    A  L RILR+L S+ V    +  D    +ER Y L  + K LV ++D
Sbjct  61   QIVAHIPTTNPDAAITLDRILRVLASHSVLSCSVTTDENGKAERLYGLTPLCKYLVNNQD  120

Query  403  GLSYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSY  540
            G+S    VL +    LM+ W  + +AV++  S+PF KA+G  A+ Y
Sbjct  121  GVSLAPLVLMNQDKVLMETWYYLKDAVLE-GSQPFTKAHGMNAFEY  165



>emb|CAI30878.1| caffeate O-methyltransferase [Picea abies]
 gb|ABK23738.1| unknown [Picea sitchensis]
Length=364

 Score = 89.0 bits (219),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 56/166 (34%), Positives = 87/166 (52%), Gaps = 11/166 (7%)
 Frame = +1

Query  73   MGSESESAQKNAR-------LTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSAS  231
            MGS SE+++ N +       L  MEL N   +PM + A + L+V   I   G+   LS  
Sbjct  1    MGSASENSEMNTKIVNEDEWLLGMELGNFSCLPMGMKAAIELDVLQIIANAGNGVQLSPR  60

Query  232  EILSSVLPSGGGDAQNLQRILRMLTSYGVFREHINAD---ASERRYSLGEVGKTLVTDKD  402
            +I++ +  +    A  L RILR+L S+ V    +  D    +ER Y L  + K LV ++D
Sbjct  61   QIVAHIPTTNPDAAITLDRILRVLASHSVLSCSVTTDENGKAERLYGLTPLCKYLVKNQD  120

Query  403  GLSYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSY  540
            G+S    VL +    LM +W  + +AV++  S+PF KA+G  A+ Y
Sbjct  121  GVSLAPLVLMNQDKVLMDSWYYLKDAVLE-GSQPFTKAHGMNAFEY  165



>gb|ABK22490.1| unknown [Picea sitchensis]
Length=364

 Score = 89.0 bits (219),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 56/166 (34%), Positives = 87/166 (52%), Gaps = 11/166 (7%)
 Frame = +1

Query  73   MGSESESAQKNAR-------LTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSAS  231
            MGS SE+++ N +       L  MEL N   +PM + A + L+V   I   G+   LS  
Sbjct  1    MGSASENSEMNTKVVNEDEWLLGMELGNFSCLPMGMKAAIELDVLQIIANAGNGVQLSPR  60

Query  232  EILSSVLPSGGGDAQNLQRILRMLTSYGVFREHINAD---ASERRYSLGEVGKTLVTDKD  402
            +I++ +  +    A  L RILR+L S+ V    +  D    +ER Y L  + K LV ++D
Sbjct  61   QIVAHIPTTNPDAAITLDRILRVLASHSVLSCSVTTDENGKAERLYGLTPLCKYLVMNQD  120

Query  403  GLSYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSY  540
            G+S    VL +    LM +W  + +AV++  S+PF KA+G  A+ Y
Sbjct  121  GVSLAPLVLMNQDKVLMDSWYYLKDAVLE-GSQPFTKAHGMNAFEY  165



>gb|KDO39478.1| hypothetical protein CISIN_1g036218mg, partial [Citrus sinensis]
Length=79

 Score = 84.0 bits (206),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 47/88 (53%), Positives = 55/88 (63%), Gaps = 19/88 (22%)
 Frame = +1

Query  100  KNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQN  279
            K  RL +MELANMISVPMSL A +RL+                  IL+ +LPSGGGDA+N
Sbjct  11   KKVRLAVMELANMISVPMSLTAAIRLH------------------ILTRILPSGGGDAEN  52

Query  280  LQRILRMLTSYGVFREHINADASERRYS  363
            LQRIL +LTSYGVF EH      ERR +
Sbjct  53   LQRILCLLTSYGVFSEH-REFGGERRMN  79



>gb|AAV36348.1| caffeate O-methyltransferase, partial [Pinus taeda]
 gb|AAV36366.1| caffeate O-methyltransferase, partial [Pinus taeda]
Length=185

 Score = 86.7 bits (213),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 50/143 (35%), Positives = 78/143 (55%), Gaps = 4/143 (3%)
 Frame = +1

Query  121  MELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQNLQRILRM  300
            MEL N   +PM++ A + L+V   I   G+   LS  +I++ +  +    A  L RILR+
Sbjct  16   MELGNFSCLPMAMKAAIELDVLQIIANAGNGVQLSPRQIVAHIPTTNPDAAITLDRILRV  75

Query  301  LTSYGVFREHINAD---ASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQDALMKAWPLV  471
            L S+ V    +  +    +ER Y L  + K LV ++DG+S    VL +    LM++W  V
Sbjct  76   LASHSVLSCSVTTNENGKAERLYGLTPLCKYLVKNQDGVSLAPLVLMNQDKVLMESWYYV  135

Query  472  HEAVVDSSSEPFVKANGEPAYSY  540
             +AV+D  S+PF KA+G  A+ Y
Sbjct  136  KDAVLD-GSQPFTKAHGMNAFEY  157



>ref|XP_002962074.1| hypothetical protein SELMODRAFT_76630 [Selaginella moellendorffii]
 gb|EFJ37334.1| hypothetical protein SELMODRAFT_76630 [Selaginella moellendorffii]
Length=385

 Score = 88.6 bits (218),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 55/147 (37%), Positives = 83/147 (56%), Gaps = 11/147 (7%)
 Frame = +1

Query  109  RLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVL----PSGGGDAQ  276
            R  IMEL  + +VPM+L A +RL+V   I   G +A LSA+EI++ +     P+ GG   
Sbjct  19   RQRIMELGLLCNVPMALTAAIRLDVFQIIASAGCDAMLSAAEIVARIPGCQSPALGGIVL  78

Query  277  NLQRILRMLTSYGVFREHINAD----ASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQD  444
            N  RILR+L S G+FRE +  D    A+ RRY L  + + L+ D  G S   ++  +H +
Sbjct  79   N--RILRVLASRGIFREDVERDDPAPAAIRRYGLTNLCRFLLKDDRGASLAPWISLNHDE  136

Query  445  ALMKAWPLVHEAVVD-SSSEPFVKANG  522
             LM+ W  + +AV+    + PF  A+G
Sbjct  137  ILMRPWQFLADAVLSGGQTSPFSLAHG  163



>ref|XP_002971011.1| hypothetical protein SELMODRAFT_94918 [Selaginella moellendorffii]
 gb|EFJ27609.1| hypothetical protein SELMODRAFT_94918 [Selaginella moellendorffii]
Length=385

 Score = 88.6 bits (218),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 55/147 (37%), Positives = 83/147 (56%), Gaps = 11/147 (7%)
 Frame = +1

Query  109  RLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVL----PSGGGDAQ  276
            R  IMEL  + +VPM+L A +RL+V   I   G +A LSA+EI++ +     P+ GG   
Sbjct  19   RQRIMELGLLCNVPMALTAAIRLDVFQIIASAGCDAMLSAAEIVARIPGCQSPALGGIVL  78

Query  277  NLQRILRMLTSYGVFREHINAD----ASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQD  444
            N  RILR+L S G+FRE +  D    A+ RRY L  + + L+ D  G S   ++  +H +
Sbjct  79   N--RILRVLASRGIFREDVERDDPAPAAIRRYGLTNLCRFLLKDDRGASLAPWISLNHDE  136

Query  445  ALMKAWPLVHEAVVD-SSSEPFVKANG  522
             LM+ W  + +AV+    + PF  A+G
Sbjct  137  ILMRPWQFLADAVLSGGQTSPFSLAHG  163



>gb|KHF97637.1| Caffeic acid 3-O-methyltransferase [Gossypium arboreum]
Length=308

 Score = 87.4 bits (215),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 61/182 (34%), Positives = 95/182 (52%), Gaps = 13/182 (7%)
 Frame = +1

Query  31   RIEKQITGKKEIEAMGSESESAQKN------ARLTIMELANMISVPMSLNAVVRLNVADA  192
            +I  Q  GK +    G+E E+  +        +L +  LAN + +PM L + + LN+ D 
Sbjct  2    QIRSQNFGKVKQPETGAEKETMSQEDQEEEVGKLAV-RLANAVVLPMVLKSALELNIIDT  60

Query  193  IWQGGSNAPLSASEILSSVLPSGGGDAQNL-QRILRMLTSYGVFREHINA---DASERRY  360
            I   G  A LS S+I +S LPS   DA  L  R+LR+L S+ + +  + A   +  ER Y
Sbjct  61   ILAAGDGAFLSPSQI-ASALPSKNPDAPVLLDRMLRLLASHSILKCSVKAKEKEEIERLY  119

Query  361  SLGEVGKTLVTDKDGLSYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSY  540
              G + K LV ++DG S    +L HH    M++W  +++A+++    PF KA G  A+ Y
Sbjct  120  GAGPLCKFLVKNQDGGSIAPLLLLHHDQVFMQSWYHLNDAILEGGV-PFSKAYGMTAFEY  178

Query  541  YG  546
             G
Sbjct  179  PG  180



>ref|XP_008788729.1| PREDICTED: tricetin 3',4',5'-O-trimethyltransferase [Phoenix 
dactylifera]
Length=367

 Score = 87.4 bits (215),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 55/167 (33%), Positives = 88/167 (53%), Gaps = 4/167 (2%)
 Frame = +1

Query  55   KKEIEAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASE  234
            K+ +  M  E ++A + A +  ++LA+   +PM+L   + L+V + I + GS A LS +E
Sbjct  6    KQGVPTMSLEKQAADEEACMYALQLASASILPMTLKNAIELDVLEIIAKAGSAAKLSPAE  65

Query  235  ILSSVLPSGGGDAQNLQRILRMLTSYGVFREHINADASE---RRYSLGEVGKTLVTDKDG  405
            + + +       A  L R+LR+L SY V    +  DA     RRY    V K L  ++DG
Sbjct  66   VAAQLPTKNPMAAAMLDRMLRLLASYNVLTCSVEVDADGKPLRRYGPAPVCKWLTKNEDG  125

Query  406  LSYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
            +S  A  L +    LM++W  + +AV+D    PF KA G  A+ Y+G
Sbjct  126  VSMAALTLMNQDKILMESWYYLKDAVLDGGI-PFNKAYGMTAFEYHG  171



>gb|AAV36304.1| caffeate O-methyltransferase, partial [Pinus taeda]
 gb|AAV36306.1| caffeate O-methyltransferase, partial [Pinus taeda]
 gb|AAV36314.1| caffeate O-methyltransferase, partial [Pinus taeda]
 gb|AAV36318.1| caffeate O-methyltransferase, partial [Pinus taeda]
 gb|AAV36320.1| caffeate O-methyltransferase, partial [Pinus taeda]
 gb|AAV36322.1| caffeate O-methyltransferase, partial [Pinus taeda]
 gb|AAV36326.1| caffeate O-methyltransferase, partial [Pinus taeda]
 gb|AAV36328.1| caffeate O-methyltransferase, partial [Pinus taeda]
 gb|AAV36332.1| caffeate O-methyltransferase, partial [Pinus taeda]
 gb|AAV36336.1| caffeate O-methyltransferase, partial [Pinus taeda]
 gb|AAV36340.1| caffeate O-methyltransferase, partial [Pinus taeda]
 gb|AAV36342.1| caffeate O-methyltransferase, partial [Pinus taeda]
 gb|AAV36344.1| caffeate O-methyltransferase, partial [Pinus taeda]
 gb|AAV36352.1| caffeate O-methyltransferase, partial [Pinus taeda]
 gb|AAV36356.1| caffeate O-methyltransferase, partial [Pinus taeda]
 gb|AAV36358.1| caffeate O-methyltransferase, partial [Pinus taeda]
 gb|AAV36360.1| caffeate O-methyltransferase, partial [Pinus taeda]
 gb|AAV36362.1| caffeate O-methyltransferase, partial [Pinus taeda]
Length=185

 Score = 85.5 bits (210),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 78/143 (55%), Gaps = 4/143 (3%)
 Frame = +1

Query  121  MELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQNLQRILRM  300
            MEL N   +PM++ A + L+V   I   G+   LS  +I++ +  +    A  L RILR+
Sbjct  16   MELGNFSCLPMAMKAAIELDVLQIIANAGNGVQLSPRQIVAHIPTTNPDAAITLDRILRV  75

Query  301  LTSYGVFREHINAD---ASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQDALMKAWPLV  471
            L S+ V    +  +    +ER Y L  + K LV ++DG+S    VL +    LM++W  +
Sbjct  76   LASHSVLSCSVTTNENGKAERLYGLTPLCKYLVKNQDGVSLAPLVLMNQDKVLMESWYYL  135

Query  472  HEAVVDSSSEPFVKANGEPAYSY  540
             +AV+D  S+PF KA+G  A+ Y
Sbjct  136  KDAVLD-GSQPFTKAHGMNAFEY  157



>gb|AHY28755.1| caffeate O-methyltransferase, partial [Pinus palustris]
Length=189

 Score = 85.5 bits (210),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 78/143 (55%), Gaps = 4/143 (3%)
 Frame = +1

Query  121  MELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQNLQRILRM  300
            MEL N   +PM++ A + L+V   I   G+   LS  +I++ +  +    A  L RILR+
Sbjct  19   MELGNFSCLPMAMKAAIELDVLQIIANAGNGVQLSPRQIVAHIPTTNPDAAITLDRILRV  78

Query  301  LTSYGVFREHINAD---ASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQDALMKAWPLV  471
            L S+ V    +  +    +ER Y L  + K LV ++DG+S    VL +    LM++W  +
Sbjct  79   LASHSVLSCSVTTNENGKAERLYGLTPLCKYLVKNQDGVSLAPLVLMNQDKVLMESWYYL  138

Query  472  HEAVVDSSSEPFVKANGEPAYSY  540
             +AV+D  S+PF KA+G  A+ Y
Sbjct  139  KDAVLD-GSQPFTKAHGMNAFEY  160



>ref|NP_200227.1| caffeic acid/5-hydroxyferulic acid O-methyltransferase [Arabidopsis 
thaliana]
 sp|Q9FK25.1|OMT1_ARATH RecName: Full=Flavone 3'-O-methyltransferase 1; Short=AtOMT1; 
AltName: Full=Caffeate O-methyltransferase 1; AltName: Full=Quercetin 
3'-O-methyltransferase 1 [Arabidopsis thaliana]
 dbj|BAB11578.1| O-methyltransferase [Arabidopsis thaliana]
 gb|AAL32915.1| O-methyltransferase [Arabidopsis thaliana]
 gb|AAM10127.1| O-methyltransferase [Arabidopsis thaliana]
 gb|AAM64849.1| O-methyltransferase [Arabidopsis thaliana]
 gb|AED96460.1| caffeic acid/5-hydroxyferulic acid O-methyltransferase [Arabidopsis 
thaliana]
Length=363

 Score = 87.0 bits (214),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 60/169 (36%), Positives = 93/169 (55%), Gaps = 15/169 (9%)
 Frame = +1

Query  73   MGSESES-------AQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSAS  231
            MGS +E+           A L  M+LA+   +PM+L + + L++ + + + GS  P+S +
Sbjct  1    MGSTAETQLTPVQVTDDEAALFAMQLASASVLPMALKSALELDLLEIMAKNGS--PMSPT  58

Query  232  EILSSVLPSGGGDAQ-NLQRILRMLTSYGVF---REHINADASERRYSLGEVGKTLVTDK  399
            EI +S LP+   +A   L RILR+LTSY V       ++ D  ER Y LG V K L  ++
Sbjct  59   EI-ASKLPTKNPEAPVMLDRILRLLTSYSVLTCSNRKLSGDGVERIYGLGPVCKYLTKNE  117

Query  400  DGLSYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
            DG+S  A  L +    LM++W  + +A++D    PF KA G  A+ Y+G
Sbjct  118  DGVSIAALCLMNQDKVLMESWYHLKDAILDGGI-PFNKAYGMSAFEYHG  165



>gb|AAB96879.1| O-methyltransferase 1 [Arabidopsis thaliana]
Length=363

 Score = 86.7 bits (213),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 60/169 (36%), Positives = 93/169 (55%), Gaps = 15/169 (9%)
 Frame = +1

Query  73   MGSESES-------AQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSAS  231
            MGS +E+           A L  M+LA+   +PM+L + + L++ + + + GS  P+S +
Sbjct  1    MGSTAETQLTPVQVTDDEAALFAMQLASASVLPMALKSALELDLLEIMAKNGS--PMSPT  58

Query  232  EILSSVLPSGGGDAQ-NLQRILRMLTSYGVF---REHINADASERRYSLGEVGKTLVTDK  399
            EI +S LP+   +A   L RILR+LTSY V       ++ D  ER Y LG V K L  ++
Sbjct  59   EI-ASKLPTKNPEAPVMLDRILRLLTSYSVLTCSNRKLSGDGVERIYGLGPVCKYLTKNE  117

Query  400  DGLSYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
            DG+S  A  L +    LM++W  + +A++D    PF KA G  A+ Y+G
Sbjct  118  DGVSIAALCLMNQDKVLMESWYHLKDAILDGGI-PFNKAYGMSAFEYHG  165



>ref|XP_006280681.1| hypothetical protein CARUB_v10026645mg [Capsella rubella]
 gb|EOA13579.1| hypothetical protein CARUB_v10026645mg [Capsella rubella]
Length=363

 Score = 86.7 bits (213),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 61/169 (36%), Positives = 93/169 (55%), Gaps = 15/169 (9%)
 Frame = +1

Query  73   MGSESES-------AQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSAS  231
            MGS +E+           A L  M+LA+   +PM+L A + L++ + + +  S  P+S +
Sbjct  1    MGSTAETQITPVQVTDDEAALFAMQLASASVLPMALKAALELDLLEIMAKNAS--PMSPT  58

Query  232  EILSSVLPSGGGDAQ-NLQRILRMLTSYGVF---REHINADASERRYSLGEVGKTLVTDK  399
            EI +S LP+   +A   L RILR+LTSY V       ++ D+ ER Y LG V K L  ++
Sbjct  59   EI-ASKLPTKNPEAPVMLDRILRLLTSYSVLTCSNRKLSGDSVERIYGLGPVCKYLTKNE  117

Query  400  DGLSYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
            DG+S  A  L +    LM++W  + +AV+D    PF KA G  A+ Y+G
Sbjct  118  DGVSIAALCLMNQDKVLMESWYHLKDAVLDGGI-PFNKAYGMSAFEYHG  165



>gb|AAV36354.1| caffeate O-methyltransferase, partial [Pinus taeda]
Length=185

 Score = 84.7 bits (208),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 77/143 (54%), Gaps = 4/143 (3%)
 Frame = +1

Query  121  MELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQNLQRILRM  300
            MEL N   +PM++ A + L+V   I   G+   LS  +I++ +  +    A  L RILR+
Sbjct  16   MELGNFSCLPMAMKAAIELDVLQIIANAGNGVQLSPRQIVAHIPTTNPDAAITLDRILRV  75

Query  301  LTSYGVFREHINAD---ASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQDALMKAWPLV  471
            L S+ V    +       +ER Y L  + K LV ++DG+S    VL +    LM++W  +
Sbjct  76   LASHSVLSCSVTTSENGKAERLYGLTPLCKYLVKNQDGVSLAPLVLMNQDKVLMESWYYL  135

Query  472  HEAVVDSSSEPFVKANGEPAYSY  540
             +AV+D  S+PF KA+G  A+ Y
Sbjct  136  KDAVLD-GSQPFTKAHGMNAFEY  157



>gb|AAV36346.1| caffeate O-methyltransferase, partial [Pinus taeda]
Length=185

 Score = 84.7 bits (208),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 77/143 (54%), Gaps = 4/143 (3%)
 Frame = +1

Query  121  MELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQNLQRILRM  300
            MEL N   +PM++ A + L+V   I   G+   LS  +I++ +  +    A  L RILR+
Sbjct  16   MELGNFSCLPMAMKAAIELDVLQIIANAGNGVQLSPRQIVAHIPTTNPDAAITLDRILRV  75

Query  301  LTSYGVFREHINAD---ASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQDALMKAWPLV  471
            L S+ V    +       +ER Y L  + K LV ++DG+S    VL +    LM++W  +
Sbjct  76   LASHSVLSCSVTTSENGKAERFYGLTPLCKYLVKNQDGVSLAPLVLMNQDKVLMESWYYL  135

Query  472  HEAVVDSSSEPFVKANGEPAYSY  540
             +AV+D  S+PF KA+G  A+ Y
Sbjct  136  KDAVLD-GSQPFTKAHGMNAFEY  157



>gb|KHF97352.1| Caffeic acid 3-O-methyltransferase [Gossypium arboreum]
 gb|KHG01818.1| Caffeic acid 3-O-methyltransferase [Gossypium arboreum]
 gb|KHG22578.1| Caffeic acid 3-O-methyltransferase [Gossypium arboreum]
Length=286

 Score = 85.5 bits (210),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 55/160 (34%), Positives = 88/160 (55%), Gaps = 7/160 (4%)
 Frame = +1

Query  79   SESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPS  258
            S+ +  ++  +L +  LAN + +PM L + + LN+ D I   G  A LS S+I +S LPS
Sbjct  2    SQEDQEEEVGKLAV-RLANAVVLPMVLKSALELNIIDTILAAGDGAFLSPSQI-ASALPS  59

Query  259  GGGDAQNL-QRILRMLTSYGVFREHINA---DASERRYSLGEVGKTLVTDKDGLSYGAYV  426
               DA  L  R+LR+L S+ + +  + A   +  ER Y  G + K LV ++DG S    +
Sbjct  60   KNPDAPVLLDRMLRLLASHSILKCSVKAKEKEEIERLYGAGPLCKFLVKNQDGGSIAPLL  119

