BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001N13

Length=582
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009760049.1|  PREDICTED: gamma-interferon-inducible lysoso...    231   2e-72   Nicotiana sylvestris
ref|XP_009760046.1|  PREDICTED: GILT-like protein F37H8.5 isoform X1    231   2e-72   Nicotiana sylvestris
ref|XP_009760047.1|  PREDICTED: GILT-like protein F37H8.5 isoform X2    226   2e-70   Nicotiana sylvestris
ref|XP_009590102.1|  PREDICTED: GILT-like protein F37H8.5 isoform X1    223   2e-69   Nicotiana tomentosiformis
ref|XP_009590105.1|  PREDICTED: gamma-interferon-inducible lysoso...    221   3e-68   Nicotiana tomentosiformis
ref|XP_009590103.1|  PREDICTED: GILT-like protein F37H8.5 isoform X2    221   3e-68   Nicotiana tomentosiformis
ref|XP_006344069.1|  PREDICTED: GILT-like protein F37H8.5-like          220   4e-68   Solanum tuberosum [potatoes]
ref|XP_004240417.1|  PREDICTED: GILT-like protein F37H8.5               219   1e-67   Solanum lycopersicum
ref|XP_002275283.1|  PREDICTED: gamma-interferon-inducible lysoso...    214   9e-66   Vitis vinifera
emb|CAN76152.1|  hypothetical protein VITISV_012674                     212   1e-64   Vitis vinifera
ref|XP_009369566.1|  PREDICTED: gamma-interferon-inducible lysoso...    208   2e-63   Pyrus x bretschneideri [bai li]
ref|XP_011089279.1|  PREDICTED: gamma-interferon-inducible lysoso...    208   2e-63   Sesamum indicum [beniseed]
ref|XP_008234879.1|  PREDICTED: gamma-interferon-inducible lysoso...    207   4e-63   
ref|XP_004294783.1|  PREDICTED: gamma-interferon-inducible lysoso...    207   7e-63   Fragaria vesca subsp. vesca
ref|XP_010043395.1|  PREDICTED: gamma-interferon-inducible lysoso...    204   1e-61   Eucalyptus grandis [rose gum]
ref|XP_003599338.1|  Gamma-interferon-inducible lysosomal thiol r...    203   2e-61   Medicago truncatula
gb|AFK44126.1|  unknown                                                 203   2e-61   Medicago truncatula
ref|XP_007016964.1|  Thioredoxin superfamily protein isoform 1          203   3e-61   
ref|XP_007016966.1|  Thioredoxin superfamily protein isoform 3          203   3e-61   
ref|XP_010685916.1|  PREDICTED: gamma-interferon-inducible lysoso...    201   1e-60   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006425132.1|  hypothetical protein CICLE_v10029177mg             199   3e-60   Citrus clementina [clementine]
gb|KDP45780.1|  hypothetical protein JCGZ_17387                         200   4e-60   Jatropha curcas
gb|KDO66987.1|  hypothetical protein CISIN_1g026069mg                   197   1e-59   Citrus sinensis [apfelsine]
ref|XP_004500307.1|  PREDICTED: gamma-interferon-inducible lysoso...    198   2e-59   
ref|XP_010685915.1|  PREDICTED: gamma-interferon-inducible lysoso...    197   2e-59   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007016965.1|  Thioredoxin superfamily protein isoform 2          196   4e-59   
gb|KDO66986.1|  hypothetical protein CISIN_1g026069mg                   196   5e-59   Citrus sinensis [apfelsine]
ref|XP_002313228.1|  hypothetical protein POPTR_0009s08000g             196   9e-59   Populus trichocarpa [western balsam poplar]
ref|XP_006488571.1|  PREDICTED: gamma-interferon-inducible lysoso...    196   1e-58   Citrus sinensis [apfelsine]
gb|KHG16010.1|  Gamma-interferon-inducible lysosomal thiol reductase    194   5e-58   Gossypium arboreum [tree cotton]
ref|XP_011003523.1|  PREDICTED: gamma-interferon-inducible lysoso...    194   5e-58   Populus euphratica
ref|XP_004240418.1|  PREDICTED: GILT-like protein F37H8.5               194   5e-58   Solanum lycopersicum
gb|KJB21243.1|  hypothetical protein B456_003G149000                    192   6e-58   Gossypium raimondii
gb|KDO66988.1|  hypothetical protein CISIN_1g026069mg                   191   1e-57   Citrus sinensis [apfelsine]
gb|KJB21241.1|  hypothetical protein B456_003G149000                    193   1e-57   Gossypium raimondii
ref|XP_010089536.1|  hypothetical protein L484_011700                   192   3e-57   Morus notabilis
ref|XP_010937929.1|  PREDICTED: gamma-interferon-inducible lysoso...    192   4e-57   Elaeis guineensis
gb|KCW85398.1|  hypothetical protein EUGRSUZ_B02223                     190   4e-57   Eucalyptus grandis [rose gum]
ref|XP_006344118.1|  PREDICTED: GILT-like protein F37H8.5-like          191   9e-57   
ref|XP_002275261.1|  PREDICTED: gamma-interferon-inducible lysoso...    192   9e-57   Vitis vinifera
ref|XP_010043394.1|  PREDICTED: gamma-interferon-inducible lysoso...    191   9e-57   Eucalyptus grandis [rose gum]
emb|CDY06674.1|  BnaA10g04530D                                          189   5e-56   
ref|XP_009118998.1|  PREDICTED: gamma-interferon-inducible lysoso...    189   5e-56   Brassica rapa
ref|XP_004145238.1|  PREDICTED: gamma-interferon-inducible lysoso...    188   7e-56   Cucumis sativus [cucumbers]
ref|XP_010264555.1|  PREDICTED: gamma-interferon-inducible lysoso...    189   7e-56   Nelumbo nucifera [Indian lotus]
emb|CDP09237.1|  unnamed protein product                                188   8e-56   Coffea canephora [robusta coffee]
ref|XP_008457559.1|  PREDICTED: gamma-interferon-inducible lysoso...    187   1e-55   Cucumis melo [Oriental melon]
gb|KJB21244.1|  hypothetical protein B456_003G149000                    185   1e-55   Gossypium raimondii
gb|KJB21242.1|  hypothetical protein B456_003G149000                    185   2e-55   Gossypium raimondii
ref|XP_010921010.1|  PREDICTED: gamma-interferon-inducible lysoso...    187   3e-55   
gb|ACJ85245.1|  unknown                                                 184   5e-55   Medicago truncatula
ref|XP_009402396.1|  PREDICTED: gamma-interferon-inducible lysoso...    186   5e-55   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006649924.1|  PREDICTED: gamma-interferon-inducible lysoso...    186   8e-55   Oryza brachyantha
ref|XP_003599337.1|  Gamma-interferon-inducible lysosomal thiol r...    186   1e-54   Medicago truncatula
gb|AFK37977.1|  unknown                                                 186   1e-54   Medicago truncatula
emb|CDY10246.1|  BnaC05g04890D                                          187   1e-54   Brassica napus [oilseed rape]
ref|XP_007205747.1|  hypothetical protein PRUPE_ppa010218mg             186   1e-54   Prunus persica
ref|XP_010557194.1|  PREDICTED: gamma-interferon-inducible lysoso...    186   2e-54   Tarenaya hassleriana [spider flower]
ref|XP_010937930.1|  PREDICTED: gamma-interferon-inducible lysoso...    183   3e-54   Elaeis guineensis
emb|CDY09941.1|  BnaC08g45100D                                          184   4e-54   Brassica napus [oilseed rape]
ref|XP_003558135.1|  PREDICTED: gamma-interferon-inducible lysoso...    184   4e-54   Brachypodium distachyon [annual false brome]
ref|XP_004984874.1|  PREDICTED: gamma-interferon-inducible lysoso...    184   5e-54   Setaria italica
ref|XP_006417847.1|  hypothetical protein EUTSA_v10008497mg             184   6e-54   Eutrema salsugineum [saltwater cress]
emb|CDY59062.1|  BnaAnng15750D                                          183   1e-53   Brassica napus [oilseed rape]
ref|XP_009118464.1|  PREDICTED: gamma-interferon-inducible lysoso...    183   1e-53   Brassica rapa
ref|XP_010521972.1|  PREDICTED: gamma-interferon-inducible lysoso...    183   2e-53   Tarenaya hassleriana [spider flower]
ref|XP_009369568.1|  PREDICTED: gamma-interferon-inducible lysoso...    182   2e-53   Pyrus x bretschneideri [bai li]
ref|NP_563779.1|  GILT domain-containing protein                        182   2e-53   Arabidopsis thaliana [mouse-ear cress]
gb|AAF82212.1|AC067971_20  Contains similarity to an unknown prot...    182   3e-53   Arabidopsis thaliana [mouse-ear cress]
tpg|DAA44882.1|  TPA: hypothetical protein ZEAMMB73_014337              182   3e-53   
gb|ACN29331.1|  unknown                                                 181   5e-53   Zea mays [maize]
ref|XP_011089280.1|  PREDICTED: gamma-interferon-inducible lysoso...    181   8e-53   Sesamum indicum [beniseed]
gb|KHN22803.1|  Gamma-interferon-inducible lysosomal thiol reductase    180   1e-52   Glycine soja [wild soybean]
ref|XP_009417986.1|  PREDICTED: gamma-interferon-inducible lysoso...    180   1e-52   Musa acuminata subsp. malaccensis [pisang utan]
gb|ACU19503.1|  unknown                                                 180   1e-52   Glycine max [soybeans]
ref|XP_004294784.1|  PREDICTED: gamma-interferon-inducible lysoso...    180   2e-52   Fragaria vesca subsp. vesca
ref|XP_008678717.1|  PREDICTED: LOC100284511 isoform X1                 180   2e-52   
ref|XP_010685914.1|  PREDICTED: gamma-interferon-inducible lysoso...    179   2e-52   Beta vulgaris subsp. vulgaris [field beet]
emb|CDY15598.1|  BnaA08g28820D                                          180   2e-52   Brassica napus [oilseed rape]
ref|XP_002889632.1|  hypothetical protein ARALYDRAFT_470730             180   3e-52   
ref|XP_007146821.1|  hypothetical protein PHAVU_006G072600g             179   4e-52   Phaseolus vulgaris [French bean]
ref|XP_006847415.1|  hypothetical protein AMTR_s00153p00061670          179   5e-52   Amborella trichopoda
ref|XP_008804105.1|  PREDICTED: gamma-interferon-inducible lysoso...    178   7e-52   Phoenix dactylifera
ref|NP_001150878.1|  LOC100284511 precursor                             178   8e-52   
gb|KFK43003.1|  hypothetical protein AALP_AA1G067000                    178   1e-51   Arabis alpina [alpine rockcress]
ref|NP_001151695.1|  gamma-interferon-inducible lysosomal thiol r...    177   2e-51   
ref|XP_006847417.1|  hypothetical protein AMTR_s00153p00064140          176   3e-51   
ref|XP_006649925.1|  PREDICTED: gamma-interferon-inducible lysoso...    176   6e-51   Oryza brachyantha
ref|XP_010487104.1|  PREDICTED: gamma-interferon-inducible lysoso...    176   1e-50   Camelina sativa [gold-of-pleasure]
gb|EYU18820.1|  hypothetical protein MIMGU_mgv1a012187mg                175   2e-50   Erythranthe guttata [common monkey flower]
ref|XP_006303277.1|  hypothetical protein CARUB_v10010028mg             175   2e-50   
ref|XP_010475460.1|  PREDICTED: gamma-interferon-inducible lysoso...    175   2e-50   Camelina sativa [gold-of-pleasure]
ref|NP_001049827.1|  Os03g0295800                                       174   4e-50   
gb|KFK43005.1|  hypothetical protein AALP_AA1G067000                    174   6e-50   Arabis alpina [alpine rockcress]
gb|ACN40570.1|  unknown                                                 172   8e-50   Picea sitchensis
gb|ABK21952.1|  unknown                                                 172   9e-50   Picea sitchensis
ref|XP_009110962.1|  PREDICTED: gamma-interferon-inducible lysoso...    173   1e-49   Brassica rapa
ref|XP_010922609.1|  PREDICTED: gamma-interferon-inducible lysoso...    172   1e-49   
ref|XP_010457871.1|  PREDICTED: gamma-interferon-inducible lysoso...    172   2e-49   Camelina sativa [gold-of-pleasure]
gb|ABK23086.1|  unknown                                                 171   2e-49   Picea sitchensis
ref|XP_008777702.1|  PREDICTED: gamma-interferon-inducible lysoso...    173   3e-49   Phoenix dactylifera
ref|XP_008457320.1|  PREDICTED: gamma-interferon-inducible lysoso...    170   4e-49   Cucumis melo [Oriental melon]
gb|ABF95437.1|  Gamma interferon inducible lysosomal thiol reduct...    171   5e-49   Oryza sativa Japonica Group [Japonica rice]
gb|EEC75043.1|  hypothetical protein OsI_11143                          171   5e-49   Oryza sativa Indica Group [Indian rice]
ref|XP_011024903.1|  PREDICTED: gamma-interferon-inducible lysoso...    171   6e-49   Populus euphratica
ref|XP_004145239.1|  PREDICTED: gamma-interferon-inducible lysoso...    170   8e-49   Cucumis sativus [cucumbers]
ref|XP_004164408.1|  PREDICTED: gamma-interferon-inducible lysoso...    169   9e-49   
gb|KFK43004.1|  hypothetical protein AALP_AA1G067000                    176   1e-48   Arabis alpina [alpine rockcress]
ref|XP_009400003.1|  PREDICTED: gamma-interferon-inducible lysoso...    169   2e-48   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMT12528.1|  hypothetical protein F775_29715                         169   5e-48   
ref|XP_003558136.1|  PREDICTED: gamma-interferon-inducible lysoso...    167   1e-47   Brachypodium distachyon [annual false brome]
gb|EAZ26583.1|  hypothetical protein OsJ_10480                          167   2e-47   Oryza sativa Japonica Group [Japonica rice]
gb|EMS63318.1|  hypothetical protein TRIUR3_04864                       166   3e-47   Triticum urartu
ref|XP_010543187.1|  PREDICTED: gamma-interferon-inducible lysoso...    166   4e-47   Tarenaya hassleriana [spider flower]
gb|ABK27097.1|  unknown                                                 165   5e-47   Picea sitchensis
gb|EMS53982.1|  hypothetical protein TRIUR3_28410                       166   7e-47   Triticum urartu
dbj|BAI78303.1|  27k protein                                            162   4e-46   Triticum aestivum [Canadian hard winter wheat]
gb|EMT18017.1|  hypothetical protein F775_31970                         163   4e-46   
dbj|BAC76688.1|  27K protein                                            162   5e-46   Triticum aestivum [Canadian hard winter wheat]
emb|CAY85464.1|  Tri a Bd 27K                                           161   6e-46   Triticum aestivum [Canadian hard winter wheat]
emb|CBI18121.3|  unnamed protein product                                162   6e-45   Vitis vinifera
ref|NP_195778.1|  protein OAS HIGH ACCUMULATION 1                       158   3e-44   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002267105.1|  PREDICTED: gamma-interferon-inducible lysoso...    157   1e-43   Vitis vinifera
emb|CAN83947.1|  hypothetical protein VITISV_043667                     157   2e-43   Vitis vinifera
ref|XP_002870911.1|  predicted protein                                  156   2e-43   
dbj|BAK04070.1|  predicted protein                                      155   9e-43   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMS63316.1|  hypothetical protein TRIUR3_04862                       154   2e-42   Triticum urartu
ref|XP_006398604.1|  hypothetical protein EUTSA_v10015266mg             154   2e-42   Eutrema salsugineum [saltwater cress]
ref|XP_009804795.1|  PREDICTED: gamma-interferon-inducible lysoso...    153   2e-42   Nicotiana sylvestris
ref|XP_008370179.1|  PREDICTED: gamma-interferon-inducible lysoso...    153   3e-42   Malus domestica [apple tree]
ref|XP_011077526.1|  PREDICTED: gamma-interferon-inducible lysoso...    154   5e-42   Sesamum indicum [beniseed]
gb|EYU26691.1|  hypothetical protein MIMGU_mgv1a010676mg                154   7e-42   Erythranthe guttata [common monkey flower]
ref|XP_004302276.1|  PREDICTED: gamma-interferon-inducible lysoso...    151   8e-42   Fragaria vesca subsp. vesca
ref|XP_010423970.1|  PREDICTED: gamma-interferon-inducible lysoso...    151   1e-41   Camelina sativa [gold-of-pleasure]
gb|EMT15047.1|  hypothetical protein F775_26223                         152   1e-41   
ref|XP_008370183.1|  PREDICTED: gamma-interferon-inducible lysoso...    152   2e-41   Malus domestica [apple tree]
ref|XP_008243096.1|  PREDICTED: gamma-interferon-inducible lysoso...    151   2e-41   Prunus mume [ume]
gb|EPS59926.1|  hypothetical protein M569_14879                         150   2e-41   Genlisea aurea
ref|XP_006481420.1|  PREDICTED: GILT-like protein F37H8.5-like          150   3e-41   
ref|XP_007205797.1|  hypothetical protein PRUPE_ppa010639mg             150   3e-41   Prunus persica
ref|XP_010490539.1|  PREDICTED: GILT-like protein F37H8.5               150   3e-41   Camelina sativa [gold-of-pleasure]
emb|CDY11193.1|  BnaA03g00290D                                          149   5e-41   Brassica napus [oilseed rape]
ref|XP_010451968.1|  PREDICTED: GILT-like protein F37H8.5 isoform X1    149   5e-41   Camelina sativa [gold-of-pleasure]
emb|CDX80764.1|  BnaC03g00180D                                          149   6e-41   
ref|XP_009376399.1|  PREDICTED: gamma-interferon-inducible lysoso...    149   7e-41   Pyrus x bretschneideri [bai li]
ref|XP_009376405.1|  PREDICTED: gamma-interferon-inducible lysoso...    150   8e-41   Pyrus x bretschneideri [bai li]
ref|XP_004970433.1|  PREDICTED: gamma-interferon-inducible lysoso...    149   8e-41   Setaria italica
ref|XP_006288581.1|  hypothetical protein CARUB_v10001872mg             149   9e-41   Capsella rubella
ref|XP_002300002.2|  hypothetical protein POPTR_0001s28790g             148   1e-40   
ref|XP_011466176.1|  PREDICTED: gamma-interferon-inducible lysoso...    150   1e-40   Fragaria vesca subsp. vesca
ref|XP_006429474.1|  hypothetical protein CICLE_v10012699mg             148   2e-40   
ref|XP_006481419.1|  PREDICTED: gamma-interferon-inducible lysoso...    148   2e-40   
gb|KDO63236.1|  hypothetical protein CISIN_1g042427mg                   148   2e-40   Citrus sinensis [apfelsine]
ref|XP_009621639.1|  PREDICTED: gamma-interferon-inducible lysoso...    148   2e-40   Nicotiana tomentosiformis
ref|XP_003516977.1|  PREDICTED: gamma-interferon-inducible lysoso...    149   3e-40   Glycine max [soybeans]
ref|XP_003604571.1|  Gamma-interferon-inducible lysosomal thiol r...    149   3e-40   Medicago truncatula
ref|XP_008464223.1|  PREDICTED: gamma-interferon-inducible lysoso...    148   3e-40   Cucumis melo [Oriental melon]
ref|XP_009130643.1|  PREDICTED: GILT-like protein F37H8.5               147   3e-40   Brassica rapa
ref|XP_009804788.1|  PREDICTED: gamma-interferon-inducible lysoso...    147   5e-40   Nicotiana sylvestris
ref|XP_011046836.1|  PREDICTED: gamma-interferon-inducible lysoso...    147   5e-40   Populus euphratica
ref|XP_007026601.1|  Gamma-interferon-inducible lysosomal thiol r...    147   9e-40   
ref|XP_003567241.1|  PREDICTED: gamma-interferon-inducible lysoso...    146   1e-39   Brachypodium distachyon [annual false brome]
emb|CDM84815.1|  unnamed protein product                                145   1e-39   Triticum aestivum [Canadian hard winter wheat]
ref|XP_011466447.1|  PREDICTED: gamma-interferon-inducible-lysoso...    145   3e-39   Fragaria vesca subsp. vesca
ref|XP_002323009.1|  gamma interferon responsive lysosomal thiol ...    145   3e-39   
gb|KFK24661.1|  hypothetical protein AALP_AA8G008600                    145   3e-39   Arabis alpina [alpine rockcress]
ref|XP_011046831.1|  PREDICTED: gamma-interferon-inducible lysoso...    145   5e-39   Populus euphratica
ref|XP_010450256.1|  PREDICTED: gamma-interferon-inducible-lysoso...    144   6e-39   Camelina sativa [gold-of-pleasure]
ref|XP_010676804.1|  PREDICTED: gamma-interferon-inducible lysoso...    145   6e-39   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007026603.1|  Gamma-interferon-inducible lysosomal thiol r...    145   7e-39   
ref|XP_006576222.1|  PREDICTED: uncharacterized protein LOC100784...    145   9e-39   Glycine max [soybeans]
gb|KHN03097.1|  Gamma-interferon-inducible lysosomal thiol reductase    144   9e-39   Glycine soja [wild soybean]
ref|XP_010325745.1|  PREDICTED: gamma-interferon-inducible lysoso...    142   9e-39   
gb|AES86767.2|  gamma interferon inducible lysosomal thiol reductase    144   1e-38   Medicago truncatula
gb|EMS56591.1|  hypothetical protein TRIUR3_02402                       144   1e-38   Triticum urartu
ref|XP_002456575.1|  hypothetical protein SORBIDRAFT_03g038650          144   1e-38   Sorghum bicolor [broomcorn]
ref|XP_010325744.1|  PREDICTED: gamma-interferon-inducible lysoso...    142   1e-38   Solanum lycopersicum
ref|XP_004246266.1|  PREDICTED: gamma-interferon-inducible lysoso...    142   1e-38   Solanum lycopersicum
ref|XP_007026600.1|  Gamma interferon responsive lysosomal thiol ...    144   2e-38   
ref|NP_001140474.1|  hypothetical protein precursor                     143   2e-38   Zea mays [maize]
ref|XP_008654524.1|  PREDICTED: hypothetical protein isoform X1         144   2e-38   Zea mays [maize]
emb|CDX86505.1|  BnaC08g01980D                                          143   2e-38   
gb|EMT22579.1|  hypothetical protein F775_21058                         143   2e-38   
gb|KCW49429.1|  hypothetical protein EUGRSUZ_K02963                     142   3e-38   Eucalyptus grandis [rose gum]
ref|XP_007134663.1|  hypothetical protein PHAVU_010G065800g             143   3e-38   Phaseolus vulgaris [French bean]
ref|XP_004506797.1|  PREDICTED: gamma-interferon-inducible lysoso...    143   3e-38   Cicer arietinum [garbanzo]
ref|XP_010325743.1|  PREDICTED: gamma-interferon-inducible lysoso...    142   5e-38   Solanum lycopersicum
ref|XP_003604570.1|  Gamma-interferon-inducible lysosomal thiol r...    145   6e-38   
ref|XP_009804800.1|  PREDICTED: gamma-interferon-inducible lysoso...    141   1e-37   Nicotiana sylvestris
ref|XP_010435333.1|  PREDICTED: gamma-interferon-inducible-lysoso...    141   1e-37   Camelina sativa [gold-of-pleasure]
ref|XP_006359552.1|  PREDICTED: gamma-interferon-inducible lysoso...    141   1e-37   Solanum tuberosum [potatoes]
gb|ACG36171.1|  hypothetical protein                                    140   1e-37   Zea mays [maize]
gb|EAY76352.1|  hypothetical protein OsI_04287                          141   2e-37   Oryza sativa Indica Group [Indian rice]
ref|XP_006286071.1|  hypothetical protein CARUB_v10007604mg             140   2e-37   Capsella rubella
dbj|BAD73620.1|  putative legumaturain                                  140   2e-37   Oryza sativa Japonica Group [Japonica rice]
gb|KJB36937.1|  hypothetical protein B456_006G184500                    140   2e-37   Gossypium raimondii
gb|KJB36938.1|  hypothetical protein B456_006G184500                    140   2e-37   Gossypium raimondii
gb|KJB77052.1|  hypothetical protein B456_012G118100                    141   3e-37   Gossypium raimondii
ref|XP_008243106.1|  PREDICTED: gamma-interferon-inducible lysoso...    140   3e-37   Prunus mume [ume]
ref|XP_004148608.1|  PREDICTED: gamma-interferon-inducible lysoso...    140   4e-37   Cucumis sativus [cucumbers]
ref|XP_010450255.1|  PREDICTED: gamma-interferon-inducible lysoso...    139   4e-37   Camelina sativa [gold-of-pleasure]
ref|XP_002863284.1|  gamma interferon responsive lysosomal thiol ...    139   5e-37   Arabidopsis lyrata subsp. lyrata
gb|KDP20259.1|  hypothetical protein JCGZ_08854                         140   6e-37   Jatropha curcas
ref|XP_002318774.1|  hypothetical protein POPTR_0012s10920g             140   7e-37   Populus trichocarpa [western balsam poplar]
ref|XP_002528051.1|  Gamma-interferon-inducible lysosomal thiol r...    140   8e-37   Ricinus communis
ref|XP_006376928.1|  hypothetical protein POPTR_0012s10950g             139   2e-36   
ref|XP_010036388.1|  PREDICTED: gamma-interferon-inducible lysoso...    138   2e-36   Eucalyptus grandis [rose gum]
ref|XP_002526664.1|  Gamma-interferon-inducible lysosomal thiol r...    138   3e-36   Ricinus communis
gb|KFK23482.1|  hypothetical protein AALP_AAs46213U000200               137   3e-36   Arabis alpina [alpine rockcress]
ref|XP_006374008.1|  hypothetical protein POPTR_0016s13020g             137   4e-36   
gb|KDO63232.1|  hypothetical protein CISIN_1g025043mg                   137   5e-36   Citrus sinensis [apfelsine]
gb|KHG26319.1|  Gamma-interferon-inducible lysosomal thiol reductase    137   5e-36   Gossypium arboreum [tree cotton]
ref|XP_006481098.1|  PREDICTED: gamma-interferon-inducible lysoso...    137   5e-36   Citrus sinensis [apfelsine]
ref|XP_002323011.2|  hypothetical protein POPTR_0016s12980g             137   5e-36   Populus trichocarpa [western balsam poplar]
ref|XP_009114146.1|  PREDICTED: gamma-interferon-inducible-lysoso...    137   5e-36   Brassica rapa
ref|XP_006481097.1|  PREDICTED: gamma-interferon-inducible lysoso...    138   6e-36   Citrus sinensis [apfelsine]
emb|CDY04160.1|  BnaA09g19380D                                          136   7e-36   
ref|NP_193026.1|  Gamma interferon responsive lysosomal thiol (GI...    136   9e-36   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009621640.1|  PREDICTED: gamma-interferon-inducible lysoso...    136   9e-36   Nicotiana tomentosiformis
gb|KJB77051.1|  hypothetical protein B456_012G118100                    135   9e-36   Gossypium raimondii
ref|XP_002308232.1|  hypothetical protein POPTR_0006s10390g             136   1e-35   
ref|XP_010435334.1|  PREDICTED: gamma-interferon-inducible lysoso...    135   2e-35   Camelina sativa [gold-of-pleasure]
ref|XP_002526663.1|  Gamma-interferon-inducible lysosomal thiol r...    136   2e-35   Ricinus communis
emb|CDP06442.1|  unnamed protein product                                136   3e-35   Coffea canephora [robusta coffee]
gb|AAM65819.1|  unknown                                                 134   5e-35   Arabidopsis thaliana [mouse-ear cress]
ref|NP_193032.1|  Gamma interferon responsive lysosomal thiol (GI...    134   5e-35   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006481417.1|  PREDICTED: gamma-interferon-inducible lysoso...    134   1e-34   