Query  427  LQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
            L HH    M++W  +++A+++    PF KA G  A+ Y G
Sbjct  120  LLHHDQVFMQSWYHLNDAILEGGV-PFSKAYGMTAFEYPG  158



>gb|AER35881.1| S-adenosyl-L-methionine:flavonoid O-methyltransferase [Ginkgo 
biloba]
Length=362

 Score = 86.3 bits (212),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 51/143 (36%), Positives = 76/143 (53%), Gaps = 4/143 (3%)
 Frame = +1

Query  121  MELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQNLQRILRM  300
            MEL N   +PM++ A V L+V   I   G  A +S  EI++ +  +    A  L RILR+
Sbjct  20   MELGNFSCLPMAMKAAVELDVLQIIANAGHGAQISPREIVTHIPTTNPDAAITLDRILRV  79

Query  301  LTSYGVFREHINAD---ASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQDALMKAWPLV  471
            L S+ V    +  D    + R Y L  + K LV +KDG+S    VL +     M++W  +
Sbjct  80   LASHSVLSSSVTTDENGKTGRVYGLTPLCKYLVQNKDGVSLAPLVLMNQDKVFMESWYYL  139

Query  472  HEAVVDSSSEPFVKANGEPAYSY  540
             +AV+D  S+PF KA+G  A+ Y
Sbjct  140  KDAVLD-GSQPFTKAHGVNAFEY  161



>ref|XP_002864309.1| O-methyltransferase 1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH40568.1| O-methyltransferase 1 [Arabidopsis lyrata subsp. lyrata]
Length=363

 Score = 86.3 bits (212),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 60/169 (36%), Positives = 93/169 (55%), Gaps = 15/169 (9%)
 Frame = +1

Query  73   MGSESES-------AQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSAS  231
            MGS +E+           A L  M+LA+   +PM+L + + L++ + + + GS  P+S +
Sbjct  1    MGSTAETQLTPVQVTDDEAALFAMQLASASVLPMALKSALELDLLEIMAKNGS--PMSPT  58

Query  232  EILSSVLPSGGGDAQ-NLQRILRMLTSYGVF---REHINADASERRYSLGEVGKTLVTDK  399
            EI +S LP+   +A   L RILR+LTSY V       ++ D  ER Y LG V K L  ++
Sbjct  59   EI-ASHLPTKNPEAPVMLDRILRLLTSYSVLTCSNRKLSGDGVERIYGLGPVCKYLTKNE  117

Query  400  DGLSYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
            DG+S  A  L +    LM++W  + +A++D    PF KA G  A+ Y+G
Sbjct  118  DGVSIAALCLMNQDKVLMESWYHLKDAILDGGI-PFNKAYGMSAFEYHG  165



>gb|AFM73596.1| caffeate O-methyltransferase, partial [Populus simonii]
Length=300

 Score = 85.5 bits (210),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 55/140 (39%), Positives = 78/140 (56%), Gaps = 8/140 (6%)
 Frame = +1

Query  142  SVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQ-NLQRILRMLTSYGV  318
            +VPM+L A + L+V + I +GG  A LSA EI +  LP+   DA   L R+LR+L SY V
Sbjct  5    AVPMALKAAIELDVLEIIAKGGPGAHLSALEI-ARCLPTQNADAPIMLDRMLRLLASYNV  63

Query  319  FREHI-----NADASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQDALMKAWPLVHEAV  483
                I        + ERRY L  V K L+ ++DG+S    VL +     M++W  + EAV
Sbjct  64   LTCSIVSLDGGCGSIERRYGLAPVCKFLIRNQDGVSIAPLVLMNQDKVTMESWYHLKEAV  123

Query  484  VDSSSEPFVKANGEPAYSYY  543
            +D    PF KA+G  A+ Y+
Sbjct  124  LDGGI-PFNKAHGMSAFEYH  142



>gb|EPS67212.1| hypothetical protein M569_07558 [Genlisea aurea]
Length=364

 Score = 86.3 bits (212),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 56/160 (35%), Positives = 89/160 (56%), Gaps = 6/160 (4%)
 Frame = +1

Query  79   SESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPS  258
            S ++S ++ A L  M+LA+   +PM L + + LN+ + I   G+ + +S +E L++ LP+
Sbjct  11   SPTDSDEEGAFLFAMQLASASVLPMVLKSAIELNLLELIKTSGAGSFVSPAE-LAAQLPA  69

Query  259  GGGDAQN-LQRILRMLTSYGVFREHINADAS---ERRYSLGEVGKTLVTDKDGLSYGAYV  426
               DA   + RILR+L  Y V    +   A    ERRY LG V K L  ++DG+S    V
Sbjct  70   SNADAPVVIDRILRLLACYDVLSCRVETLADGGIERRYGLGPVCKFLTKNEDGVSMAPLV  129

Query  427  LQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
            L +    LM++W  + +AV++    PF +A G  A+ YYG
Sbjct  130  LMNQDKVLMESWYHLKDAVLEGGI-PFNRAYGMSAFEYYG  168



>gb|ABO41840.1| putative caffeic acid methyltransferase [Gossypium arboreum]
Length=358

 Score = 85.9 bits (211),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 55/160 (34%), Positives = 88/160 (55%), Gaps = 7/160 (4%)
 Frame = +1

Query  79   SESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPS  258
            S+ +  ++  +L +  LAN + +PM L + + LN+ D I   G  A LS S+I +S LPS
Sbjct  2    SQEDQEEEVGKLAV-RLANAVVLPMVLKSALELNIIDTILAAGDGAFLSPSQI-ASALPS  59

Query  259  GGGDAQNL-QRILRMLTSYGVFREHINA---DASERRYSLGEVGKTLVTDKDGLSYGAYV  426
               DA  L  R+LR+L S+ + +  + A   +  ER Y  G + K LV ++DG S    +
Sbjct  60   KNPDAPVLLDRMLRLLASHSILKCSVKAKEKEEIERLYGAGPLCKFLVKNQDGGSIAPLL  119

Query  427  LQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
            L HH    M++W  +++A+++    PF KA G  A+ Y G
Sbjct  120  LLHHDQVFMQSWYHLNDAILEGGV-PFSKAYGMTAFEYPG  158



>ref|XP_010241050.1| PREDICTED: caffeic acid 3-O-methyltransferase 1 [Nelumbo nucifera]
Length=364

 Score = 85.9 bits (211),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 63/169 (37%), Positives = 91/169 (54%), Gaps = 12/169 (7%)
 Frame = +1

Query  55   KKEIEAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASE  234
            K +I+    E E A   A    M+LA+   VPM L A + L+V + I + G+ A +S SE
Sbjct  5    KTQIKIADQEEEEACNYA----MQLASASVVPMVLKAAIELDVLEIIAEAGAGAHISTSE  60

Query  235  ILSSVLPSGGGDAQ-NLQRILRMLTSYGV----FREHINADASERRYSLGEVGKTLVTDK  399
            I +S LP+   DA   L R+LR+L S+ +     R H +    ER Y L  V K LV ++
Sbjct  61   I-ASHLPTQNPDAPVMLDRMLRLLASFSILTCSLRTHDDGRV-ERLYGLAPVCKFLVKNE  118

Query  400  DGLSYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
            DG+S    VL +    LM++W  + +AV+D    PF KA G  A+ Y+G
Sbjct  119  DGVSMAPLVLMNQDKVLMESWYHLKDAVLDGGI-PFNKAYGMTAFEYHG  166



>gb|ABO41845.1| putative caffeic acid methyltransferase [Gossypium hirsutum]
Length=358

 Score = 85.5 bits (210),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 55/160 (34%), Positives = 88/160 (55%), Gaps = 7/160 (4%)
 Frame = +1

Query  79   SESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPS  258
            S+ +  ++  +L +  LAN + +PM L + + LN+ D I   G  A LS S+I +S LPS
Sbjct  2    SQEDQEEEVGKLAV-RLANAVVLPMVLKSALELNIIDTILAAGDGAFLSPSQI-ASALPS  59

Query  259  GGGDAQNL-QRILRMLTSYGVFREHINA---DASERRYSLGEVGKTLVTDKDGLSYGAYV  426
               DA  L  R+LR+L S+ + +  + A   +  ER Y  G + K LV ++DG S    +
Sbjct  60   KNPDAPVLLDRMLRLLASHSILKCAVKAKEKEEIERLYGAGPLCKFLVKNQDGGSIAPLL  119

Query  427  LQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
            L HH    M++W  +++A+++    PF KA G  A+ Y G
Sbjct  120  LLHHDQVFMQSWYHLNDAILEGGV-PFSKAYGMTAFEYPG  158



>gb|KJB16304.1| hypothetical protein B456_002G222400 [Gossypium raimondii]
Length=404

 Score = 85.9 bits (211),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 60/173 (35%), Positives = 92/173 (53%), Gaps = 8/173 (5%)
 Frame = +1

Query  40   KQITGKKEIEAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAP  219
            KQ     E E M S+ +  ++  +L +  LAN + +PM L + + LN+ D I   G  A 
Sbjct  36   KQPETGAEKETM-SQEDQEEEVGKLAV-RLANAVVLPMVLKSALELNIIDTISAAGDGAF  93

Query  220  LSASEILSSVLPSGGGDAQNL-QRILRMLTSYGVFREHINADAS---ERRYSLGEVGKTL  387
            LS S+I +S LPS   DA  L  R+LR+L S+ + +  + A      ER Y  G + K L
Sbjct  94   LSPSQI-ASALPSKNPDAPVLLDRMLRLLASHSILKCSVKAKEKGEIERLYGAGPLCKFL  152

Query  388  VTDKDGLSYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
            V ++DG S    +L HH    M++W  +++A+++    PF KA G  A+ Y G
Sbjct  153  VKNQDGGSIAPLLLLHHDQVFMQSWYHLNDAILEGGV-PFSKAYGMTAFEYPG  204



>gb|AAV36308.1| caffeate O-methyltransferase, partial [Pinus taeda]
 gb|AAV36310.1| caffeate O-methyltransferase, partial [Pinus taeda]
 gb|AAV36312.1| caffeate O-methyltransferase, partial [Pinus taeda]
 gb|AAV36316.1| caffeate O-methyltransferase, partial [Pinus taeda]
 gb|AAV36324.1| caffeate O-methyltransferase, partial [Pinus taeda]
 gb|AAV36330.1| caffeate O-methyltransferase, partial [Pinus taeda]
 gb|AAV36334.1| caffeate O-methyltransferase, partial [Pinus taeda]
 gb|AAV36338.1| caffeate O-methyltransferase, partial [Pinus taeda]
 gb|AAV36350.1| caffeate O-methyltransferase, partial [Pinus taeda]
 gb|AAV36364.1| caffeate O-methyltransferase, partial [Pinus taeda]
Length=185

 Score = 83.6 bits (205),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 77/143 (54%), Gaps = 4/143 (3%)
 Frame = +1

Query  121  MELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQNLQRILRM  300
            MEL N   +PM++ A + L+V   I   G+   LS  +I++ +  +    A  L RILR+
Sbjct  16   MELGNFSCLPMAMKAAIELDVLQIIANAGNGVQLSPRQIVAHIPTTNPDAAITLDRILRV  75

Query  301  LTSYGVFREHINAD---ASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQDALMKAWPLV  471
            L S+ V    +       +ER Y L  + K LV ++DG+S    VL +    LM++W  +
Sbjct  76   LASHSVLSCSVTTSENGKAERLYGLTPLCKYLVKNQDGVSLAPLVLMNQDKVLMESWYYL  135

Query  472  HEAVVDSSSEPFVKANGEPAYSY  540
             +AV+D  S+PF KA+G  A+ Y
Sbjct  136  KDAVLD-GSQPFSKAHGMNAFEY  157



>gb|ABO41834.1| putative caffeic acid methyltransferase [Gossypium raimondii]
Length=358

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 55/160 (34%), Positives = 87/160 (54%), Gaps = 7/160 (4%)
 Frame = +1

Query  79   SESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPS  258
            S+ +  ++  +L +  LAN + +PM L + + LN+ D I   G  A LS S+I +S LPS
Sbjct  2    SQEDQEEEVGKLAV-RLANAVVLPMVLKSALELNIIDTISAAGDGAFLSPSQI-ASALPS  59

Query  259  GGGDAQNL-QRILRMLTSYGVFREHINADAS---ERRYSLGEVGKTLVTDKDGLSYGAYV  426
               DA  L  R+LR+L S+ + +  + A      ER Y  G + K LV ++DG S    +
Sbjct  60   KNPDAPVLLDRMLRLLASHSILKCSVKAKEKGEIERLYGAGPLCKFLVKNQDGGSIAPLL  119

Query  427  LQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
            L HH    M++W  +++A+++    PF KA G  A+ Y G
Sbjct  120  LLHHDQVFMQSWYHLNDAILEGGV-PFSKAYGMTAFEYPG  158



>gb|ABO41846.1| putative caffeic acid methyltransferase [Gossypium hirsutum]
Length=345

 Score = 84.7 bits (208),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 54/160 (34%), Positives = 88/160 (55%), Gaps = 7/160 (4%)
 Frame = +1

Query  79   SESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPS  258
            S+ +  ++  +L +  LAN + +PM L + + LN+ D I   G  A LS S+I +S LPS
Sbjct  2    SQEDQEEEVGKLAV-RLANAVILPMVLKSALELNIIDTILAAGDGAFLSPSQI-ASALPS  59

Query  259  GGGDAQNL-QRILRMLTSYGVFREHINA---DASERRYSLGEVGKTLVTDKDGLSYGAYV  426
               DA  L  R+LR+L S+ + +  + A   +  ER Y  G + K LV ++DG S    +
Sbjct  60   KNPDAPVLLDRMLRLLASHSILKCSVKAKEKEEIERLYGAGPLCKFLVKNQDGGSIAPLL  119

Query  427  LQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
            + HH    M++W  +++A+++    PF KA G  A+ Y G
Sbjct  120  VLHHDQVFMQSWYHLNDAILEGGF-PFSKAYGMTAFEYPG  158



>gb|AHY28752.1| caffeate O-methyltransferase, partial [Pinus echinata]
Length=359

 Score = 84.7 bits (208),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 78/143 (55%), Gaps = 4/143 (3%)
 Frame = +1

Query  121  MELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQNLQRILRM  300
            MEL N   +PM++ A + L+V   I   G+   LS  +I++ +  +    A  L RILR+
Sbjct  19   MELGNFSCLPMAMKAAIELDVLQIIANAGNGVQLSPRQIVAHIPTTNPDAAITLDRILRV  78

Query  301  LTSYGVFREHINADA---SERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQDALMKAWPLV  471
            L S+ V    +  +    +ER Y L  + K LV ++DG+S    VL +    LM++W  +
Sbjct  79   LASHSVLSCSVTTNENGNAERLYGLTPLCKYLVKNQDGVSLAPLVLMNQDKVLMESWYYL  138

Query  472  HEAVVDSSSEPFVKANGEPAYSY  540
             +AV+D  S+PF KA+G  A+ Y
Sbjct  139  KDAVLD-GSQPFTKAHGMNAFEY  160



>gb|AHY28754.1| caffeate O-methyltransferase, partial [Pinus elliottii]
Length=359

 Score = 84.3 bits (207),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 48/143 (34%), Positives = 78/143 (55%), Gaps = 4/143 (3%)
 Frame = +1

Query  121  MELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQNLQRILRM  300
            MEL N   +PM++ A + L+V   I   G+   LS  +I++ +  +    A  L RILR+
Sbjct  19   MELGNFSCLPMAMKAAIELDVLQIIANAGNGVQLSPRQIVAHIPTTNPDAAITLDRILRV  78

Query  301  LTSYGVFREHINAD---ASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQDALMKAWPLV  471
            L S+ V    +  +    +ER Y L  + K L+ ++DG+S    VL +    LM++W  +
Sbjct  79   LASHSVLSCSVTTNENGKAERLYGLTPLCKYLIKNQDGVSLAPLVLMNQDKVLMESWYYL  138

Query  472  HEAVVDSSSEPFVKANGEPAYSY  540
             +AV+D  S+PF KA+G  A+ Y
Sbjct  139  KDAVLD-GSQPFTKAHGMNAFEY  160



>ref|XP_006401613.1| hypothetical protein EUTSA_v10013897mg [Eutrema salsugineum]
 gb|ESQ43066.1| hypothetical protein EUTSA_v10013897mg [Eutrema salsugineum]
Length=364

 Score = 84.3 bits (207),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 60/170 (35%), Positives = 92/170 (54%), Gaps = 16/170 (9%)
 Frame = +1

Query  73   MGSESES-------AQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSAS  231
            MGS +E+           A L  M+LA+   +PM+L + + L++ + + +  +  P+S S
Sbjct  1    MGSTAETQITPVQVTDDEAALFAMQLASASVLPMALKSALELDLLEIMAK--NTKPMSPS  58

Query  232  EILSSVLPSGGGDAQ-NLQRILRMLTSYGVF----REHINADASERRYSLGEVGKTLVTD  396
            EI +S LP+   +A   L RILR+LT+Y V     R   N D  ER Y LG V K L  +
Sbjct  59   EI-ASHLPTKNPEAPVMLDRILRLLTAYSVLTCSNRTLPNGDGVERLYGLGPVCKYLTKN  117

Query  397  KDGLSYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
            +DG+S  A  L +    LM++W  + +A++D    PF KA G  A+ Y+G
Sbjct  118  EDGVSIAALCLMNQDKVLMESWYHLKDAILDGGI-PFNKAYGMSAFEYHG  166



>dbj|BAJ34520.1| unnamed protein product [Thellungiella halophila]
Length=364

 Score = 84.3 bits (207),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 60/170 (35%), Positives = 92/170 (54%), Gaps = 16/170 (9%)
 Frame = +1

Query  73   MGSESES-------AQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSAS  231
            MGS +E+           A L  M+LA+   +PM+L + + L++ + + +  +  P+S S
Sbjct  1    MGSTAETQITPVQVTDDEAALFAMQLASASVLPMALKSALELDLLEIMAK--NTKPMSPS  58

Query  232  EILSSVLPSGGGDAQ-NLQRILRMLTSYGVF----REHINADASERRYSLGEVGKTLVTD  396
            EI +S LP+   +A   L RILR+LT+Y V     R   N D  ER Y LG V K L  +
Sbjct  59   EI-ASHLPTKNPEAPVMLDRILRLLTAYSVLTCSNRTLPNGDGVERLYGLGPVCKYLTKN  117

Query  397  KDGLSYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
            +DG+S  A  L +    LM++W  + +A++D    PF KA G  A+ Y+G
Sbjct  118  EDGVSIAALCLMNQDKVLMESWYHLKDAILDGGI-PFNKAYGMSAFEYHG  166



>gb|ACD56610.1| putative caffeic acid protein [Gossypioides kirkii]
Length=358

 Score = 84.0 bits (206),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 54/160 (34%), Positives = 86/160 (54%), Gaps = 7/160 (4%)
 Frame = +1

Query  79   SESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPS  258
            S+ +  ++  +L +  LAN + +PM L + + LN+ D I   G    LS S+I +S LPS
Sbjct  2    SQEDQDEEVGKLAV-RLANAVVLPMVLKSALELNIIDTISAAGDGTFLSPSQI-ASCLPS  59

Query  259  GGGDAQNL-QRILRMLTSYGVFREHINADAS---ERRYSLGEVGKTLVTDKDGLSYGAYV  426
               DA  L  R+LR+L S+ + +  + A      ER Y  G + K LV ++DG S    +
Sbjct  60   KNPDAPVLLDRMLRLLASHSILKCSVKAKEKGEIERLYGAGPLCKFLVKNQDGGSIAPLL  119

Query  427  LQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
            L HH    M++W  +++A+++    PF KA G  A+ Y G
Sbjct  120  LLHHDQVFMQSWYHLNDAILEGGV-PFSKAYGMTAFEYPG  158



>ref|XP_002864307.1| O-methyltransferase 1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH40566.1| O-methyltransferase 1 [Arabidopsis lyrata subsp. lyrata]
Length=362

 Score = 83.2 bits (204),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 56/168 (33%), Positives = 87/168 (52%), Gaps = 13/168 (8%)
 Frame = +1

Query  73   MGSESES-------AQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSAS  231
            MGS +E+           A L  M+LA+   +PM+L + + L++ + + + GS  P+S +
Sbjct  1    MGSTAETQLTPVQVTDDEAALFAMQLASASVLPMALKSALELDLLEIMAKNGS--PMSPT  58

Query  232  EILSSVLPSGGGDAQNLQRILRMLTSYGVF---REHINADASERRYSLGEVGKTLVTDKD  402
            EI S +     G    L RILR+LTS+ V       ++ D  ER Y LG V K L  ++D
Sbjct  59   EIASHLPTKNPGAPVMLDRILRLLTSHSVLTCSNRKLSGDGVERIYGLGPVCKYLTKNED  118

Query  403  GLSYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
            G+S     L      LM++W  + +A++D    PF KA G  A+ Y+G
Sbjct  119  GVSIAGLCLTSQDKVLMESWYHLKDAILDGGI-PFNKAYGMSAFEYHG  165



>gb|ABO41852.1| putative caffeic acid methyltransferase [Gossypium hirsutum]
Length=358

 Score = 83.2 bits (204),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 51/159 (32%), Positives = 84/159 (53%), Gaps = 5/159 (3%)
 Frame = +1

Query  79   SESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPS  258
            S+ +  ++  +L +  LAN + +PM L + + LN+ D I   G  A LS S+I S++   
Sbjct  2    SQEDQEEEVGKLAV-RLANAVVLPMVLKSALELNIIDTISAAGDGAFLSPSQIASALPSK  60

Query  259  GGGDAQNLQRILRMLTSYGVFREHINADAS---ERRYSLGEVGKTLVTDKDGLSYGAYVL  429
              G    L R+LR+L S+ + +  + A      ER Y  G + K LV ++DG S    +L
Sbjct  61   NPGAPVLLDRMLRLLASHSILKCSVKAKEKGEIERLYGAGPLCKFLVKNQDGGSIAPLLL  120

Query  430  QHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
             HH    M++W  +++A+++    PF KA G  A+ Y G
Sbjct  121  LHHDQVFMQSWYHLNDAILEGGV-PFSKAYGMTAFEYPG  158



>ref|XP_007136428.1| hypothetical protein PHAVU_009G044400g [Phaseolus vulgaris]
 gb|ESW08422.1| hypothetical protein PHAVU_009G044400g [Phaseolus vulgaris]
Length=365

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 61/170 (36%), Positives = 92/170 (54%), Gaps = 10/170 (6%)
 Frame = +1

Query  49   TGKKEIEAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSA  228
            TG+ +I    + S  + + A L  M+LA+   +PM L + + L++ + I +GG    LS 
Sbjct  4    TGETQI----TPSHVSDEEANLFAMQLASASVLPMVLKSAIELDLLEIIAKGGPGVHLSP  59

Query  229  SEILSSVLPSGGGDAQ-NLQRILRMLTSYGV--FREHINADAS-ERRYSLGEVGKTLVTD  396
            S+I +S LP+   +A   L RILR+L SY +  F      D   ER Y L  V K LV +
Sbjct  60   SQI-ASQLPTRNPEAPVMLDRILRLLASYNILSFTLRTLPDGKVERLYGLAPVAKYLVKN  118

Query  397  KDGLSYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
            +DG+S  A  L +    LM++W  + +AV+D    PF KA G  A+ Y+G
Sbjct  119  EDGVSIAALNLMNQDKVLMESWYYLKDAVLDGGI-PFNKAYGMTAFEYHG  167



>gb|AHY28757.1| caffeate O-methyltransferase, partial [Pinus taeda]
Length=359

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 77/143 (54%), Gaps = 4/143 (3%)
 Frame = +1

Query  121  MELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQNLQRILRM  300
            MEL N   +PM++ A + L+V   I   G+   LS  +I++ +  +    A  L RILR+
Sbjct  19   MELGNFSCLPMAMKAAIELDVLQIIANAGNGVQLSPRQIVAHIPTTNPDAAITLDRILRV  78

Query  301  LTSYGVFREHINAD---ASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQDALMKAWPLV  471
            L S+ V    +       +ER Y L  + K LV ++DG+S    VL +    LM++W  +
Sbjct  79   LASHSVLSCSVTTSENGKAERLYGLTPLCKYLVKNQDGVSLAPLVLMNQDKVLMESWYYL  138

Query  472  HEAVVDSSSEPFVKANGEPAYSY  540
             +AV+D  S+PF KA+G  A+ Y
Sbjct  139  KDAVLD-GSQPFSKAHGMNAFEY  160



>gb|ABK21417.1| unknown [Picea sitchensis]
Length=365

 Score = 82.8 bits (203),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 76/143 (53%), Gaps = 4/143 (3%)
 Frame = +1

Query  121  MELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQNLQRILRM  300
            MEL N   +PM++ A V L+V   I   G+   LS  +I++ +  +    A  L RILR+
Sbjct  25   MELGNFSCLPMAMKAAVELDVLQIIANAGNGVQLSPRQIVAHIPTTNPDAAITLDRILRV  84

Query  301  LTSYGVFREHINAD---ASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQDALMKAWPLV  471
            L S+ V    +  D    +ER Y L  + K LV ++DG+S    VL +     M+ W  +
Sbjct  85   LASHSVLSCSVTTDENGKAERLYGLTPLCKYLVKNQDGVSLAPLVLINQDKVFMETWYYL  144

Query  472  HEAVVDSSSEPFVKANGEPAYSY  540
             +AV++  S+PF KA+G  A+ Y
Sbjct  145  KDAVLE-GSQPFTKAHGMNAFEY  166



>dbj|BAK42963.1| caffeic acid O-methylltransferase [Chrysanthemum x morifolium]
Length=355

 Score = 82.8 bits (203),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 57/161 (35%), Positives = 89/161 (55%), Gaps = 5/161 (3%)
 Frame = +1

Query  73   MGSESESAQKN--ARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSS  246
            MGS +  A+K+  A L  M+LA+   +PM L + + L++ + I + G  A +S +E+ + 
Sbjct  1    MGSSALDAKKDEEAFLFAMQLASASVLPMVLKSAIELDLLEIIAKAGPGAYVSPTELAAQ  60

Query  247  VLPSGGGDAQ-NLQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGAY  423
            +      +A   L RI R+L SY V    +N D SER Y L  V K LV ++DG+S    
Sbjct  61   LPKVENPEAPVMLDRICRLLASYSVLTCKLN-DQSERLYGLAPVCKYLVKNEDGVSNAPL  119

Query  424  VLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
            +L +    LM++W  + +AV+D    PF KA G  A+ Y+G
Sbjct  120  LLMNQDKILMESWYHLKDAVLDGGI-PFNKAYGMTAFEYHG  159



>gb|AAD29845.1|AF064697_1 O-methyltransferase [Thalictrum tuberosum]
Length=362

 Score = 82.8 bits (203),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 55/153 (36%), Positives = 81/153 (53%), Gaps = 4/153 (3%)
 Frame = +1

Query  97   QKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQ  276
            ++ A L  M+LA+   +PM L A + L+V + I + G  A ++ SEI S +  S      
Sbjct  15   EEEACLHAMQLASASVLPMVLKAAIELDVLEIIAKAGQGAYVAPSEIASQLSTSNSQAPI  74

Query  277  NLQRILRMLTSYGVFREHINA---DASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQDA  447
             L RILR+L SY V   ++        ER Y L  V K LV ++DG+S    VL +    
Sbjct  75   ILDRILRLLASYKVLTCNLRTLEDGGVERLYGLAPVCKFLVKNEDGVSMAPLVLMNQDKV  134

Query  448  LMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
            LM++W  + +AV+D    PF KA G  A+ Y+G
Sbjct  135  LMESWYHLKDAVLDGGI-PFNKAYGMTAFEYHG  166



>gb|ABK23795.1| unknown [Picea sitchensis]
Length=365

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 45/146 (31%), Positives = 80/146 (55%), Gaps = 4/146 (3%)
 Frame = +1

Query  112  LTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQNLQRI  291
            L  MEL N   +PM++ A + L+V   I   G+   L++++I++ +  +    A +L RI
Sbjct  22   LLCMELGNFSCLPMAMKAAIELDVFQIIANAGNGVQLASTQIVARIQTTNPDAAISLNRI  81

Query  292  LRMLTSYGVFREHINAD---ASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQDALMKAW  462
            L++L S+ V    +  D    +E  Y L  + K LV ++DG+S   +VL +     M++W
Sbjct  82   LKVLASHSVLSCSVTMDENGKAECLYGLTSLCKYLVKNRDGISLAPWVLMNQDKVFMESW  141

Query  463  PLVHEAVVDSSSEPFVKANGEPAYSY  540
              + +AV++  S+PF KA+G   + Y
Sbjct  142  HYLKDAVLE-GSQPFTKAHGMNVFEY  166



>prf||1906376A O-methyltransferase
Length=364

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 55/165 (33%), Positives = 88/165 (53%), Gaps = 8/165 (5%)
 Frame = +1

Query  67   EAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSS  246
            E   + ++ + + A L  M+LA+   +PM L   + L++ + + + G  A LS SEI +S
Sbjct  6    ETQMTPTQVSDEEAHLFAMQLASASVLPMILKTAIELDLLEIMAKAGPGAFLSTSEI-AS  64

Query  247  VLPSGGGDAQ-NLQRILRMLTSYGV----FREHINADASERRYSLGEVGKTLVTDKDGLS  411
             LP+   DA   L RILR+L SY +     ++H +    ER Y L  V K L  ++DG+S
Sbjct  65   HLPTKNPDAPVMLDRILRLLASYSILICSLKDHPDGKV-ERLYGLAPVCKFLTKNEDGVS  123

Query  412  YGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
                 L +    LM++W  + +A++D    PF KA G  A+ Y+G
Sbjct  124  VSPLCLMNQDKVLMESWYYLKDAILDGGI-PFNKAYGMTAFEYHG  167



>ref|XP_009119948.1| PREDICTED: flavone 3'-O-methyltransferase 1-like [Brassica rapa]
 emb|CDY14330.1| BnaA10g07250D [Brassica napus]
Length=362

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 57/168 (34%), Positives = 91/168 (54%), Gaps = 14/168 (8%)
 Frame = +1

Query  73   MGSESESAQKNARLT-------IMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSAS  231
            MGS +E+     ++T        ++LA+   +PM+L + + L++ + + +  S  P+SAS
Sbjct  1    MGSTAETHSTPVQVTDDETALFAIQLASASVLPMALKSAIELDLLEIMARNCS--PMSAS  58

Query  232  EILSSVLPSGGGDAQ-NLQRILRMLTSYGVFREHINA--DASERRYSLGEVGKTLVTDKD  402
            EI SS LP+   +A   L RILR+LT+Y V    +    D  +R Y LG V K  + ++D
Sbjct  59   EI-SSHLPTKNPEAPVMLDRILRLLTAYSVLTCSVRTLPDGVDRLYGLGPVCKYFIKNED  117

Query  403  GLSYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
            G+S     L +H    M +W  + +AV+D    PF KA G  A+ Y+G
Sbjct  118  GVSIAPLCLLNHDKVFMGSWYYLKDAVLDGGI-PFNKAYGMSAFEYHG  164



>gb|AIJ28474.1| O-methyltransferase [Vaccinium corymbosum]
Length=370

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 59/174 (34%), Positives = 92/174 (53%), Gaps = 18/174 (10%)
 Frame = +1

Query  73   MGSESESA------------QKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNA  216
            MGSESE+             ++ A L  M+LA+   +PM L + + L++ + + + G  A
Sbjct  1    MGSESENQTSSTSTPVGSEEEEEACLFAMQLASASVLPMVLKSAIELDLLETMAKAGPGA  60

Query  217  PLSASEILSSVLPSGGGDAQ-NLQRILRMLTSYGVFREHINA---DASERRYSLGEVGKT  384
             +S +E L++ LP+   DA   L RILR+LTSY V    + +      ER Y+L  V K 
Sbjct  61   FVSPTE-LAAQLPTQNPDAAVMLDRILRLLTSYSVLNCSVKSLPGGGVERLYALAPVCKY  119

Query  385  LVTDKDGLSYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
            L  + DG+S    +L +    LM++W  + +AV+D    PF KA G  A+ Y+G
Sbjct  120  LTRNSDGVSMAPLLLMNQDKVLMESWYYLKDAVLDGGI-PFNKAYGMTAFEYHG  172



>gb|ABU53653.1| caffeic acid O-3-methyltransferase [Populus deltoides]
Length=364

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 55/165 (33%), Positives = 88/165 (53%), Gaps = 8/165 (5%)
 Frame = +1

Query  67   EAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSS  246
            E   + ++ + + A L  M+LA+   +PM L   + L++ + + + G  A LS SEI +S
Sbjct  6    ETQMTPTQVSDEEAHLFAMQLASASVLPMILKTAIELDLLEIMAKAGPGAFLSTSEI-AS  64

Query  247  VLPSGGGDAQ-NLQRILRMLTSYGV----FREHINADASERRYSLGEVGKTLVTDKDGLS  411
             LP+   DA   L RILR+L SY +     ++H +    ER Y L  V K L  ++DG+S
Sbjct  65   HLPTKNPDAPVMLDRILRLLASYSILTCSLKDHPDGKV-ERLYGLAPVCKFLTKNEDGVS  123

Query  412  YGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
                 L +    LM++W  + +A++D    PF KA G  A+ Y+G
Sbjct  124  VSPLCLMNQDKVLMESWYYLKDAILDGGI-PFNKAYGMTAFEYHG  167



>ref|XP_008775842.1| PREDICTED: tricetin 3',4',5'-O-trimethyltransferase-like [Phoenix 
dactylifera]
Length=367

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 51/158 (32%), Positives = 82/158 (52%), Gaps = 4/158 (3%)
 Frame = +1

Query  82   ESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSG  261
            + ++A + A +  ++LA+   +PM+L A + L++ + I + G  A LS +E+ + +    
Sbjct  15   DEQAADEAACMYAVQLASSSILPMTLKAAIELDILEIIVKAGPGAKLSPAEVATQLPTEN  74

Query  262  GGDAQNLQRILRMLTSYGVFREHINADASE---RRYSLGEVGKTLVTDKDGLSYGAYVLQ  432
               A  L R+LR+L SY +    +  DA     RRY    V K L  +K+G S  A  L 
Sbjct  75   PMAATMLDRMLRLLASYNILTCSVEIDADGKPFRRYGAAPVCKWLTKNKEGASMSALTLM  134

Query  433  HHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
            +    LM +W  + +AV+D    PF KA G  A+ YYG
Sbjct  135  NQDKILMGSWYYLKDAVLDGGI-PFNKAYGTTAFEYYG  171



>gb|AAF60951.1| O-methyltransferase [Populus trichocarpa x Populus deltoides]
Length=364

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 55/165 (33%), Positives = 88/165 (53%), Gaps = 8/165 (5%)
 Frame = +1

Query  67   EAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSS  246
            E   + ++ + + A L  M+LA+   +PM L   + L++ + + + G  A LS SEI +S
Sbjct  6    ETQMTPTQVSDEEAHLFAMQLASASVLPMILKTAIELDLLEIMAKAGPGAFLSTSEI-AS  64

Query  247  VLPSGGGDAQ-NLQRILRMLTSYGV----FREHINADASERRYSLGEVGKTLVTDKDGLS  411
             LP+   DA   L RILR+L SY +     ++H +    ER Y L  V K L  ++DG+S
Sbjct  65   HLPTKNPDAPVMLDRILRLLASYSILTCSLKDHPDGKV-ERLYGLAPVCKFLTKNEDGVS  123

Query  412  YGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
                 L +    LM++W  + +A++D    PF KA G  A+ Y+G
Sbjct  124  VSPLCLMNQDKVLMESWYYLKDAILDGGI-PFNKAYGMTAFEYHG  167



>gb|KHG13754.1| Caffeic acid 3-O-methyltransferase [Gossypium arboreum]
Length=387

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 59/177 (33%), Positives = 90/177 (51%), Gaps = 6/177 (3%)
 Frame = +1

Query  28   SRIEKQITGKKEIEAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGG  207
            S I   IT     E   + ++ +   A L  M+LA+   +PM L + + L++ + + + G
Sbjct  15   SFITPDITMGSIGETQMTPTQVSDDEANLFAMQLASASVLPMVLKSAIELDLLEIMAKAG  74

Query  208  SNAPLSASEILSSVLPSGGGDAQ-NLQRILRMLTSYGVFREHINADAS---ERRYSLGEV  375
              A LS  E+ +S LP+   DA   L RILR+L SY V    +        ER Y LG V
Sbjct  75   PGAFLSPKEV-ASKLPTTNPDAPVMLDRILRLLASYNVLTCSLRTFPGGKVERLYGLGPV  133

Query  376  GKTLVTDKDGLSYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
             K L  ++DG++  A  L +    LM++W  + +AV+D    PF KA G  A+ Y+G
Sbjct  134  CKFLTKNEDGVTLSALSLMNQDKVLMESWYYLKDAVLDGGI-PFNKAYGMTAFEYHG  189



>gb|ACN41351.2| putative caffeic acid O-methyltransferase [Betula pendula]
Length=365

 Score = 82.0 bits (201),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 59/169 (35%), Positives = 91/169 (54%), Gaps = 13/169 (8%)
 Frame = +1

Query  73   MGSESES-------AQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSAS  231
            MGS +E+       + + A L  M+LA+   +PM L + + L++ + + + G  A LS S
Sbjct  1    MGSTAETQMTPTQVSDEEANLFAMQLASASVLPMILKSAIELDLLEIMAKAGPGAYLSPS  60

Query  232  EILSSVLPSGGGDAQ-NLQRILRMLTSYGVFREHINADAS---ERRYSLGEVGKTLVTDK  399
            EI +S LP+   DA   L RILR+L SY V    +        ER Y LG V K L  ++
Sbjct  61   EI-ASQLPTTNPDAPVMLDRILRLLASYSVLTYSLRTLPDGRVERLYGLGPVCKFLTKNE  119

Query  400  DGLSYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
            DG+S  A  L +    LM++W  + +AV++    PF KA+G  ++ Y+G
Sbjct  120  DGVSIAALNLMNQDKVLMESWYYLKDAVLEGGI-PFNKAHGMTSFEYHG  167



>gb|EEC84528.1| hypothetical protein OsI_31257 [Oryza sativa Indica Group]
Length=620

 Score = 83.2 bits (204),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 45/83 (54%), Positives = 57/83 (69%), Gaps = 6/83 (7%)
 Frame = +1

Query  283  QRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDG---LSYGAYVLQHHQDALM  453
             R+LR+L S GVF EH ++  S RR+SL  V +TLV    G    SY  YVLQHHQD L+
Sbjct  347  HRLLRLLASRGVFSEHTSS--SPRRFSLTTVSRTLVPAGGGSSAASYADYVLQHHQDELV  404

Query  454  KAWPLVHEAVVD-SSSEPFVKAN  519
            +AW L+HEAV+D + SEPF +AN
Sbjct  405  RAWSLLHEAVLDPAGSEPFARAN  427



>gb|AAD29842.1|AF064694_1 catechol O-methyltransferase [Thalictrum tuberosum]
Length=362

 Score = 81.3 bits (199),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 54/153 (35%), Positives = 81/153 (53%), Gaps = 4/153 (3%)
 Frame = +1

Query  97   QKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQ  276
            ++ A L  M+LA+   +PM L A + L+V + I + G  A ++ +EI S +  S      
Sbjct  15   EEEACLHAMQLASASVLPMVLKAAIELSVLEIIAKAGQGAYVAPTEIASQLSTSNSQAPI  74

Query  277  NLQRILRMLTSYGVFREHINA---DASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQDA  447
             L RILR+L SY V   ++        ER Y L  V K LV ++DG+S    VL +    
Sbjct  75   ILDRILRLLASYKVLTCNLRTLEDGGVERLYGLAPVCKFLVKNEDGVSIAPLVLMNQDKV  134

Query  448  LMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
            LM++W  + +AV+D    PF KA G  A+ Y+G
Sbjct  135  LMESWYHLKDAVLDGGI-PFNKAYGMTAFEYHG  166



>gb|KDO40925.1| hypothetical protein CISIN_1g0357381mg, partial [Citrus sinensis]
Length=235

 Score = 80.1 bits (196),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 47/141 (33%), Positives = 73/141 (52%), Gaps = 1/141 (1%)
 Frame = +1

Query  124  ELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQNLQRILRML  303
            +LA  I +PM++ AV  L + + I + G  A LSAS+I + +          L RILR+L
Sbjct  18   QLARGIVLPMAMQAVYELGIFEIIDKAGPGAKLSASDIAAQLTTKNKDAPMMLDRILRLL  77

Query  304  TSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQDALMKAWPLVHEAV  483
             SY V    ++A  + R YSL  V K  V +KDG+S G  +   H    ++ W  +  A+
Sbjct  78   ASYSVVECSLDASGARRLYSLNSVSKYYVPNKDGVSLGPGIQITHDKVFLECWSQLKHAI  137

Query  484  VDSSSEPFVKANGEPAYSYYG  546
            ++    PF +A+G   + Y G
Sbjct  138  LEGGI-PFNRAHGMHTFEYAG  157



>gb|ABK25932.1| unknown [Picea sitchensis]
Length=353

 Score = 80.9 bits (198),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 45/146 (31%), Positives = 80/146 (55%), Gaps = 4/146 (3%)
 Frame = +1

Query  112  LTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQNLQRI  291
            L  MEL N   +PM++ A + L+V   I   G+   L++++I++ +  +    A +L RI
Sbjct  10   LLCMELGNFSCLPMAMKAAIELDVFQIIANAGNGVQLASTQIVARIPTTNPDAAISLDRI  69

Query  292  LRMLTSYGVFREHINAD---ASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQDALMKAW  462
            L++L S+ V    +  D    +E  Y L  + K LV ++DG+S   +VL +     M++W
Sbjct  70   LKVLASHSVLSCSVTMDENGKAEGLYGLTPLCKYLVKNRDGISLAPWVLMNQDKVFMESW  129

Query  463  PLVHEAVVDSSSEPFVKANGEPAYSY  540
              + +AV++  S+PF KA+G   + Y
Sbjct  130  HYLKDAVLE-GSQPFTKAHGMNVFEY  154



>sp|Q9XGW0.1|COMT1_OCIBA RecName: Full=Caffeic acid 3-O-methyltransferase 1; Short=CAOMT-1; 
Short=COMT-1; AltName: Full=S-adenosysl-L-methionine:caffeic 
acid 3-O-methyltransferase 1 [Ocimum basilicum]
 gb|AAD38189.1|AF154917_1 caffeic acid O-methyltransferase [Ocimum basilicum]
Length=361

 Score = 81.3 bits (199),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 57/167 (34%), Positives = 88/167 (53%), Gaps = 11/167 (7%)
 Frame = +1

Query  73   MGSESESAQKNAR-----LTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEI  237
            MGS + + Q N+      L  M+LA+   +PM L + + L++ + I + G+ A +S  + 
Sbjct  1    MGSATNTPQINSDEEENFLFAMQLASASVLPMVLKSAIELDLLELIKKSGAGAFVSPVD-  59

Query  238  LSSVLPSGGGDAQ-NLQRILRMLTSYGVFREHINA---DASERRYSLGEVGKTLVTDKDG  405
            L++ LP+   DA   L RILR+LTSY +    +        ER Y L  V K L  ++DG
Sbjct  60   LAAQLPTTNPDAHVMLDRILRLLTSYAILECRLKTLPDGGVERLYGLAPVCKFLTKNEDG  119