gb|KDO63233.1|  hypothetical protein CISIN_1g040358mg                   132   3e-34   Citrus sinensis [apfelsine]
ref|XP_009337735.1|  PREDICTED: gamma-interferon-inducible lysoso...    131   4e-34   Pyrus x bretschneideri [bai li]
ref|XP_006481418.1|  PREDICTED: gamma-interferon-inducible lysoso...    132   5e-34   Citrus sinensis [apfelsine]
ref|XP_006429471.1|  hypothetical protein CICLE_v10013559mg             134   1e-33   
gb|KJB77058.1|  hypothetical protein B456_012G118200                    130   2e-33   Gossypium raimondii
gb|KHG04271.1|  Gamma-interferon-inducible lysosomal thiol reductase    130   4e-33   Gossypium arboreum [tree cotton]
gb|AAM65025.1|  unknown                                                 129   4e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002993226.1|  hypothetical protein SELMODRAFT_162916             129   6e-33   Selaginella moellendorffii
gb|KFK23481.1|  hypothetical protein AALP_AAs46213U000100               128   7e-33   Arabis alpina [alpine rockcress]
ref|XP_002965810.1|  hypothetical protein SELMODRAFT_406875             129   7e-33   
gb|KJB77056.1|  hypothetical protein B456_012G118200                    129   7e-33   Gossypium raimondii
ref|XP_010529036.1|  PREDICTED: gamma-interferon-inducible lysoso...    129   7e-33   Tarenaya hassleriana [spider flower]
gb|KDO63235.1|  hypothetical protein CISIN_1g043330mg                   128   7e-33   Citrus sinensis [apfelsine]
ref|XP_007026602.1|  Gamma-interferon-inducible lysosomal thiol r...    130   8e-33   
ref|XP_009354192.1|  PREDICTED: gamma-interferon-inducible lysoso...    125   1e-32   Pyrus x bretschneideri [bai li]
ref|NP_567395.1|  Gamma interferon responsive lysosomal thiol (GI...    128   1e-32   Arabidopsis thaliana [mouse-ear cress]
emb|CAB41006.1|  putative protein                                       127   3e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002863285.1|  gamma interferon responsive lysosomal thiol ...    126   6e-32   Arabidopsis lyrata subsp. lyrata
emb|CDX80703.1|  BnaC08g05370D                                          126   8e-32   
ref|NP_001154228.1|  Gamma interferon responsive lysosomal thiol ...    126   8e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007207734.1|  hypothetical protein PRUPE_ppb022512mg             129   8e-32   
ref|XP_010093552.1|  hypothetical protein L484_013988                   125   8e-32   
ref|XP_002863286.1|  gamma interferon responsive lysosomal thiol ...    125   9e-32   
ref|XP_001769359.1|  predicted protein                                  125   1e-31   
ref|XP_009107667.1|  PREDICTED: gamma-interferon-inducible-lysoso...    125   2e-31   Brassica rapa
emb|CDY34533.1|  BnaA08g04880D                                          125   2e-31   Brassica napus [oilseed rape]
ref|XP_011019078.1|  PREDICTED: gamma-interferon-inducible lysoso...    125   2e-31   Populus euphratica
gb|KFK23483.1|  hypothetical protein AALP_AAs46213U000300               124   3e-31   Arabis alpina [alpine rockcress]
ref|XP_006414999.1|  hypothetical protein EUTSA_v10026151mg             124   3e-31   Eutrema salsugineum [saltwater cress]
gb|KJB77057.1|  hypothetical protein B456_012G118200                    124   6e-31   Gossypium raimondii
emb|CDY33703.1|  BnaC04g29480D                                          123   9e-31   Brassica napus [oilseed rape]
ref|XP_004506796.1|  PREDICTED: gamma-interferon-inducible lysoso...    122   2e-30   Cicer arietinum [garbanzo]
gb|KJB77055.1|  hypothetical protein B456_012G118200                    122   3e-30   Gossypium raimondii
gb|KJB77053.1|  hypothetical protein B456_012G118100                    121   4e-30   Gossypium raimondii
ref|XP_006429473.1|  hypothetical protein CICLE_v10013816mg             122   5e-30   
ref|XP_009139655.1|  PREDICTED: gamma-interferon-inducible-lysoso...    120   7e-30   Brassica rapa
ref|XP_010264556.1|  PREDICTED: gamma-interferon-inducible lysoso...    120   9e-30   Nelumbo nucifera [Indian lotus]
ref|XP_002323010.1|  hypothetical protein POPTR_0016s13000g             118   5e-29   
ref|XP_006284931.1|  hypothetical protein CARUB_v10006230mg             118   5e-29   Capsella rubella
ref|XP_011046832.1|  PREDICTED: gamma-interferon-inducible lysoso...    118   7e-29   Populus euphratica
ref|NP_193023.2|  Gamma interferon responsive lysosomal thiol (GI...    117   1e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011465923.1|  PREDICTED: gamma-interferon-inducible lysoso...    116   2e-28   Fragaria vesca subsp. vesca
ref|XP_011046834.1|  PREDICTED: GILT-like protein F37H8.5 isoform X3    115   2e-28   Populus euphratica
ref|XP_006282782.1|  hypothetical protein CARUB_v10006370mg             115   5e-28   Capsella rubella
gb|KHG04272.1|  Gamma-interferon-inducible lysosomal thiol reductase    115   1e-27   Gossypium arboreum [tree cotton]
ref|XP_010435337.1|  PREDICTED: gamma-interferon-inducible-lysoso...    114   1e-27   Camelina sativa [gold-of-pleasure]
emb|CAB41004.1|  putative protein                                       112   1e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010450253.1|  PREDICTED: gamma-interferon-inducible-lysoso...    114   2e-27   Camelina sativa [gold-of-pleasure]
ref|XP_011466451.1|  PREDICTED: gamma-interferon-inducible lysoso...    114   3e-27   Fragaria vesca subsp. vesca
gb|KDO63234.1|  hypothetical protein CISIN_1g043871mg                   114   4e-27   Citrus sinensis [apfelsine]
ref|XP_010450045.1|  PREDICTED: gamma-interferon-inducible-lysoso...    113   6e-27   Camelina sativa [gold-of-pleasure]
ref|XP_004302593.1|  PREDICTED: gamma-interferon-inducible lysoso...    113   8e-27   Fragaria vesca subsp. vesca
ref|XP_007140220.1|  hypothetical protein PHAVU_008G094200g             112   2e-26   
ref|XP_010440630.1|  PREDICTED: gamma-interferon-inducible-lysoso...    111   3e-26   
ref|XP_007140219.1|  hypothetical protein PHAVU_008G094200g             110   4e-26   
ref|XP_003604572.1|  Gamma-interferon-inducible lysosomal thiol r...    108   2e-25   
ref|XP_006429472.1|  hypothetical protein CICLE_v10013451mg             108   3e-25   
gb|KJB74160.1|  hypothetical protein B456_011G276400                    110   5e-25   
gb|KJB74158.1|  hypothetical protein B456_011G276400                    110   6e-25   
gb|KJB74166.1|  hypothetical protein B456_011G277200                    108   7e-25   
gb|KJB74167.1|  hypothetical protein B456_011G277200                    108   8e-25   
ref|XP_009804806.1|  PREDICTED: gamma-interferon-inducible lysoso...    105   3e-24   
ref|XP_010451970.1|  PREDICTED: gamma-interferon-inducible lysoso...    105   3e-24   
ref|XP_008789174.1|  PREDICTED: gamma-interferon-inducible lysoso...    103   4e-24   
ref|XP_003604573.1|  Gamma-interferon-inducible lysosomal thiol r...    104   1e-23   
ref|XP_006573382.1|  PREDICTED: gamma-interferon-inducible lysoso...    104   1e-23   
gb|ACF74268.1|  unknown                                                 102   1e-23   
ref|XP_005651988.1|  GILT-domain-containing protein                     102   2e-23   
gb|KJB74168.1|  hypothetical protein B456_011G277200                    103   3e-23   
gb|KDP22843.1|  hypothetical protein JCGZ_00430                         102   5e-23   
ref|XP_003525904.1|  PREDICTED: gamma-interferon-inducible lysoso...    102   5e-23   
gb|KJB77050.1|  hypothetical protein B456_012G118100                    101   7e-23   
gb|KJB77054.1|  hypothetical protein B456_012G118100                  99.8    1e-22   
gb|KHN40714.1|  Gamma-interferon-inducible lysosomal thiol reductase    100   2e-22   
ref|NP_001236685.1|  uncharacterized protein LOC100306044 precursor     100   2e-22   
ref|XP_003520337.1|  PREDICTED: gamma-interferon-inducible lysoso...  98.6    1e-21   
gb|EMS63317.1|  hypothetical protein TRIUR3_04863                     97.1    3e-21   
ref|XP_002863283.1|  hypothetical protein ARALYDRAFT_497109           97.4    3e-21   
gb|KHN23040.1|  Gamma-interferon-inducible lysosomal thiol reductase  97.8    5e-21   
gb|AAL62341.1|  putative protein                                      95.9    5e-21   
ref|NP_001239975.1|  uncharacterized protein LOC100784702             95.1    1e-20   
ref|XP_009063344.1|  hypothetical protein LOTGIDRAFT_235669           94.7    3e-20   
ref|XP_008882925.1|  gamma interferon inducible lysosomal thiol r...  94.4    7e-20   
emb|CDQ05808.1|  Protein BM-PQN-48, isoform c                         94.0    8e-20   
gb|EPR62685.1|  gamma interferon inducible lysosomal thiol reduct...  93.2    1e-19   
gb|KFH15370.1|  gamma interferon inducible lysosomal thiol reduct...  93.2    1e-19   
gb|EKC24277.1|  Gamma-interferon-inducible lysosomal thiol reductase  93.2    2e-19   
gb|EPT29587.1|  gamma interferon inducible lysosomal thiol reduct...  93.2    2e-19   
gb|ERG86779.1|  gilt-like protein                                     93.2    2e-19   
ref|XP_011451824.1|  PREDICTED: gamma-interferon-inducible lysoso...  92.8    3e-19   
ref|XP_004209577.1|  PREDICTED: gamma-interferon-inducible lysoso...  91.7    3e-19   
gb|KJB74234.1|  hypothetical protein B456_011G281300                  92.4    3e-19   
gb|KDP22842.1|  hypothetical protein JCGZ_00429                       92.0    3e-19   
gb|EKC19601.1|  Gamma-interferon-inducible lysosomal thiol reductase  92.0    5e-19   
ref|XP_011417891.1|  PREDICTED: gamma-interferon-inducible lysoso...  92.0    6e-19   
ref|XP_009376401.1|  PREDICTED: gamma-interferon-inducible lysoso...  91.3    8e-19   
gb|ACX30641.1|  interferon-gamma-inducible lysosomal thiol reductase  90.9    1e-18   
gb|EKC19602.1|  Gamma-interferon-inducible lysosomal thiol reductase  90.1    2e-18   
ref|XP_001627114.1|  predicted protein                                89.4    4e-18   
ref|XP_001009610.1|  hypothetical protein TTHERM_00373820             87.8    1e-17   
ref|XP_975539.1|  PREDICTED: GILT-like protein F37H8.5                86.7    2e-17   
ref|XP_009800308.1|  PREDICTED: gamma-interferon-inducible lysoso...  86.3    3e-17   
ref|XP_008370180.1|  PREDICTED: gamma-interferon-inducible lysoso...  84.7    4e-17   
gb|EFO16549.2|  hypothetical protein LOAG_11956                       86.3    4e-17   
ref|XP_004209432.1|  PREDICTED: gamma-interferon-inducible lysoso...  86.3    6e-17   
ref|XP_001627133.1|  predicted protein                                85.1    6e-17   
ref|XP_006284569.1|  hypothetical protein CARUB_v10005793mg           85.1    7e-17   
gb|KHN72819.1|  GILT-like protein F37H8.5                             86.3    7e-17   
gb|EMT12529.1|  hypothetical protein F775_29716                       82.4    1e-16   
gb|EFX72165.1|  hypothetical protein DAPPUDRAFT_308544                84.3    1e-16   
ref|XP_003101572.1|  CRE-PQN-48 protein                               85.5    1e-16   
ref|XP_003388404.1|  PREDICTED: gamma-interferon-inducible lysoso...  84.3    1e-16   
gb|KHN88797.1|  GILT-like protein F37H8.5                             84.7    2e-16   
gb|ETN82088.1|  gamma interferon inducible lysosomal thiol reductase  84.7    2e-16   
gb|AAQ83892.1|  interferon gamma-inducible protein 30                 84.3    3e-16   
ref|XP_011302264.1|  PREDICTED: gamma-interferon-inducible lysoso...  84.3    3e-16   
ref|NP_494711.1|  Protein PQN-48                                      84.7    3e-16   
ref|XP_009376400.1|  PREDICTED: GILT-like protein F37H8.5             82.0    3e-16   
gb|EGT57234.1|  hypothetical protein CAEBREN_32853                    84.3    3e-16   
ref|XP_005279068.1|  PREDICTED: gamma-interferon-inducible lysoso...  84.0    3e-16   
gb|AFK38451.1|  unknown                                               83.6    3e-16   
gb|ELU04646.1|  hypothetical protein CAPTEDRAFT_173595                84.0    4e-16   
gb|EZA53914.1|  GILT-like protein C02D5.2                             83.2    4e-16   
ref|XP_002365295.1|  hypothetical protein TGME49_061630               82.4    4e-16   
ref|XP_011339488.1|  PREDICTED: GILT-like protein C02D5.2 isoform X1  83.6    4e-16   
ref|XP_002648005.1|  C. briggsae CBR-PQN-48 protein                   84.3    4e-16   
gb|KJE89311.1|  hypothetical protein CAOG_009343                      83.2    5e-16   
gb|EYB97564.1|  hypothetical protein Y032_0139g2100                   83.6    6e-16   
gb|KHN10551.1|  hypothetical protein glysoja_037030                   82.0    8e-16   
ref|XP_011270013.1|  hypothetical protein CAOG_08442                  82.4    8e-16   
ref|XP_011465925.1|  PREDICTED: gamma-interferon-inducible lysoso...  80.9    1e-15   
ref|XP_011046833.1|  PREDICTED: gamma-interferon-inducible lysoso...  81.6    1e-15   
emb|CEF60543.1|  Gamma-interferon-inducible lysosomal thiol reduc...  81.6    2e-15   
gb|KJE89310.1|  hypothetical protein CAOG_009342                      81.3    2e-15   
ref|XP_011311094.1|  PREDICTED: gamma-interferon-inducible lysoso...  80.9    3e-15   
ref|XP_011465924.1|  PREDICTED: gamma-interferon-inducible lysoso...  80.1    3e-15   
ref|XP_006126886.1|  PREDICTED: gamma-interferon-inducible lysoso...  81.3    3e-15   
gb|KJB74173.1|  hypothetical protein B456_011G277600                  80.9    4e-15   
ref|XP_010723409.1|  PREDICTED: LOW QUALITY PROTEIN: gamma-interf...  81.6    4e-15   
ref|XP_011061192.1|  PREDICTED: GILT-like protein C02D5.2             80.5    4e-15   
ref|NP_001040501.1|  legumaturain                                     80.1    6e-15   
emb|CDJ82643.1|  Gamma interferon inducible lysosomal thiol reduc...  80.1    7e-15   
ref|XP_008370181.1|  PREDICTED: uncharacterized protein LOC103433691  79.0    7e-15   
ref|XP_002606920.1|  hypothetical protein BRAFLDRAFT_126371           82.4    8e-15   
gb|EGI70238.1|  DNA-directed RNA polymerases I and III subunit RPAC1  80.9    9e-15   
ref|XP_005107684.1|  PREDICTED: gamma-interferon-inducible lysoso...  79.7    9e-15   
ref|XP_003117361.1|  hypothetical protein CRE_02159                   79.7    9e-15   
gb|KJB74112.1|  hypothetical protein B456_011G273500                  80.1    1e-14   
gb|EEC75044.1|  hypothetical protein OsI_11144                        77.4    1e-14   
gb|KFM58934.1|  Gamma-interferon-inducible lysosomal thiol reductase  79.7    1e-14   
gb|AFQ32460.1|  interferon-gamma inducible lysosomal thiol reductase  79.3    1e-14   
ref|XP_002631164.1|  Hypothetical protein CBG02950                    79.3    1e-14   
gb|EAZ26584.1|  hypothetical protein OsJ_10481                        76.6    1e-14   
gb|EFX72166.1|  hypothetical protein DAPPUDRAFT_231465                78.6    2e-14   
ref|XP_001511104.1|  PREDICTED: gamma-interferon-inducible lysoso...  79.0    2e-14   
ref|XP_005107688.1|  PREDICTED: gamma-interferon-inducible lysoso...  78.6    2e-14   
gb|AEE63512.1|  unknown                                               78.2    2e-14   
ref|XP_008639269.1|  PREDICTED: gamma-interferon-inducible lysoso...  78.6    2e-14   
ref|XP_008234981.1|  PREDICTED: GILT-like protein F37H8.5             76.3    2e-14   
ref|XP_008123131.1|  PREDICTED: gamma-interferon-inducible lysoso...  78.6    2e-14   
gb|KFO64681.1|  Gamma-interferon-inducible lysosomal thiol reductase  77.4    2e-14   
ref|XP_010409904.1|  PREDICTED: gamma-interferon-inducible lysoso...  78.6    2e-14   
gb|EMP24074.1|  Gamma-interferon-inducible lysosomal thiol reductase  78.6    3e-14   
gb|EGT44855.1|  hypothetical protein CAEBREN_02159                    78.6    3e-14   
gb|KIY98080.1|  hypothetical protein MNEG_9880                        77.4    3e-14   
ref|XP_007072191.1|  PREDICTED: LOW QUALITY PROTEIN: gamma-interf...  78.2    3e-14   
gb|AFX74692.1|  interferon-gamma-inducible lysosomal thiol reductase  78.2    3e-14   
ref|XP_009063220.1|  hypothetical protein LOTGIDRAFT_235566           78.2    3e-14   
ref|XP_011417890.1|  PREDICTED: gamma-interferon-inducible lysoso...  77.0    4e-14   
gb|EYC28483.1|  hypothetical protein Y032_0007g3247                   77.8    4e-14   
ref|XP_791549.3|  PREDICTED: gamma-interferon-inducible lysosomal...  77.4    5e-14   
gb|EMC87123.1|  Gamma-interferon-inducible lysosomal thiol reductase  76.3    6e-14   
ref|XP_009470236.1|  PREDICTED: gamma-interferon-inducible lysoso...  77.4    6e-14   
ref|XP_003882829.1|  hypothetical protein NCLIV_025860                76.3    6e-14   
ref|XP_011255654.1|  PREDICTED: gamma-interferon-inducible lysoso...  77.0    6e-14   
gb|KHJ43170.1|  gamma interferon inducible lysosomal thiol reductase  77.0    8e-14   
gb|ERG82080.1|  gilt-like protein                                     77.0    8e-14   
ref|XP_005531301.1|  PREDICTED: gamma-interferon-inducible lysoso...  76.6    9e-14   
ref|XP_005244255.1|  PREDICTED: gamma-interferon-inducible lysoso...  76.6    9e-14   
gb|KFR04804.1|  Gamma-interferon-inducible lysosomal thiol reductase  75.9    1e-13   
ref|XP_005444379.1|  PREDICTED: gamma-interferon-inducible lysoso...  76.6    1e-13   
gb|AIU34503.1|  gamma-interferon-inducible lysosomal thiol reductase  76.6    1e-13   
emb|CBK22660.2|  unnamed protein product                              79.0    1e-13   
gb|ADR31352.1|  gamma-interferon-inducible lysosomal thiol reductase  76.3    1e-13   
gb|EYC28482.1|  hypothetical protein Y032_0007g3247                   78.6    1e-13   
gb|EYC28481.1|  hypothetical protein Y032_0007g3247                   78.2    1e-13   
gb|ELU18886.1|  hypothetical protein CAPTEDRAFT_180198                76.3    1e-13   
gb|ABQ24037.1|  gamma interferon-inducible protein 30                 75.9    1e-13   
ref|XP_011505236.1|  PREDICTED: GILT-like protein C02D5.2             75.9    1e-13   
ref|XP_418246.3|  PREDICTED: gamma-interferon-inducible-lysosomal...  77.8    2e-13   
ref|XP_011139528.1|  PREDICTED: GILT-like protein C02D5.2             75.5    2e-13   
ref|NP_001017196.1|  interferon, gamma-inducible protein 30 precu...  75.5    3e-13   
gb|ELT91216.1|  hypothetical protein CAPTEDRAFT_134055                74.3    3e-13   
gb|EMS63319.1|  hypothetical protein TRIUR3_04865                     73.2    3e-13   
ref|XP_005505605.1|  PREDICTED: gamma-interferon-inducible lysoso...  75.5    3e-13   
gb|AIU41386.1|  gamma-interferon-inducible lysosomal thiol reductase  75.1    3e-13   
ref|XP_003695251.1|  PREDICTED: LOW QUALITY PROTEIN: DNA-directed...  77.8    3e-13   
emb|CAN76153.1|  hypothetical protein VITISV_012675                   73.2    3e-13   
ref|XP_009561147.1|  PREDICTED: gamma-interferon-inducible lysoso...  75.5    3e-13   
ref|XP_967638.1|  PREDICTED: gamma-interferon-inducible lysosomal...  74.7    4e-13   
gb|ENN80218.1|  hypothetical protein YQE_03353                        74.7    4e-13   
ref|XP_009893492.1|  PREDICTED: gamma-interferon-inducible lysoso...  73.6    4e-13   
ref|XP_001423595.1|  hypothetical protein                             74.3    4e-13   
ref|NP_496397.1|  Protein F37H8.5                                     74.7    5e-13   
emb|CDW55813.1|  Gamma interferon inducible lysosomal thiol           74.3    6e-13   
ref|XP_007897114.1|  PREDICTED: gamma-interferon-inducible lysoso...  74.3    6e-13   
ref|XP_004522785.1|  PREDICTED: gamma-interferon-inducible lysoso...  74.3    6e-13   
ref|XP_007560600.1|  PREDICTED: gamma-interferon-inducible lysoso...  74.7    7e-13   
ref|XP_007560602.1|  PREDICTED: gamma-interferon-inducible lysoso...  74.7    7e-13   
gb|KFO77624.1|  Gamma-interferon-inducible lysosomal thiol reductase  72.8    8e-13   
dbj|BAN20339.1|  unkown protein                                       73.9    8e-13   
ref|XP_004037460.1|  hypothetical protein IMG5_051520                 73.9    9e-13   
gb|KFW74242.1|  Gamma-interferon-inducible lysosomal thiol reductase  72.8    9e-13   
ref|NP_001267597.1|  IFN-gamma-inducible-lysosomal thiol reductas...  73.9    9e-13   
gb|EHJ74638.1|  legumaturain                                          75.9    1e-12   
ref|XP_002192272.1|  PREDICTED: gamma-interferon-inducible lysoso...  73.6    1e-12   
emb|CAP47204.1|  interferon gamma inducible protein 30                73.2    1e-12   
ref|XP_005060078.1|  PREDICTED: gamma-interferon-inducible lysoso...  73.6    1e-12   
ref|XP_008190385.1|  PREDICTED: gamma-interferon-inducible lysoso...  73.2    1e-12   
ref|XP_006271117.1|  PREDICTED: gamma-interferon-inducible lysoso...  73.6    1e-12   
gb|KGL88079.1|  Gamma-interferon-inducible lysosomal thiol reductase  71.2    1e-12   
ref|XP_005800935.1|  PREDICTED: gamma-interferon-inducible lysoso...  73.6    1e-12   
ref|XP_003700748.1|  PREDICTED: DNA-directed RNA polymerases I an...  75.9    1e-12   
ref|XP_008330416.1|  PREDICTED: gamma-interferon-inducible lysoso...  73.2    2e-12   
ref|XP_005496514.1|  PREDICTED: gamma-interferon-inducible lysoso...  72.4    2e-12   
gb|ADJ21806.1|  gamma-interferon-inducible lysosomal thiol reductase  73.2    2e-12   
ref|XP_010560471.1|  PREDICTED: gamma-interferon-inducible lysoso...  73.2    2e-12   
ref|XP_002411063.1|  gamma-interferon inducible lysosomal thiol r...  72.4    2e-12   
gb|KFQ21229.1|  Gamma-interferon-inducible lysosomal thiol reductase  71.6    2e-12   
gb|ETN67062.1|  hypothetical protein AND_001141                       72.8    2e-12   
gb|AEX07320.1|  gamma-interferon-inducible lysosomal thiol reductase  72.4    2e-12   
ref|XP_003740590.1|  PREDICTED: GILT-like protein C02D5.2-like        72.4    3e-12   
gb|AFO63174.1|  gamma-interferon-inducible lysosomal thiol reductase  72.0    3e-12   
ref|NP_651166.1|  CG10157                                             72.0    3e-12   
ref|XP_004569456.1|  PREDICTED: gamma-interferon-inducible lysoso...  72.4    3e-12   
ref|XP_008932488.1|  PREDICTED: gamma-interferon-inducible lysoso...  72.8    3e-12   
ref|XP_001982121.1|  GG11213                                          72.0    3e-12   
gb|ENN74078.1|  hypothetical protein YQE_09051                        72.0    3e-12   
gb|EHJ74652.1|  legumaturain                                          72.0    3e-12   
ref|XP_006612076.1|  PREDICTED: DNA-directed RNA polymerases I an...  74.3    3e-12   
ref|XP_006565319.1|  PREDICTED: DNA-directed RNA polymerases I an...  74.3    3e-12   
gb|KFP46892.1|  Gamma-interferon-inducible lysosomal thiol reductase  70.1    3e-12   
ref|XP_010178531.1|  PREDICTED: gamma-interferon-inducible lysoso...  71.2    3e-12   
gb|EZA45588.1|  Gamma interferon inducible lysosomal thiol reduct...  72.4    3e-12   
ref|XP_002163359.1|  PREDICTED: gamma-interferon-inducible lysoso...  72.0    3e-12   
gb|ACJ23247.1|  gamma-interferon-inducible lysosomal thiol reductase  72.0    3e-12   
ref|XP_005429563.1|  PREDICTED: gamma-interferon-inducible lysoso...  73.6    3e-12   
gb|AEE63335.1|  unknown                                               71.6    4e-12   
ref|XP_008545101.1|  PREDICTED: GILT-like protein C02D5.2             72.0    4e-12   
gb|EPS58984.1|  hypothetical protein M569_15829                       69.7    4e-12   
ref|XP_003599339.1|  Gamma-interferon-inducible lysosomal thiol r...  70.9    4e-12   
ref|XP_002428434.1|  gamma-interferon-inducible lysosomal thiol r...  71.6    4e-12   
ref|XP_003381919.1|  gamma interferon inducible lysosomal thiol r...  72.0    4e-12   
ref|XP_002031332.1|  GM25939                                          71.6    5e-12   
ref|XP_005929025.1|  PREDICTED: gamma-interferon-inducible lysoso...  72.0    5e-12   
ref|XP_005934975.1|  PREDICTED: gamma-interferon-inducible lysoso...  72.0    5e-12   
gb|KFV67815.1|  Gamma-interferon-inducible lysosomal thiol reductase  70.9    5e-12   
ref|XP_004688236.1|  PREDICTED: gamma-interferon-inducible-lysoso...  71.6    5e-12   
ref|XP_004564862.1|  PREDICTED: gamma-interferon-inducible lysoso...  71.6    5e-12   
gb|AHD26940.1|  interferon-gamma-inducible lysosomal thiol reductase  71.6    6e-12   
ref|XP_005090370.1|  PREDICTED: gamma-interferon-inducible lysoso...  71.2    6e-12   
ref|XP_009021136.1|  hypothetical protein HELRODRAFT_185746           72.0    6e-12   
ref|XP_318831.4|  AGAP009747-PA                                       71.2    7e-12   
emb|CDJ97518.1|  Gamma interferon inducible lysosomal thiol reduc...  71.2    7e-12   
gb|EFZ10807.1|  hypothetical protein SINV_06782                       70.9    7e-12   
ref|XP_001953586.1|  GF17838                                          70.9    7e-12   
ref|XP_002410651.1|  gamma-interferon inducible lysosomal thiol r...  70.9    8e-12   
gb|KFB53718.1|  AGAP009747-PA-like protein                            70.9    8e-12   
ref|NP_650287.3|  CG9796                                              71.2    8e-12   
ref|XP_002433205.1|  conserved hypothetical protein                   70.5    9e-12   
ref|XP_005028173.1|  PREDICTED: gamma-interferon-inducible lysoso...  69.7    9e-12   
ref|XP_006381247.1|  hypothetical protein POPTR_0006s10400g           68.9    9e-12   
ref|XP_002020165.1|  GL13649                                          70.5    1e-11   