Query  406  LSYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
            +S     L +    LM++W  + +AVVD    PF KA G  A+ Y+G
Sbjct  120  VSMAPLTLMNQDKVLMESWYHLSDAVVDGGI-PFNKAYGMTAFEYHG  165



>gb|AAD29843.1|AF064695_1 catechol O-methyltransferase [Thalictrum tuberosum]
Length=362

 Score = 81.3 bits (199),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 53/153 (35%), Positives = 81/153 (53%), Gaps = 4/153 (3%)
 Frame = +1

Query  97   QKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQ  276
            ++ A L  M+LA+   +PM L A + L+V + I + G  A ++ +EI S +  S      
Sbjct  15   EEEACLHAMQLASASVLPMVLKAAIELDVLEIIAKAGQGAYVAPTEIASQLSTSNSQAPI  74

Query  277  NLQRILRMLTSYGVFREHINA---DASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQDA  447
             L R+LR+L SY V   ++        ER Y L  V K LV ++DG+S    VL +    
Sbjct  75   ILDRVLRLLASYKVLTCNLRTLEDGGVERLYGLAPVCKFLVKNEDGVSIAPLVLMNQDKV  134

Query  448  LMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
            LM++W  + +AV+D    PF KA G  A+ Y+G
Sbjct  135  LMESWYHLKDAVLDGGI-PFNKAYGMTAFEYHG  166



>prf||2119166A caffeic acid O-methyltransferase
Length=365

 Score = 81.3 bits (199),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 54/168 (32%), Positives = 85/168 (51%), Gaps = 11/168 (7%)
 Frame = +1

Query  73   MGSESES-------AQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSAS  231
            MGS  E+       + + A L  M+LA+   +PM L + + L+V + I + G    LS +
Sbjct  1    MGSTGETQITPTVVSDEEANLFAMQLASASVLPMVLKSAIELDVLEIIAKAGPGVHLSPA  60

Query  232  EILSSVLPSGGGDAQNLQRILRMLTSYGVFREHINA---DASERRYSLGEVGKTLVTDKD  402
            +I ++V  +    A  L R+LR+L  Y +    +        ER Y L  V K LV ++D
Sbjct  61   DIAANVPTTNPDAAVMLDRMLRLLACYNILNHSLRTLPDGKVERLYGLAPVAKFLVKNED  120

Query  403  GLSYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
            G+S  A  L +H   LM++W  + E V++    PF KA G  A+ Y+G
Sbjct  121  GVSLSALNLMNHDKVLMESWYYLKETVLEGGI-PFNKAYGMTAFEYHG  167



>gb|ACT32028.1| caffeic acid O-methyltransferase 1 [Gossypium hirsutum]
Length=366

 Score = 81.3 bits (199),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 55/164 (34%), Positives = 86/164 (52%), Gaps = 6/164 (4%)
 Frame = +1

Query  67   EAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSS  246
            E   + ++ +   A L  M+LA+   +PM L + + L++ + + + G  A LS  E+ +S
Sbjct  6    ETQMTPTQVSDDEANLFAMQLASASVLPMVLKSAIELDLLEIMAKAGPGAFLSPKEV-AS  64

Query  247  VLPSGGGDAQ-NLQRILRMLTSYGVFREHINA---DASERRYSLGEVGKTLVTDKDGLSY  414
             LP+   DA   L RILR+L SY V    +        ER Y LG V K L  ++DG++ 
Sbjct  65   KLPTTNPDAPVMLDRILRLLASYNVLTCSLRTFPGGKVERLYGLGPVCKFLTRNEDGVTL  124

Query  415  GAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
             A  L +    LM++W  + +AV+D    PF KA G  A+ Y+G
Sbjct  125  SALSLMNQDKVLMESWYYLKDAVLDGGI-PFNKAYGMTAFEYHG  167



>gb|AAD29844.1|AF064696_1 catechol O-methyltransferase [Thalictrum tuberosum]
Length=364

 Score = 80.9 bits (198),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 54/150 (36%), Positives = 79/150 (53%), Gaps = 4/150 (3%)
 Frame = +1

Query  106  ARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQNLQ  285
            A L  M+LA+   +PM L A + L+V + I + G  A ++ SEI S +  S       L 
Sbjct  20   ACLHAMQLASASVLPMVLKAAIELDVLEIIAKAGKGAYVAPSEIASQLSTSNSQAPTVLD  79

Query  286  RILRMLTSYGVFR---EHINADASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQDALMK  456
            R+LR+L SY V      ++     ER Y L  V K LV ++DG+S    VL +    LM+
Sbjct  80   RMLRLLASYKVLTCNLRNLEDGGVERLYGLAPVCKFLVKNEDGVSMAPLVLMNQDKVLME  139

Query  457  AWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
            +W  + +AV+D    PF KA G  A+ Y+G
Sbjct  140  SWYHLKDAVLDGGI-PFNKAYGMTAFEYHG  168



>gb|AGG91492.1| caffeic acid 3-O-methyltransferase [Betula platyphylla]
Length=365

 Score = 80.9 bits (198),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 55/164 (34%), Positives = 89/164 (54%), Gaps = 6/164 (4%)
 Frame = +1

Query  67   EAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSS  246
            E   + ++ + + A L  M+LA+   +PM L + + L++ + + + G  A LS SE+ +S
Sbjct  6    ETQMTPTQVSDEEANLFAMQLASASVLPMILKSAIELDLLEIMAKAGPGAYLSPSEV-AS  64

Query  247  VLPSGGGDAQ-NLQRILRMLTSYGVFREHINADAS---ERRYSLGEVGKTLVTDKDGLSY  414
             LP+   DA   L RILR+L SY V    +        ER Y LG V K L  ++DG+S 
Sbjct  65   QLPTTNPDAPVMLDRILRLLASYSVLTYSLRTLPDGRVERLYGLGPVCKFLTKNEDGVSI  124

Query  415  GAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
             A  L +    LM++W  + +AV++    PF KA+G  ++ Y+G
Sbjct  125  AALNLMNQDKVLMESWYYLKDAVLEGGI-PFNKAHGMTSFEYHG  167



>gb|AAD29841.1|AF064693_1 catechol O-methyltransferase [Thalictrum tuberosum]
Length=364

 Score = 80.9 bits (198),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 54/150 (36%), Positives = 79/150 (53%), Gaps = 4/150 (3%)
 Frame = +1

Query  106  ARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQNLQ  285
            A L  M+LA+   +PM L A + L+V + I + G  A ++ SEI S +  S       L 
Sbjct  20   AYLHAMQLASASVLPMVLKAAIELDVLEIIAKAGKGAYVAPSEIASQLSTSNSQAPTVLD  79

Query  286  RILRMLTSYGVFR---EHINADASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQDALMK  456
            R+LR+L SY V      ++     ER Y L  V K LV ++DG+S    VL +    LM+
Sbjct  80   RMLRLLASYKVLTCNLRNLEDGGVERLYGLAPVCKFLVKNEDGVSMAPLVLMNQDKVLME  139

Query  457  AWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
            +W  + +AV+D    PF KA G  A+ Y+G
Sbjct  140  SWYHLKDAVLDGGI-PFNKAYGMTAFEYHG  168



>ref|XP_010671332.1| PREDICTED: caffeic acid 3-O-methyltransferase [Beta vulgaris 
subsp. vulgaris]
Length=365

 Score = 80.9 bits (198),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 52/137 (38%), Positives = 76/137 (55%), Gaps = 6/137 (4%)
 Frame = +1

Query  148  PMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQN-LQRILRMLTSYGVFR  324
            PM L AV+ L+V + I + G NA LS +EI++  LPS   DA   L R+LR+L SY +  
Sbjct  30   PMVLKAVIELDVLEIIKRAGPNAQLSPAEIVAQ-LPSKNPDAATMLDRMLRLLASYSILS  88

Query  325  EHINA---DASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQDALMKAWPLVHEAVVDSS  495
              +        ER Y L  V + L  ++DG++ GA  L +    LM++W  + +AV+D  
Sbjct  89   YSLRTLPDGKVERLYGLAPVCQFLTKNQDGVTLGALSLMNQDKILMESWYHLKDAVLDGG  148

Query  496  SEPFVKANGEPAYSYYG  546
              PF KA G  A+ Y+G
Sbjct  149  I-PFNKAYGMTAFEYHG  164



>gb|AFK40372.1| unknown [Lotus japonicus]
Length=365

 Score = 80.9 bits (198),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 55/170 (32%), Positives = 92/170 (54%), Gaps = 10/170 (6%)
 Frame = +1

Query  49   TGKKEIEAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSA  228
            TG+ +I    + +  + + A L  M+LA+   +PM L + + L++ + I + G+ A LS 
Sbjct  4    TGETQI----TPTHVSDEEANLFAMQLASASVLPMVLKSAIELDLLEFIAKAGTGAQLSP  59

Query  229  SEILSSVLPSGGGDAQN-LQRILRMLTSYGVFREHINADAS---ERRYSLGEVGKTLVTD  396
            +EI +S LP+   DA   L R+LR+L  Y +    +  +     +R Y L  V K LV +
Sbjct  60   AEI-ASQLPTTNPDAPTVLDRMLRLLACYNILTCSVRTEQDGKVQRLYGLAPVAKYLVKN  118

Query  397  KDGLSYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
            +DG+S  A  L +    LM++W  + +AV++    PF KA G  A+ Y+G
Sbjct  119  EDGVSISALNLMNQDKVLMESWYHLKDAVLEGGI-PFNKAYGMTAFEYHG  167



>emb|CDY43839.1| BnaC03g14720D [Brassica napus]
Length=364

 Score = 80.9 bits (198),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 58/169 (34%), Positives = 86/169 (51%), Gaps = 14/169 (8%)
 Frame = +1

Query  73   MGSESES-------AQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSAS  231
            MGS +E+           A L  M+LA+   +PM L + + L++ + + +  S  P+S S
Sbjct  1    MGSTAETQITPVQVTDDEAALFAMQLASASVLPMVLKSALDLDLLEIMAKNSS--PMSPS  58

Query  232  EILSSVLPSGGGDAQNLQRILRMLTSYGVF----REHINADASERRYSLGEVGKTLVTDK  399
            EI S +          L RILR+LTSY +     R     D+ ER Y LG V K L  ++
Sbjct  59   EIASKLQTKNPEAPVMLDRILRLLTSYSILTCSNRTIPGGDSVERIYGLGPVCKYLTKNE  118

Query  400  DGLSYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
            DG+S  A  L +    LM++W  + +AV+D    PF KA G  A+ Y+G
Sbjct  119  DGVSIAALCLMNQDKVLMESWYHLKDAVLDGGI-PFNKAYGMSAFEYHG  166



>gb|KJB52493.1| hypothetical protein B456_008G264900 [Gossypium raimondii]
 gb|KJB52494.1| hypothetical protein B456_008G264900 [Gossypium raimondii]
Length=275

 Score = 79.7 bits (195),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 58/177 (33%), Positives = 90/177 (51%), Gaps = 6/177 (3%)
 Frame = +1

Query  28   SRIEKQITGKKEIEAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGG  207
            S I   IT     E   + ++ + + A    M+LA+   +PM L + + L++ + + + G
Sbjct  15   SFITPDITMGSIGETQMTPTQVSDEEANSFAMQLASASVLPMVLKSAIELDLLEIMAKAG  74

Query  208  SNAPLSASEILSSVLPSGGGDAQ-NLQRILRMLTSYGVFREHINA---DASERRYSLGEV  375
              A LS  E+ +S LP+   DA   L RILR+L SY V    +        ER Y LG V
Sbjct  75   PGAFLSPKEV-ASKLPTTNPDAPVMLDRILRLLASYNVLTCSLRTLPDGKVERLYGLGPV  133

Query  376  GKTLVTDKDGLSYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
             K L  ++DG++  A  L +    LM++W  + +AV+D    PF KA G  A+ Y+G
Sbjct  134  CKFLTKNEDGVTLSALSLMNQDKVLMESWYYLKDAVLDGGI-PFNKAYGMTAFEYHG  189



>ref|XP_011043758.1| PREDICTED: caffeic acid 3-O-methyltransferase 1 [Populus euphratica]
Length=365

 Score = 80.9 bits (198),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 54/164 (33%), Positives = 86/164 (52%), Gaps = 6/164 (4%)
 Frame = +1

Query  67   EAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSS  246
            E   + ++ + + A L  M+LA+   +PM L   + L++ + + + G  A LS SEI +S
Sbjct  6    ETQMTPTQVSDEEAHLFAMQLASASVLPMILKTAIELDLLEIMAKAGPGAFLSTSEI-AS  64

Query  247  VLPSGGGDAQ-NLQRILRMLTSYGVFR---EHINADASERRYSLGEVGKTLVTDKDGLSY  414
             LP+   DA   L RILR+L SY +     + +     ER Y L  V K L  ++DG+S 
Sbjct  65   HLPTKNPDAPVMLDRILRLLASYSILTCSLKDLPDGKVERLYGLAPVCKFLTKNEDGVSV  124

Query  415  GAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
                L +    LM++W  + +A++D    PF KA G  A+ Y+G
Sbjct  125  SPLCLMNQDKVLMESWYYLKDAILDGGI-PFNKAYGMTAFEYHG  167



>sp|Q00763.1|COMT1_POPTM RecName: Full=Caffeic acid 3-O-methyltransferase 1; Short=CAOMT-1; 
Short=COMT-1; AltName: Full=S-adenosysl-L-methionine:caffeic 
acid 3-O-methyltransferase 1 [Populus tremuloides]
 emb|CAA44006.1| lignin bispecific acid/5-hydroxyferulic acid methyltransferase 
[Populus tremuloides]
 gb|AAB61731.1| caffeic acid/5-hydroxyferulic acid O-methyltransferase [Populus 
tremuloides]
Length=365

 Score = 80.5 bits (197),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 54/164 (33%), Positives = 86/164 (52%), Gaps = 6/164 (4%)
 Frame = +1

Query  67   EAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSS  246
            E   + ++ + + A L  M+LA+   +PM L   + L++ + + + G  A LS SEI +S
Sbjct  6    ETQMTPTQVSDEEAHLFAMQLASASVLPMILKTAIELDLLEIMAKAGPGAFLSTSEI-AS  64

Query  247  VLPSGGGDAQ-NLQRILRMLTSYGVFR---EHINADASERRYSLGEVGKTLVTDKDGLSY  414
             LP+   DA   L RILR+L SY +     + +     ER Y L  V K L  ++DG+S 
Sbjct  65   HLPTKNPDAPVMLDRILRLLASYSILTCSLKDLPDGKVERLYGLAPVCKFLTKNEDGVSV  124

Query  415  GAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
                L +    LM++W  + +A++D    PF KA G  A+ Y+G
Sbjct  125  SPLCLMNQDKVLMESWYYLKDAILDGGI-PFNKAYGMTAFEYHG  167



>gb|AFZ78575.1| caffeic acid O-methyltransferase [Populus tomentosa]
Length=365

 Score = 80.5 bits (197),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 54/164 (33%), Positives = 86/164 (52%), Gaps = 6/164 (4%)
 Frame = +1

Query  67   EAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSS  246
            E   + ++ + + A L  M+LA+   +PM L   + L++ + + + G  A LS SEI +S
Sbjct  6    ETQMTPTQVSDEEAHLFAMQLASASVLPMILKTAIELDLLEIMAKAGPGAFLSTSEI-AS  64

Query  247  VLPSGGGDAQ-NLQRILRMLTSYGVFR---EHINADASERRYSLGEVGKTLVTDKDGLSY  414
             LP+   DA   L RILR+L SY +     + +     ER Y L  V K L  ++DG+S 
Sbjct  65   HLPTKNPDAPVMLDRILRLLASYSILTCSLKDLPDGKVERLYGLAPVCKFLTKNEDGVSV  124

Query  415  GAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
                L +    LM++W  + +A++D    PF KA G  A+ Y+G
Sbjct  125  SPLCLMNQDKVLMESWYYLKDAILDGGI-PFNKAYGMTAFEYHG  167



>ref|XP_009132451.1| PREDICTED: flavone 3'-O-methyltransferase 1 [Brassica rapa]
 emb|CDY43052.1| BnaA03g11990D [Brassica napus]
Length=364

 Score = 80.5 bits (197),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 57/169 (34%), Positives = 86/169 (51%), Gaps = 14/169 (8%)
 Frame = +1

Query  73   MGSESES-------AQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSAS  231
            MGS +E+           A L  M+LA+   +PM L + + L++ + + +  S  P+S S
Sbjct  1    MGSTAETQITPVQVTDDEAALFAMQLASASVLPMVLKSALDLDLLEIMAKNSS--PMSPS  58

Query  232  EILSSVLPSGGGDAQNLQRILRMLTSYGVF----REHINADASERRYSLGEVGKTLVTDK  399
            EI S +          L RILR+LTSY +     R     D+ ER Y LG V K L  ++
Sbjct  59   EIASKLQTKNPEAPVMLDRILRLLTSYSILTCSNRTIPGGDSVERIYGLGPVCKYLTKNE  118

Query  400  DGLSYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
            DG+S  A  L +    LM++W  + +A++D    PF KA G  A+ Y+G
Sbjct  119  DGVSIAALCLMNQDKVLMESWYHLKDAILDGGI-PFNKAYGMSAFEYHG  166



>ref|XP_002317838.1| Chain A family protein [Populus trichocarpa]
 gb|ABK92533.1| unknown [Populus trichocarpa]
 gb|ACC63886.1| caffeic acid 3-O-methyltransferase [Populus trichocarpa]
 gb|ACJ76441.1| caffeic acid 3-O-methyltransferase 1 [Populus trichocarpa]
 gb|EEE96058.1| Chain A family protein [Populus trichocarpa]
Length=364

 Score = 80.5 bits (197),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 54/164 (33%), Positives = 86/164 (52%), Gaps = 6/164 (4%)
 Frame = +1

Query  67   EAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSS  246
            E   + ++ + + A L  M+LA+   +PM L   + L++ + + + G  A LS SEI +S
Sbjct  6    ETQMTPTQVSDEEAHLFAMQLASASVLPMILKTAIELDLLEIMAKAGPGAFLSTSEI-AS  64

Query  247  VLPSGGGDAQ-NLQRILRMLTSYGVFR---EHINADASERRYSLGEVGKTLVTDKDGLSY  414
             LP+   DA   L RILR+L SY +     + +     ER Y L  V K L  ++DG+S 
Sbjct  65   HLPTKNPDAPVMLDRILRLLASYSILTCSLKDLPDGKVERLYGLAPVCKFLTKNEDGVSV  124

Query  415  GAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
                L +    LM++W  + +A++D    PF KA G  A+ Y+G
Sbjct  125  SPLCLMNQDKVLMESWYYLKDAILDGGI-PFNKAYGMTAFEYHG  167



>gb|KFK27028.1| hypothetical protein AALP_AA8G324800 [Arabis alpina]
Length=365

 Score = 80.5 bits (197),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 60/171 (35%), Positives = 90/171 (53%), Gaps = 17/171 (10%)
 Frame = +1

Query  73   MGSESES-------AQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSAS  231
            MGS +E+           A L  M+LA+   +PM+L   + L++ + + +  S  P+S S
Sbjct  1    MGSTAETQLTPVQVTDDEAALFAMQLASASVLPMALKTALELDLLEIMAKNSS--PMSPS  58

Query  232  EILSSVLPSGGGDAQ-NLQRILRMLTSYGVFREHINA-----DASERRYSLGEVGKTLVT  393
            EI +S LP+   +A   L RILR+LT+Y V            DA ER Y LG V K L  
Sbjct  59   EI-ASHLPTKNLEAPVMLDRILRLLTAYSVLTCSNRTLPGGGDAVERTYGLGPVCKYLTK  117

Query  394  DKDGLSYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
            ++DG+S  A  L +    LM++W  + +A++D    PF KA G  A+ Y+G
Sbjct  118  NEDGVSIAALCLMNQDKVLMESWYHLKDAILDGGI-PFNKAYGMSAFEYHG  167



>gb|AAO43609.1| caffeic acid O-methyltransferase [Sorghum bicolor]
 gb|AEM63601.1| caffeic acid O-methyltransferase [Sorghum bicolor]
 gb|AEM63610.1| caffeic acid O-methyltransferase [Sorghum bicolor]
 gb|AEM63611.1| caffeic acid O-methyltransferase [Sorghum bicolor]
 gb|AEM63612.1| caffeic acid O-methyltransferase [Sorghum bicolor]
 gb|AFO69478.1| caffeic acid O-methyltransferase [Sorghum bicolor]
 gb|AFO69479.1| caffeic acid O-methyltransferase [Sorghum bicolor]
 gb|AHN09802.1| caffeic acid O-methyltransferase [Sorghum sudanense]
Length=362

 Score = 80.1 bits (196),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 57/166 (34%), Positives = 90/166 (54%), Gaps = 10/166 (6%)
 Frame = +1

Query  73   MGSESES----AQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEIL  240
            MGS +E     A + A +  M+LA+   +PM+L   + L + + + +    A L+A E++
Sbjct  1    MGSTAEDVAAVADEEACMYAMQLASSSILPMTLKNALELGLLEVLQKDAGKA-LAAEEVV  59

Query  241  S--SVLPSGGGDAQNLQRILRMLTSYGVFREHI-NADAS-ERRYSLGEVGKTLVTDKDGL  408
            +   V P+    A  + R+LR+L SY V R  + + D   ERRYS   VGK L  ++DG+
Sbjct  60   ARLPVAPTNPAAADMVDRMLRLLASYDVVRCQMEDKDGKYERRYSAAPVGKWLTPNEDGV  119

Query  409  SYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
            S  A  L +    LM++W  + +AV+D    PF KA G  A+ Y+G
Sbjct  120  SMAALALMNQDKVLMESWYYLKDAVLDGGI-PFNKAYGMTAFEYHG  164



>gb|AAL57301.1|AF387790_1 O-methyltransferase [Sorghum bicolor]
Length=362

 Score = 80.1 bits (196),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 57/166 (34%), Positives = 90/166 (54%), Gaps = 10/166 (6%)
 Frame = +1

Query  73   MGSESES----AQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEIL  240
            MGS +E     A + A +  M+LA+   +PM+L   + L + + + +    A L+A E++
Sbjct  1    MGSTAEDVAAVADEEACMYAMQLASSSILPMTLKNALELGLLEVLQKDAGKA-LAAEEVV  59

Query  241  S--SVLPSGGGDAQNLQRILRMLTSYGVFREHI-NADAS-ERRYSLGEVGKTLVTDKDGL  408
            +   V P+    A  + RILR+L SY V +  + + D   ERRYS   VGK L  ++DG+
Sbjct  60   ARLPVAPTNPAAADMVDRILRLLASYDVVKCQMEDKDGKYERRYSAAPVGKWLTPNEDGV  119

Query  409  SYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
            S  A  L +    LM++W  + +AV+D    PF KA G  A+ Y+G
Sbjct  120  SMAALALMNQDKVLMESWYYLKDAVLDGGI-PFNKAYGMTAFEYHG  164



>gb|AFO69477.1| caffeic acid O-methyltransferase [Sorghum bicolor]
Length=362

 Score = 80.1 bits (196),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 57/166 (34%), Positives = 90/166 (54%), Gaps = 10/166 (6%)
 Frame = +1

Query  73   MGSESES----AQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEIL  240
            MGS +E     A + A +  M+LA+   +PM+L   + L + + + +    A L+A E++
Sbjct  1    MGSTAEDVAAVADEEACMYAMQLASSSILPMTLKNALELGLLEVLQKDAGKA-LAAEEVV  59

Query  241  S--SVLPSGGGDAQNLQRILRMLTSYGVFREHI-NADAS-ERRYSLGEVGKTLVTDKDGL  408
            +   V P+    A  + R+LR+L SY V R  + + D   ERRYS   VGK L  ++DG+
Sbjct  60   ARLPVAPTNPAAADMVDRMLRLLASYDVVRCQMEDKDGKYERRYSAAPVGKWLTPNEDGV  119

Query  409  SYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
            S  A  L +    LM++W  + +AV+D    PF KA G  A+ Y+G
Sbjct  120  SMAALALMNQDKVLMESWYYLKDAVLDGGI-PFNKAYGMTAFEYHG  164



>ref|XP_002525818.1| o-methyltransferase, putative [Ricinus communis]
 gb|EEF36570.1| o-methyltransferase, putative [Ricinus communis]
Length=365

 Score = 80.1 bits (196),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 55/164 (34%), Positives = 87/164 (53%), Gaps = 6/164 (4%)
 Frame = +1

Query  67   EAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSS  246
            E   + ++ + + A L  M+LA+   +PM L + + L++ + + + G +A LS SEI +S
Sbjct  6    ETQMTPTQVSDEEANLFAMQLASASVLPMVLKSAIELDLLEIMAKAGPSAFLSPSEI-AS  64

Query  247  VLPSGGGDAQ-NLQRILRMLTSYGVFREHINA---DASERRYSLGEVGKTLVTDKDGLSY  414
             LP+   DA   L RILR+L SY V    +        ER Y L  V K L+ ++DG+S 
Sbjct  65   QLPTKNPDAPVMLDRILRLLASYNVLTCSLRTLPDGKVERLYGLAPVCKFLIKNEDGVSI  124

Query  415  GAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
                L +    LM++W  + +AV+     PF KA G  A+ Y+G
Sbjct  125  APLCLMNQDKVLMESWYYLKDAVL-LGGIPFNKAYGMTAFDYHG  167



>ref|XP_010934914.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Elaeis guineensis]
Length=367

 Score = 80.1 bits (196),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 51/167 (31%), Positives = 87/167 (52%), Gaps = 4/167 (2%)
 Frame = +1

Query  55   KKEIEAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASE  234
            K+ + A   E+++  + + +  ++LA+   +PM+L A + L V + I + GS   LS ++
Sbjct  6    KQGMPAPSVENQAGDEASCMYALQLASSSILPMTLKAAIELGVLEIIAKAGSVGKLSPAQ  65

Query  235  ILSSVLPSGGGDAQNLQRILRMLTSYGVFREHINADASE---RRYSLGEVGKTLVTDKDG  405
            + + +       A  L R+LR+L SY +    +  DA     RRY    V K L  ++DG
Sbjct  66   VAAQLPTENPMAATMLDRMLRLLASYNILTCSVEVDADGKPLRRYGPAPVCKWLTKNEDG  125

Query  406  LSYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
            +S  A  L +    LM++W  + +AV+D    PF KA G  A+ Y+G
Sbjct  126  VSMAALTLMNQDKVLMESWYYLKDAVLDGGI-PFNKAYGMTAFEYHG  171



>gb|ADO16247.1| caffeic acid O-methyltransferase [Ocimum tenuiflorum]
Length=361

 Score = 80.1 bits (196),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 56/167 (34%), Positives = 88/167 (53%), Gaps = 11/167 (7%)
 Frame = +1

Query  73   MGSESESAQKNAR-----LTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEI  237
            MGS + + Q N+      L  M+LA+   +PM L + + L++ + I + G+ A +S  + 
Sbjct  1    MGSATNTPQINSDEEENFLFAMQLASASVLPMVLKSAIELDLLELIKKSGAGAFVSPVD-  59

Query  238  LSSVLPSGGGDAQ-NLQRILRMLTSYGVFREHINA---DASERRYSLGEVGKTLVTDKDG  405
            L++ LP+   DA   L RILR+LTSY +    +        ER Y L  V K L  ++DG
Sbjct  60   LAAQLPTTNPDAHVMLDRILRLLTSYAILECRLKTLPNGGVERLYGLAPVCKFLTRNEDG  119

Query  406  LSYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
            +S     L +    LM++W  + +AV+D    PF KA G  A+ Y+G
Sbjct  120  VSMAPLTLMNQDKVLMESWYHLKDAVLDGGI-PFNKAYGMTAFEYHG  165



>sp|Q8W013.1|COMT1_CATRO RecName: Full=Caffeic acid 3-O-methyltransferase; Short=CAOMT; 
Short=COMT; AltName: Full=S-adenosysl-L-methionine:caffeic 
acid 3-O-methyltransferase [Catharanthus roseus]
 gb|AAK20170.1| caffeic acid O-methyltransferase [Catharanthus roseus]
Length=363

 Score = 80.1 bits (196),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 55/154 (36%), Positives = 86/154 (56%), Gaps = 6/154 (4%)
 Frame = +1

Query  97   QKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQ  276
            ++ A L+ M LA+   +PM L + + L++ + I + G  A +S SE L++ LP+   DA 
Sbjct  16   EEEACLSAMRLASASVLPMVLKSAIELDLLELIKKSGPGAYVSPSE-LAAQLPTQNPDAP  74

Query  277  -NLQRILRMLTSYGVFR---EHINADASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQD  444
              L RILR+L SY V     + +     ER YSL  V K L  ++DG+S  A +L +   
Sbjct  75   VMLDRILRLLASYSVLNCTLKDLPDGGIERLYSLAPVCKFLTKNEDGVSMAALLLMNQDK  134

Query  445  ALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
             LM++W  + +AV++    PF KA G  A+ Y+G
Sbjct  135  VLMESWYHLKDAVLEGGI-PFNKAYGMTAFEYHG  167



>dbj|BAO79380.1| 5-hydroxyconiferylaldehyde O-methyltransferase [Anthriscus sylvestris]
Length=365

 Score = 79.7 bits (195),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 55/154 (36%), Positives = 83/154 (54%), Gaps = 6/154 (4%)
 Frame = +1

Query  97   QKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQ  276
            ++ A +  M+LA+   +PM L + + LN+ +AI + G  A +S SE L++ LPS   D  
Sbjct  18   EEEACMFAMQLASASVLPMVLKSAIELNLLEAIAKAGPGAYVSPSE-LAAGLPSSQPDTP  76

Query  277  -NLQRILRMLTSYGVFREHINA---DASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQD  444
              L RILR+L SY V +  +        ER Y L  V K L  + DG+S    +L +   
Sbjct  77   VMLDRILRLLASYSVLKCQLRDLPHGRVERLYGLAPVCKFLTKNSDGVSMAPLLLMNQDK  136

Query  445  ALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
             LM++W  + +AV+D    PF KA G  A+ Y+G
Sbjct  137  ILMESWYHLKDAVLDGGI-PFNKAYGMTAFEYHG  169



>gb|AGR85824.1| caffeic acid O-methyltransferase [Hibiscus cannabinus]
Length=306

 Score = 79.0 bits (193),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 52/164 (32%), Positives = 88/164 (54%), Gaps = 6/164 (4%)
 Frame = +1

Query  67   EAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSS  246
            E   + ++ + + A L  M+LA+   +PM L + + L++ + + + G  A LS  E+ ++
Sbjct  6    ETQMTPTQVSDEEANLFAMQLASASVLPMVLKSAIELDLLEIMAKAGPGASLSPKEV-AA  64

Query  247  VLPSGGGDAQ-NLQRILRMLTSYGVFREHINA---DASERRYSLGEVGKTLVTDKDGLSY  414
             LP+   DA   L RILR+L SY +    + +      ER Y LG V K L  ++DG++ 
Sbjct  65   QLPTTNPDAPVMLDRILRLLASYSILTCSLRSLPDGKVERLYGLGPVCKFLTKNEDGVTL  124

Query  415  GAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
             A  L +    LM++W  + +AV++    PF KA G  A+ Y+G
Sbjct  125  SALSLMNQDKVLMESWYYLKDAVLEGGI-PFNKAYGMTAFEYHG  167



>gb|AEQ59236.1| putative S-adenosyl-L-methionine:flavonoid O-methyltransferase 
[Ginkgo biloba]
Length=296

 Score = 78.6 bits (192),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 48/143 (34%), Positives = 73/143 (51%), Gaps = 4/143 (3%)
 Frame = +1

Query  121  MELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQNLQRILRM  300
            MEL N   +PM++ A V L+V   I   G  A +S  EI++ +  +    A  L RI R+
Sbjct  20   MELGNFSCLPMAMKAAVELDVLQIIANAGHGAQISPREIVTHIPTTNPDAAITLARIFRV  79

Query  301  LTSYGVFREHINAD---ASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQDALMKAWPLV  471
            L S+ V    +  D    +ER Y L  + K L  +KDG+S    +L       M++W  +
Sbjct  80   LASHSVLSSSVTTDENGKTERVYGLTPLYKYLEQNKDGVSLAPLLLMSQDKVFMESWYYL  139

Query  472  HEAVVDSSSEPFVKANGEPAYSY  540
             +AV+D  S+ F KA+G  A+ Y
Sbjct  140  KDAVLD-GSQSFTKAHGVNAFEY  161



>gb|KJB52492.1| hypothetical protein B456_008G264900 [Gossypium raimondii]
Length=387

 Score = 79.7 bits (195),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 58/177 (33%), Positives = 90/177 (51%), Gaps = 6/177 (3%)
 Frame = +1

Query  28   SRIEKQITGKKEIEAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGG  207
            S I   IT     E   + ++ + + A    M+LA+   +PM L + + L++ + + + G
Sbjct  15   SFITPDITMGSIGETQMTPTQVSDEEANSFAMQLASASVLPMVLKSAIELDLLEIMAKAG  74

Query  208  SNAPLSASEILSSVLPSGGGDAQ-NLQRILRMLTSYGVFREHINA---DASERRYSLGEV  375
              A LS  E+ +S LP+   DA   L RILR+L SY V    +        ER Y LG V
Sbjct  75   PGAFLSPKEV-ASKLPTTNPDAPVMLDRILRLLASYNVLTCSLRTLPDGKVERLYGLGPV  133

Query  376  GKTLVTDKDGLSYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
             K L  ++DG++  A  L +    LM++W  + +AV+D    PF KA G  A+ Y+G
Sbjct  134  CKFLTKNEDGVTLSALSLMNQDKVLMESWYYLKDAVLDGGI-PFNKAYGMTAFEYHG  189



>ref|XP_006441263.1| hypothetical protein CICLE_v100208142mg, partial [Citrus clementina]
 gb|ESR54503.1| hypothetical protein CICLE_v100208142mg, partial [Citrus clementina]
Length=235

 Score = 78.2 bits (191),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 53/169 (31%), Positives = 88/169 (52%), Gaps = 6/169 (4%)
 Frame = +1

Query  52   GKKEIEAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSAS  231
            G    E   S ++ + + A L  M+L +   +PM L + + L++ + I + G +A +S  
Sbjct  2    GSTSSETQISPAQGSDEEANLLAMQLTSASVLPMVLKSAIELDLLEIIAKAGPDAFMSPK  61

Query  232  EILSSVLPSGGGDAQ-NLQRILRMLTSYGVFR---EHINADASERRYSLGEVGKTLVTDK  399
            +I +S LP+   DA   L RILR+L SY V      ++     ER Y L  V K L  ++
Sbjct  62   DI-ASQLPTKNPDAHIVLDRILRLLASYSVLNCSLRNLPDGKVERLYGLAPVCKFLTKNE  120

Query  400  DGLSYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
            DG++     L +    LM++W  + +AV++    PF KA+G  A+ Y+G
Sbjct  121  DGVTLSDLCLMNQDKVLMESWYYLKDAVLEGGI-PFNKAHGMNAFDYHG  168



>ref|XP_010103059.1| Caffeic acid 3-O-methyltransferase [Morus notabilis]
 gb|EXB94708.1| Caffeic acid 3-O-methyltransferase [Morus notabilis]
Length=264

 Score = 78.6 bits (192),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 47/163 (29%), Positives = 86/163 (53%), Gaps = 4/163 (2%)
 Frame = +1

Query  67   EAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSS  246
            E   + ++ + + A L  M+LA+   +PM L   + L++ + + + G  A LS S+++S 
Sbjct  6    ETQMTPTQVSDEEANLFAMQLASASVLPMVLKTALDLDLLEIMAKAGPGAYLSPSDVVSQ  65

Query  247  VLPSGGGDAQNLQRILRMLTSYGVFR---EHINADASERRYSLGEVGKTLVTDKDGLSYG  417
            +     G    L R+LR+L SY +      ++     ER Y LG V K L  ++DG+S G
Sbjct  66   LPTKNPGAPVMLDRVLRLLASYSILTYSLRNLPDGKVERLYGLGPVCKYLTKNEDGVSIG  125

Query  418  AYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
            +  L +    LM++W  + + +++    PF KA+G  ++ Y+G
Sbjct  126  SLCLMNQDKVLMESWYHLKDTILEGGI-PFNKAHGMTSFDYHG  167



>gb|AET34455.1| putative S-adenosyl-L-methionine: flavonoid O-methyltransferase 
[Ginkgo biloba]
Length=270

 Score = 78.6 bits (192),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 48/143 (34%), Positives = 73/143 (51%), Gaps = 4/143 (3%)
 Frame = +1

Query  121  MELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQNLQRILRM  300
            MEL N   +PM++ A V L+V   I   G  A +S  EI++ +  +    A  L RI R+
Sbjct  20   MELGNFSCLPMAMKAAVELDVLQIIANAGHGAQISPREIVTHIPTTNPDAAITLARIFRV  79

Query  301  LTSYGVFREHINAD---ASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQDALMKAWPLV  471
            L S+ V    +  D    +ER Y L  + K L  +KDG+S    +L       M++W  +
Sbjct  80   LASHSVLSSSVTTDENGKTERVYGLTPLYKYLEQNKDGVSLAPLLLMSQDKVFMESWYYL  139

Query  472  HEAVVDSSSEPFVKANGEPAYSY  540
             +AV+D  S+ F KA+G  A+ Y
Sbjct  140  KDAVLD-GSQSFTKAHGVNAFEY  161



>ref|XP_010934913.1| PREDICTED: tricetin 3',4',5'-O-trimethyltransferase-like [Elaeis 
guineensis]
Length=367

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 50/167 (30%), Positives = 85/167 (51%), Gaps = 4/167 (2%)
 Frame = +1

Query  55   KKEIEAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASE  234
            K+ + A   E+++  + A L  ++L +   +PM+L A + L+V + I + G    LS ++
Sbjct  6    KQGMPAPSVENQAGDEAACLYALQLVSSSILPMTLKAAIELDVLEIIAKAGPEGKLSPAQ  65

Query  235  ILSSVLPSGGGDAQNLQRILRMLTSYGVFREHINADASE---RRYSLGEVGKTLVTDKDG  405
            + + +       A  L R+LR+L SY +    +  DA     RRY    V K L  ++DG
Sbjct  66   VAAQLPTENSMAATMLDRMLRLLASYNILTCSVEVDADGKPLRRYGPAPVCKWLTKNEDG  125

Query  406  LSYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
            +S     L +    LM++W  + +AV+D    PF KA G  A+ Y+G
Sbjct  126  VSMAPLTLMNQDKVLMESWYYLKDAVLDGGI-PFNKAYGMTAFEYHG  171



>ref|XP_006431772.1| hypothetical protein CICLE_v10001661mg [Citrus clementina]
 gb|ESR45012.1| hypothetical protein CICLE_v10001661mg [Citrus clementina]
Length=353

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 56/158 (35%), Positives = 86/158 (54%), Gaps = 5/158 (3%)
 Frame = +1

Query  73   MGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVL  252
            MGS  +  +  +     +LA    +PM++ AV  L +   I + G  A LSAS+I ++ L
Sbjct  1    MGSIVDGERDQSFAYANQLAMGTVLPMAMQAVYELGIFQIIDKAGPGAKLSASDI-AAQL  59

Query  253  PSGGGDAQN-LQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGAYVL  429
            P+   DA   L RILR+L SY V    ++   + RRYSL  V K  V +KDG+S G   L
Sbjct  60   PTKNKDAPTMLDRILRLLASYSVVECSLDGSGARRRYSLNSVSKYYVPNKDGVSLGP-AL  118

Query  430  QHHQD-ALMKAWPLVHEAVVDSSSEPFVKANGEPAYSY  540
            Q  QD   +++W  + +A+++    PF +A+G  A+ Y
Sbjct  119  QMIQDKVFLESWSHLKDAILEGGI-PFNRAHGMHAFEY  155



>gb|AAN03726.1| caffeic acid O-methyltransferase [Coffea canephora]
Length=350

 Score = 79.0 bits (193),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 56/155 (36%), Positives = 85/155 (55%), Gaps = 6/155 (4%)
 Frame = +1

Query  94   AQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  273
            A++ A L  M LA+   +PM L + + L++ + I + G  A +S SE L++ LP+   +A
Sbjct  2    AEEEACLFAMSLASASVLPMVLKSAIELDLLELIAKAGPGAYVSPSE-LAAQLPTHNPEA  60

Query  274  Q-NLQRILRMLTSYGVFREHIN--ADAS-ERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQ  441
               L RILR+L +Y V    +N  AD   ER Y L  V K L  + DG+S    +L +  
Sbjct  61   PIMLDRILRLLATYSVLDCKLNNLADGGVERLYGLAPVCKFLTKNADGVSMAPLLLMNQD  120

Query  442  DALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
              LM++W  + +AV+D    PF KA G  A+ Y+G
Sbjct  121  KVLMESWYHLKDAVLDGGI-PFNKAYGMTAFEYHG  154



>gb|ABR18103.1| unknown [Picea sitchensis]
Length=365

 Score = 79.0 bits (193),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 45/146 (31%), Positives = 78/146 (53%), Gaps = 4/146 (3%)
 Frame = +1

Query  112  LTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQNLQRI  291
            L  MEL N   +PM++ A + L+V   I   G+   LS+ +I++ +  +    A +L RI
Sbjct  22   LLCMELGNFSYLPMAMKAAIELDVFQIIANAGNGVQLSSRQIVAHIPTTNPDAAISLDRI  81

Query  292  LRMLTSYGVFREHINAD---ASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQDALMKAW  462
            L++L S+ V    +  D    +E  Y L  + K +V ++DG+S   +VL +     M+ W
Sbjct  82   LKVLASHSVLSCSVTTDENGKAEGLYGLTPLCKYIVKNRDGISLAPWVLMNQDKVFMETW  141

Query  463  PLVHEAVVDSSSEPFVKANGEPAYSY  540
              + +AV++  S+PF KA+G   + Y
Sbjct  142  HYLKDAVLE-GSQPFTKAHGMNLFQY  166



>gb|KDO44005.1| hypothetical protein CISIN_1g018576mg [Citrus sinensis]
Length=353

 Score = 79.0 bits (193),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 56/158 (35%), Positives = 86/158 (54%), Gaps = 5/158 (3%)
 Frame = +1

Query  73   MGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVL  252
            MGS  +  +  +     +LA    +PM++ AV  L +   I + G  A LSAS+I ++ L
Sbjct  1    MGSIVDGERDQSFAYANQLAMGTVLPMAMQAVYELGIFQIIDKAGPGAKLSASDI-AAQL  59

Query  253  PSGGGDAQN-LQRILRMLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGAYVL  429
            P+   DA   L RILR+L SY V    ++   + RRYSL  V K  V +KDG+S G   L
Sbjct  60   PTKNKDAPTMLDRILRLLASYSVVECSLDGSGARRRYSLNSVSKYYVPNKDGVSLGP-AL  118

Query  430  QHHQD-ALMKAWPLVHEAVVDSSSEPFVKANGEPAYSY  540
            Q  QD   +++W  + +A+++    PF +A+G  A+ Y
Sbjct  119  QMIQDKVFLESWSHLKDAILEGGI-PFNRAHGMHAFEY  155