>ref|XP_009760049.1| PREDICTED: gamma-interferon-inducible lysosomal thiol reductase-like 
isoform X3 [Nicotiana sylvestris]
Length=252

 Score =   231 bits (589),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 109/160 (68%), Positives = 126/160 (79%), Gaps = 1/160 (1%)
 Frame = +1

Query  106  MAGSHQQTKICFLVCLLFFTSLSPISCG-KVSLDLYYESLCPYSANFIVNYLAKIYENGI  282
            M  S Q+T   FL C L FT +SPISC  KVSL LYYESLCPY +NFIVNYL K+++NG+
Sbjct  1    MGSSFQRTVSIFLACSLCFTQISPISCEEKVSLVLYYESLCPYCSNFIVNYLPKVFKNGL  60

Query  283  IDIVDLTLFPWGNAKLKGNNTFECQHGAAECLLNTIEACAIDAWPDLKEHFPFIYCVESL  462
            ID+VDL L PWGN KL+ NNTF+CQHG AEC L+T+EACAIDAWPDL EHFPFIYCVESL
Sbjct  61   IDVVDLKLVPWGNTKLQANNTFKCQHGKAECFLDTVEACAIDAWPDLNEHFPFIYCVESL  120

Query  463  VNNGEYSKWETCYEKLGKDPKQISDCYASGRGKELELSYA  582
            V +  Y++WETC+EKL    K + DC  SGRGKELEL YA
Sbjct  121  VYHKNYTQWETCFEKLNLKAKPVKDCVGSGRGKELELRYA  160



>ref|XP_009760046.1| PREDICTED: GILT-like protein F37H8.5 isoform X1 [Nicotiana sylvestris]
Length=253

 Score =   231 bits (589),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 109/160 (68%), Positives = 127/160 (79%), Gaps = 1/160 (1%)
 Frame = +1

Query  106  MAGSHQQTKICFLVCLLFFTSLSPISCG-KVSLDLYYESLCPYSANFIVNYLAKIYENGI  282
            M  S Q+T   FL C L FT +SPISC  KVSL LYYESLCPY +NFIVNYL K+++NG+
Sbjct  1    MGSSFQRTVSIFLACSLCFTQISPISCEEKVSLVLYYESLCPYCSNFIVNYLPKVFKNGL  60

Query  283  IDIVDLTLFPWGNAKLKGNNTFECQHGAAECLLNTIEACAIDAWPDLKEHFPFIYCVESL  462
            ID+VDL L PWGN KL+ NNTF+CQHG AEC L+T+EACAIDAWPDL EHFPFIYCVESL
Sbjct  61   IDVVDLKLVPWGNTKLQANNTFKCQHGPAECFLDTLEACAIDAWPDLNEHFPFIYCVESL  120

Query  463  VNNGEYSKWETCYEKLGKDPKQISDCYASGRGKELELSYA  582
            V +  Y++WETC+EKL    K ++DC  SGRGKELEL YA
Sbjct  121  VYHKNYTQWETCFEKLNLKAKLVTDCVGSGRGKELELRYA  160



>ref|XP_009760047.1| PREDICTED: GILT-like protein F37H8.5 isoform X2 [Nicotiana sylvestris]
Length=253

 Score =   226 bits (576),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 107/160 (67%), Positives = 125/160 (78%), Gaps = 1/160 (1%)
 Frame = +1

Query  106  MAGSHQQTKICFLVCLLFFTSLSPISC-GKVSLDLYYESLCPYSANFIVNYLAKIYENGI  282
            M  S Q+T   FL   L FT +SPISC  KVSL LYYE+LCP  +NFIVNYL KI++NGI
Sbjct  1    MGSSFQKTVSIFLAFFLCFTQISPISCEKKVSLTLYYETLCPGCSNFIVNYLTKIFKNGI  60

Query  283  IDIVDLTLFPWGNAKLKGNNTFECQHGAAECLLNTIEACAIDAWPDLKEHFPFIYCVESL  462
            ID+VDL L PWGN K++ NNTF+CQHG AEC L+T+EACAIDAWPDL EHFPFIYCVESL
Sbjct  61   IDVVDLKLVPWGNTKIQANNTFKCQHGPAECFLDTLEACAIDAWPDLNEHFPFIYCVESL  120

Query  463  VNNGEYSKWETCYEKLGKDPKQISDCYASGRGKELELSYA  582
            V +  Y++WETC+EKL    K ++DC  SGRGKELEL YA
Sbjct  121  VYHKNYTQWETCFEKLNLKAKLVTDCVGSGRGKELELRYA  160



>ref|XP_009590102.1| PREDICTED: GILT-like protein F37H8.5 isoform X1 [Nicotiana tomentosiformis]
Length=253

 Score =   223 bits (569),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 107/160 (67%), Positives = 123/160 (77%), Gaps = 1/160 (1%)
 Frame = +1

Query  106  MAGSHQQTKICFLVCLLFFTSLSPISCG-KVSLDLYYESLCPYSANFIVNYLAKIYENGI  282
            M  S Q+T   FL   L F  +SPI C  KVSL LYYESLCPY +NFIVNYL KI++NG+
Sbjct  1    MGSSFQRTVSIFLAFFLCFIQISPIYCEEKVSLTLYYESLCPYCSNFIVNYLPKIFKNGL  60

Query  283  IDIVDLTLFPWGNAKLKGNNTFECQHGAAECLLNTIEACAIDAWPDLKEHFPFIYCVESL  462
            ID+VDL L PWGN KL+ NNTF+CQHG AEC L+T+EACAIDAWPDL EHFPFIYCVESL
Sbjct  61   IDVVDLKLVPWGNTKLQANNTFKCQHGPAECFLDTLEACAIDAWPDLNEHFPFIYCVESL  120

Query  463  VNNGEYSKWETCYEKLGKDPKQISDCYASGRGKELELSYA  582
            V +  Y++WETC+EKL    K + DC  SGRGKELEL YA
Sbjct  121  VYHKNYTQWETCFEKLNLKAKLVKDCVGSGRGKELELRYA  160



>ref|XP_009590105.1| PREDICTED: gamma-interferon-inducible lysosomal thiol reductase-like 
isoform X3 [Nicotiana tomentosiformis]
Length=252

 Score =   221 bits (562),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 105/160 (66%), Positives = 123/160 (77%), Gaps = 1/160 (1%)
 Frame = +1

Query  106  MAGSHQQTKICFLVCLLFFTSLSPISCG-KVSLDLYYESLCPYSANFIVNYLAKIYENGI  282
            M  S Q+T   FL   L F  +SPI C  KVSL LYYESLCPY +NFIVNYL KI++NG+
Sbjct  1    MGSSFQRTVSIFLAFFLCFIQISPIYCEEKVSLTLYYESLCPYCSNFIVNYLPKIFKNGL  60

Query  283  IDIVDLTLFPWGNAKLKGNNTFECQHGAAECLLNTIEACAIDAWPDLKEHFPFIYCVESL  462
            ID+VDL L PWGN KL+ NNTF+CQHG AEC L+T+EACAIDAWPDL EHFPFIYCVESL
Sbjct  61   IDVVDLKLVPWGNTKLQANNTFKCQHGKAECFLDTVEACAIDAWPDLNEHFPFIYCVESL  120

Query  463  VNNGEYSKWETCYEKLGKDPKQISDCYASGRGKELELSYA  582
            V +  Y++WETC+EKL    + + DC  SG+GKELEL YA
Sbjct  121  VYHKNYTQWETCFEKLNLKAELVKDCVGSGQGKELELRYA  160



>ref|XP_009590103.1| PREDICTED: GILT-like protein F37H8.5 isoform X2 [Nicotiana tomentosiformis]
Length=253

 Score =   221 bits (562),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 105/160 (66%), Positives = 124/160 (78%), Gaps = 1/160 (1%)
 Frame = +1

Query  106  MAGSHQQTKICFLVCLLFFTSLSPISC-GKVSLDLYYESLCPYSANFIVNYLAKIYENGI  282
            M  S Q++   FL   L FT +SPISC  KVSL LYYE+LCP  +NFIVNYL KI++NG+
Sbjct  1    MRSSFQRSVSIFLAFFLCFTQISPISCEQKVSLTLYYETLCPGCSNFIVNYLPKIFKNGL  60

Query  283  IDIVDLTLFPWGNAKLKGNNTFECQHGAAECLLNTIEACAIDAWPDLKEHFPFIYCVESL  462
            ID+VDL L PWGN K++ NNTF+CQHG AEC L+T+EACAIDAWPDL EHFPFIYCVESL
Sbjct  61   IDVVDLKLVPWGNTKIQPNNTFKCQHGPAECFLDTLEACAIDAWPDLNEHFPFIYCVESL  120

Query  463  VNNGEYSKWETCYEKLGKDPKQISDCYASGRGKELELSYA  582
            V +  Y++WETC+EKL    K + DC  SGRGKELEL YA
Sbjct  121  VYHKNYTQWETCFEKLNLKAKLVKDCVGSGRGKELELRYA  160



>ref|XP_006344069.1| PREDICTED: GILT-like protein F37H8.5-like [Solanum tuberosum]
Length=254

 Score =   220 bits (561),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 105/149 (70%), Positives = 121/149 (81%), Gaps = 1/149 (1%)
 Frame = +1

Query  139  FLVCLLFFTSLSPISC-GKVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPW  315
            FLVCLL FT  S ISC  KVSL LYYESLCPY +NFIVNYL KI++NG+IDIVDL L PW
Sbjct  13   FLVCLLCFTQFSSISCEKKVSLTLYYESLCPYCSNFIVNYLPKIFKNGMIDIVDLKLVPW  72

Query  316  GNAKLKGNNTFECQHGAAECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWET  495
            GN KL+ +NTF+CQHG AEC L+ +EACAIDAWPDL EHFPFIYCVESLV +  Y++WET
Sbjct  73   GNTKLQPDNTFKCQHGKAECFLDIVEACAIDAWPDLNEHFPFIYCVESLVYHKNYTQWET  132

Query  496  CYEKLGKDPKQISDCYASGRGKELELSYA  582
            C+EKL    K +++C  SGRGKELEL YA
Sbjct  133  CFEKLNLKKKLVTNCVLSGRGKELELQYA  161



>ref|XP_004240417.1| PREDICTED: GILT-like protein F37H8.5 [Solanum lycopersicum]
Length=254

 Score =   219 bits (558),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 108/161 (67%), Positives = 125/161 (78%), Gaps = 2/161 (1%)
 Frame = +1

Query  106  MAGSHQQTKIC-FLVCLLFFTSLSPISC-GKVSLDLYYESLCPYSANFIVNYLAKIYENG  279
            M  S Q+  I  FLVCLL FT  S ISC  KVSL LYYESLCPY +NFIVNYL KI++NG
Sbjct  1    MEISFQKNVISYFLVCLLCFTQFSSISCEKKVSLTLYYESLCPYCSNFIVNYLPKIFKNG  60

Query  280  IIDIVDLTLFPWGNAKLKGNNTFECQHGAAECLLNTIEACAIDAWPDLKEHFPFIYCVES  459
            +IDIVD  L PWGN KL+ +NTF+CQHG  EC+L+T+EACAIDAWPDL EHFPFIYCVES
Sbjct  61   MIDIVDFKLVPWGNTKLQPDNTFKCQHGKDECILDTVEACAIDAWPDLSEHFPFIYCVES  120

Query  460  LVNNGEYSKWETCYEKLGKDPKQISDCYASGRGKELELSYA  582
            LV +  Y++WETC+EKL    K ++DC  SGRG ELEL YA
Sbjct  121  LVYHKNYTQWETCFEKLNLKKKLVTDCVLSGRGNELELQYA  161



>ref|XP_002275283.1| PREDICTED: gamma-interferon-inducible lysosomal thiol reductase 
isoform X2 [Vitis vinifera]
 emb|CBI15903.3| unnamed protein product [Vitis vinifera]
Length=259

 Score =   214 bits (546),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 99/136 (73%), Positives = 113/136 (83%), Gaps = 0/136 (0%)
 Frame = +1

Query  175  PISCGKVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKLKGNNTFEC  354
            P    KVSL LYYESLCPYSANFI+NYL KI+ENG+I IVDL L P+GNAK++GNNT +C
Sbjct  26   PSDSDKVSLGLYYESLCPYSANFIINYLVKIFENGLISIVDLNLVPFGNAKIRGNNTIDC  85

Query  355  QHGAAECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWETCYEKLGKDPKQIS  534
            QHG AECLLNT+EACAID WPDL +HF FIYC+E+LV   +Y +WETC+EKLG DPK IS
Sbjct  86   QHGPAECLLNTVEACAIDVWPDLSQHFSFIYCIETLVYERKYPQWETCFEKLGLDPKPIS  145