>sp|Q8LL87.1|COMT1_COFCA RecName: Full=Caffeic acid 3-O-methyltransferase; Short=CAOMT; 
Short=COMT; AltName: Full=S-adenosysl-L-methionine:caffeic 
acid 3-O-methyltransferase [Coffea canephora]
 gb|AAN03727.1| caffeic acid O-methyltransferase [Coffea canephora]
 emb|CDP04982.1| unnamed protein product [Coffea canephora]
Length=350

 Score = 79.0 bits (193),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 56/155 (36%), Positives = 85/155 (55%), Gaps = 6/155 (4%)
 Frame = +1

Query  94   AQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  273
            A++ A L  M LA+   +PM L + + L++ + I + G  A +S SE L++ LP+   +A
Sbjct  2    AEEEACLFAMSLASASVLPMVLKSAIELDLLELIAKAGPGAYVSPSE-LAAQLPTHNPEA  60

Query  274  Q-NLQRILRMLTSYGVFREHIN--ADAS-ERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQ  441
               L RILR+L +Y V    +N  AD   ER Y L  V K L  + DG+S    +L +  
Sbjct  61   PIMLDRILRLLATYSVLDCKLNNLADGGVERLYGLAPVCKFLTKNADGVSMAPLLLMNQD  120

Query  442  DALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
              LM++W  + +AV+D    PF KA G  A+ Y+G
Sbjct  121  KVLMESWYHLKDAVLDGGI-PFNKAYGMTAFEYHG  154



>gb|ABK23414.1| unknown [Picea sitchensis]
Length=365

 Score = 79.0 bits (193),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 45/146 (31%), Positives = 78/146 (53%), Gaps = 4/146 (3%)
 Frame = +1

Query  112  LTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQNLQRI  291
            L  MEL N   +PM++ A + L+V   I   G+   LS+ +I++ +  +    A +L RI
Sbjct  22   LLCMELGNFSYLPMAMKAAIELDVFQIIANAGNGVQLSSRQIVAHIPTTNPDAAISLDRI  81

Query  292  LRMLTSYGVFREHINAD---ASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQDALMKAW  462
            L++L S+ V    +  D    +E  Y L  + K +V ++DG+S   +VL +     M+ W
Sbjct  82   LKVLASHSVLSCSVTTDENGKAEGLYGLTPLCKYIVKNRDGISLAPWVLMNQDKVFMETW  141

Query  463  PLVHEAVVDSSSEPFVKANGEPAYSY  540
              + +AV++  S+PF KA+G   + Y
Sbjct  142  HYLKDAVLE-GSQPFTKAHGMNLFQY  166



>ref|XP_002445083.1| hypothetical protein SORBIDRAFT_07g003860 [Sorghum bicolor]
 gb|EES14578.1| hypothetical protein SORBIDRAFT_07g003860 [Sorghum bicolor]
 gb|ADW65743.1| caffeic acid O-methyltransferase [Sorghum bicolor]
Length=362

 Score = 79.0 bits (193),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 56/166 (34%), Positives = 90/166 (54%), Gaps = 10/166 (6%)
 Frame = +1

Query  73   MGSESES----AQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEIL  240
            MGS +E     A + A +  M+LA+   +PM+L   + L + + + +    A L+A E++
Sbjct  1    MGSTAEDVAAVADEEACMYAMQLASSSILPMTLKNALELGLLEVLQKDAGKA-LAAEEVV  59

Query  241  S--SVLPSGGGDAQNLQRILRMLTSYGVFREHI-NADAS-ERRYSLGEVGKTLVTDKDGL  408
            +   V P+    A  + R+LR+L SY V +  + + D   ERRYS   VGK L  ++DG+
Sbjct  60   ARLPVAPTNPAAADMVDRMLRLLASYDVVKCQMEDKDGKYERRYSAAPVGKWLTPNEDGV  119

Query  409  SYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
            S  A  L +    LM++W  + +AV+D    PF KA G  A+ Y+G
Sbjct  120  SMAALALMNQDKVLMESWYYLKDAVLDGGI-PFNKAYGMTAFEYHG  164



>gb|AAF63200.1| caffeic acid O-3-methyltransferase [Populus tomentosa]
Length=360

 Score = 79.0 bits (193),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 53/164 (32%), Positives = 86/164 (52%), Gaps = 6/164 (4%)
 Frame = +1

Query  67   EAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSS  246
            E   + ++ + + A L  M+LA+   +PM L   + L++ + + + G  A LS SEI +S
Sbjct  6    ETQMTPTQVSDEEAHLFAMQLASASVLPMILKTAIELDLLEIMAKAGPGAFLSTSEI-AS  64

Query  247  VLPSGGGDAQ-NLQRILRMLTSYGVFR---EHINADASERRYSLGEVGKTLVTDKDGLSY  414
             LP+   DA   L RILR+L SY +     + +     ER Y L  V K L  ++DG+S 
Sbjct  65   HLPTKNPDAPVMLDRILRLLASYSILTCSLKDLPDGKVERLYGLAPVCKFLTKNEDGVSV  124

Query  415  GAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
                L +    LM++W  + +A+++    PF KA G  A+ Y+G
Sbjct  125  SPLCLMNQDKVLMESWYYLKDAILEGGI-PFNKAYGMTAFEYHG  167



>sp|Q6T1F5.1|COMT1_AMMMJ RecName: Full=Caffeic acid 3-O-methyltransferase; Short=CAOMT; 
Short=COMT; AltName: Full=S-adenosysl-L-methionine:caffeic 
acid 3-O-methyltransferase [Ammi majus]
 gb|AAR24097.1| caffeic acid O-methyltransferase [Ammi majus]
Length=365

 Score = 79.0 bits (193),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 55/154 (36%), Positives = 84/154 (55%), Gaps = 6/154 (4%)
 Frame = +1

Query  97   QKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQ  276
            ++ A +  M+LA+   +PM L + + LN+ ++I + G  A +S S+ L++ LPS   D  
Sbjct  18   EEEACMFAMQLASASVLPMVLKSAIELNLLESIAKAGPGAYVSPSQ-LAAALPSSQPDTP  76

Query  277  -NLQRILRMLTSYGVFREHIN--ADAS-ERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQD  444
              L RILR+L SY V    +    DA  ER Y L  V K L  + DG+S    +L +   
Sbjct  77   VMLDRILRLLASYSVLNCKLRDLPDARVERLYGLAPVCKFLTKNSDGVSMAPLLLMNQDK  136

Query  445  ALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
             LM++W  + +AV+D    PF KA G  A+ Y+G
Sbjct  137  ILMESWYHLKDAVLDGGI-PFNKAYGMTAFEYHG  169



>ref|XP_009418618.1| PREDICTED: tricetin 3',4',5'-O-trimethyltransferase-like [Musa 
acuminata subsp. malaccensis]
Length=362

 Score = 78.6 bits (192),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 55/167 (33%), Positives = 86/167 (51%), Gaps = 8/167 (5%)
 Frame = +1

Query  55   KKEIEAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASE  234
            K+E++    E E A K A    +ELA    +PM++ A V+L + + + + G    LSA++
Sbjct  5    KEELQLTPEEDEEACKYA----VELAGGPILPMTVAAAVQLGLFEILIKAGPTPKLSAAD  60

Query  235  ILSSVLPSGGGDAQNLQRILRMLTSYGVFREHINADASER---RYSLGEVGKTLVTDKDG  405
            I + +       A  + RILR+L +Y V R  +   A  R   +Y    V K L  ++DG
Sbjct  61   IAAQMPNQNPQAAVMVDRILRLLAAYNVVRCTVETGADGRPLGKYGPAPVCKYLAKNEDG  120

Query  406  LSYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
            +S  A  L +    LM++W  + +AV+D    PF KA G  A+ YYG
Sbjct  121  VSMAALALMNQDKVLMESWYHLKDAVLDGGI-PFNKAYGMTAFEYYG  166



>ref|NP_001289246.1| caffeic acid 3-O-methyltransferase [Pyrus x bretschneideri]
 gb|AGS44640.1| caffeic acid-O-methyltransferase [Pyrus x bretschneideri]
Length=365

 Score = 78.6 bits (192),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 53/164 (32%), Positives = 88/164 (54%), Gaps = 6/164 (4%)
 Frame = +1

Query  67   EAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSS  246
            E   + ++ + + A L  M+LA+   +PM L A + L++ + + + G  A +S ++I +S
Sbjct  6    ETQMTPTQVSDEEANLFAMQLASGSILPMVLKAAIELDLLEVMAKAGPGAFVSPADI-AS  64

Query  247  VLPSGGGDAQ-NLQRILRMLTSYGVFREHINA---DASERRYSLGEVGKTLVTDKDGLSY  414
             LP+   DA   L RILR+L SY +    +        +R Y LG V K L  ++DG S 
Sbjct  65   QLPTKNPDAPVMLDRILRLLASYSILTYSLRTLPDGKVQRLYGLGPVCKFLTKNEDGASI  124

Query  415  GAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
            G+  L +    LM++W  + E+V++    PF KA G  A+ Y+G
Sbjct  125  GSLCLMNQDKVLMESWYHLKESVLEGGI-PFNKAYGMTAFEYHG  167



>dbj|BAD18975.1| phloroglucinol O-methyltransferase [Rosa chinensis var. spontanea]
Length=371

 Score = 78.6 bits (192),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 54/159 (34%), Positives = 83/159 (52%), Gaps = 12/159 (8%)
 Frame = +1

Query  82   ESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSG  261
            E E   K A    + LAN++ +PM L + + LNV D IW  G    LS S+I ++ LP+ 
Sbjct  21   EEEELGKQA----IRLANVVILPMVLKSALELNVIDIIWGAGDGESLSPSDI-AAQLPTK  75

Query  262  GGDAQN-LQRILRMLTSYGVFREHINADAS---ERRYSLGEVGKTLVTDKDG--LSYGAY  423
              +A   L R+LR+L S+ + +      +    ER YS G + K LV D++G   S G  
Sbjct  76   NSNAPAVLDRMLRLLASHSILKCSARTGSDGQVERLYSAGPICKFLVKDQNGGTRSVGPL  135

Query  424  VLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSY  540
             L HH    M+ W  +++A+++    PF +A G  A+ Y
Sbjct  136  FLLHHDKVFMEGWFHLNDAILEGGI-PFNRAYGMTAFEY  173



>sp|Q43046.1|COMT1_POPKI RecName: Full=Caffeic acid 3-O-methyltransferase 1; Short=CAOMT-1; 
Short=COMT-1; AltName: Full=S-adenosysl-L-methionine:caffeic 
acid 3-O-methyltransferase 1 [Populus sieboldii x Populus 
grandidentata]
 dbj|BAA08558.1| caffeic acid O-methyltransferase [Populus kitakamiensis]
Length=365

 Score = 78.6 bits (192),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 53/164 (32%), Positives = 86/164 (52%), Gaps = 6/164 (4%)
 Frame = +1

Query  67   EAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSS  246
            E   + ++ + + A L  M+LA+   +PM L   + L++ + + + G  A LS SEI +S
Sbjct  6    ETQMTPTQVSDEEAHLFAMQLASASVLPMILKTAIELDLLEIMAKAGPGAFLSTSEI-AS  64

Query  247  VLPSGGGDAQ-NLQRILRMLTSYGVFR---EHINADASERRYSLGEVGKTLVTDKDGLSY  414
             LP+   DA   L RILR+L SY +     + +     ER Y L  V K L  ++DG+S 
Sbjct  65   HLPTKNPDAPVMLDRILRLLASYSILTCSLKDLPDGKVERLYGLAPVCKFLTKNEDGVSV  124

Query  415  GAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
                L +    LM++W  + +A+++    PF KA G  A+ Y+G
Sbjct  125  SPLCLMNQDKVLMESWYYLKDAILEGGI-PFNKAYGMTAFEYHG  167



>gb|ADN27527.1| caffeic acid O-methyltransferase [Camellia sinensis]
Length=363

 Score = 78.6 bits (192),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 58/168 (35%), Positives = 90/168 (54%), Gaps = 13/168 (8%)
 Frame = +1

Query  73   MGSESESA-----QKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEI  237
            MGS SE+      ++ A L  M+LA+   +PM L + + L++ + + + G  A +S SE+
Sbjct  1    MGSTSETQTIHTDEEEACLFAMQLASASVLPMVLKSAIELDLLEIMAKAGPGAYVSPSEV  60

Query  238  LSSVLPSGGGDAQ-NLQRILRMLTSYGV----FREHINADASERRYSLGEVGKTLVTDKD  402
             ++ LP+   DA   L RILR+LTSY V     R+  N    ER Y L  V K L  + D
Sbjct  61   -AAQLPTKNPDAAVMLDRILRLLTSYSVLNCTLRDLPNG-GVERLYGLAPVCKFLTRNAD  118

Query  403  GLSYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
            G+S    +L +    LM++W  + + V++    PF KA G  A+ Y+G
Sbjct  119  GVSMAPLLLMNQDKVLMESWYYLKDTVLEGGI-PFNKAYGMTAFEYHG  165



>gb|AAF28353.1|AF220491_1 O-methyltransferase [Fragaria x ananassa]
Length=365

 Score = 78.6 bits (192),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 56/169 (33%), Positives = 89/169 (53%), Gaps = 13/169 (8%)
 Frame = +1

Query  73   MGSESES-------AQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSAS  231
            MGS  E+       + + A L  M+LA+   +PM L A + L++ + + + G  + LS S
Sbjct  1    MGSTGETQMTPTHVSDEEANLFAMQLASASVLPMVLKAAIELDLLEIMAKAGPGSFLSPS  60

Query  232  EILSSVLPSGGGDAQ-NLQRILRMLTSYGVFREHINA---DASERRYSLGEVGKTLVTDK  399
            + L+S LP+   +A   L R+LR+L SY +    +        ER Y LG V K L  ++
Sbjct  61   D-LASQLPTKNPEAPVMLDRMLRLLASYSILTCSLRTLPDGKVERLYCLGPVCKFLTKNE  119

Query  400  DGLSYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
            DG+S  A  L +    L+++W  + +AV+D    PF KA G  A+ Y+G
Sbjct  120  DGVSIAALCLMNQDKVLVESWYHLKDAVLDGGI-PFNKAYGMTAFDYHG  167



>ref|XP_007223223.1| hypothetical protein PRUPE_ppa007212mg [Prunus persica]
 gb|EMJ24422.1| hypothetical protein PRUPE_ppa007212mg [Prunus persica]
Length=377

 Score = 78.6 bits (192),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 53/146 (36%), Positives = 80/146 (55%), Gaps = 8/146 (5%)
 Frame = +1

Query  121  MELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQNL-QRILR  297
            + LAN++ +PM L + + LN+ D I   G    LS SEI +S LP+   DA  L  R+LR
Sbjct  32   IRLANVVILPMVLKSAIELNIIDIISAAGDGKFLSPSEIAAS-LPTKNPDASVLLDRMLR  90

Query  298  MLTSYGVFREHINADAS---ERRYSLGEVGKTLVTDK-DGL-SYGAYVLQHHQDALMKAW  462
            +LTS+ + +  +        ER Y  G + K LV D+ DG+ S G  +L HH    M++W
Sbjct  91   LLTSHSILKCSVRTGQDGKVERLYGAGALCKFLVKDQHDGVGSVGPLLLLHHDKVFMESW  150

Query  463  PLVHEAVVDSSSEPFVKANGEPAYSY  540
               ++AV++    PF +A G  A+ Y
Sbjct  151  CHFNDAVLEGGI-PFNRAYGMTAFEY  175



>ref|XP_006478090.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Citrus sinensis]
 gb|KDO46359.1| hypothetical protein CISIN_1g017777mg [Citrus sinensis]
Length=366

 Score = 78.2 bits (191),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 53/169 (31%), Positives = 87/169 (51%), Gaps = 6/169 (4%)
 Frame = +1

Query  52   GKKEIEAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSAS  231
            G    E   S ++ + + A L  M+L +   +PM L + + L++ + I + G +A +S  
Sbjct  2    GSTSSETQISPAQGSDEEANLLAMQLTSASVLPMVLKSAIELDLLEIIAKAGPDAFMSPK  61

Query  232  EILSSVLPSGGGDAQN-LQRILRMLTSYGVFR---EHINADASERRYSLGEVGKTLVTDK  399
            +I +S LP+   DA   L RILR+L SY V      ++     ER Y L  V K L  ++
Sbjct  62   DI-ASQLPTKNPDAHTVLDRILRLLASYSVLNCSLRNLPDGKVERLYGLAPVCKFLTKNE  120

Query  400  DGLSYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
            DG++     L +    LM++W  + +AV++    PF KA G  A+ Y+G
Sbjct  121  DGVTLSDLCLMNQDKVLMESWYYLKDAVLEGGI-PFNKAYGMNAFDYHG  168



>gb|AGJ84131.1| putative caffeic acid O-methyltransferase [Hibiscus cannabinus]
Length=365

 Score = 78.2 bits (191),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 52/164 (32%), Positives = 87/164 (53%), Gaps = 6/164 (4%)
 Frame = +1

Query  67   EAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSS  246
            E   + ++ + + A L  M+LA+   +PM L + + L++ + + + G  A LS  E+ +S
Sbjct  6    ETQMTPTQVSDEEANLFAMQLASASVLPMVLKSAIELDLLEIMAKAGPGAFLSPMEV-AS  64

Query  247  VLPSGGGDAQ-NLQRILRMLTSYGVFREHINADAS---ERRYSLGEVGKTLVTDKDGLSY  414
             LP+   DA   L RILR+L +Y +    +        ER Y LG V K L  ++DG++ 
Sbjct  65   QLPTANPDAPVMLDRILRLLATYSILTCSLRTLPDGRVERLYGLGPVCKFLTKNQDGVAL  124

Query  415  GAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
             A  L +    LM++W  + +AV++    PF KA G  A+ Y+G
Sbjct  125  SALSLMNQDKVLMESWYYLKDAVLEGGI-PFNKAYGMTAFEYHG  167



>sp|Q8GU25.1|COMT1_ROSCH RecName: Full=Caffeic acid 3-O-methyltransferase; Short=CAOMT; 
Short=COMT; AltName: Full=S-adenosysl-L-methionine:caffeic 
acid 3-O-methyltransferase [Rosa chinensis]
 emb|CAD29457.1| caffeic acid O-methyltransferase [Rosa chinensis]
Length=365

 Score = 78.2 bits (191),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 53/164 (32%), Positives = 88/164 (54%), Gaps = 6/164 (4%)
 Frame = +1

Query  67   EAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSS  246
            E   + ++ + + A L  M+LA+   +PM L A + L++ + + + G  A LS ++ L+S
Sbjct  6    ETQMTPTQVSDEEANLFAMQLASASVLPMVLKAAIELDLLEIMAKAGPGAFLSPND-LAS  64

Query  247  VLPSGGGDAQ-NLQRILRMLTSYGVFREHINA---DASERRYSLGEVGKTLVTDKDGLSY  414
             LP+   +A   L R+LR+L SY +    +        ER Y LG V K L  ++DG+S 
Sbjct  65   QLPTKNPEAPVMLDRMLRLLASYSILTYSLRTLPDGKVERLYGLGPVCKFLTKNEDGVSI  124

Query  415  GAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
             A  L +    L+++W  + +AV+D    PF KA G  A+ Y+G
Sbjct  125  AALCLMNQDKVLVESWYHLKDAVLDGGI-PFNKAYGMTAFDYHG  167



>gb|KHG13289.1| Caffeic acid 3-O-methyltransferase [Gossypium arboreum]
Length=365

 Score = 78.2 bits (191),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 52/164 (32%), Positives = 86/164 (52%), Gaps = 6/164 (4%)
 Frame = +1

Query  67   EAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSS  246
            E   + ++ + + A L  M+L +   +PM L + + L++ + + + G  A LS  E L+S
Sbjct  6    ETQMTPTQVSDEEANLFAMQLTSASVLPMVLKSAIELDLLEIMAKAGPGAFLSPKE-LAS  64

Query  247  VLPSGGGDAQ-NLQRILRMLTSYGVFREHINA---DASERRYSLGEVGKTLVTDKDGLSY  414
             LP+   DA   L RILR+L +Y +    +        ER Y LG V K L  ++DG++ 
Sbjct  65   QLPTNNPDAPVMLDRILRLLATYSILTCSLRTLPDGKVERLYGLGPVCKFLTKNEDGVTL  124

Query  415  GAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
             A  L +    LM++W  + +AV++    PF KA G  A+ Y+G
Sbjct  125  SALSLMNQDKVLMESWYYLKDAVLEGGI-PFNKAYGMTAFEYHG  167



>gb|ABI54119.1| caffeic acid O-methyltransferase [Malus domestica]
Length=365

 Score = 78.2 bits (191),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 54/164 (33%), Positives = 87/164 (53%), Gaps = 6/164 (4%)
 Frame = +1

Query  67   EAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSS  246
            E   + ++ + + A L  M+LA+   +PM L A + L++ + + + G  A +S ++ LSS
Sbjct  6    ETQMTPTQVSDEEANLFAMQLASASVLPMVLKAAIELDLLEIMAKAGPGAFVSPAD-LSS  64

Query  247  VLPSGGGDAQ-NLQRILRMLTSYGVFREHINA---DASERRYSLGEVGKTLVTDKDGLSY  414
             LP+   DA   L R+LR+L SY +    +        ER Y LG V K L   +DG S 
Sbjct  65   QLPTKNPDAPVMLDRMLRVLASYSILTYSLRTLPDGKVERLYGLGPVCKFLTKSEDGASI  124

Query  415  GAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
            G+  L +    LM++W  + +AV++    PF KA G  A+ Y+G
Sbjct  125  GSLCLMNQDKVLMESWYNLKDAVLEGGI-PFNKAYGMTAFEYHG  167



>dbj|BAC78827.1| caffeic acid O-methyltransferase [Rosa chinensis var. spontanea]
Length=365