Query  535  DCYASGRGKELELSYA  582
            DCY SG GKELEL YA
Sbjct  146  DCYNSGYGKELELKYA  161



>emb|CAN76152.1| hypothetical protein VITISV_012674 [Vitis vinifera]
Length=259

 Score =   212 bits (539),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 98/136 (72%), Positives = 112/136 (82%), Gaps = 0/136 (0%)
 Frame = +1

Query  175  PISCGKVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKLKGNNTFEC  354
            P    KVSL LYYESLCPYSANFI+NYL KI+ENG+I IV L L P+GNAK++GNNT +C
Sbjct  26   PSDSDKVSLGLYYESLCPYSANFIINYLVKIFENGLISIVXLNLVPFGNAKIRGNNTIDC  85

Query  355  QHGAAECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWETCYEKLGKDPKQIS  534
            QHG AECLLNT+EACAID WPDL +HF FIYC+E+LV   +Y +WETC+EKLG DPK IS
Sbjct  86   QHGPAECLLNTVEACAIDVWPDLSQHFSFIYCIETLVYEXKYPQWETCFEKLGLDPKPIS  145

Query  535  DCYASGRGKELELSYA  582
            DCY SG GKELEL YA
Sbjct  146  DCYNSGYGKELELKYA  161



>ref|XP_009369566.1| PREDICTED: gamma-interferon-inducible lysosomal thiol reductase-like 
isoform X1 [Pyrus x bretschneideri]
 ref|XP_009369567.1| PREDICTED: gamma-interferon-inducible lysosomal thiol reductase-like 
isoform X1 [Pyrus x bretschneideri]
Length=265

 Score =   208 bits (530),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 102/171 (60%), Positives = 123/171 (72%), Gaps = 12/171 (7%)
 Frame = +1

Query  106  MAGSHQQTK---ICFLVCLLFFTSLSPISC---------GKVSLDLYYESLCPYSANFIV  249
            MA S  +++      + CL      +P S          GKVSL LYYESLCPYSANFIV
Sbjct  1    MASSRLESRTLSFSLMSCLFLVAVFTPPSSAARTPPSDSGKVSLALYYESLCPYSANFIV  60

Query  250  NYLAKIYENGIIDIVDLTLFPWGNAKLKGNNTFECQHGAAECLLNTIEACAIDAWPDLKE  429
            NYL K++E+ +I IVDL L PWGNAKL+ N+TF CQHG +ECLLNT+EACAI+ WP L +
Sbjct  61   NYLVKLFEDDLISIVDLKLSPWGNAKLRSNDTFTCQHGPSECLLNTVEACAIEIWPALND  120

Query  430  HFPFIYCVESLVNNGEYSKWETCYEKLGKDPKQISDCYASGRGKELELSYA  582
            HFPFIYCVESLV   +Y +WE+CYEKLG D K I++CY+SG GKELEL YA
Sbjct  121  HFPFIYCVESLVYKHKYPQWESCYEKLGLDSKPIAECYSSGLGKELELQYA  171



>ref|XP_011089279.1| PREDICTED: gamma-interferon-inducible lysosomal thiol reductase 
isoform X1 [Sesamum indicum]
Length=256

 Score =   208 bits (530),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 93/138 (67%), Positives = 115/138 (83%), Gaps = 0/138 (0%)
 Frame = +1

Query  169  LSPISCGKVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKLKGNNTF  348
            +SPISC KV+L LYYESLCPYSA+FI++ LA+I+ NG+IDIVDL L PWGN KL GN+TF
Sbjct  23   MSPISCNKVALGLYYESLCPYSASFIIDSLARIFTNGLIDIVDLDLVPWGNTKLYGNHTF  82

Query  349  ECQHGAAECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWETCYEKLGKDPKQ  528
            +CQHG  ECLLNT+EACAID WPD+K +FPF+YCVESLV +  Y+ W+TC+EKLG D   
Sbjct  83   KCQHGPNECLLNTVEACAIDVWPDVKVYFPFVYCVESLVYHHNYTHWDTCFEKLGLDASP  142

Query  529  ISDCYASGRGKELELSYA  582
            ++DCY+  RG+ELEL YA
Sbjct  143  VADCYSGERGRELELKYA  160



>ref|XP_008234879.1| PREDICTED: gamma-interferon-inducible lysosomal thiol reductase 
[Prunus mume]
Length=268

 Score =   207 bits (528),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 95/136 (70%), Positives = 111/136 (82%), Gaps = 0/136 (0%)
 Frame = +1

Query  175  PISCGKVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKLKGNNTFEC  354
            P   GKVSL LYYESLCPYSANFIVNYL K++E+ +I IVDL L PWGNAKL+ N+TF C
Sbjct  36   PSDSGKVSLALYYESLCPYSANFIVNYLVKLFEDDLISIVDLKLSPWGNAKLRSNDTFSC  95

Query  355  QHGAAECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWETCYEKLGKDPKQIS  534
            QHG +ECLLNT+EACAI  WP L +HFPFIYC+ESLV   +Y +WE+CYEKLG D K I+
Sbjct  96   QHGPSECLLNTVEACAIKIWPALNDHFPFIYCIESLVYEHKYPQWESCYEKLGLDSKPIA  155

Query  535  DCYASGRGKELELSYA  582
            +CY+SG GKELEL YA
Sbjct  156  ECYSSGLGKELELQYA  171



>ref|XP_004294783.1| PREDICTED: gamma-interferon-inducible lysosomal thiol reductase 
isoform X1 [Fragaria vesca subsp. vesca]
Length=268

 Score =   207 bits (527),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 96/146 (66%), Positives = 113/146 (77%), Gaps = 0/146 (0%)
 Frame = +1

Query  145  VCLLFFTSLSPISCGKVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNA  324
             C     S  P+  GKVSL LYYESLCPYSANF+VNYL K++E+ +I IVDL L PWGNA
Sbjct  26   TCSASARSFMPLESGKVSLALYYESLCPYSANFVVNYLVKLFEDDLISIVDLKLVPWGNA  85

Query  325  KLKGNNTFECQHGAAECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWETCYE  504
            KL+GN+TF CQHG +ECLLNT+EACAI  WP L +HFPFIYCVESL   G+Y +WE+CYE
Sbjct  86   KLRGNDTFVCQHGPSECLLNTVEACAIKTWPALNDHFPFIYCVESLAYEGKYPQWESCYE  145

Query  505  KLGKDPKQISDCYASGRGKELELSYA  582
            KLG +   I++CY SG GKELEL YA
Sbjct  146  KLGLNSTPIAECYNSGTGKELELQYA  171



>ref|XP_010043395.1| PREDICTED: gamma-interferon-inducible lysosomal thiol reductase-like 
isoform X2 [Eucalyptus grandis]
 gb|KCW85399.1| hypothetical protein EUGRSUZ_B02223 [Eucalyptus grandis]
Length=267

 Score =   204 bits (519),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 99/168 (59%), Positives = 126/168 (75%), Gaps = 6/168 (4%)
 Frame = +1

Query  94   ASSQMAGSHQQTKICFLVCLLFFTSLSPI-----SCGKVSLDLYYESLCPYSANFIVNYL  258
            ++S +A     T +C L+ +L  +S S I     S  KVSL LYYESLCPYSA+F+VN+L
Sbjct  3    SASDLARRSLLTCLC-LIGVLSTSSSSEIALPSESSNKVSLGLYYESLCPYSADFVVNHL  61

Query  259  AKIYENGIIDIVDLTLFPWGNAKLKGNNTFECQHGAAECLLNTIEACAIDAWPDLKEHFP  438
             KI+++ ++  VDL L PWGNAK++GN TF+CQHG  ECLLNT+EACAID WPDL EHFP
Sbjct  62   PKIFDSDLVSHVDLHLVPWGNAKMRGNATFDCQHGPWECLLNTVEACAIDVWPDLSEHFP  121

Query  439  FIYCVESLVNNGEYSKWETCYEKLGKDPKQISDCYASGRGKELELSYA  582
             IYC+E LV + +Y++WE+C+E LG D K +SDCYA GRGKELEL YA
Sbjct  122  LIYCIEKLVYSHDYAQWESCFEPLGLDSKLVSDCYAGGRGKELELEYA  169



>ref|XP_003599338.1| Gamma-interferon-inducible lysosomal thiol reductase [Medicago 
truncatula]
 gb|AES69589.1| gamma interferon inducible lysosomal thiol reductase [Medicago 
truncatula]
Length=260

 Score =   203 bits (516),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 95/143 (66%), Positives = 115/143 (80%), Gaps = 1/143 (1%)
 Frame = +1

Query  157  FFTSLSPI-SCGKVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKLK  333
            FF+  SP  S  KVSL+LYYESLCPYSANFIVNYL KI+++ ++ IVDL L PWGNAKL+
Sbjct  19   FFSLFSPSQSHSKVSLELYYESLCPYSANFIVNYLPKIFKHDLLSIVDLKLVPWGNAKLR  78

Query  334  GNNTFECQHGAAECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWETCYEKLG  513
            GN+TF+CQHG  ECLLNT+EACAID WP L++HF FIYCVE L   G+ ++WE+C+EKLG
Sbjct  79   GNSTFDCQHGPYECLLNTVEACAIDIWPQLEKHFSFIYCVEDLAYQGKRTEWESCFEKLG  138

Query  514  KDPKQISDCYASGRGKELELSYA  582
             D K ++DCY S RG ELEL YA
Sbjct  139  LDSKLVNDCYRSERGNELELKYA  161



>gb|AFK44126.1| unknown [Medicago truncatula]
Length=260

 Score =   203 bits (516),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 95/143 (66%), Positives = 114/143 (80%), Gaps = 1/143 (1%)
 Frame = +1

Query  157  FFTSLSPI-SCGKVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKLK  333
            FF+  SP  S  KVSL+LYYESLCPYSANFIVNYL KI+++ ++ IVDL L PWGNAKL+
Sbjct  19   FFSLFSPSQSHSKVSLELYYESLCPYSANFIVNYLPKIFKHDLLSIVDLKLVPWGNAKLR  78

Query  334  GNNTFECQHGAAECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWETCYEKLG  513
            GN+TF+CQHG  ECLLNT+EACAID WP L+ HF FIYCVE L   G+ ++WE+C+EKLG
Sbjct  79   GNSTFDCQHGPYECLLNTVEACAIDIWPQLERHFSFIYCVEDLAYQGKRTEWESCFEKLG  138

Query  514  KDPKQISDCYASGRGKELELSYA  582
             D K ++DCY S RG ELEL YA
Sbjct  139  LDSKLVNDCYRSERGNELELKYA  161



>ref|XP_007016964.1| Thioredoxin superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY34583.1| Thioredoxin superfamily protein isoform 1 [Theobroma cacao]
Length=259

 Score =   203 bits (516),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 96/136 (71%), Positives = 110/136 (81%), Gaps = 0/136 (0%)
 Frame = +1

Query  175  PISCGKVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKLKGNNTFEC  354
            P    KVSL LYYESLCPYSANFIVNYL K++E+ ++ IVDL L PWGNAKLKGN+TF C
Sbjct  31   PSDSHKVSLTLYYESLCPYSANFIVNYLGKLFEDDLLSIVDLRLVPWGNAKLKGNDTFAC  90

Query  355  QHGAAECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWETCYEKLGKDPKQIS  534
            QHG  ECLLNTIEACAIDAWP L +HFPFIYCVE+LV   +Y +WE+CY KLG D K IS
Sbjct  91   QHGPGECLLNTIEACAIDAWPQLNDHFPFIYCVETLVYELKYLEWESCYGKLGLDSKPIS  150

Query  535  DCYASGRGKELELSYA  582
            DCY++G G +LEL YA
Sbjct  151  DCYSNGLGLKLELQYA  166



>ref|XP_007016966.1| Thioredoxin superfamily protein isoform 3 [Theobroma cacao]
 gb|EOY34585.1| Thioredoxin superfamily protein isoform 3 [Theobroma cacao]
Length=270

 Score =   203 bits (516),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 96/136 (71%), Positives = 110/136 (81%), Gaps = 0/136 (0%)
 Frame = +1

Query  175  PISCGKVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKLKGNNTFEC  354
            P    KVSL LYYESLCPYSANFIVNYL K++E+ ++ IVDL L PWGNAKLKGN+TF C
Sbjct  31   PSDSHKVSLTLYYESLCPYSANFIVNYLGKLFEDDLLSIVDLRLVPWGNAKLKGNDTFAC  90

Query  355  QHGAAECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWETCYEKLGKDPKQIS  534
            QHG  ECLLNTIEACAIDAWP L +HFPFIYCVE+LV   +Y +WE+CY KLG D K IS
Sbjct  91   QHGPGECLLNTIEACAIDAWPQLNDHFPFIYCVETLVYELKYLEWESCYGKLGLDSKPIS  150

Query  535  DCYASGRGKELELSYA  582
            DCY++G G +LEL YA
Sbjct  151  DCYSNGLGLKLELQYA  166



>ref|XP_010685916.1| PREDICTED: gamma-interferon-inducible lysosomal thiol reductase-like 
[Beta vulgaris subsp. vulgaris]
Length=249

 Score =   201 bits (510),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 96/150 (64%), Positives = 114/150 (76%), Gaps = 3/150 (2%)
 Frame = +1

Query  133  ICFLVCLLFFTSLSPISCGKVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFP  312
            I  +V + F  S SP    KVSLDLYYESLCPYSANFI+N L  I++NGIIDIVDL LFP
Sbjct  14   ILTMVQICFGASNSP---QKVSLDLYYESLCPYSANFIINELTDIFDNGIIDIVDLRLFP  70

Query  313  WGNAKLKGNNTFECQHGAAECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWE  492
            WGNAK   NN+F CQHG  EC LNT+EACAIDAWP+L +HFPFI CVES V  G+YS+W+
Sbjct  71   WGNAKRTSNNSFTCQHGPRECFLNTVEACAIDAWPNLDDHFPFINCVESRVYEGKYSQWD  130

Query  493  TCYEKLGKDPKQISDCYASGRGKELELSYA  582
            TC+++L  DPK ++ CY    GK+LEL YA
Sbjct  131  TCFKELNLDPKPVTSCYKGEEGKKLELKYA  160



>ref|XP_006425132.1| hypothetical protein CICLE_v10029177mg [Citrus clementina]
 gb|ESR38372.1| hypothetical protein CICLE_v10029177mg [Citrus clementina]
Length=243

 Score =   199 bits (507),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 96/154 (62%), Positives = 117/154 (76%), Gaps = 2/154 (1%)
 Frame = +1

Query  127  TKICFLVCLLFFTSLSPISC-GKVSLDLYYESLCPYSANFIVNYLAKIYEN-GIIDIVDL  300
            T  CFL   +  +  SP     KV L LYYESLCPYSANFI+NYL KI+E+  ++ IVDL
Sbjct  19   TLFCFLSGFVSASRTSPSDVNSKVKLGLYYESLCPYSANFIINYLVKIFEDVDLLSIVDL  78

Query  301  TLFPWGNAKLKGNNTFECQHGAAECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEY  480
             L PWGNAK++ N+TF+CQHG +ECLLNT+EACAID+WP+L +HFPFIYC+ESLV   +Y
Sbjct  79   HLSPWGNAKIRANSTFDCQHGPSECLLNTVEACAIDSWPELNKHFPFIYCIESLVYEHKY  138

Query  481  SKWETCYEKLGKDPKQISDCYASGRGKELELSYA  582
            S WETC++KL  DPK I DCY SG G +LEL YA
Sbjct  139  SHWETCFDKLELDPKPIVDCYTSGYGTQLELKYA  172



>gb|KDP45780.1| hypothetical protein JCGZ_17387 [Jatropha curcas]
Length=264

 Score =   200 bits (508),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 97/160 (61%), Positives = 121/160 (76%), Gaps = 3/160 (2%)
 Frame = +1

Query  112  GSHQQTKICFLVCLLFFTSLSPISC--GKVSLDLYYESLCPYSANFIVNYLAKIYENG-I  282
             S  +  + FLV L  F S S  S   GKVSL LYYESLCPYSANFI+N L +++E+  +
Sbjct  2    ASPPKITLSFLVYLCLFCSFSRASSDSGKVSLGLYYESLCPYSANFIINDLVELFEDDEL  61

Query  283  IDIVDLTLFPWGNAKLKGNNTFECQHGAAECLLNTIEACAIDAWPDLKEHFPFIYCVESL  462
              +VDL L PWGNA+LKGN++F CQHG +ECLLNT+EACAI+ WP L+EHFPFIYC+ESL
Sbjct  62   FSVVDLHLSPWGNARLKGNDSFVCQHGPSECLLNTVEACAINVWPQLEEHFPFIYCIESL  121

Query  463  VNNGEYSKWETCYEKLGKDPKQISDCYASGRGKELELSYA  582
            V+  ++ +WE+C+E LG DPK + DCY SG GKELEL YA
Sbjct  122  VHERKFPEWESCFETLGLDPKPVIDCYNSGYGKELELQYA  161



>gb|KDO66987.1| hypothetical protein CISIN_1g026069mg [Citrus sinensis]
Length=201

 Score =   197 bits (500),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 97/155 (63%), Positives = 118/155 (76%), Gaps = 3/155 (2%)
 Frame = +1

Query  127  TKICFLVCLLFFTSLSPISC-GKVSLDLYYESLCPYSANFIVNYLAKIYEN-GIIDIVDL  300
            T  CFL   +  +  SP     KV L LYYESLCPYSANFI+NYL KI+E+  ++ IVDL
Sbjct  19   TLFCFLSGSVSASRTSPSDVNSKVKLGLYYESLCPYSANFIINYLVKIFEDVDLLSIVDL  78

Query  301  TLFPWGNAKLKGNN-TFECQHGAAECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGE  477
             L PWGNAK++ NN TF+CQHG +ECLLNT+EACAID+WP+L +HFPFIYC+ESLV   +
Sbjct  79   HLSPWGNAKIRANNSTFDCQHGPSECLLNTVEACAIDSWPELNKHFPFIYCIESLVYEHK  138

Query  478  YSKWETCYEKLGKDPKQISDCYASGRGKELELSYA  582
            YS+WETC++KL  DPK I DCY SG G +LEL YA
Sbjct  139  YSQWETCFDKLELDPKPIVDCYTSGYGTQLELKYA  173



>ref|XP_004500307.1| PREDICTED: gamma-interferon-inducible lysosomal thiol reductase-like 
[Cicer arietinum]
Length=256

 Score =   198 bits (503),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 92/132 (70%), Positives = 105/132 (80%), Gaps = 0/132 (0%)
 Frame = +1

Query  187  GKVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKLKGNNTFECQHGA  366
             KVSL+LYYESLCPY +NFIVNYL KI+E  +I IVDL L PWGNAKL+GN+TF+CQHG 
Sbjct  28   NKVSLELYYESLCPYCSNFIVNYLPKIFEQDLISIVDLKLVPWGNAKLRGNSTFDCQHGP  87

Query  367  AECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWETCYEKLGKDPKQISDCYA  546
             ECLLNT+EACAID WP L +HFPFIYCVE LV  G+  +WE+CYEKLG D   I DCY 
Sbjct  88   NECLLNTVEACAIDIWPQLSKHFPFIYCVEDLVYEGKRDEWESCYEKLGLDSTLIDDCYR  147

Query  547  SGRGKELELSYA  582
            S  GKEL+L YA
Sbjct  148  SEHGKELDLKYA  159



>ref|XP_010685915.1| PREDICTED: gamma-interferon-inducible lysosomal thiol reductase-like 
[Beta vulgaris subsp. vulgaris]
Length=247

 Score =   197 bits (502),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 89/134 (66%), Positives = 107/134 (80%), Gaps = 0/134 (0%)
 Frame = +1

Query  181  SCGKVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKLKGNNTFECQH  360
            S GKV LDLYYESLCPY ANFIVN L  I++NGIIDIVDL LFPWGNA+L  NN+F CQH
Sbjct  28   SAGKVPLDLYYESLCPYCANFIVNELPIIFKNGIIDIVDLRLFPWGNARLTSNNSFICQH  87

Query  361  GAAECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWETCYEKLGKDPKQISDC  540
            G  ECL NT+EACAIDAWP+L +HFPFI CVES ++ G+Y++W TC+++LG DPK ++ C
Sbjct  88   GPNECLFNTVEACAIDAWPNLDDHFPFIKCVESQIHEGKYTQWATCFKELGLDPKPVTSC  147

Query  541  YASGRGKELELSYA  582
            Y    GK+L L YA
Sbjct  148  YNGAYGKQLVLKYA  161



>ref|XP_007016965.1| Thioredoxin superfamily protein isoform 2 [Theobroma cacao]
 gb|EOY34584.1| Thioredoxin superfamily protein isoform 2 [Theobroma cacao]
Length=218

 Score =   196 bits (498),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 91/128 (71%), Positives = 104/128 (81%), Gaps = 0/128 (0%)
 Frame = +1

Query  175  PISCGKVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKLKGNNTFEC  354
            P    KVSL LYYESLCPYSANFIVNYL K++E+ ++ IVDL L PWGNAKLKGN+TF C
Sbjct  31   PSDSHKVSLTLYYESLCPYSANFIVNYLGKLFEDDLLSIVDLRLVPWGNAKLKGNDTFAC  90

Query  355  QHGAAECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWETCYEKLGKDPKQIS  534
            QHG  ECLLNTIEACAIDAWP L +HFPFIYCVE+LV   +Y +WE+CY KLG D K IS
Sbjct  91   QHGPGECLLNTIEACAIDAWPQLNDHFPFIYCVETLVYELKYLEWESCYGKLGLDSKPIS  150

Query  535  DCYASGRG  558
            DCY++G G
Sbjct  151  DCYSNGLG  158



>gb|KDO66986.1| hypothetical protein CISIN_1g026069mg [Citrus sinensis]
Length=244

 Score =   196 bits (499),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 97/155 (63%), Positives = 118/155 (76%), Gaps = 3/155 (2%)
 Frame = +1

Query  127  TKICFLVCLLFFTSLSPISC-GKVSLDLYYESLCPYSANFIVNYLAKIYEN-GIIDIVDL  300
            T  CFL   +  +  SP     KV L LYYESLCPYSANFI+NYL KI+E+  ++ IVDL
Sbjct  19   TLFCFLSGSVSASRTSPSDVNSKVKLGLYYESLCPYSANFIINYLVKIFEDVDLLSIVDL  78

Query  301  TLFPWGNAKLKGNN-TFECQHGAAECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGE  477
             L PWGNAK++ NN TF+CQHG +ECLLNT+EACAID+WP+L +HFPFIYC+ESLV   +
Sbjct  79   HLSPWGNAKIRANNSTFDCQHGPSECLLNTVEACAIDSWPELNKHFPFIYCIESLVYEHK  138

Query  478  YSKWETCYEKLGKDPKQISDCYASGRGKELELSYA  582
            YS+WETC++KL  DPK I DCY SG G +LEL YA
Sbjct  139  YSQWETCFDKLELDPKPIVDCYTSGYGTQLELKYA  173



>ref|XP_002313228.1| hypothetical protein POPTR_0009s08000g [Populus trichocarpa]
 gb|EEE87183.1| hypothetical protein POPTR_0009s08000g [Populus trichocarpa]
Length=255

 Score =   196 bits (498),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 91/141 (65%), Positives = 113/141 (80%), Gaps = 1/141 (1%)
 Frame = +1

Query  163  TSLSPISCGKVSLDLYYESLCPYSANFIVNYLAKIYENG-IIDIVDLTLFPWGNAKLKGN  339
            T++ P +  KVSL LYYESLCPYSANFIVNYL K+ E+  ++ IVDL L PWGNAK++GN
Sbjct  26   TTILPSNSDKVSLALYYESLCPYSANFIVNYLDKLVEDDDLLSIVDLYLSPWGNAKIRGN  85

Query  340  NTFECQHGAAECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWETCYEKLGKD  519
            +TF CQHG  ECLLNT+EACAI AWP L++HFPF+YCVE LV   +Y +WE+C+E+LG D
Sbjct  86   DTFVCQHGPYECLLNTVEACAIHAWPKLEDHFPFVYCVEKLVYERKYPEWESCFEELGLD  145

Query  520  PKQISDCYASGRGKELELSYA  582
            PK++S+CY  G G ELEL YA
Sbjct  146  PKRVSECYTGGYGNELELEYA  166



>ref|XP_006488571.1| PREDICTED: gamma-interferon-inducible lysosomal thiol reductase-like 
[Citrus sinensis]
Length=244

 Score =   196 bits (497),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 97/155 (63%), Positives = 118/155 (76%), Gaps = 3/155 (2%)
 Frame = +1

Query  127  TKICFLVCLLFFTSLSPISC-GKVSLDLYYESLCPYSANFIVNYLAKIYEN-GIIDIVDL  300
            T  CFL   +  +  SP     KV L LYYESLCPYSANFI+NYL KI+E+  ++ IVDL
Sbjct  19   TLFCFLSGSVSASRTSPSDVNSKVKLGLYYESLCPYSANFIINYLVKIFEDVDLLSIVDL  78

Query  301  TLFPWGNAKLKGNN-TFECQHGAAECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGE  477
             L PWGNAK++ NN TF+CQHG +ECLLNT+EACAID+WP+L +HFPFIYC+ESLV   +
Sbjct  79   HLSPWGNAKIRANNSTFDCQHGPSECLLNTVEACAIDSWPELNKHFPFIYCIESLVYEHK  138

Query  478  YSKWETCYEKLGKDPKQISDCYASGRGKELELSYA  582
            YS+WETC++KL  DPK I DCY SG G +LEL YA
Sbjct  139  YSQWETCFDKLELDPKPIVDCYTSGYGTQLELKYA  173



>gb|KHG16010.1| Gamma-interferon-inducible lysosomal thiol reductase [Gossypium 
arboreum]
Length=257

 Score =   194 bits (494),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 96/154 (62%), Positives = 116/154 (75%), Gaps = 4/154 (3%)
 Frame = +1

Query  133  ICFLVCLLFFTSLSPIS----CGKVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDL  300
            +C L  L  F S S IS      KVSL LYYESLCPYSANFIVNYL K++   +I IVDL
Sbjct  11   LCCLSLLGSFASASTISLPSDSRKVSLTLYYESLCPYSANFIVNYLPKLFNEDLISIVDL  70

Query  301  TLFPWGNAKLKGNNTFECQHGAAECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEY  480
             L PWGNAKLKGN+TF+CQHG  ECLLNT+EACAIDAWP L +HFPFIYCVE+L    + 
Sbjct  71   RLVPWGNAKLKGNDTFDCQHGPTECLLNTVEACAIDAWPKLNDHFPFIYCVENLELERKP  130

Query  481  SKWETCYEKLGKDPKQISDCYASGRGKELELSYA  582
             +WE+C++KLG + K ++DCY SG G++L+L YA
Sbjct  131  LEWESCFKKLGLESKPVNDCYKSGLGQKLDLQYA  164



>ref|XP_011003523.1| PREDICTED: gamma-interferon-inducible lysosomal thiol reductase-like 
[Populus euphratica]
Length=254

 Score =   194 bits (494),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 90/137 (66%), Positives = 110/137 (80%), Gaps = 1/137 (1%)
 Frame = +1

Query  175  PISCGKVSLDLYYESLCPYSANFIVNYLAKIYENG-IIDIVDLTLFPWGNAKLKGNNTFE  351
            P +  KVSL+LYYESLCPYSANFIVNYL K+ E+  ++ IVDL L PWGNAK++GN+TF 
Sbjct  29   PSNSDKVSLELYYESLCPYSANFIVNYLDKLVEDDDLLSIVDLYLSPWGNAKIRGNDTFV  88

Query  352  CQHGAAECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWETCYEKLGKDPKQI  531
            CQHG  ECLLNT+EACAI AWP L++HFPF+YCVE LV   +Y +WE+C+E+LG DPK +
Sbjct  89   CQHGPYECLLNTVEACAIHAWPKLEDHFPFVYCVEKLVYERKYPEWESCFEELGLDPKPV  148

Query  532  SDCYASGRGKELELSYA  582
            S+CY  G G ELEL YA
Sbjct  149  SECYTGGYGNELELEYA  165



>ref|XP_004240418.1| PREDICTED: GILT-like protein F37H8.5 [Solanum lycopersicum]
Length=237

 Score =   194 bits (492),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 91/140 (65%), Positives = 108/140 (77%), Gaps = 1/140 (1%)
 Frame = +1

Query  166  SLSPISC-GKVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKLKGNN  342
              S ISC  KVSL LYYESLCP  +NFIVNYL KI+ NGIID VDL L PWGN K+  NN
Sbjct  22   QFSSISCEKKVSLALYYESLCPGCSNFIVNYLPKIFRNGIIDFVDLKLVPWGNTKILPNN  81

Query  343  TFECQHGAAECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWETCYEKLGKDP  522
            TF+CQHG AEC L+T+EACA+D WP+L EHFPFI+CVESL+ +  Y++WETC+EKL    
Sbjct  82   TFKCQHGPAECFLDTVEACALDVWPNLNEHFPFIHCVESLIYHKNYTQWETCFEKLNLRK  141

Query  523  KQISDCYASGRGKELELSYA  582
            K ++DC  S RGKELEL +A
Sbjct  142  KLVTDCVGSDRGKELELRHA  161



>gb|KJB21243.1| hypothetical protein B456_003G149000 [Gossypium raimondii]
Length=198

 Score =   192 bits (488),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 96/154 (62%), Positives = 115/154 (75%), Gaps = 4/154 (3%)
 Frame = +1

Query  133  ICFLVCLLFFTSLSPIS----CGKVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDL  300
            +C L  L  F S S IS      KVSL LYYESLCPYSANFIVNYL K++   +I IVDL
Sbjct  11   LCCLSLLGSFASASTISLPSDSRKVSLTLYYESLCPYSANFIVNYLPKLFNEDLISIVDL  70

Query  301  TLFPWGNAKLKGNNTFECQHGAAECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEY  480
             L PWGNAKLKGN TF+CQHG  ECLLNT+EACAIDAWP L +HFPFIYCVE+L    + 
Sbjct  71   RLVPWGNAKLKGNGTFDCQHGPTECLLNTVEACAIDAWPKLNDHFPFIYCVENLELERKP  130

Query  481  SKWETCYEKLGKDPKQISDCYASGRGKELELSYA  582
             +WE+C++KLG + K ++DCY SG G++L+L YA
Sbjct  131  LEWESCFKKLGLESKPVNDCYNSGLGQKLDLQYA  164



>gb|KDO66988.1| hypothetical protein CISIN_1g026069mg [Citrus sinensis]
 gb|KDO66989.1| hypothetical protein CISIN_1g026069mg [Citrus sinensis]
Length=173

 Score =   191 bits (484),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 93/153 (61%), Positives = 116/153 (76%), Gaps = 3/153 (2%)
 Frame = +1

Query  127  TKICFLVCLLFFTSLSPISC-GKVSLDLYYESLCPYSANFIVNYLAKIYEN-GIIDIVDL  300
            T  CFL   +  +  SP     KV L LYYESLCPYSANFI+NYL KI+E+  ++ IVDL
Sbjct  19   TLFCFLSGSVSASRTSPSDVNSKVKLGLYYESLCPYSANFIINYLVKIFEDVDLLSIVDL  78

Query  301  TLFPWGNAKLKGNN-TFECQHGAAECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGE  477
             L PWGNAK++ NN TF+CQHG +ECLLNT+EACAID+WP+L +HFPFIYC+ESLV   +
Sbjct  79   HLSPWGNAKIRANNSTFDCQHGPSECLLNTVEACAIDSWPELNKHFPFIYCIESLVYEHK  138

Query  478  YSKWETCYEKLGKDPKQISDCYASGRGKELELS  576
            YS+WETC++KL  DPK I DCY SG G ++ L+
Sbjct  139  YSQWETCFDKLELDPKPIVDCYTSGYGTQVSLA  171



>gb|KJB21241.1| hypothetical protein B456_003G149000 [Gossypium raimondii]
Length=257

 Score =   193 bits (491),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 96/154 (62%), Positives = 115/154 (75%), Gaps = 4/154 (3%)
 Frame = +1

Query  133  ICFLVCLLFFTSLSPIS----CGKVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDL  300
            +C L  L  F S S IS      KVSL LYYESLCPYSANFIVNYL K++   +I IVDL
Sbjct  11   LCCLSLLGSFASASTISLPSDSRKVSLTLYYESLCPYSANFIVNYLPKLFNEDLISIVDL  70

Query  301  TLFPWGNAKLKGNNTFECQHGAAECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEY  480
             L PWGNAKLKGN TF+CQHG  ECLLNT+EACAIDAWP L +HFPFIYCVE+L    + 
Sbjct  71   RLVPWGNAKLKGNGTFDCQHGPTECLLNTVEACAIDAWPKLNDHFPFIYCVENLELERKP  130

Query  481  SKWETCYEKLGKDPKQISDCYASGRGKELELSYA  582
             +WE+C++KLG + K ++DCY SG G++L+L YA
Sbjct  131  LEWESCFKKLGLESKPVNDCYNSGLGQKLDLQYA  164



>ref|XP_010089536.1| hypothetical protein L484_011700 [Morus notabilis]
 gb|EXB37975.1| hypothetical protein L484_011700 [Morus notabilis]
Length=260

 Score =   192 bits (489),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 93/160 (58%), Positives = 115/160 (72%), Gaps = 13/160 (8%)
 Frame = +1

Query  142  LVCLLFFTSLSPI------------SCGKVSLDLYYESLCPYSANFIVNYLAKIYENGII  285
            L CL+ F S  P               GKVSL LYYESLCP+SA+F+VNYL K++E+ +I
Sbjct  15   LSCLVSFVSFCPSPSWALKSEILASDSGKVSLGLYYESLCPFSASFVVNYLVKLFEDDLI  74

Query  286  DIVDLTLFPWGNAKLKGNN-TFECQHGAAECLLNTIEACAIDAWPDLKEHFPFIYCVESL  462
             IVDL L PWGNAK++G+N T  CQHG  ECLLNT+EACAID WP+L +HFPFIYC+E L
Sbjct  75   SIVDLNLVPWGNAKIRGSNYTVVCQHGTYECLLNTVEACAIDIWPELNKHFPFIYCIEEL  134

Query  463  VNNGEYSKWETCYEKLGKDPKQISDCYASGRGKELELSYA  582
            V   +Y++WE+C+EKL  DPK ++DCY    GKELEL YA
Sbjct  135  VFERKYTQWESCFEKLNLDPKPVTDCYTGEYGKELELRYA  174



>ref|XP_010937929.1| PREDICTED: gamma-interferon-inducible lysosomal thiol reductase 
isoform X1 [Elaeis guineensis]
Length=254

 Score =   192 bits (488),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 91/150 (61%), Positives = 113/150 (75%), Gaps = 1/150 (1%)
 Frame = +1

Query  133  ICFLVCLLFFTSLSPISCGKVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFP  312
            + FL+    F S SP+S  KV L LYYE+LCPY +NFIVNYLAKI+ENG+IDI++L L P
Sbjct  9    VFFLISSSCFAS-SPVSARKVPLALYYETLCPYCSNFIVNYLAKIFENGLIDIIELDLIP  67

Query  313  WGNAKLKGNNTFECQHGAAECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWE  492
            +GNA++  N+T  CQHG  EC+LNT+EACAI AWPD+ EHF FIYCVESLV   +Y +WE
Sbjct  68   YGNARIGSNDTISCQHGPNECVLNTVEACAITAWPDVSEHFSFIYCVESLVMEHKYLEWE  127

Query  493  TCYEKLGKDPKQISDCYASGRGKELELSYA  582
            +C+ K G D   + DCY SG GK+LEL YA
Sbjct  128  SCFSKTGLDSNAVLDCYKSGYGKKLELHYA  157



>gb|KCW85398.1| hypothetical protein EUGRSUZ_B02223 [Eucalyptus grandis]
Length=194

 Score =   190 bits (482),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 84/132 (64%), Positives = 107/132 (81%), Gaps = 0/132 (0%)
 Frame = +1

Query  187  GKVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKLKGNNTFECQHGA  366
            GKV L LYYE+LCPY +NF+VN+L K++++G+I I+DL L P+GNA++  N+T  CQHG 
Sbjct  38   GKVELALYYETLCPYCSNFVVNHLFKVFDSGLISILDLKLVPYGNARIGANDTVTCQHGP  97

Query  367  AECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWETCYEKLGKDPKQISDCYA  546
             ECLLNT+EACAID WPDL EHFP IYC+E LV + +Y++WE+C+E LG D K +SDCYA
Sbjct  98   WECLLNTVEACAIDVWPDLSEHFPLIYCIEKLVYSHDYAQWESCFEPLGLDSKLVSDCYA  157

Query  547  SGRGKELELSYA  582
             GRGKELEL YA
Sbjct  158  GGRGKELELEYA  169



>ref|XP_006344118.1| PREDICTED: GILT-like protein F37H8.5-like [Solanum tuberosum]
Length=242

 Score =   191 bits (484),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 88/142 (62%), Positives = 109/142 (77%), Gaps = 1/142 (1%)
 Frame = +1

Query  160  FTSLSPISC-GKVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKLKG  336
            F   S ISC  KVSL LYYESLCP  ++FIVNYL KI++NG+ID VDL L PWGN K++ 
Sbjct  25   FIQFSSISCEKKVSLALYYESLCPGCSDFIVNYLPKIFKNGMIDFVDLKLVPWGNTKIQP  84

Query  337  NNTFECQHGAAECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWETCYEKLGK  516
            NNTF+CQHG AEC L+T+EACA+D WPDL EHFPFI+CVES + +  Y++WETC+EKL  
Sbjct  85   NNTFKCQHGPAECFLDTVEACALDVWPDLNEHFPFIHCVESWIYHKNYTQWETCFEKLNL  144

Query  517  DPKQISDCYASGRGKELELSYA  582
              K ++DC    RGK+LEL +A
Sbjct  145  KKKLVTDCVGGDRGKQLELRHA  166



>ref|XP_002275261.1| PREDICTED: gamma-interferon-inducible lysosomal thiol reductase 
isoform X1 [Vitis vinifera]
Length=284

 Score =   192 bits (487),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 91/141 (65%), Positives = 108/141 (77%), Gaps = 2/141 (1%)
 Frame = +1

Query  166  SLSPISCGKVSLDLYYESLCPYSANFIVNYLAKIYENG--IIDIVDLTLFPWGNAKLKGN  339
            S+S     KV L LYYE+LCPY +NFIVN+L K++ NG  ++ IVDL L P+GNAK+  N
Sbjct  46   SISASEAEKVPLALYYETLCPYCSNFIVNHLIKLFNNGDGLVSIVDLKLLPYGNAKIGPN  105

Query  340  NTFECQHGAAECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWETCYEKLGKD  519
             T  CQHG AECLLNT+EACAID WPDL +HF FIYC+E+LV   +Y +WETC+EKLG D
Sbjct  106  GTITCQHGPAECLLNTVEACAIDVWPDLSQHFSFIYCIETLVYERKYPQWETCFEKLGLD  165

Query  520  PKQISDCYASGRGKELELSYA  582
            PK ISDCY SG GKELEL YA
Sbjct  166  PKPISDCYNSGYGKELELKYA  186



>ref|XP_010043394.1| PREDICTED: gamma-interferon-inducible lysosomal thiol reductase-like 
isoform X1 [Eucalyptus grandis]
 gb|KCW85397.1| hypothetical protein EUGRSUZ_B02223 [Eucalyptus grandis]
Length=267

 Score =   191 bits (486),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 84/132 (64%), Positives = 107/132 (81%), Gaps = 0/132 (0%)
 Frame = +1

Query  187  GKVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKLKGNNTFECQHGA  366
            GKV L LYYE+LCPY +NF+VN+L K++++G+I I+DL L P+GNA++  N+T  CQHG 
Sbjct  38   GKVELALYYETLCPYCSNFVVNHLFKVFDSGLISILDLKLVPYGNARIGANDTVTCQHGP  97

Query  367  AECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWETCYEKLGKDPKQISDCYA  546
             ECLLNT+EACAID WPDL EHFP IYC+E LV + +Y++WE+C+E LG D K +SDCYA
Sbjct  98   WECLLNTVEACAIDVWPDLSEHFPLIYCIEKLVYSHDYAQWESCFEPLGLDSKLVSDCYA  157

Query  547  SGRGKELELSYA  582
             GRGKELEL YA
Sbjct  158  GGRGKELELEYA  169



>emb|CDY06674.1| BnaA10g04530D [Brassica napus]
Length=260

 Score =   189 bits (481),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 88/135 (65%), Positives = 108/135 (80%), Gaps = 1/135 (1%)
 Frame = +1

Query  181  SCGKVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKLKGNN-TFECQ  357
            S  KVSL LYYESLCPY ++FIVN+L K++E+G+I IVDL L PWGN+KL+ +N T  CQ
Sbjct  35   SSSKVSLGLYYESLCPYCSSFIVNHLTKLFEDGLISIVDLHLSPWGNSKLRSDNVTVLCQ  94

Query  358  HGAAECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWETCYEKLGKDPKQISD  537
            HGA EC L+T+EACAID WP+L++HFPFIYCVESLV   +Y KWETCYEKL    K ++D
Sbjct  95   HGAYECFLDTVEACAIDVWPELRDHFPFIYCVESLVIEHKYKKWETCYEKLNLSSKPVAD  154

Query  538  CYASGRGKELELSYA  582
            C +SG GKEL+L YA
Sbjct  155  CLSSGHGKELQLQYA  169



>ref|XP_009118998.1| PREDICTED: gamma-interferon-inducible lysosomal thiol reductase-like 
[Brassica rapa]
Length=260

 Score =   189 bits (480),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 88/135 (65%), Positives = 108/135 (80%), Gaps = 1/135 (1%)
 Frame = +1

Query  181  SCGKVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKLKGNN-TFECQ  357
            S  KVSL LYYESLCPY ++FIVN+L K++E+G+I IVDL L PWGN+KL+ +N T  CQ
Sbjct  35   SSSKVSLGLYYESLCPYCSSFIVNHLTKLFEDGLISIVDLHLSPWGNSKLRSDNVTVLCQ  94

Query  358  HGAAECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWETCYEKLGKDPKQISD  537
            HGA EC L+T+EACAID WP+L++HFPFIYCVESLV   +Y KWETCYEKL    K ++D
Sbjct  95   HGAYECFLDTVEACAIDVWPELRDHFPFIYCVESLVIEHKYKKWETCYEKLNLSSKPVAD  154

Query  538  CYASGRGKELELSYA  582
            C +SG GKEL+L YA
Sbjct  155  CLSSGHGKELQLQYA  169



>ref|XP_004145238.1| PREDICTED: gamma-interferon-inducible lysosomal thiol reductase-like 
[Cucumis sativus]
 ref|XP_004153541.1| PREDICTED: gamma-interferon-inducible lysosomal thiol reductase-like 
[Cucumis sativus]
 ref|XP_004164407.1| PREDICTED: gamma-interferon-inducible lysosomal thiol reductase-like 
[Cucumis sativus]
 gb|KGN65849.1| hypothetical protein Csa_1G533560 [Cucumis sativus]
Length=223

 Score =   188 bits (477),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 88/140 (63%), Positives = 111/140 (79%), Gaps = 0/140 (0%)
 Frame = +1

Query  163  TSLSPISCGKVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKLKGNN  342
             S S     KVSL LYYESLCPYSANFIVNYL K++++ +I IVDL L P+GNA++  N+
Sbjct  29   ASTSTYGTHKVSLKLYYESLCPYSANFIVNYLIKLFDDDLISIVDLRLVPYGNARVGRND  88

Query  343  TFECQHGAAECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWETCYEKLGKDP  522
            +  CQHG +ECLLNT+EACAI+AWP+L  HFPFIYCVE LV   +Y++WE+C+EKLG +P
Sbjct  89   SITCQHGPSECLLNTMEACAINAWPELDGHFPFIYCVEYLVYKRKYTQWESCFEKLGLNP  148

Query  523  KQISDCYASGRGKELELSYA  582
            K ISDCY++  GK+LEL YA
Sbjct  149  KPISDCYSTELGKKLELEYA  168



>ref|XP_010264555.1| PREDICTED: gamma-interferon-inducible lysosomal thiol reductase 
isoform X1 [Nelumbo nucifera]
Length=258

 Score =   189 bits (479),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 85/132 (64%), Positives = 106/132 (80%), Gaps = 0/132 (0%)
 Frame = +1

Query  187  GKVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKLKGNNTFECQHGA  366
            GKVSL LYYE+LCPY ++FIV +LA ++E G+I IVDL L P+GNAK+  NNT  CQHG+
Sbjct  36   GKVSLALYYETLCPYCSSFIVKHLANVFEKGLIKIVDLKLVPYGNAKVGSNNTITCQHGS  95

Query  367  AECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWETCYEKLGKDPKQISDCYA  546
             ECLLNT+EACAI+ WPDL +HF FIYC+E LV  G+Y++WE+C+ K+G DPK I+DCY 
Sbjct  96   YECLLNTVEACAINVWPDLNKHFTFIYCIEHLVTQGKYNEWESCFGKMGLDPKPIADCYN  155

Query  547  SGRGKELELSYA  582
             G GKELEL YA
Sbjct  156  DGYGKELELRYA  167



>emb|CDP09237.1| unnamed protein product [Coffea canephora]
Length=247

 Score =   188 bits (478),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 85/138 (62%), Positives = 109/138 (79%), Gaps = 0/138 (0%)
 Frame = +1

Query  169  LSPISCGKVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKLKGNNTF  348
            ++  S  KV+L+LYYE+LCPY ANFIVNYL K+++ G+I+I DL L P+GNAK++ ++T 
Sbjct  11   IAATSSDKVTLELYYETLCPYCANFIVNYLYKLFDTGLIEITDLKLVPYGNAKIRPDSTV  70