 Score = 78.2 bits (191),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 53/164 (32%), Positives = 88/164 (54%), Gaps = 6/164 (4%)
 Frame = +1

Query  67   EAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSS  246
            E   + ++ + + A L  M+LA+   +PM L A + L++ + + + G  A LS ++ L+S
Sbjct  6    ETQMTPTQVSDEEANLFAMQLASASVLPMVLKAAIELDLLEIMAKAGPGAFLSPND-LAS  64

Query  247  VLPSGGGDAQ-NLQRILRMLTSYGVFREHINA---DASERRYSLGEVGKTLVTDKDGLSY  414
             LP+   +A   L R+LR+L SY +    +        ER Y LG V K L  ++DG+S 
Sbjct  65   QLPTKNPEAPVMLDRMLRLLASYSILTYSLRTLPDGKVERLYGLGPVCKFLTKNEDGVSI  124

Query  415  GAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
             A  L +    L+++W  + +AV+D    PF KA G  A+ Y+G
Sbjct  125  AALCLMNQDKVLVESWYHLKDAVLDGGI-PFNKAYGMTAFDYHG  167



>ref|XP_008376825.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Malus domestica]
Length=365

 Score = 78.2 bits (191),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 57/169 (34%), Positives = 87/169 (51%), Gaps = 13/169 (8%)
 Frame = +1

Query  73   MGSESES-------AQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSAS  231
            MGS  E+         K   L  M+LAN   +PM L   + L++ + + + G  A +S++
Sbjct  1    MGSTGETQMPPTQVTDKETNLFAMQLANAPVLPMVLKTALELDLLEIMVKAGPGAFVSSA  60

Query  232  EILSSVLPSGGGDAQ-NLQRILRMLTSYGVFREHINA--DAS-ERRYSLGEVGKTLVTDK  399
            + LSS LP+   DA   L R+LR+L SY +    +    D + ER Y LG V K L  ++
Sbjct  61   D-LSSQLPTKNPDAPVMLDRMLRLLASYSILTYSLRTLPDGNVERLYGLGPVCKFLTKNE  119

Query  400  DGLSYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
            DG+S     L      LM++W  + +AV++    PF KA G  A+ Y+G
Sbjct  120  DGVSIAPLCLMSQDKVLMESWYHLKDAVLEGGI-PFNKAYGMTAFEYHG  167



>gb|KJB23956.1| hypothetical protein B456_004G125600 [Gossypium raimondii]
Length=251

 Score = 76.6 bits (187),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 51/164 (31%), Positives = 86/164 (52%), Gaps = 6/164 (4%)
 Frame = +1

Query  67   EAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSS  246
            E   + ++ + + A L  M+L +   +PM L + + L++ + + + G  A LS  E L+S
Sbjct  6    ETQMTPTQVSDEEANLFAMQLTSASVLPMVLKSAIELDLLEIMAKAGPGAFLSPKE-LAS  64

Query  247  VLPSGGGDAQ-NLQRILRMLTSYGVFREHINA---DASERRYSLGEVGKTLVTDKDGLSY  414
             LP+   DA   L RILR+L +Y +    +        ER Y LG V K +  ++DG++ 
Sbjct  65   QLPTSNPDAPVMLDRILRLLATYSILTCSLRTLPDGKVERLYGLGPVCKFVTKNEDGVTL  124

Query  415  GAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
             A  L +    LM++W  + +AV++    PF KA G  A+ Y+G
Sbjct  125  SALSLMNQDKVLMESWYYLKDAVLEGGI-PFNKAYGMTAFEYHG  167



>dbj|BAO79382.1| hypothetical plant O-methyltransferase [Anthriscus sylvestris]
Length=365

 Score = 78.2 bits (191),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 52/157 (33%), Positives = 84/157 (54%), Gaps = 6/157 (4%)
 Frame = +1

Query  88   ESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGG  267
            +  ++ A +  M+LA+   +PM L + + L++ ++I Q G  A +S +E L++ LPS   
Sbjct  15   DDEEEEACMFAMQLASASVLPMVLKSAIELDLLESIAQAGPGAYVSPAE-LAAKLPSSQP  73

Query  268  DAQ-NLQRILRMLTSYGVFR---EHINADASERRYSLGEVGKTLVTDKDGLSYGAYVLQH  435
            D    L RILR+L SY V +     +     ER Y+L  V K L  + DG+S    +L +
Sbjct  74   DTPVMLDRILRLLASYSVLKCKLRDLPQGGVERLYALAPVCKFLTKNSDGVSMAPLLLMN  133

Query  436  HQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
                LM++W  + + V+D    PF KA G  A+ Y+G
Sbjct  134  QDKILMESWYHLKDTVLDGGI-PFNKAYGMTAFEYHG  169



>gb|KHN23296.1| Caffeic acid 3-O-methyltransferase [Glycine soja]
Length=365

 Score = 77.8 bits (190),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 58/170 (34%), Positives = 90/170 (53%), Gaps = 10/170 (6%)
 Frame = +1

Query  49   TGKKEIEAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSA  228
            TG+ +I    + +  + + A L  M+LA+   +PM L + + L++ + I + G    LS 
Sbjct  4    TGETQI----TPTHVSDEEANLFAMQLASASVLPMILKSALELDLLEIIAKAGPGVHLSP  59

Query  229  SEILSSVLPSGGGDAQ-NLQRILRMLTSYGV--FREHINADAS-ERRYSLGEVGKTLVTD  396
            ++I SS LP+   DA   L RILR+L  Y +  F      D   ER Y L  V K LV +
Sbjct  60   TDI-SSQLPTQNPDAPVMLDRILRLLACYNILSFSLRTLPDGKVERLYGLAPVAKYLVKN  118

Query  397  KDGLSYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
            +DG+S  A  L +    LM++W  + +AV++    PF KA G  A+ Y+G
Sbjct  119  EDGVSIAALNLMNQDKVLMESWYYLKDAVLEGGI-PFNKAYGMTAFEYHG  167



>ref|NP_001242325.1| uncharacterized protein LOC100805999 [Glycine max]
 gb|ACU21012.1| unknown [Glycine max]
Length=365

 Score = 77.8 bits (190),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 58/170 (34%), Positives = 90/170 (53%), Gaps = 10/170 (6%)
 Frame = +1

Query  49   TGKKEIEAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSA  228
            TG+ +I    + +  + + A L  M+LA+   +PM L + + L++ + I + G    LS 
Sbjct  4    TGETQI----TPTHVSDEEANLFAMQLASASVLPMILKSALELDLLEIIAKAGPGVHLSP  59

Query  229  SEILSSVLPSGGGDAQ-NLQRILRMLTSYGV--FREHINADAS-ERRYSLGEVGKTLVTD  396
            ++I SS LP+   DA   L RILR+L  Y +  F      D   ER Y L  V K LV +
Sbjct  60   TDI-SSQLPTQNPDAPVMLDRILRLLACYNILSFSLRTLPDGKVERLYGLAPVAKYLVKN  118

Query  397  KDGLSYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
            +DG+S  A  L +    LM++W  + +AV++    PF KA G  A+ Y+G
Sbjct  119  EDGVSIAALNLMNQDKVLMESWYYLKDAVLEGGI-PFNKAYGMTAFEYHG  167



>ref|XP_006478241.1| PREDICTED: caffeic acid 3-O-methyltransferase 1-like [Citrus 
sinensis]
Length=432

 Score = 78.6 bits (192),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 45/134 (34%), Positives = 75/134 (56%), Gaps = 3/134 (2%)
 Frame = +1

Query  151  MSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA-QNLQRILRMLTSYGVFRE  327
            M++ AV++L + + I + G  A LSASEI + +  +   DA   L RILR+L SYG+ + 
Sbjct  104  MTMKAVIKLGLFEIIAKAGPGAKLSASEIAAQLPATKNKDAPMMLDRILRLLASYGIVQC  163

Query  328  HI-NADASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQDALMKAWPLVHEAVVDSSSEP  504
             + + D S R Y L +V K  V+++DG+S G  +      A + +W  + E +++    P
Sbjct  164  SLDDVDGSHRLYGLNDVSKYFVSNQDGVSLGPVLALIQDKAFLDSWSQLKETIIEGGV-P  222

Query  505  FVKANGEPAYSYYG  546
            F + +G  A+ Y G
Sbjct  223  FDRVHGTHAFEYLG  236



>gb|AHM25237.1| noraucuparin O-methyltransferase [Sorbus aucuparia]
Length=365

 Score = 77.8 bits (190),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 53/165 (32%), Positives = 88/165 (53%), Gaps = 6/165 (4%)
 Frame = +1

Query  64   IEAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILS  243
            +E   +  + + + A L  M+LA+   +PM L A + L++ + + + G  A +S ++ L+
Sbjct  5    VETQMTPIQVSDEEANLFAMQLASGSILPMVLKAAIELDLLEVMAKAGPGAFVSPAD-LA  63

Query  244  SVLPSGGGDAQ-NLQRILRMLTSYGVFREHINA---DASERRYSLGEVGKTLVTDKDGLS  411
            S LP+   DA   L R+LR+L SY +    +        ER Y LG V K L  ++DG S
Sbjct  64   SQLPTKNPDAPVMLDRMLRLLASYSILTYSLRTLPDGKVERLYGLGPVCKFLTKNEDGAS  123

Query  412  YGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
             G+  L +    LM++W  + +AV++    PF KA G  A+ Y+G
Sbjct  124  IGSLCLMNQDKVLMESWYHLKDAVLEGGI-PFNKAYGMTAFEYHG  167



>ref|XP_008234634.1| PREDICTED: caffeic acid 3-O-methyltransferase [Prunus mume]
Length=365

 Score = 77.8 bits (190),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 52/165 (32%), Positives = 88/165 (53%), Gaps = 6/165 (4%)
 Frame = +1

Query  64   IEAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILS  243
            +E   + ++ + + A L  M+LA+   +PM L A + L++ + + + G    LS ++I +
Sbjct  5    VETQMTPTQVSDEEANLFAMQLASASVLPMVLKAAIELDLLEIMAKAGPGVFLSPADI-A  63

Query  244  SVLPSGGGDAQ-NLQRILRMLTSYGVFREHINADAS---ERRYSLGEVGKTLVTDKDGLS  411
            S LP+   DA   L R+LR+L SY +    +   A    ER Y LG V K L  ++DG+S
Sbjct  64   SQLPTKNPDAPVMLDRMLRLLASYSILTYSLRTLADGKVERLYGLGPVCKFLTKNEDGVS  123

Query  412  YGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
                 L +    L+++W  + +AV++    PF KA G  A+ Y+G
Sbjct  124  IAPLCLMNQDKVLVESWYHLKDAVLEGGI-PFNKAYGMTAFEYHG  167



>ref|XP_011075886.1| PREDICTED: LOW QUALITY PROTEIN: caffeic acid 3-O-methyltransferase 
1-like [Sesamum indicum]
Length=370

 Score = 77.8 bits (190),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 53/160 (33%), Positives = 87/160 (54%), Gaps = 6/160 (4%)
 Frame = +1

Query  79   SESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPS  258
            S  +S+++ + L  M+LA+   +PM L + + L++ + I + G  A +S +E L++ LP+
Sbjct  11   STIDSSEEESCLFAMQLASFSVLPMVLKSAIELDLLELIKKAGPGAFVSPAE-LAAQLPT  69

Query  259  GGGDAQ-NLQRILRMLTSYGVFR---EHINADASERRYSLGEVGKTLVTDKDGLSYGAYV  426
               +A   L RILR+L SY V     + +     ER Y L  V K L  + DG+S    +
Sbjct  70   SNPEAHVMLDRILRLLASYSVVNCSLKKLPDGGVERLYGLAPVCKFLTKNDDGVSMAPLL  129

Query  427  LQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
            L +    LM++W  + +AV+D    PF KA G  A+ Y+G
Sbjct  130  LMNQDKILMESWYHLKDAVLDGGI-PFNKAYGMTAFDYHG  168



>gb|AEV93478.1| caffeic acid O-methyltransferase [Caragana korshinskii]
Length=365

 Score = 77.8 bits (190),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 55/169 (33%), Positives = 89/169 (53%), Gaps = 13/169 (8%)
 Frame = +1

Query  73   MGSESES-------AQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSAS  231
            MGS  E+       + + A L  M+LA+   +PM L + + L++ + I + G  A LS +
Sbjct  1    MGSAGETQITPTHVSDEEANLFAMQLASASVLPMVLKSALELDLLEIIAKAGPGAHLSPN  60

Query  232  EILSSVLPSGGGDAQ-NLQRILRMLTSYGVFR---EHINADASERRYSLGEVGKTLVTDK  399
            +I +S LP+   DA   L R+LR+L  Y +F      +     +R Y L  V K L+ ++
Sbjct  61   DI-ASQLPTNNPDAPIMLDRMLRLLACYNIFTCSLRTLQDGKVQRLYGLAPVAKYLIKNE  119

Query  400  DGLSYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
            DG+S  A  L +    LM++W  + +AV++    PF KA G  A+ Y+G
Sbjct  120  DGVSLSALNLMNQDKVLMESWYYLKDAVLEGGI-PFNKAYGMTAFEYHG  167



>ref|XP_008381500.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Malus domestica]
Length=433

 Score = 78.6 bits (192),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 58/172 (34%), Positives = 88/172 (51%), Gaps = 13/172 (8%)
 Frame = +1

Query  64   IEAMGSESES-------AQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPL  222
            I+ MGS  E+       + + A L  M+LA+   +PM L A + L++ + + + G  A +
Sbjct  66   IQKMGSTPETQMTPTQVSDEEANLFAMQLASASVLPMVLKAAIELDLLEIMAKAGPGAFV  125

Query  223  SASEILSSVLPSGGGDAQ-NLQRILRMLTSYGVFREHINA---DASERRYSLGEVGKTLV  390
            S ++ LSS LP+   DA   L R+LR L SY +    +        ER Y LG V K L 
Sbjct  126  SPAD-LSSQLPTKNPDAPVMLDRMLRXLASYSILTYSLRTLPDGKVERLYGLGPVCKFLT  184

Query  391  TDKDGLSYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
               DG S G+  L +    LM++W  + +AV++    PF KA G  A+ Y+G
Sbjct  185  KXXDGASIGSLCLMNQDKVLMESWYNLKDAVLEGGI-PFNKAYGMTAFEYHG  235



>ref|XP_010537046.1| PREDICTED: flavone 3'-O-methyltransferase 1 [Tarenaya hassleriana]
Length=366

 Score = 77.8 bits (190),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 58/170 (34%), Positives = 92/170 (54%), Gaps = 14/170 (8%)
 Frame = +1

Query  73   MGSESES-------AQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQ-GGSNAPLSA  228
            MGS +E+       +   A L  M+LA+   +PM L + + L++ + + +  G +A +S 
Sbjct  1    MGSTAETQITPNQVSDDEANLFAMQLASASVLPMVLKSAIELDLLEIMAKNAGFSAQMSP  60

Query  229  SEILSSVLPSGGGDAQ-NLQRILRMLTSYGVFREHINADAS---ERRYSLGEVGKTLVTD  396
            S+I +S LP+   DA   L RILR+L SY +    +   +S   ER Y LG V K L  +
Sbjct  61   SDI-ASHLPTKNPDAPVMLDRILRLLASYSILTCSVRTLSSGGVERLYGLGPVCKYLTKN  119

Query  397  KDGLSYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
            +DG+S  A  L +    LM++W  + +AV++    PF KA G  A+ Y+G
Sbjct  120  EDGVSIAALCLMNQDKVLMESWYHLKDAVLEGGI-PFNKAYGMTAFEYHG  168



>ref|XP_008376828.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Malus domestica]
Length=365

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 57/169 (34%), Positives = 87/169 (51%), Gaps = 13/169 (8%)
 Frame = +1

Query  73   MGSESES-------AQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSAS  231
            MGS  E+         K   L  M+LAN   +PM L   + L++ + + + G  A +S++
Sbjct  1    MGSTGETQMPPTQVTDKETNLFAMQLANAPVLPMVLKTALELDLLEIMVKAGPGAFVSSA  60

Query  232  EILSSVLPSGGGDAQ-NLQRILRMLTSYGVFREHINA--DAS-ERRYSLGEVGKTLVTDK  399
            + LSS LP+   DA   L R+LR+L SY +    +    D + ER Y LG V K L  ++
Sbjct  61   D-LSSQLPTKNPDAPVMLDRMLRLLASYSILTYSLRTLPDGNVERLYGLGPVCKFLTKNE  119

Query  400  DGLSYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
            DG+S     L      LM++W  + +AV++    PF KA G  A+ Y+G
Sbjct  120  DGVSIAPLCLMSQDKVLMESWYHLKDAVLEGGI-PFNKAYGMSAFEYHG  167



>ref|XP_003526767.1| PREDICTED: caffeic acid 3-O-methyltransferase isoform 1 [Glycine 
max]
 gb|KHN23294.1| Caffeic acid 3-O-methyltransferase [Glycine soja]
Length=365

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 59/169 (35%), Positives = 88/169 (52%), Gaps = 13/169 (8%)
 Frame = +1

Query  73   MGSESES-------AQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSAS  231
            MGS +E+       + + A L  M+LA+   +PM L + + L++ + I + G    LS +
Sbjct  1    MGSAAETQITPTHVSDEEANLFAMQLASASVLPMVLKSALELDLLEIIAKAGPGVHLSPT  60

Query  232  EILSSVLPSGGGDAQ-NLQRILRMLTSYGV--FREHINADAS-ERRYSLGEVGKTLVTDK  399
            +I SS LP+   DA   L RILR+L  Y +  F      D   ER Y L  V K LV  +
Sbjct  61   DI-SSQLPTQNPDAPVMLDRILRLLACYNILSFSLRTLPDGKVERLYGLAPVAKYLVKTE  119

Query  400  DGLSYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
            DG+S  A  L +    LM++W  + +AV++    PF KA G  A+ Y+G
Sbjct  120  DGVSIAALNLMNQDKVLMESWYYLKDAVLEGGI-PFNKAYGMTAFEYHG  167



>gb|KJB23957.1| hypothetical protein B456_004G125600 [Gossypium raimondii]
Length=290

 Score = 76.6 bits (187),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 51/164 (31%), Positives = 86/164 (52%), Gaps = 6/164 (4%)
 Frame = +1

Query  67   EAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSS  246
            E   + ++ + + A L  M+L +   +PM L + + L++ + + + G  A LS  E L+S
Sbjct  6    ETQMTPTQVSDEEANLFAMQLTSASVLPMVLKSAIELDLLEIMAKAGPGAFLSPKE-LAS  64

Query  247  VLPSGGGDAQ-NLQRILRMLTSYGVFREHINA---DASERRYSLGEVGKTLVTDKDGLSY  414
             LP+   DA   L RILR+L +Y +    +        ER Y LG V K +  ++DG++ 
Sbjct  65   QLPTSNPDAPVMLDRILRLLATYSILTCSLRTLPDGKVERLYGLGPVCKFVTKNEDGVTL  124

Query  415  GAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
             A  L +    LM++W  + +AV++    PF KA G  A+ Y+G
Sbjct  125  SALSLMNQDKVLMESWYYLKDAVLEGGI-PFNKAYGMTAFEYHG  167



>ref|XP_004235028.1| PREDICTED: caffeic acid 3-O-methyltransferase [Solanum lycopersicum]
Length=357

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 57/163 (35%), Positives = 84/163 (52%), Gaps = 7/163 (4%)
 Frame = +1

Query  73   MGSES-ESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSV  249
            MGS S    +  A L  M+LA+   +PM L + V L + + + + G  A +S +E L+S 
Sbjct  1    MGSTSLTQTEDEAFLFAMQLASASVLPMVLKSAVELELLELMAKAGPGASISPAE-LASQ  59

Query  250  LPSGGGDAQ-NLQRILRMLTSYGVFREHINADAS---ERRYSLGEVGKTLVTDKDGLSYG  417
            LP    DA   L R+LR+L +Y V    +        ER YSL  V K L  + DG+S  
Sbjct  60   LPCKNPDAPVMLDRMLRLLAAYSVLNCTLRTLPDGRVERLYSLAPVCKFLTKNADGVSVA  119

Query  418  AYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
              +L +    LM++W  + +AV+D    PF KA G  A+ Y+G
Sbjct  120  PLLLMNQDKVLMQSWYHLKDAVLDGGI-PFNKAYGMTAFEYHG  161



>gb|KJB23955.1| hypothetical protein B456_004G125600 [Gossypium raimondii]
Length=269

 Score = 76.3 bits (186),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 51/164 (31%), Positives = 86/164 (52%), Gaps = 6/164 (4%)
 Frame = +1

Query  67   EAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSS  246
            E   + ++ + + A L  M+L +   +PM L + + L++ + + + G  A LS  E L+S
Sbjct  6    ETQMTPTQVSDEEANLFAMQLTSASVLPMVLKSAIELDLLEIMAKAGPGAFLSPKE-LAS  64

Query  247  VLPSGGGDAQ-NLQRILRMLTSYGVFREHINA---DASERRYSLGEVGKTLVTDKDGLSY  414
             LP+   DA   L RILR+L +Y +    +        ER Y LG V K +  ++DG++ 
Sbjct  65   QLPTSNPDAPVMLDRILRLLATYSILTCSLRTLPDGKVERLYGLGPVCKFVTKNEDGVTL  124

Query  415  GAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
             A  L +    LM++W  + +AV++    PF KA G  A+ Y+G
Sbjct  125  SALSLMNQDKVLMESWYYLKDAVLEGGI-PFNKAYGMTAFEYHG  167



>ref|XP_009418616.1| PREDICTED: tricetin 3',4',5'-O-trimethyltransferase-like [Musa 
acuminata subsp. malaccensis]
Length=362

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 46/152 (30%), Positives = 81/152 (53%), Gaps = 4/152 (3%)
 Frame = +1