Query  349  ECQHGAAECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWETCYEKLGKDPKQ  528
             CQHG  ECLLNTIEACAID WPD+  HFPFIYCVE L+ +G+ ++WETC+ KLG D K 
Sbjct  71   VCQHGPYECLLNTIEACAIDVWPDVHAHFPFIYCVEKLIYDGKKTEWETCFLKLGLDEKP  130

Query  529  ISDCYASGRGKELELSYA  582
            ++DCY SGRGKEL L  A
Sbjct  131  VTDCYESGRGKELNLRNA  148



>ref|XP_008457559.1| PREDICTED: gamma-interferon-inducible lysosomal thiol reductase-like, 
partial [Cucumis melo]
Length=227

 Score =   187 bits (475),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 88/140 (63%), Positives = 110/140 (79%), Gaps = 0/140 (0%)
 Frame = +1

Query  163  TSLSPISCGKVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKLKGNN  342
             S S     KVSL LYYESLCPYSANFIVNYL K++++ +I IVDL+L P+GNA++  N+
Sbjct  33   ASTSNYGTHKVSLKLYYESLCPYSANFIVNYLVKLFDDDLISIVDLSLVPYGNARVGRND  92

Query  343  TFECQHGAAECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWETCYEKLGKDP  522
            +  CQHG  ECLLNT+EACAI+AWP+L  HFPFIYCVE LV   +Y++WE+C+EKLG +P
Sbjct  93   SITCQHGPNECLLNTVEACAINAWPELDGHFPFIYCVEYLVYKRKYTQWESCFEKLGLNP  152

Query  523  KQISDCYASGRGKELELSYA  582
            K ISDCY +  GK+LEL YA
Sbjct  153  KPISDCYKTELGKKLELEYA  172



>gb|KJB21244.1| hypothetical protein B456_003G149000 [Gossypium raimondii]
Length=166

 Score =   185 bits (470),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 92/149 (62%), Positives = 111/149 (74%), Gaps = 4/149 (3%)
 Frame = +1

Query  133  ICFLVCLLFFTSLSPIS----CGKVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDL  300
            +C L  L  F S S IS      KVSL LYYESLCPYSANFIVNYL K++   +I IVDL
Sbjct  11   LCCLSLLGSFASASTISLPSDSRKVSLTLYYESLCPYSANFIVNYLPKLFNEDLISIVDL  70

Query  301  TLFPWGNAKLKGNNTFECQHGAAECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEY  480
             L PWGNAKLKGN TF+CQHG  ECLLNT+EACAIDAWP L +HFPFIYCVE+L    + 
Sbjct  71   RLVPWGNAKLKGNGTFDCQHGPTECLLNTVEACAIDAWPKLNDHFPFIYCVENLELERKP  130

Query  481  SKWETCYEKLGKDPKQISDCYASGRGKEL  567
             +WE+C++KLG + K ++DCY SG G+++
Sbjct  131  LEWESCFKKLGLESKPVNDCYNSGLGQKV  159



>gb|KJB21242.1| hypothetical protein B456_003G149000 [Gossypium raimondii]
Length=188

 Score =   185 bits (470),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 92/148 (62%), Positives = 110/148 (74%), Gaps = 4/148 (3%)
 Frame = +1

Query  133  ICFLVCLLFFTSLSPIS----CGKVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDL  300
            +C L  L  F S S IS      KVSL LYYESLCPYSANFIVNYL K++   +I IVDL
Sbjct  11   LCCLSLLGSFASASTISLPSDSRKVSLTLYYESLCPYSANFIVNYLPKLFNEDLISIVDL  70

Query  301  TLFPWGNAKLKGNNTFECQHGAAECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEY  480
             L PWGNAKLKGN TF+CQHG  ECLLNT+EACAIDAWP L +HFPFIYCVE+L    + 
Sbjct  71   RLVPWGNAKLKGNGTFDCQHGPTECLLNTVEACAIDAWPKLNDHFPFIYCVENLELERKP  130

Query  481  SKWETCYEKLGKDPKQISDCYASGRGKE  564
             +WE+C++KLG + K ++DCY SG G++
Sbjct  131  LEWESCFKKLGLESKPVNDCYNSGLGQK  158



>ref|XP_010921010.1| PREDICTED: gamma-interferon-inducible lysosomal thiol reductase-like 
[Elaeis guineensis]
Length=244

 Score =   187 bits (474),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 86/137 (63%), Positives = 104/137 (76%), Gaps = 0/137 (0%)
 Frame = +1

Query  172  SPISCGKVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKLKGNNTFE  351
            SP+S  K+ L LYYE+LCPY +NFIVNYLAKI+ENG+IDIVDL L P+GNA++  N T  
Sbjct  21   SPVSARKIPLALYYETLCPYCSNFIVNYLAKIFENGLIDIVDLDLVPYGNARVGSNGTIS  80

Query  352  CQHGAAECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWETCYEKLGKDPKQI  531
            CQHG  EC+LNT+EACAI  WPD+  HF FIYCVESLV   +Y +WE+C+ K G D   +
Sbjct  81   CQHGPYECVLNTVEACAISVWPDVNVHFSFIYCVESLVVEHKYLEWESCFSKTGLDSHAV  140

Query  532  SDCYASGRGKELELSYA  582
             DCY SG GK+LEL YA
Sbjct  141  LDCYESGYGKKLELQYA  157



>gb|ACJ85245.1| unknown [Medicago truncatula]
Length=189

 Score =   184 bits (468),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 85/134 (63%), Positives = 102/134 (76%), Gaps = 0/134 (0%)
 Frame = +1

Query  181  SCGKVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKLKGNNTFECQH  360
            S  KVSL+LYYESLCPY ANFIVNYL +I+++ +  IVDL L PWGNAKL+GN+T  CQH
Sbjct  26   SHNKVSLELYYESLCPYCANFIVNYLPQIFQHDLTSIVDLKLVPWGNAKLRGNSTIVCQH  85

Query  361  GAAECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWETCYEKLGKDPKQISDC  540
            G  ECLL+ +EACAID WP L EHFPFI+CVE     G++S+WE+CYEKLG D   +  C
Sbjct  86   GPDECLLDRVEACAIDIWPQLSEHFPFIHCVEDFSYQGKHSEWESCYEKLGLDSSLVDHC  145

Query  541  YASGRGKELELSYA  582
            Y S  GKEL+L YA
Sbjct  146  YHSEHGKELDLKYA  159



>ref|XP_009402396.1| PREDICTED: gamma-interferon-inducible lysosomal thiol reductase-like 
[Musa acuminata subsp. malaccensis]
Length=255

 Score =   186 bits (473),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 87/140 (62%), Positives = 107/140 (76%), Gaps = 0/140 (0%)
 Frame = +1

Query  163  TSLSPISCGKVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKLKGNN  342
            T+ SP S   VSL LYYE+LCPY +NFIVN+L+KI+ +G+I IVDL L P+GNA+L  N+
Sbjct  29   TTSSPASPRNVSLALYYETLCPYCSNFIVNHLSKIFHDGLISIVDLDLIPYGNARLGSNS  88

Query  343  TFECQHGAAECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWETCYEKLGKDP  522
            T  CQHG  ECLLNT+EACAI+AWPDL  HF FIYCVE LV   +Y++WE+C+ KLG D 
Sbjct  89   TMSCQHGPNECLLNTVEACAINAWPDLSIHFSFIYCVEHLVLEHKYTEWESCFSKLGLDS  148

Query  523  KQISDCYASGRGKELELSYA  582
              + +CY SG GKELEL YA
Sbjct  149  NAVLNCYDSGHGKELELQYA  168



>ref|XP_006649924.1| PREDICTED: gamma-interferon-inducible lysosomal thiol reductase-like 
isoform X1 [Oryza brachyantha]
Length=259

 Score =   186 bits (472),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 86/134 (64%), Positives = 104/134 (78%), Gaps = 0/134 (0%)
 Frame = +1

Query  181  SCGKVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKLKGNNTFECQH  360
            + GKVSL LYYESLCPY + FIVN+LA I+E+G+ID VDL L P+GNA +  NNT  CQH
Sbjct  28   AAGKVSLALYYESLCPYCSRFIVNHLAGIFEDGLIDAVDLRLVPYGNAHVGANNTISCQH  87

Query  361  GAAECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWETCYEKLGKDPKQISDC  540
            G  ECLLNT+EACAIDAWPDL+ HF FIYCVESLV +G+ S+WE+C+ KL  D K ++DC
Sbjct  88   GGDECLLNTVEACAIDAWPDLRVHFRFIYCVESLVVDGKRSEWESCFAKLNLDAKPVTDC  147

Query  541  YASGRGKELELSYA  582
            Y S RG +L L Y 
Sbjct  148  YKSERGHQLSLKYG  161



>ref|XP_003599337.1| Gamma-interferon-inducible lysosomal thiol reductase [Medicago 
truncatula]
 gb|AES69588.1| gamma interferon inducible lysosomal thiol reductase [Medicago 
truncatula]
Length=253

 Score =   186 bits (471),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 85/134 (63%), Positives = 102/134 (76%), Gaps = 0/134 (0%)
 Frame = +1

Query  181  SCGKVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKLKGNNTFECQH  360
            S  KVSL+LYYESLCPY ANFIVNYL +I+++ +  IVDL L PWGNAKL+GN+T  CQH
Sbjct  26   SHNKVSLELYYESLCPYCANFIVNYLPQIFQHDLTSIVDLKLVPWGNAKLRGNSTIVCQH  85

Query  361  GAAECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWETCYEKLGKDPKQISDC  540
            G  ECLL+ +EACAID WP L EHFPFI+CVE     G++S+WE+CYEKLG D   +  C
Sbjct  86   GPDECLLDRVEACAIDIWPQLSEHFPFIHCVEDFSYQGKHSEWESCYEKLGLDSSLVDHC  145

Query  541  YASGRGKELELSYA  582
            Y S  GKEL+L YA
Sbjct  146  YHSEHGKELDLKYA  159



>gb|AFK37977.1| unknown [Medicago truncatula]
Length=253

 Score =   186 bits (471),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 85/134 (63%), Positives = 102/134 (76%), Gaps = 0/134 (0%)
 Frame = +1

Query  181  SCGKVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKLKGNNTFECQH  360
            S  KVSL+LYYESLCPY ANFIVNYL +I+++ +  IVDL L PWGNAKL+GN+T  CQH
Sbjct  26   SHNKVSLELYYESLCPYCANFIVNYLPQIFQHDLTSIVDLKLVPWGNAKLRGNSTIVCQH  85

Query  361  GAAECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWETCYEKLGKDPKQISDC  540
            G  ECLL+ +EACAID WP L EHFPFI+CVE     G++S+WE+CYEKLG D   +  C
Sbjct  86   GPDECLLDRVEACAIDIWPQLSEHFPFIHCVEDFSYQGKHSEWESCYEKLGLDSSLVDHC  145

Query  541  YASGRGKELELSYA  582
            Y S  GKEL+L YA
Sbjct  146  YHSEHGKELDLKYA  159



>emb|CDY10246.1| BnaC05g04890D [Brassica napus]
Length=294

 Score =   187 bits (474),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 86/133 (65%), Positives = 108/133 (81%), Gaps = 1/133 (1%)
 Frame = +1

Query  187  GKVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKLKGNN-TFECQHG  363
             KVSL LYYESLCPY ++FIVN+L K++E+G+I IVDL L PWGN+KL+ +N T  CQHG
Sbjct  69   SKVSLGLYYESLCPYCSSFIVNHLTKLFEDGLISIVDLHLSPWGNSKLRSDNVTVLCQHG  128

Query  364  AAECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWETCYEKLGKDPKQISDCY  543
            A EC L+T+EACAID WP+L++HFPFIYCVESLV   +Y KWETCYEKL  + K ++DC 
Sbjct  129  AYECFLDTVEACAIDVWPELRDHFPFIYCVESLVIEHKYKKWETCYEKLNLNSKPVADCL  188

Query  544  ASGRGKELELSYA  582
            +SG GK+L+L YA
Sbjct  189  SSGHGKKLQLQYA  201



>ref|XP_007205747.1| hypothetical protein PRUPE_ppa010218mg [Prunus persica]
 gb|EMJ06946.1| hypothetical protein PRUPE_ppa010218mg [Prunus persica]
Length=258

 Score =   186 bits (471),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 87/142 (61%), Positives = 108/142 (76%), Gaps = 0/142 (0%)
 Frame = +1

Query  157  FFTSLSPISCGKVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKLKG  336
            F T+       KV +D+YYE+LCP S +FIV  L K++E+G+I IVDL L+P+GNAKL  
Sbjct  20   FPTTTISSESNKVRVDVYYETLCPDSEDFIVKDLIKLFESGLISIVDLKLYPYGNAKLGS  79

Query  337  NNTFECQHGAAECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWETCYEKLGK  516
            NNT  CQHG +ECLLNT+EACAI  WP L +HFPFIYC+ESLV   +Y +WE+CYEKLG 
Sbjct  80   NNTIYCQHGPSECLLNTVEACAIKIWPALNDHFPFIYCIESLVYEHKYPQWESCYEKLGL  139

Query  517  DPKQISDCYASGRGKELELSYA  582
            D K I++CY+SG GKELEL YA
Sbjct  140  DSKPIAECYSSGLGKELELQYA  161



>ref|XP_010557194.1| PREDICTED: gamma-interferon-inducible lysosomal thiol reductase-like 
[Tarenaya hassleriana]
Length=279

 Score =   186 bits (472),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 87/135 (64%), Positives = 106/135 (79%), Gaps = 1/135 (1%)
 Frame = +1

Query  181  SCGKVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKLKGNN-TFECQ  357
            S  KVS+ LYYESLCPY ANF+VN+L K+++  +I IVDL L PWGN KL+ +N TF CQ
Sbjct  44   SSQKVSVGLYYESLCPYCANFVVNHLVKLFDEDLISIVDLHLSPWGNTKLRPDNLTFVCQ  103

Query  358  HGAAECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWETCYEKLGKDPKQISD  537
            HG  ECLL+T+EACAI+AWP L +HFPFI+C+ESLV   +Y KWETCYEKL  + K I+D
Sbjct  104  HGPYECLLDTVEACAIEAWPKLSDHFPFIHCIESLVPERKYEKWETCYEKLKLNSKPIND  163

Query  538  CYASGRGKELELSYA  582
            C +SG GKELEL YA
Sbjct  164  CLSSGHGKELELQYA  178



>ref|XP_010937930.1| PREDICTED: gamma-interferon-inducible lysosomal thiol reductase 
isoform X2 [Elaeis guineensis]
Length=223

 Score =   183 bits (465),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 86/142 (61%), Positives = 107/142 (75%), Gaps = 1/142 (1%)
 Frame = +1

Query  139  FLVCLLFFTSLSPISCGKVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWG  318
            FL+    F S SP+S  KV L LYYE+LCPY +NFIVNYLAKI+ENG+IDI++L L P+G
Sbjct  11   FLISSSCFAS-SPVSARKVPLALYYETLCPYCSNFIVNYLAKIFENGLIDIIELDLIPYG  69

Query  319  NAKLKGNNTFECQHGAAECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWETC  498
            NA++  N+T  CQHG  EC+LNT+EACAI AWPD+ EHF FIYCVESLV   +Y +WE+C
Sbjct  70   NARIGSNDTISCQHGPNECVLNTVEACAITAWPDVSEHFSFIYCVESLVMEHKYLEWESC  129

Query  499  YEKLGKDPKQISDCYASGRGKE  564
            + K G D   + DCY SG GK+
Sbjct  130  FSKTGLDSNAVLDCYKSGYGKK  151



>emb|CDY09941.1| BnaC08g45100D [Brassica napus]
Length=263

 Score =   184 bits (468),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 86/132 (65%), Positives = 106/132 (80%), Gaps = 1/132 (1%)
 Frame = +1

Query  190  KVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKLKGNN-TFECQHGA  366
            KVSL LYYESLCPY ++FIVN+L K++E+ +I IVDL L PWGN KL+ +N T  CQHGA
Sbjct  39   KVSLGLYYESLCPYCSSFIVNHLTKLFEDNLISIVDLHLSPWGNTKLRSDNVTAVCQHGA  98

Query  367  AECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWETCYEKLGKDPKQISDCYA  546
             ECLL+T+EACAIDAWP L++HFPFI+CVESLV   +Y KWETCY+KL  + K +SDC +
Sbjct  99   FECLLDTVEACAIDAWPKLRDHFPFIHCVESLVTEHKYDKWETCYQKLNLNSKPVSDCLS  158

Query  547  SGRGKELELSYA  582
            SG G +LEL YA
Sbjct  159  SGHGDKLELKYA  170



>ref|XP_003558135.1| PREDICTED: gamma-interferon-inducible lysosomal thiol reductase-like 
isoform X2 [Brachypodium distachyon]
Length=243

 Score =   184 bits (466),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 90/160 (56%), Positives = 113/160 (71%), Gaps = 1/160 (1%)
 Frame = +1

Query  106  MAGSHQQTKICFLVCLLFFTSLSPISCGKVSLDLYYESLCPYSANFIVNYLAKIYENGII  285
            MAGS +   +  L+     + L P + GKV L LYYESLCPY + FIVN+LA I++NG+I
Sbjct  1    MAGSRRVLPLLLLLSSALGSLLPPAAAGKVPLALYYESLCPYCSRFIVNHLAGIFDNGVI  60

Query  286  DIVDLTLFPWGNAKLKG-NNTFECQHGAAECLLNTIEACAIDAWPDLKEHFPFIYCVESL  462
            D V+L LFP+GNA ++G NNT  CQHG  ECLLNT+EACA+DAWPDLK HF FI CVE L
Sbjct  61   DAVELQLFPYGNAHVRGSNNTISCQHGPDECLLNTVEACAMDAWPDLKVHFGFINCVEDL  120

Query  463  VNNGEYSKWETCYEKLGKDPKQISDCYASGRGKELELSYA  582
            V      +WE+C+ KLG D K+++DCY S RG EL L + 
Sbjct  121  VMKRRRGEWESCFNKLGLDSKRVTDCYKSERGHELSLKFG  160



>ref|XP_004984874.1| PREDICTED: gamma-interferon-inducible lysosomal thiol reductase-like 
[Setaria italica]
Length=255

 Score =   184 bits (467),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 79/132 (60%), Positives = 104/132 (79%), Gaps = 0/132 (0%)
 Frame = +1

Query  187  GKVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKLKGNNTFECQHGA  366
            GKV++ LYYE+LCPYSA F+V++LA+++E+G++D VDLTL P+GNA++       CQHG 
Sbjct  28   GKVAVALYYETLCPYSARFVVDHLARVFEDGLLDAVDLTLVPYGNARVHAGGEITCQHGP  87

Query  367  AECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWETCYEKLGKDPKQISDCYA  546
             ECLLNT+EACAID WPDL  HF FIYCVE LV   +Y KW++C++KLG DPK ++DCY 
Sbjct  88   NECLLNTVEACAIDTWPDLDVHFRFIYCVEDLVMKRQYKKWDSCFQKLGLDPKPVTDCYK  147

Query  547  SGRGKELELSYA  582
            S +G +LEL YA
Sbjct  148  SEQGHKLELKYA  159



>ref|XP_006417847.1| hypothetical protein EUTSA_v10008497mg [Eutrema salsugineum]
 gb|ESQ36200.1| hypothetical protein EUTSA_v10008497mg [Eutrema salsugineum]
Length=264

 Score =   184 bits (467),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 96/167 (57%), Positives = 117/167 (70%), Gaps = 16/167 (10%)
 Frame = +1

Query  127  TKICFLVCLLFF--------------TSLSPISCGKVSLDLYYESLCPYSANFIVNYLAK  264
            +K+  LVC +F               TS SP S  KVSL LYYESLCPY ++FIVN+LAK
Sbjct  3    SKLHLLVCYVFLLGFASASDFSGISLTSSSPDS-PKVSLGLYYESLCPYCSSFIVNHLAK  61

Query  265  IYENGIIDIVDLTLFPWGNAKLKGNN-TFECQHGAAECLLNTIEACAIDAWPDLKEHFPF  441
            ++E+ +I IVDL L PWGN KL+ +N T  CQHGA EC L+T+EACAIDAWP L +HFPF
Sbjct  62   LFEDDLISIVDLHLSPWGNTKLRPDNVTVVCQHGAFECFLDTVEACAIDAWPKLSDHFPF  121

Query  442  IYCVESLVNNGEYSKWETCYEKLGKDPKQISDCYASGRGKELELSYA  582
            IYC+ESLV   +Y KWETCYEKL  + K ++DC +SG G EL L YA
Sbjct  122  IYCIESLVIEHKYDKWETCYEKLNLNSKPVADCLSSGHGNELVLQYA  168



>emb|CDY59062.1| BnaAnng15750D [Brassica napus]
Length=259

 Score =   183 bits (465),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 86/132 (65%), Positives = 105/132 (80%), Gaps = 1/132 (1%)
 Frame = +1

Query  190  KVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKLKGNN-TFECQHGA  366
            KVSL LYYESLCPY ++FIVN+L K++E+ +I IVDL L PWGN KL+ +N T  CQHGA
Sbjct  35   KVSLGLYYESLCPYCSSFIVNHLTKLFEDDLISIVDLHLSPWGNTKLRSDNATAVCQHGA  94

Query  367  AECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWETCYEKLGKDPKQISDCYA  546
             ECLL+T+EACAIDAWP L +HFPFI+CVESLV   +Y KWETCY+KL  + K +SDC +
Sbjct  95   FECLLDTVEACAIDAWPKLSDHFPFIHCVESLVTEHKYDKWETCYQKLNLNSKPVSDCLS  154

Query  547  SGRGKELELSYA  582
            SG G +LEL YA
Sbjct  155  SGHGDKLELKYA  166



>ref|XP_009118464.1| PREDICTED: gamma-interferon-inducible lysosomal thiol reductase-like 
[Brassica rapa]
Length=259

 Score =   183 bits (465),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 86/132 (65%), Positives = 105/132 (80%), Gaps = 1/132 (1%)
 Frame = +1

Query  190  KVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKLKGNN-TFECQHGA  366
            KVSL LYYESLCPY ++FIVN+L K++E+ +I IVDL L PWGN KL+ +N T  CQHGA
Sbjct  35   KVSLGLYYESLCPYCSSFIVNHLTKLFEDDLISIVDLHLSPWGNTKLRSDNATAVCQHGA  94

Query  367  AECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWETCYEKLGKDPKQISDCYA  546
             ECLL+T+EACAIDAWP L +HFPFI+CVESLV   +Y KWETCY+KL  + K +SDC +
Sbjct  95   FECLLDTVEACAIDAWPKLSDHFPFIHCVESLVTEHKYDKWETCYQKLNLNSKPVSDCLS  154

Query  547  SGRGKELELSYA  582
            SG G +LEL YA
Sbjct  155  SGHGDKLELKYA  166



>ref|XP_010521972.1| PREDICTED: gamma-interferon-inducible lysosomal thiol reductase-like 
[Tarenaya hassleriana]
Length=278

 Score =   183 bits (465),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 87/132 (66%), Positives = 105/132 (80%), Gaps = 1/132 (1%)
 Frame = +1

Query  190  KVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKLKGNN-TFECQHGA  366
            KVS+ LYYESLCPYSA FIVN+L K++++ +I IVDL L PWGN KL+ +N TF CQHG 
Sbjct  46   KVSVGLYYESLCPYSAKFIVNHLVKLFDDDLISIVDLHLSPWGNTKLRPDNLTFVCQHGP  105

Query  367  AECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWETCYEKLGKDPKQISDCYA  546
             ECLL+T+EACAI+AWP L +HFPFIYCVESLV+  +Y KWETCYEKL  + K + DC +
Sbjct  106  YECLLDTVEACAIEAWPKLSDHFPFIYCVESLVSEHKYDKWETCYEKLELNSKPMDDCLS  165

Query  547  SGRGKELELSYA  582
            SG G ELEL YA
Sbjct  166  SGHGIELELQYA  177



>ref|XP_009369568.1| PREDICTED: gamma-interferon-inducible lysosomal thiol reductase-like 
isoform X2 [Pyrus x bretschneideri]
Length=263

 Score =   182 bits (463),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 83/131 (63%), Positives = 104/131 (79%), Gaps = 0/131 (0%)
 Frame = +1

Query  190  KVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKLKGNNTFECQHGAA  369
            KV ++LYYE+LCP S  FIVN L K++E GII + DL L+P+GNA++  N+T  CQHG +
Sbjct  39   KVRVELYYETLCPDSYQFIVNDLIKLFETGIISVTDLKLYPYGNARIGSNSTITCQHGPS  98

Query  370  ECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWETCYEKLGKDPKQISDCYAS  549
            ECLLNT+EACAI+ WP L +HFPFIYCVESLV   +Y +WE+CYEKLG D K I++CY+S
Sbjct  99   ECLLNTVEACAIEIWPALNDHFPFIYCVESLVYKHKYPQWESCYEKLGLDSKPIAECYSS  158

Query  550  GRGKELELSYA  582
            G GKELEL YA
Sbjct  159  GLGKELELQYA  169



>ref|NP_563779.1| GILT domain-containing protein [Arabidopsis thaliana]
 gb|AAK83650.1| At1g07080/F10K1_15 [Arabidopsis thaliana]
 gb|AAL06806.1| At1g07080/F10K1_15 [Arabidopsis thaliana]
 gb|AEE28075.1| GILT domain-containing protein [Arabidopsis thaliana]
Length=265

 Score =   182 bits (463),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 93/158 (59%), Positives = 113/158 (72%), Gaps = 11/158 (7%)
 Frame = +1

Query  142  LVCLLF---FTSLS-------PISCGKVSLDLYYESLCPYSANFIVNYLAKIYENGIIDI  291
            LVC +F   F S S       P S  KVS+ LYYESLCPY ++FIVN+LAK++E+ +I I
Sbjct  12   LVCYVFLFPFASSSDYSGVSLPSSSPKVSVGLYYESLCPYCSSFIVNHLAKLFEDDLISI  71

Query  292  VDLTLFPWGNAKLKGNN-TFECQHGAAECLLNTIEACAIDAWPDLKEHFPFIYCVESLVN  468
            VDL L PWGN KL+ +N T  CQHGA EC L+T+EACAIDAWP + +HFPFIYCVE LV 
Sbjct  72   VDLHLSPWGNTKLRSDNVTAVCQHGAFECFLDTVEACAIDAWPKVSDHFPFIYCVEKLVT  131

Query  469  NGEYSKWETCYEKLGKDPKQISDCYASGRGKELELSYA  582
              +Y KWETCYEKL  + K ++DC +SG G EL L YA
Sbjct  132  EHKYDKWETCYEKLNLNSKPVADCLSSGHGNELALHYA  169



>gb|AAF82212.1|AC067971_20 Contains similarity to an unknown protein F7A7_100 gi|7327817 
from Arabidopsis thaliana BAC F7A7 gb|AL161946. ESTs gb|N65842, 
gb|F19836 and gb|AI993679 come from this gene [Arabidopsis 
thaliana]
Length=262

 Score =   182 bits (463),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 93/158 (59%), Positives = 113/158 (72%), Gaps = 11/158 (7%)
 Frame = +1

Query  142  LVCLLF---FTSLS-------PISCGKVSLDLYYESLCPYSANFIVNYLAKIYENGIIDI  291
            LVC +F   F S S       P S  KVS+ LYYESLCPY ++FIVN+LAK++E+ +I I
Sbjct  9    LVCYVFLFPFASSSDYSGVSLPSSSPKVSVGLYYESLCPYCSSFIVNHLAKLFEDDLISI  68

Query  292  VDLTLFPWGNAKLKGNN-TFECQHGAAECLLNTIEACAIDAWPDLKEHFPFIYCVESLVN  468
            VDL L PWGN KL+ +N T  CQHGA EC L+T+EACAIDAWP + +HFPFIYCVE LV 
Sbjct  69   VDLHLSPWGNTKLRSDNVTAVCQHGAFECFLDTVEACAIDAWPKVSDHFPFIYCVEKLVT  128

Query  469  NGEYSKWETCYEKLGKDPKQISDCYASGRGKELELSYA  582
              +Y KWETCYEKL  + K ++DC +SG G EL L YA
Sbjct  129  EHKYDKWETCYEKLNLNSKPVADCLSSGHGNELALHYA  166



>tpg|DAA44882.1| TPA: hypothetical protein ZEAMMB73_014337, partial [Zea mays]
Length=268

 Score =   182 bits (462),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 81/132 (61%), Positives = 102/132 (77%), Gaps = 0/132 (0%)
 Frame = +1

Query  187  GKVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKLKGNNTFECQHGA  366
            GKV++ LYYESLCPYSA F+VN+LAK++ +G+ ++VDLTL P+GNA++       CQHG 
Sbjct  26   GKVAVALYYESLCPYSARFVVNHLAKVFADGLREVVDLTLVPYGNARIHPGGEISCQHGP  85

Query  367  AECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWETCYEKLGKDPKQISDCYA  546
             ECLLNT+EACAIDAWPDL  HF FIYCVE LV   +Y  WE+C+EKLG DPK +++CY 
Sbjct  86   YECLLNTVEACAIDAWPDLDVHFSFIYCVEDLVVKRQYKDWESCFEKLGLDPKPVTECYK  145

Query  547  SGRGKELELSYA  582
            S  G +LEL YA
Sbjct  146  SEHGHKLELKYA  157



>gb|ACN29331.1| unknown [Zea mays]
 tpg|DAA44881.1| TPA: gamma-interferon-inducible lysosomal thiol reductase [Zea 
mays]
Length=247

 Score =   181 bits (460),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 81/132 (61%), Positives = 102/132 (77%), Gaps = 0/132 (0%)
 Frame = +1

Query  187  GKVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKLKGNNTFECQHGA  366
            GKV++ LYYESLCPYSA F+VN+LAK++ +G+ ++VDLTL P+GNA++       CQHG 
Sbjct  26   GKVAVALYYESLCPYSARFVVNHLAKVFADGLREVVDLTLVPYGNARIHPGGEISCQHGP  85

Query  367  AECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWETCYEKLGKDPKQISDCYA  546
             ECLLNT+EACAIDAWPDL  HF FIYCVE LV   +Y  WE+C+EKLG DPK +++CY 
Sbjct  86   YECLLNTVEACAIDAWPDLDVHFSFIYCVEDLVVKRQYKDWESCFEKLGLDPKPVTECYK  145

Query  547  SGRGKELELSYA  582
            S  G +LEL YA
Sbjct  146  SEHGHKLELKYA  157



>ref|XP_011089280.1| PREDICTED: gamma-interferon-inducible lysosomal thiol reductase 
isoform X2 [Sesamum indicum]
Length=250

 Score =   181 bits (458),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 81/134 (60%), Positives = 103/134 (77%), Gaps = 0/134 (0%)
 Frame = +1

Query  181  SCGKVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKLKGNNTFECQH  360
            S  KVS D+YYESLCPY +N IVNYL K++++ +I I D  L P+GNAK++ N T  CQH
Sbjct  21   SGDKVSFDVYYESLCPYCSNLIVNYLYKLFDSDLISITDFKLVPYGNAKIRPNGTITCQH  80

Query  361  GAAECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWETCYEKLGKDPKQISDC  540
            G  ECLLNT+EACAID WPD+K +FPF+YCVESLV +  Y+ W+TC+EKLG D   ++DC
Sbjct  81   GPNECLLNTVEACAIDVWPDVKVYFPFVYCVESLVYHHNYTHWDTCFEKLGLDASPVADC  140

Query  541  YASGRGKELELSYA  582
            Y+  RG+ELEL YA
Sbjct  141  YSGERGRELELKYA  154



>gb|KHN22803.1| Gamma-interferon-inducible lysosomal thiol reductase [Glycine 
soja]
Length=241

 Score =   180 bits (457),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 85/134 (63%), Positives = 100/134 (75%), Gaps = 0/134 (0%)
 Frame = +1

Query  181  SCGKVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKLKGNNTFECQH  360
            S  KVSL+LYYESLCPYSANFIVN+L KI+   +  IV L L PWGNAKL+ N TF+CQH
Sbjct  21   SHDKVSLELYYESLCPYSANFIVNHLPKIFTPDLAPIVHLKLVPWGNAKLRANATFDCQH  80

Query  361  GAAECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWETCYEKLGKDPKQISDC  540
            G  ECLLNT+EACAI  WP L +HFPFIYCVE LV   +  +WE+C+EKL  D + I+ C
Sbjct  81   GPYECLLNTVEACAIHIWPQLSKHFPFIYCVEDLVFQSKREEWESCFEKLDLDSEPINQC  140

Query  541  YASGRGKELELSYA  582
            Y S  GK+LEL YA
Sbjct  141  YNSEHGKQLELQYA  154



>ref|XP_009417986.1| PREDICTED: gamma-interferon-inducible lysosomal thiol reductase-like 
[Musa acuminata subsp. malaccensis]
Length=249

 Score =   180 bits (457),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 84/131 (64%), Positives = 105/131 (80%), Gaps = 1/131 (1%)
 Frame = +1

Query  190  KVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKLKGNNTFECQHGAA  369
            KVSL LYYE+LCPYSANFIVNYLAKI+++G+I IVD+ L P+GNA+++ N T  CQHG  
Sbjct  33   KVSLALYYETLCPYSANFIVNYLAKIFDDGLISIVDVDLVPYGNARIQ-NGTISCQHGPY  91

Query  370  ECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWETCYEKLGKDPKQISDCYAS  549
            ECLLNT+EACAIDAWPDL +HF FIYCVESLV   +Y +WE+C+ + G     +S+CY +
Sbjct  92   ECLLNTVEACAIDAWPDLNQHFSFIYCVESLVLKRKYLEWESCFSETGLGSHAVSECYDN  151

Query  550  GRGKELELSYA  582
            G G+ELEL YA
Sbjct  152  GHGQELELKYA  162



>gb|ACU19503.1| unknown [Glycine max]
Length=241

 Score =   180 bits (457),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 85/134 (63%), Positives = 100/134 (75%), Gaps = 0/134 (0%)
 Frame = +1

Query  181  SCGKVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKLKGNNTFECQH  360
            S  KVSL+LYYESLCPYSANFIVN+L KI+   +  IV L L PWGNAKL+ N TF+CQH
Sbjct  21   SHDKVSLELYYESLCPYSANFIVNHLPKIFTPDLAPIVHLKLVPWGNAKLRANATFDCQH  80

Query  361  GAAECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWETCYEKLGKDPKQISDC  540
            G  ECLLNT+EACAI  WP L +HFPFIYCVE LV   +  +WE+C+EKL  D + I+ C
Sbjct  81   GPYECLLNTVEACAIHIWPQLSKHFPFIYCVEDLVFQSKREEWESCFEKLDLDSEPINQC  140

Query  541  YASGRGKELELSYA  582
            Y S  GK+LEL YA
Sbjct  141  YNSEHGKQLELQYA  154



>ref|XP_004294784.1| PREDICTED: gamma-interferon-inducible lysosomal thiol reductase 
isoform X2 [Fragaria vesca subsp. vesca]
Length=259

 Score =   180 bits (457),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 87/158 (55%), Positives = 114/158 (72%), Gaps = 1/158 (1%)
 Frame = +1

Query  112  GSHQQTKICFLVCLLFFTSLSPISCG-KVSLDLYYESLCPYSANFIVNYLAKIYENGIID  288
            GS     + F+  +L F + S  S G KVS+DLYYE+LCP  ++F++ +L K+++ G+I 
Sbjct  5    GSSLAQLLLFICSVLLFPNPSYSSEGNKVSVDLYYETLCPDCSDFMIKHLIKLFDTGLIS  64

Query  289  IVDLTLFPWGNAKLKGNNTFECQHGAAECLLNTIEACAIDAWPDLKEHFPFIYCVESLVN  468
             VDL L P+GNAK+  N+T  CQHG +ECLLNT+EACAI  WP L +HFPFIYCVESL  
Sbjct  65   AVDLNLVPYGNAKVGPNSTITCQHGPSECLLNTVEACAIKTWPALNDHFPFIYCVESLAY  124

Query  469  NGEYSKWETCYEKLGKDPKQISDCYASGRGKELELSYA  582
             G+Y +WE+CYEKLG +   I++CY SG GKELEL YA
Sbjct  125  EGKYPQWESCYEKLGLNSTPIAECYNSGTGKELELQYA  162



>ref|XP_008678717.1| PREDICTED: LOC100284511 isoform X1 [Zea mays]
 tpg|DAA44883.1| TPA: gamma-interferon-inducible lysosomal thiol reductase [Zea 
mays]
Length=252

 Score =   180 bits (456),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 86/142 (61%), Positives = 103/142 (73%), Gaps = 6/142 (4%)
 Frame = +1

Query  175  PISCG------KVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKLKG  336
            P  CG      KVSL+LYYESLCPY + FIVN LA I+E+G+ID V L L P+GNA++  
Sbjct  21   PPQCGSAEEGTKVSLELYYESLCPYCSRFIVNRLAGIFEDGLIDAVHLRLVPYGNARVAS  80

Query  337  NNTFECQHGAAECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWETCYEKLGK  516
            N+   CQHG  ECLLNT+EACAIDAWPDL  HF FIYCVE LV   +Y  WE+C+EKLG 
Sbjct  81   NSEISCQHGPYECLLNTVEACAIDAWPDLDVHFSFIYCVEDLVVKRQYKDWESCFEKLGL  140

Query  517  DPKQISDCYASGRGKELELSYA  582
            DPK +++CY S  G +LEL YA
Sbjct  141  DPKPVTECYKSEHGHKLELKYA  162



>ref|XP_010685914.1| PREDICTED: gamma-interferon-inducible lysosomal thiol reductase-like 
[Beta vulgaris subsp. vulgaris]
Length=231

 Score =   179 bits (454),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 88/157 (56%), Positives = 110/157 (70%), Gaps = 9/157 (6%)
 Frame = +1

Query  130  KICFLVCLLFFTSLSPISCG------KVSLDLYYESLCPYSANFIVNYLAKIYENGIIDI  291
            + CF   LL   +L  +S G      KV+LDLYYESLCP+SANFI N L  ++ NG+IDI
Sbjct  6    RRCF--SLLAILTLIQVSLGTSNLAEKVTLDLYYESLCPFSANFISNELPNLFLNGLIDI  63

Query  292  VDLTLFPWGNAKLKGNNTFECQHGAAECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNN  471
            VDL LFPWGNA+L   N F+CQHG  ECLLNT+EACAID WP+L +HFP+I CVE+LV  
Sbjct  64   VDLRLFPWGNARLNSGN-FDCQHGPDECLLNTVEACAIDTWPNLNDHFPYISCVETLVYE  122

Query  472  GEYSKWETCYEKLGKDPKQISDCYASGRGKELELSYA  582
            G Y+KW  C+++   DP  ++ CY    GK+LEL YA
Sbjct  123  GNYTKWPICFKEFDLDPNTLTGCYKGAYGKKLELKYA  159



>emb|CDY15598.1| BnaA08g28820D [Brassica napus]
Length=271

 Score =   180 bits (457),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 85/135 (63%), Positives = 102/135 (76%), Gaps = 1/135 (1%)
 Frame = +1

Query  181  SCGKVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKLKGNNTFE-CQ  357
            S  KVSL LYYESLCP  ++FIV++L K++E+ +I IVDL L PWGN  L+ +N  + CQ
Sbjct  41   SSSKVSLSLYYESLCPACSSFIVDHLVKLFEDDLISIVDLHLSPWGNTYLRPDNVTDLCQ  100

Query  358  HGAAECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWETCYEKLGKDPKQISD  537
            HGA EC L+T+EACAIDAWP L +HFPFIYCVESLV   +Y KWETCYEKL    K +SD
Sbjct  101  HGAVECFLDTVEACAIDAWPKLSDHFPFIYCVESLVTEDKYDKWETCYEKLNLSSKPVSD  160

Query  538  CYASGRGKELELSYA  582
            C  SG G+ELEL YA
Sbjct  161  CLGSGHGQELELQYA  175



>ref|XP_002889632.1| hypothetical protein ARALYDRAFT_470730 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65891.1| hypothetical protein ARALYDRAFT_470730 [Arabidopsis lyrata subsp. 
lyrata]
Length=268

 Score =   180 bits (456),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 84/137 (61%), Positives = 105/137 (77%), Gaps = 1/137 (1%)
 Frame = +1

Query  175  PISCGKVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKLKGNN-TFE  351
            P S  KVS+ LYYESLCPY ++FIVN+L K++E+ +I IVDL L PWGN KL+ +N T  
Sbjct  36   PSSSPKVSVGLYYESLCPYCSSFIVNHLTKLFEDDLISIVDLHLSPWGNTKLRPDNVTAV  95

Query  352  CQHGAAECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWETCYEKLGKDPKQI  531
            CQHGA EC L+T+EACAIDAWP + +HFPFIYCVE LV   +Y+KWETCYEKL  + K +
Sbjct  96   CQHGAFECFLDTVEACAIDAWPKVSDHFPFIYCVEKLVTEHKYNKWETCYEKLNLNSKPV  155

Query  532  SDCYASGRGKELELSYA  582
            +DC ++G G EL L YA
Sbjct  156  ADCLSTGHGNELALHYA  172



>ref|XP_007146821.1| hypothetical protein PHAVU_006G072600g [Phaseolus vulgaris]
 gb|ESW18815.1| hypothetical protein PHAVU_006G072600g [Phaseolus vulgaris]
Length=257

 Score =   179 bits (454),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 84/131 (64%), Positives = 99/131 (76%), Gaps = 0/131 (0%)
 Frame = +1

Query  190  KVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKLKGNNTFECQHGAA  369
            KVSL+LYYESLCPYSANFIVN+L KI+      IVD+ L PWGNAKL+ N TF CQHG  
Sbjct  33   KVSLELYYESLCPYSANFIVNHLPKIFTPEFTPIVDVKLVPWGNAKLRPNATFNCQHGPN  92

Query  370  ECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWETCYEKLGKDPKQISDCYAS  549
            ECLLNT+EACAID WP+L +HFPFIYCVE LV   + ++W++C+E L  D K I  CY S
Sbjct  93   ECLLNTVEACAIDTWPELSKHFPFIYCVEDLVYQRKCNEWKSCFETLHLDSKPIDQCYNS  152

Query  550  GRGKELELSYA  582
              GK+LEL YA
Sbjct  153  EHGKQLELHYA  163



>ref|XP_006847415.1| hypothetical protein AMTR_s00153p00061670 [Amborella trichopoda]
 gb|ERN08996.1| hypothetical protein AMTR_s00153p00061670 [Amborella trichopoda]
Length=248

 Score =   179 bits (453),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 81/137 (59%), Positives = 103/137 (75%), Gaps = 0/137 (0%)
 Frame = +1

Query  172  SPISCGKVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKLKGNNTFE  351
            S +   KVSLDLYYESLCPYSA F VNYL  ++ NG+IDIVDL L P+GNA++  NNT  
Sbjct  21   SSVGTEKVSLDLYYESLCPYSARFFVNYLDDLFSNGLIDIVDLRLIPYGNARVGSNNTIS  80

Query  352  CQHGAAECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWETCYEKLGKDPKQI  531
            CQHG  ECLLNT+EAC ID WP++ EHFPFI C+E+LV + +Y  W++C+ K     +++
Sbjct  81   CQHGPYECLLNTVEACVIDVWPNVGEHFPFINCIETLVADHKYLDWQSCFVKAFSGFQRV  140

Query  532  SDCYASGRGKELELSYA  582
            +DCY SG GK+LEL YA
Sbjct  141  ADCYNSGYGKKLELQYA  157



>ref|XP_008804105.1| PREDICTED: gamma-interferon-inducible lysosomal thiol reductase-like 
[Phoenix dactylifera]
Length=254

 Score =   178 bits (452),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 83/131 (63%), Positives = 99/131 (76%), Gaps = 0/131 (0%)
 Frame = +1

Query  190  KVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKLKGNNTFECQHGAA  369
            KV L LYYE+LCPY +NFIVNYLAKI+ENG+IDIVDL L P+GNA++  N T  CQHG  
Sbjct  27   KVPLALYYETLCPYCSNFIVNYLAKIFENGMIDIVDLDLVPYGNARVGSNGTISCQHGPY  86

Query  370  ECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWETCYEKLGKDPKQISDCYAS  549
            EC+LNT+EACAI  WPD+  HF FIYCVESLV   +Y +WE+C+   G D   + DCY S
Sbjct  87   ECVLNTVEACAISVWPDVNVHFSFIYCVESLVVEHKYLEWESCFSNTGLDSHAVLDCYES  146

Query  550  GRGKELELSYA  582
            G GK+LEL YA
Sbjct  147  GYGKKLELQYA  157



>ref|NP_001150878.1| LOC100284511 precursor [Zea mays]
 gb|ACG40758.1| gamma-interferon-inducible lysosomal thiol reductase precursor 
[Zea mays]
Length=247

 Score =   178 bits (451),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 80/132 (61%), Positives = 101/132 (77%), Gaps = 0/132 (0%)
 Frame = +1

Query  187  GKVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKLKGNNTFECQHGA  366
            GKV++ LYYESLCPYSA F+VN+LAK++ +G+ ++VDLTL P+GNA++       CQHG 
Sbjct  26   GKVAVALYYESLCPYSARFVVNHLAKVFADGLREVVDLTLVPYGNARIHPGGEISCQHGP  85

Query  367  AECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWETCYEKLGKDPKQISDCYA  546
             ECLLNT+EACAIDAWPDL  HF FIYCVE LV   +Y  WE+C+EKLG D K +++CY 
Sbjct  86   YECLLNTVEACAIDAWPDLDVHFSFIYCVEDLVVKRQYKDWESCFEKLGLDAKPVTECYK  145

Query  547  SGRGKELELSYA  582
            S  G +LEL YA
Sbjct  146  SEHGHKLELKYA  157



>gb|KFK43003.1| hypothetical protein AALP_AA1G067000 [Arabis alpina]
Length=259

 Score =   178 bits (451),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 91/161 (57%), Positives = 110/161 (68%), Gaps = 10/161 (6%)
 Frame = +1