Query  100  KNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQN  279
            ++A +  M+LA+   +PM+L A + L++ + + + G  A LS +++++ +       A  
Sbjct  16   EDACMYAMQLASASILPMTLKAAIELDLLEILVRAGPGAQLSPADVVAQLPTENPQAAVM  75

Query  280  LQRILRMLTSYGVFREHINADAS---ERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQDAL  450
            + R+LR+L +Y V    +  DA     R+Y      K L  ++DG+S  A  L +    L
Sbjct  76   VDRMLRLLAAYNVVSCTVGTDADGKPSRKYGAAPACKYLTKNEDGVSMAALTLMNQDKVL  135

Query  451  MKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
            M++W  + +AV+D    PF KA G  A+ YYG
Sbjct  136  MESWYYLKDAVLDGGI-PFNKAYGMSAFEYYG  166



>gb|AAY86361.1| caffeic acid O-methyltransferase [Acacia auriculiformis x Acacia 
mangium]
 gb|ADQ53456.1| caffeic acid O-methyltransferase [Acacia auriculiformis x Acacia 
mangium]
Length=365

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 56/169 (33%), Positives = 87/169 (51%), Gaps = 13/169 (8%)
 Frame = +1

Query  73   MGSESESA-------QKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSAS  231
            MGS  E+         + A L  M+LA+   +PM L + + L++ + I + G NA LS S
Sbjct  1    MGSAGETQITPTHVNDEEANLFAMQLASASVLPMILKSALELDLLEIIAKAGPNAQLSPS  60

Query  232  EILSSVLPSGGGDAQ-NLQRILRMLTSYGVFREHINA---DASERRYSLGEVGKTLVTDK  399
            +I +S LP+   DA   L R++R+L  Y V    +        ER Y L  V K LV ++
Sbjct  61   DI-ASQLPTKNPDAAVMLDRMMRLLACYNVLSSSLRTLPDGKIERLYGLAPVAKYLVKNE  119

Query  400  DGLSYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
            DG+S     L +    LM++W  + E V++    PF KA+G  ++ Y+G
Sbjct  120  DGVSIAPLNLMNQDKVLMESWYYLTETVLEGGI-PFNKAHGMTSFEYHG  167



>gb|KDP24164.1| hypothetical protein JCGZ_25821 [Jatropha curcas]
Length=360

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 43/134 (32%), Positives = 71/134 (53%), Gaps = 1/134 (1%)
 Frame = +1

Query  139  ISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQNLQRILRMLTSYGV  318
            I +PM +   + L + D I + G +A LSAS+I + +  S       L RILR+L S  V
Sbjct  29   IVLPMVMQTAIELGIFDIIAKAGPDAKLSASDIAAQLSASNPSAPSMLDRILRLLASNSV  88

Query  319  FREHINADASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQDALMKAWPLVHEAVVDSSS  498
                + ++  +R Y L    K  V +KDG+S G +++ +     M++WP V +A+++   
Sbjct  89   LGCSLASNTQQRLYHLISASKYFVKNKDGVSLGPFMILNQDKVYMESWPSVKDAILEGGI  148

Query  499  EPFVKANGEPAYSY  540
             PF K +G  A+ Y
Sbjct  149  -PFNKVHGMHAFDY  161



>gb|AEO14870.1| caffeic acid O-methyltransferase [Salvia miltiorrhiza]
Length=364

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 52/169 (31%), Positives = 85/169 (50%), Gaps = 12/169 (7%)
 Frame = +1

Query  73   MGSESESAQKNA--------RLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSA  228
            MGS +++ Q  A         L  M+LA+   +PM L + + L++ + I + G+ A +S 
Sbjct  1    MGSTTKNPQTAAVNSDEEESFLFAMQLASASVLPMVLKSAIELDLLEIIKKAGAGAFVSP  60

Query  229  SEILSSVLPSGGGDAQNLQRILRMLTSYGVFREHINA---DASERRYSLGEVGKTLVTDK  399
            +E+ + +  +  G A  L RILR+L SY +    +        +R Y L  V K L  + 
Sbjct  61   AEVAAQLPTTNEGAAVMLDRILRLLASYAILECRLKTLPDGGVQRLYGLAPVCKFLTKND  120

Query  400  DGLSYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
            DG+S     L +    LM++W  + +AV+D    PF KA G  A+ Y+G
Sbjct  121  DGVSVAPLALMNQDKVLMESWYHLKDAVLDGEI-PFNKAYGMSAFEYHG  168



>ref|XP_002515087.1| o-methyltransferase, putative [Ricinus communis]
 gb|EEF47071.1| o-methyltransferase, putative [Ricinus communis]
Length=359

 Score = 77.0 bits (188),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 50/143 (35%), Positives = 77/143 (54%), Gaps = 4/143 (3%)
 Frame = +1

Query  121  MELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQ-NLQRILR  297
            M+LA   ++PMSL+A + L V + I + G  + LSASEI + +      DA   L R+LR
Sbjct  24   MQLALGSALPMSLHAAIELGVFEIIAKAGPESKLSASEITAEIPDVQNPDAAITLDRVLR  83

Query  298  MLTSYGVFREHINADASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQDALMKAWPLVHE  477
            +L S+ V    +N    ER YSL  V K  V ++DG+S G ++        + +W  + +
Sbjct  84   LLASHNVLGCSLNG--LERLYSLNPVSKYFVPNQDGISLGPFMALIQDKVFLDSWTKLKD  141

Query  478  AVVDSSSEPFVKANGEPAYSYYG  546
            AV++  S PF K +G   + Y G
Sbjct  142  AVLEGGS-PFNKFHGTHCFGYSG  163



>ref|XP_006478243.1| PREDICTED: caffeic acid 3-O-methyltransferase 1-like, partial 
[Citrus sinensis]
Length=214

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 44/134 (33%), Positives = 73/134 (54%), Gaps = 3/134 (2%)
 Frame = +1

Query  151  MSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAQN-LQRILRMLTSYGVFRE  327
            M++ AV++L + + I + G  A LSASEI + +  +   DA   L RIL +L SYG+   
Sbjct  51   MTMKAVIKLGLLEIIAKAGPGAKLSASEIAAQLPATKNKDAPTMLDRILGLLASYGIVEC  110

Query  328  HI-NADASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQDALMKAWPLVHEAVVDSSSEP  504
             + + D S R Y L +V K  V ++DG+S G  +     +A + +W  + E +++    P
Sbjct  111  SLDDVDGSHRLYGLNDVSKYFVPNQDGVSLGPVLALIQDEAFLDSWSQLKETIIEGGV-P  169

Query  505  FVKANGEPAYSYYG  546
            F + +G  A+ Y G
Sbjct  170  FDRVHGTNAFEYLG  183



>gb|ACY06328.1| S-adenosyl-L-methionine: caffeic acid 3-0-methyltransferase [Medicago 
sativa]
Length=365

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 56/169 (33%), Positives = 87/169 (51%), Gaps = 13/169 (8%)
 Frame = +1

Query  73   MGSESES-------AQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSAS  231
            MGS  E+       + + A L  M+LA+   +PM L + + L++ + I + G  A +S  
Sbjct  1    MGSTGETQITPTHISDEEANLFAMQLASASVLPMILKSALELDLLEIIAKAGPGAQISPI  60

Query  232  EILSSVLPSGGGDAQ-NLQRILRMLTSYGVFREHINADAS---ERRYSLGEVGKTLVTDK  399
            EI +S LP+   DA   L R+LR+L  Y +    +        +R Y L  V K LV ++
Sbjct  61   EI-ASQLPTTNPDAPVMLDRMLRLLACYNILTCSVRTQQDGKVQRLYGLATVAKYLVKNE  119

Query  400  DGLSYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
            DG+S  A  L +    LM++W  + +AV+D    PF KA G  A+ Y+G
Sbjct  120  DGVSISALNLMNQDKVLMESWYHLKDAVLDGGI-PFNKAYGMTAFEYHG  167



>gb|ADK97702.1| putative caffeic acid O-methyltransferase [Citrus aurantium]
Length=366

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 53/169 (31%), Positives = 87/169 (51%), Gaps = 6/169 (4%)
 Frame = +1

Query  52   GKKEIEAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSAS  231
            G    E   S ++ + + A L  M+L +   +PM L + + L++ + I + G +A +S  
Sbjct  2    GSTSSETQISPAQGSDEEANLLAMQLTSASVLPMVLKSAIELDLLEIIAKAGPDAFMSPK  61

Query  232  EILSSVLPSGGGDAQ-NLQRILRMLTSYGVFR---EHINADASERRYSLGEVGKTLVTDK  399
            +I +S LP+   DA   L RILR+L SY V      ++     ER Y L  V K L  ++
Sbjct  62   DI-ASQLPTKNPDAHIVLDRILRLLASYSVLNCSLRNLPDGKVERLYGLAPVCKFLTKNE  120

Query  400  DGLSYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
            DG++     L +    LM++W  + +AV++    PF KA G  A+ Y+G
Sbjct  121  DGVTLSDLCLMNQDKVLMESWYYLKDAVLEGGI-PFNKAYGMNAFDYHG  168



>gb|AEO14871.1| caffeic acid O-methyltransferase [Salvia miltiorrhiza]
Length=364

 Score = 77.0 bits (188),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 52/169 (31%), Positives = 85/169 (50%), Gaps = 12/169 (7%)
 Frame = +1

Query  73   MGSESESAQKNA--------RLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSA  228
            MGS +++ Q  A         L  M+LA+   +PM L + + L++ + I + G+ A +S 
Sbjct  1    MGSTTKNPQTAAVNSDEEESFLFAMQLASASVLPMVLKSAIELDLLEIIKKAGAGAFVSP  60

Query  229  SEILSSVLPSGGGDAQNLQRILRMLTSYGVFREHINA---DASERRYSLGEVGKTLVTDK  399
            +E+ + +  +  G A  L RILR+L SY +    +        +R Y L  V K L  + 
Sbjct  61   AEVAAQLPTTNEGAAVMLDRILRLLASYAILECRLKTLPDGGVQRLYGLAPVCKFLTKND  120

Query  400  DGLSYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
            DG+S     L +    LM++W  + +AV+D    PF KA G  A+ Y+G
Sbjct  121  DGVSVAPLALMNQDKVLMESWYHLKDAVLDGEI-PFNKAYGMSAFEYHG  168



>gb|ABG27066.1| caffeic acid O-methyltransferase [Boehmeria nivea]
Length=365

 Score = 77.0 bits (188),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 50/163 (31%), Positives = 81/163 (50%), Gaps = 4/163 (2%)
 Frame = +1

Query  67   EAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSS  246
            E   + ++ + + A L  M+LA+   +PM L   + L++ + I + G  A LS +EI + 
Sbjct  6    ETQMTPTQVSDEEANLFAMQLASASVLPMVLKTAIELDLLEIIAKAGPGAWLSPAEIAAQ  65

Query  247  VLPSGGGDAQNLQRILRMLTSYGVFREHINA---DASERRYSLGEVGKTLVTDKDGLSYG  417
            +  +       L RILR+L  Y V    +      A+ER Y L  V K L  + DG+S  
Sbjct  66   LPTTNPAAPVMLDRILRLLACYSVVACQLRTLPGGAAERLYGLAPVCKFLTKNNDGVSIS  125

Query  418  AYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
               L +    LM++W  + +AV++    PF KA G  A+ Y+G
Sbjct  126  PLCLMNQDKVLMESWYYLKDAVLEGGI-PFNKAYGMTAFEYHG  167



>ref|XP_003602396.1| Caffeic acid O-methyltransferase [Medicago truncatula]
 gb|AES72647.1| caffeic acid O-methyltransferase [Medicago truncatula]
Length=365

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 56/169 (33%), Positives = 87/169 (51%), Gaps = 13/169 (8%)
 Frame = +1

Query  73   MGSESES-------AQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSAS  231
            MGS  E+       + + A L  M+LA+   +PM L + + L++ + I + G  A +S  
Sbjct  1    MGSTGETQITPTHISDEEANLFAMQLASASVLPMVLKSALELDLLEIIAKAGPGAQISPI  60

Query  232  EILSSVLPSGGGDAQ-NLQRILRMLTSYGVFREHINADAS---ERRYSLGEVGKTLVTDK  399
            EI +S LP+   +A   L RILR+L  Y +    +        +R Y L  V K LV ++
Sbjct  61   EI-ASQLPTTNPEAPVMLDRILRLLACYNILTCSVRTQQDGKVQRLYGLATVAKYLVKNE  119

Query  400  DGLSYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
            DG+S  A  L +    LM++W  + +AV+D    PF KA G  A+ Y+G
Sbjct  120  DGVSISALNLMNQDKVLMESWYHLKDAVLDGGI-PFNKAYGMTAFEYHG  167



>ref|XP_007039215.1| Caffeic acid 3-O-methyltransferase 1 [Theobroma cacao]
 gb|EOY23716.1| Caffeic acid 3-O-methyltransferase 1 [Theobroma cacao]
Length=365

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 53/164 (32%), Positives = 87/164 (53%), Gaps = 6/164 (4%)
 Frame = +1

Query  67   EAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSS  246
            E   + ++ + +   L  M+L +   +PM L + + L++ + + + G  A LS +E L+S
Sbjct  6    ETQMTPNQVSDEELNLFAMQLTSASVLPMVLTSAIELDLFEIMAKAGPGAFLSPNE-LAS  64

Query  247  VLPSGGGDAQ-NLQRILRMLTSYGVFREHINA---DASERRYSLGEVGKTLVTDKDGLSY  414
             LP+   DA   L RILR+L SY V    +        ER YSLG V K L  ++DG++ 
Sbjct  65   QLPTKNPDAPVMLDRILRLLASYSVLNCSLRTLPDGKVERLYSLGPVCKFLTKNEDGVTL  124

Query  415  GAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
             +  L +    LM++W  + +AV++    PF KA G  A+ Y+G
Sbjct  125  SSLSLMNQDKVLMESWYYLKDAVLEGGI-PFNKAYGMTAFEYHG  167



>gb|ABI54117.1| caffeic acid O-methyltransferase [Malus domestica]
Length=365

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 54/164 (33%), Positives = 86/164 (52%), Gaps = 6/164 (4%)
 Frame = +1

Query  67   EAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSS  246
            E   + ++ + + A L  M+LA+   +PM L A + L++ + + + G  A +S ++ LSS
Sbjct  6    ETQMTPTQVSDEEANLFAMQLASASVLPMVLKAAIELDLLEIMAKAGPGAFVSPAD-LSS  64

Query  247  VLPSGGGDAQ-NLQRILRMLTSYGVFREHINA---DASERRYSLGEVGKTLVTDKDGLSY  414
             LP+   DA   L R+LR+L SY +    +        ER Y LG V K L    DG S 
Sbjct  65   QLPTKNPDAPVMLDRMLRVLASYSILTYSLRTLPDGKVERLYGLGPVCKFLTKSVDGASI  124

Query  415  GAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
            G+  L +    LM++W  + +AV++    PF KA G  A+ Y+G
Sbjct  125  GSLCLMNQDKVLMESWYNLKDAVLEGGI-PFNKAYGMTAFEYHG  167



>gb|AFK39235.1| unknown [Medicago truncatula]
Length=365

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 56/169 (33%), Positives = 87/169 (51%), Gaps = 13/169 (8%)
 Frame = +1

Query  73   MGSESES-------AQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSAS  231
            MGS  E+       + + A L  M+LA+   +PM L + + L++ + I + G  A +S  
Sbjct  1    MGSTGETQITPTHISDEEANLFAMQLASASVLPMVLKSALELDLLEIIAKAGPGAQISPI  60

Query  232  EILSSVLPSGGGDAQ-NLQRILRMLTSYGVFREHINADAS---ERRYSLGEVGKTLVTDK  399
            EI +S LP+   +A   L RILR+L  Y +    +        +R Y L  V K LV ++
Sbjct  61   EI-ASQLPTTNPEAPVMLDRILRLLACYNILTCSVRTQQDGKVQRLYGLATVAKYLVKNE  119

Query  400  DGLSYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
            DG+S  A  L +    LM++W  + +AV+D    PF KA G  A+ Y+G
Sbjct  120  DGVSISALNLMNQDKVLMESWYHLKDAVLDGGI-PFNKAYGMTAFEYHG  167



>pdb|4PGH|A Chain A, Caffeic Acid O-methyltransferase From Sorghum Bicolor
 pdb|4PGH|B Chain B, Caffeic Acid O-methyltransferase From Sorghum Bicolor
 pdb|4PGH|C Chain C, Caffeic Acid O-methyltransferase From Sorghum Bicolor
 pdb|4PGH|D Chain D, Caffeic Acid O-methyltransferase From Sorghum Bicolor
Length=358

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 52/155 (34%), Positives = 85/155 (55%), Gaps = 6/155 (4%)
 Frame = +1

Query  94   AQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILS--SVLPSGGG  267
            A + A +  M+LA+   +PM+L   + L + + + +    A L+A E+++   V P+   
Sbjct  8    ADEEACMYAMQLASSSILPMTLKNALELGLLEVLQKDAGKA-LAAEEVVARLPVAPTNPA  66

Query  268  DAQNLQRILRMLTSYGVFREHI-NADAS-ERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQ  441
             A  + R+LR+L SY V +  + + D   ERRYS   VGK L  ++DG+S  A  L +  
Sbjct  67   AADMVDRMLRLLASYDVVKCQMEDKDGKYERRYSAAPVGKWLTPNEDGVSMAALALMNQD  126

Query  442  DALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
              LM++W  + +AV+D    PF KA G  A+ Y+G
Sbjct  127  KVLMESWYYLKDAVLDGGI-PFNKAYGMTAFEYHG  160



>dbj|BAE94403.1| Caffeic acid 3-O-methyltransferase [Ipomoea nil]
Length=364

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 53/155 (34%), Positives = 83/155 (54%), Gaps = 6/155 (4%)
 Frame = +1

Query  94   AQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  273
            + + A L  M+LA+   +PM L + + L++ + I + G  A +S SE L++ LP+   DA
Sbjct  16   SDEEASLFAMQLASASVLPMVLKSAIELDLLELIAKAGPGAAVSPSE-LAAQLPTTNPDA  74

Query  274  Q-NLQRILRMLTSYGVFREHINADAS---ERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQ  441
               L RILR+L +Y V    +        ER YSL  V K L  + DG+S    +L +  
Sbjct  75   AVMLDRILRLLCTYSVLNCSLRTLPDGRVERLYSLAPVCKYLTKNGDGVSMAPLLLMNQD  134

Query  442  DALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
              LM++W  + +AV++    PF KA G  A+ Y+G
Sbjct  135  KVLMESWYHLKDAVLEGGI-PFNKAYGMTAFEYHG  168



>ref|NP_001240003.1| uncharacterized protein LOC100780100 [Glycine max]
 gb|ACU22737.1| unknown [Glycine max]
 gb|KHN19570.1| Caffeic acid 3-O-methyltransferase [Glycine soja]
Length=365

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 56/170 (33%), Positives = 89/170 (52%), Gaps = 10/170 (6%)
 Frame = +1

Query  49   TGKKEIEAMGSESESAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSA  228
            TG+ +I    + +  + + A L  M+LA+   +PM L + + L++ + I + G    LS 
Sbjct  4    TGETQI----TPTHVSDEEANLFAMQLASASVLPMVLKSALELDLLEIIAKAGPGVHLSP  59

Query  229  SEILSSVLPSGGGDAQ-NLQRILRMLTSYGVFREHINA---DASERRYSLGEVGKTLVTD  396
            S+I +S LP+   DA   L RILR+L  Y +    +        ER Y L  V K LV +
Sbjct  60   SDI-ASRLPTHNPDAPVMLDRILRLLACYNILSFSLRTLPHGKVERLYGLAPVAKYLVRN  118

Query  397  KDGLSYGAYVLQHHQDALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
            +DG+S  A  L +    LM++W  + +AV++    PF KA G  A+ Y+G
Sbjct  119  EDGVSIAALNLMNQDKILMESWYYLKDAVLEGGI-PFNKAYGMTAFEYHG  167



>sp|Q9XGV9.1|COMT2_OCIBA RecName: Full=Caffeic acid 3-O-methyltransferase 2; Short=CAOMT-2; 
Short=COMT-2; AltName: Full=S-adenosysl-L-methionine:caffeic 
acid 3-O-methyltransferase 2 [Ocimum basilicum]
 gb|AAD38190.1|AF154918_1 caffeic acid O-methyltransferase [Ocimum basilicum]
 gb|ADO16248.1| caffeic acid O-methyltransferase [Ocimum basilicum]
Length=361

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 48/155 (31%), Positives = 81/155 (52%), Gaps = 4/155 (3%)
 Frame = +1

Query  91   SAQKNARLTIMELANMISVPMSLNAVVRLNVADAIWQGGSNAPLSASEILSSVLPSGGGD  270
            S ++   L  M+LA+   +PM L + + L++ + I + G+ A +S +E+ + +L +    
Sbjct  12   SDEEENFLFAMQLASASVLPMVLKSAIELDLLELIKKAGAGAFVSPAELAAQLLTTNAEA  71

Query  271  AQNLQRILRMLTSYGVFREHINA---DASERRYSLGEVGKTLVTDKDGLSYGAYVLQHHQ  441
               L RILR+LTSY +    +        +R Y L  V K L  ++DG+S     L +  
Sbjct  72   HVMLDRILRLLTSYAILECRLKTLPDGGVQRLYGLAPVCKFLTKNEDGVSMAPLALMNQD  131

Query  442  DALMKAWPLVHEAVVDSSSEPFVKANGEPAYSYYG  546
              LM++W  + +AV+D    PF KA G  A+ Y+G
Sbjct  132  KVLMESWYHLKDAVLDGGI-PFNKAYGMTAFEYHG  165



Lambda      K        H        a         alpha
   0.315    0.130    0.365    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 592801777335