Query  130  KICFLVCLLF---------FTSLSPISCGKVSLDLYYESLCPYSANFIVNYLAKIYENGI  282
            K   LVC +F         F+ +S  S  KV+L LYYESLCP  + FIVN L K++E+ +
Sbjct  4    KFLLLVCYVFLLGFASSSDFSGISLPSSPKVTLSLYYESLCPACSYFIVNNLVKLFEDDL  63

Query  283  IDIVDLTLFPWGNAKLKGNN-TFECQHGAAECLLNTIEACAIDAWPDLKEHFPFIYCVES  459
            I IVDL L PWGN  L+ +N T  CQHGA EC L+T+E CAIDAWP L +HFPFIYC+ES
Sbjct  64   ISIVDLHLSPWGNTNLRPDNVTAVCQHGAYECFLDTLEVCAIDAWPKLSDHFPFIYCIES  123

Query  460  LVNNGEYSKWETCYEKLGKDPKQISDCYASGRGKELELSYA  582
            LV   +Y KWETCYEKL  + K I+DC  SG GKEL+L YA
Sbjct  124  LVTEHKYDKWETCYEKLNLNSKPIADCLNSGHGKELQLQYA  164



>ref|NP_001151695.1| gamma-interferon-inducible lysosomal thiol reductase precursor 
[Zea mays]
 gb|ACG43980.1| gamma-interferon-inducible lysosomal thiol reductase precursor 
[Zea mays]
Length=253

 Score =   177 bits (449),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 82/131 (63%), Positives = 100/131 (76%), Gaps = 0/131 (0%)
 Frame = +1

Query  190  KVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKLKGNNTFECQHGAA  369
            KVSL+LYYESLCPY + FIVN+LA I+E+G+ID V L L P+GNA++  N+   CQHG  
Sbjct  33   KVSLELYYESLCPYCSRFIVNHLAGIFEDGLIDAVHLRLVPYGNARVASNSEISCQHGPY  92

Query  370  ECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWETCYEKLGKDPKQISDCYAS  549
            ECLLNT+EACAIDAWPDL  HF FIYCVE LV   +Y  WE+C+EKLG D K +++CY S
Sbjct  93   ECLLNTVEACAIDAWPDLDVHFSFIYCVEDLVVKRQYKDWESCFEKLGLDAKPVTECYKS  152

Query  550  GRGKELELSYA  582
              G +LEL YA
Sbjct  153  EHGHKLELKYA  163



>ref|XP_006847417.1| hypothetical protein AMTR_s00153p00064140 [Amborella trichopoda]
 gb|ERN08998.1| hypothetical protein AMTR_s00153p00064140 [Amborella trichopoda]
Length=241

 Score =   176 bits (447),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 80/142 (56%), Positives = 107/142 (75%), Gaps = 3/142 (2%)
 Frame = +1

Query  166  SLSP---ISCGKVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKLKG  336
            SLSP   +   KVSL+LYYE+LCPY + F+VNYL K++ NG+IDIVDL L P+GNA +  
Sbjct  16   SLSPNSSVGAEKVSLNLYYETLCPYCSRFVVNYLGKMFSNGLIDIVDLRLIPYGNAWIGS  75

Query  337  NNTFECQHGAAECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWETCYEKLGK  516
            NNT  CQHG+ EC LNT+EAC ID WP++ +HF FIYC+ESLV + +YS WE+C+ K   
Sbjct  76   NNTISCQHGSYECFLNTVEACVIDVWPNVGDHFSFIYCIESLVVDHKYSDWESCFTKAAS  135

Query  517  DPKQISDCYASGRGKELELSYA  582
              +++++CY +G GK+LEL YA
Sbjct  136  GFQRVAECYNTGYGKKLELQYA  157



>ref|XP_006649925.1| PREDICTED: gamma-interferon-inducible lysosomal thiol reductase-like 
isoform X2 [Oryza brachyantha]
Length=259

 Score =   176 bits (446),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 84/162 (52%), Positives = 112/162 (69%), Gaps = 4/162 (2%)
 Frame = +1

Query  106  MAGSHQQTKICFLVCLLFFTSLSPI---SCGKVSLDLYYESLCPYSANFIVNYLAKIYEN  276
            MA  H    + F+  LL     S       GKV + LYYESLCP+SA F+V+ LAK++ +
Sbjct  1    MAALHHSRHVPFVAVLLLLLGASGAVEGKKGKVDVALYYESLCPFSATFVVDRLAKVFRD  60

Query  277  GIIDIVDLTLFPWGNAKLKGNNTFECQHGAAECLLNTIEACAIDAWPDLKEHFPFIYCVE  456
            G++D +DL+L P+GNA+++ +    CQHG  ECLLNT+EACAIDAWPDL+ HF FIYCVE
Sbjct  61   GLLDAIDLSLVPYGNARVR-DGKISCQHGGDECLLNTVEACAIDAWPDLRVHFRFIYCVE  119

Query  457  SLVNNGEYSKWETCYEKLGKDPKQISDCYASGRGKELELSYA  582
            SLV +G+ S+WE+C+ KL  D K ++DCY S RG +L L Y 
Sbjct  120  SLVVDGKRSEWESCFAKLNLDAKPVTDCYKSERGHQLSLKYG  161



>ref|XP_010487104.1| PREDICTED: gamma-interferon-inducible lysosomal thiol reductase-like 
[Camelina sativa]
Length=264

 Score =   176 bits (445),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 83/132 (63%), Positives = 101/132 (77%), Gaps = 1/132 (1%)
 Frame = +1

Query  190  KVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKLKGNN-TFECQHGA  366
            KVSL LYYESLCPY + FIVN+L K++E+ +I IVDL L PWGN KL+ +N T  CQHGA
Sbjct  37   KVSLALYYESLCPYCSAFIVNHLPKLFEDDLISIVDLHLSPWGNTKLRPDNVTAVCQHGA  96

Query  367  AECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWETCYEKLGKDPKQISDCYA  546
             EC L+T+EACAIDAWP L +HFPFIYC+E LV   +Y KWETCYEKL  + K ++DC +
Sbjct  97   YECFLDTVEACAIDAWPILSDHFPFIYCIEKLVTEHKYDKWETCYEKLNLNSKPVADCLS  156

Query  547  SGRGKELELSYA  582
            SG G +L L YA
Sbjct  157  SGHGNKLALHYA  168



>gb|EYU18820.1| hypothetical protein MIMGU_mgv1a012187mg [Erythranthe guttata]
Length=259

 Score =   175 bits (444),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 79/131 (60%), Positives = 100/131 (76%), Gaps = 0/131 (0%)
 Frame = +1

Query  190  KVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKLKGNNTFECQHGAA  369
            KVS ++YYE+LCPY +N IVNYL K++++ ++ I D  L P+GNAK+K N T  CQHG  
Sbjct  30   KVSFEIYYETLCPYCSNLIVNYLGKLFDSDLLSITDFKLVPYGNAKIKPNGTITCQHGEW  89

Query  370  ECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWETCYEKLGKDPKQISDCYAS  549
            EC+LNT+EACAIDAWPDL  +FPF+YCVESLV    Y+ WETC++KLG DP  ++ CY S
Sbjct  90   ECILNTVEACAIDAWPDLNTYFPFVYCVESLVYEHNYTYWETCFDKLGLDPSPVAACYNS  149

Query  550  GRGKELELSYA  582
             RGKEL L YA
Sbjct  150  ERGKELILGYA  160



>ref|XP_006303277.1| hypothetical protein CARUB_v10010028mg [Capsella rubella]
 gb|EOA36175.1| hypothetical protein CARUB_v10010028mg [Capsella rubella]
Length=266

 Score =   175 bits (443),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 83/132 (63%), Positives = 101/132 (77%), Gaps = 1/132 (1%)
 Frame = +1

Query  190  KVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKLKGNN-TFECQHGA  366
            KVSL LYYESLCPY ++FIVN+L K++E+ +I IVDL L PWGN KL  +N T  CQHGA
Sbjct  39   KVSLGLYYESLCPYCSSFIVNHLTKLFEDDLISIVDLHLSPWGNTKLLPDNVTTVCQHGA  98

Query  367  AECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWETCYEKLGKDPKQISDCYA  546
             EC L+T+EACAIDAWP L +HFPFIYCVE LV   ++ KWETCYEKL  + K ++DC +
Sbjct  99   FECFLDTVEACAIDAWPKLSDHFPFIYCVEKLVTEHKFDKWETCYEKLNLNSKPVADCLS  158

Query  547  SGRGKELELSYA  582
            SG G +L L YA
Sbjct  159  SGHGNKLALHYA  170



>ref|XP_010475460.1| PREDICTED: gamma-interferon-inducible lysosomal thiol reductase-like 
[Camelina sativa]
Length=262

 Score =   175 bits (443),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 82/132 (62%), Positives = 100/132 (76%), Gaps = 1/132 (1%)
 Frame = +1

Query  190  KVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKLKGNN-TFECQHGA  366
            KVSL LYYESLCPY + FIVN+L K++E+ +I IVDL L PWGN KL+ +N T  CQHGA
Sbjct  35   KVSLGLYYESLCPYCSAFIVNHLPKLFEDDLISIVDLHLSPWGNTKLRPDNVTAVCQHGA  94

Query  367  AECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWETCYEKLGKDPKQISDCYA  546
             EC L+T+EACAIDAWP L +HFPFIYC+E LV   +Y KWE CYEKL  + K ++DC +
Sbjct  95   YECFLDTVEACAIDAWPKLSDHFPFIYCIEKLVTEHKYKKWEMCYEKLNLNSKPVADCLS  154

Query  547  SGRGKELELSYA  582
            SG G +L L YA
Sbjct  155  SGHGNKLALHYA  166



>ref|NP_001049827.1| Os03g0295800 [Oryza sativa Japonica Group]
 gb|ABF95436.1| Gamma interferon inducible lysosomal thiol reductase family protein, 
expressed [Oryza sativa Japonica Group]
 dbj|BAF11741.1| Os03g0295800 [Oryza sativa Japonica Group]
 dbj|BAG92595.1| unnamed protein product [Oryza sativa Japonica Group]
Length=265

 Score =   174 bits (442),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 81/132 (61%), Positives = 99/132 (75%), Gaps = 1/132 (1%)
 Frame = +1

Query  190  KVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKLKG-NNTFECQHGA  366
            KV L LYYE+LCPY + FIVN+LA I+E+GI+D VDL L P+GNA + G NNT  CQHG+
Sbjct  38   KVPLALYYETLCPYCSRFIVNHLAGIFEDGIVDAVDLRLVPYGNAHVVGANNTISCQHGS  97

Query  367  AECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWETCYEKLGKDPKQISDCYA  546
             EC LNT+EACAIDAWPDL+ HF FIYCVE LV N +  +WE+C+ KL  DPK ++DCY 
Sbjct  98   EECFLNTVEACAIDAWPDLRVHFRFIYCVEDLVVNHKQREWESCFGKLNLDPKPVTDCYK  157

Query  547  SGRGKELELSYA  582
              RG +L L Y 
Sbjct  158  GERGHQLSLKYG  169



>gb|KFK43005.1| hypothetical protein AALP_AA1G067000 [Arabis alpina]
Length=264

 Score =   174 bits (440),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 80/129 (62%), Positives = 99/129 (77%), Gaps = 1/129 (1%)
 Frame = +1

Query  199  LDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKLKGNN-TFECQHGAAEC  375
            L LYYESLCPY + FIVN+L K++E+ +I IVDL L PWGN KL+ +N T  CQHGA EC
Sbjct  41   LGLYYESLCPYCSAFIVNHLVKLFEDDLISIVDLHLSPWGNTKLRPDNVTVVCQHGAFEC  100

Query  376  LLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWETCYEKLGKDPKQISDCYASGR  555
             L+T+EACAIDAWP L +HFPFI+C+ESLV   +Y +WETCYEKL  D + I+DC  SG 
Sbjct  101  FLDTVEACAIDAWPKLSDHFPFIFCIESLVTERKYDQWETCYEKLNLDSRPITDCLESGH  160

Query  556  GKELELSYA  582
            G +L+L YA
Sbjct  161  GNKLQLQYA  169



>gb|ACN40570.1| unknown [Picea sitchensis]
Length=224

 Score =   172 bits (436),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 78/130 (60%), Positives = 100/130 (77%), Gaps = 0/130 (0%)
 Frame = +1

Query  193  VSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKLKGNNTFECQHGAAE  372
            VS++LYYESLCPYSANFIVNYL K++ NG+IDIVDL L P+GNA++  N+T  CQHG  E
Sbjct  19   VSVELYYESLCPYSANFIVNYLDKLFTNGLIDIVDLRLIPYGNARIGANDTISCQHGPYE  78

Query  373  CLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWETCYEKLGKDPKQISDCYASG  552
            C+LNT++ACAI+AWP L++HFPFI C+E  V   E + W+ CY+    + K + DCY SG
Sbjct  79   CVLNTVDACAINAWPSLEQHFPFINCIEKFVLAHEPTAWDACYKNTSLNMKLVGDCYESG  138

Query  553  RGKELELSYA  582
             GK+LEL YA
Sbjct  139  YGKKLELQYA  148



>gb|ABK21952.1| unknown [Picea sitchensis]
Length=240

 Score =   172 bits (437),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 78/130 (60%), Positives = 100/130 (77%), Gaps = 0/130 (0%)
 Frame = +1

Query  193  VSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKLKGNNTFECQHGAAE  372
            VS++LYYESLCPYSANFIVNYL K++ NG+IDIVDL L P+GNA++  N+T  CQHG  E
Sbjct  35   VSVELYYESLCPYSANFIVNYLDKLFTNGLIDIVDLRLIPYGNARIGANDTISCQHGPYE  94

Query  373  CLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWETCYEKLGKDPKQISDCYASG  552
            C+LNT++ACAI+AWP L++HFPFI C+E  V   E + W+ CY+    + K + DCY SG
Sbjct  95   CVLNTVDACAINAWPSLEQHFPFINCIEKFVLAHEPTAWDACYKNTSLNMKLVGDCYESG  154

Query  553  RGKELELSYA  582
             GK+LEL YA
Sbjct  155  YGKKLELQYA  164



>ref|XP_009110962.1| PREDICTED: gamma-interferon-inducible lysosomal thiol reductase-like 
[Brassica rapa]
Length=271

 Score =   173 bits (439),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 81/135 (60%), Positives = 102/135 (76%), Gaps = 1/135 (1%)
 Frame = +1

Query  181  SCGKVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKLKGNN-TFECQ  357
            S  KVSL LYYESLCP  ++F+V++L K++E+ +I IVDL L PWGN  L+ +N T  CQ
Sbjct  41   SSSKVSLSLYYESLCPACSSFVVDHLVKLFEDDLISIVDLHLSPWGNTYLRPDNVTALCQ  100

Query  358  HGAAECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWETCYEKLGKDPKQISD  537
            HG  EC L+T+EACAIDAWP L +HFPFIYCVESLV   +Y KW+TCY+KL    K +SD
Sbjct  101  HGENECFLDTVEACAIDAWPKLSDHFPFIYCVESLVTEDKYDKWKTCYDKLNLSSKPVSD  160

Query  538  CYASGRGKELELSYA  582
            C +SG G++LEL YA
Sbjct  161  CLSSGHGQKLELQYA  175



>ref|XP_010922609.1| PREDICTED: gamma-interferon-inducible lysosomal thiol reductase 
[Elaeis guineensis]
Length=245

 Score =   172 bits (436),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 79/137 (58%), Positives = 101/137 (74%), Gaps = 0/137 (0%)
 Frame = +1

Query  172  SPISCGKVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKLKGNNTFE  351
            SP+S  KVSL LYYE+LCPY ++FI N L KI++NG+I IVDL L P+GNA+L  NN+  
Sbjct  22   SPVSSRKVSLALYYETLCPYCSDFITNNLVKIFDNGLISIVDLDLVPYGNARLGSNNSII  81

Query  352  CQHGAAECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWETCYEKLGKDPKQI  531
            CQHG  EC LN IEACAI AWPD++EHF FI+C+E LV    Y +W++C ++ G D   +
Sbjct  82   CQHGPNECQLNNIEACAISAWPDVQEHFNFIHCIEHLVMELRYDEWKSCSQQTGLDSTSV  141

Query  532  SDCYASGRGKELELSYA  582
             DCY SG G++LEL YA
Sbjct  142  LDCYNSGYGEKLELQYA  158



>ref|XP_010457871.1| PREDICTED: gamma-interferon-inducible lysosomal thiol reductase-like 
[Camelina sativa]
Length=266

 Score =   172 bits (437),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 82/132 (62%), Positives = 99/132 (75%), Gaps = 1/132 (1%)
 Frame = +1

Query  190  KVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKLKGNN-TFECQHGA  366
            KVSL LYYESLCPY + FIVN+L K++E+ +I IVDL L PWGN KL  +N T  CQHG 
Sbjct  39   KVSLALYYESLCPYCSAFIVNHLPKLFEDDLISIVDLHLSPWGNTKLLPDNVTAVCQHGK  98

Query  367  AECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWETCYEKLGKDPKQISDCYA  546
             EC L+T+EACAIDAWP L +HFPFIYC+E LV   +Y KWETCYEKL  + K ++DC +
Sbjct  99   YECFLDTVEACAIDAWPKLSDHFPFIYCIEKLVTEHKYDKWETCYEKLNLNSKPVADCLS  158

Query  547  SGRGKELELSYA  582
            SG G +L L YA
Sbjct  159  SGHGNKLALHYA  170



>gb|ABK23086.1| unknown [Picea sitchensis]
 gb|ACN40507.1| unknown [Picea sitchensis]
Length=240

 Score =   171 bits (434),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 78/130 (60%), Positives = 101/130 (78%), Gaps = 0/130 (0%)
 Frame = +1

Query  193  VSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKLKGNNTFECQHGAAE  372
            VS++LYYESLCPYSANFIVNYL K++ NG+IDIVDL L P+GNA++  N+T  CQHG  E
Sbjct  35   VSVELYYESLCPYSANFIVNYLDKLFTNGLIDIVDLRLIPYGNARIGANDTISCQHGPYE  94

Query  373  CLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWETCYEKLGKDPKQISDCYASG  552
            C+LNT+EACAI+AWP+L+++FPFI C+E  V   E + W+ CY+    + K + DCY SG
Sbjct  95   CVLNTVEACAINAWPNLEQNFPFINCIEKFVLAHEPTAWDACYKNTSLNMKLVGDCYESG  154

Query  553  RGKELELSYA  582
             GK+LEL YA
Sbjct  155  YGKKLELQYA  164



>ref|XP_008777702.1| PREDICTED: gamma-interferon-inducible lysosomal thiol reductase 
[Phoenix dactylifera]
Length=299

 Score =   173 bits (438),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 76/136 (56%), Positives = 102/136 (75%), Gaps = 0/136 (0%)
 Frame = +1

Query  175  PISCGKVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKLKGNNTFEC  354
            P+   KVSL LYYE++CPY ++FI N L+KI++NG+I IVDL L P+GNA +  NN+  C
Sbjct  76   PLKISKVSLALYYETMCPYCSDFITNNLSKIFDNGLISIVDLDLVPYGNAGVGSNNSIMC  135

Query  355  QHGAAECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWETCYEKLGKDPKQIS  534
            QHG +EC LNT+EACAI AWPD++EHF FI+C+E LV    Y +W++C+++ G D   + 
Sbjct  136  QHGPSECQLNTVEACAISAWPDVQEHFDFIHCIEHLVMEHRYDEWKSCFQQTGLDSTSVL  195

Query  535  DCYASGRGKELELSYA  582
            DCY SG G+ELEL YA
Sbjct  196  DCYNSGYGEELELQYA  211



>ref|XP_008457320.1| PREDICTED: gamma-interferon-inducible lysosomal thiol reductase-like 
[Cucumis melo]
Length=226

 Score =   170 bits (431),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 86/147 (59%), Positives = 106/147 (72%), Gaps = 7/147 (5%)
 Frame = +1

Query  163  TSLSPIS----CGKVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKL  330
             S SP S    C KVSLD+YYESLCP S  FIV+ L +++E  ++ IVDL   P+GNA+L
Sbjct  25   VSASPSSPNYGCEKVSLDVYYESLCPDSVKFIVDNLIELFEGDLLPIVDLRFVPYGNARL  84

Query  331  KGNNTFECQHGAAECLLNTIEACAIDAWPDL---KEHFPFIYCVESLVNNGEYSKWETCY  501
              N++  CQHG  ECLLNT+EACAI  WPDL     HFPFIYCV +LV   +Y++W+TC+
Sbjct  85   DRNSSITCQHGPNECLLNTVEACAIHVWPDLTGATGHFPFIYCVGTLVYERKYTQWKTCF  144

Query  502  EKLGKDPKQISDCYASGRGKELELSYA  582
            EKLG + K ISDCY+SG GKELEL YA
Sbjct  145  EKLGLNSKPISDCYSSGLGKELELQYA  171



>gb|ABF95437.1| Gamma interferon inducible lysosomal thiol reductase family protein, 
expressed [Oryza sativa Japonica Group]
 dbj|BAG97530.1| unnamed protein product [Oryza sativa Japonica Group]
Length=256

 Score =   171 bits (433),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 77/132 (58%), Positives = 99/132 (75%), Gaps = 1/132 (1%)
 Frame = +1

Query  187  GKVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKLKGNNTFECQHGA  366
            GKV + LYYESLCPYSA F+V  LAK++ +G++D VDL+L P+GNA++K +    CQHG+
Sbjct  30   GKVDVALYYESLCPYSAMFVVGSLAKVFRDGLLDAVDLSLVPYGNARVK-DGKISCQHGS  88

Query  367  AECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWETCYEKLGKDPKQISDCYA  546
             EC LNT+EACAIDAWPDL+ HF FIYCVE LV N +  +WE+C+ KL  DPK ++DCY 
Sbjct  89   EECFLNTVEACAIDAWPDLRVHFRFIYCVEDLVVNHKQREWESCFGKLNLDPKPVTDCYK  148

Query  547  SGRGKELELSYA  582
              RG +L L Y 
Sbjct  149  GERGHQLSLKYG  160



>gb|EEC75043.1| hypothetical protein OsI_11143 [Oryza sativa Indica Group]
Length=256

 Score =   171 bits (433),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 77/132 (58%), Positives = 99/132 (75%), Gaps = 1/132 (1%)
 Frame = +1

Query  187  GKVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKLKGNNTFECQHGA  366
            GKV + LYYESLCPYSA F+V  LAK++ +G++D VDL+L P+GNA++K +    CQHG+
Sbjct  30   GKVDVALYYESLCPYSAMFVVGSLAKVFRDGLLDAVDLSLVPYGNARVK-DGKISCQHGS  88

Query  367  AECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWETCYEKLGKDPKQISDCYA  546
             EC LNT+EACAIDAWPDL+ HF FIYCVE LV N +  +WE+C+ KL  DPK ++DCY 
Sbjct  89   EECFLNTVEACAIDAWPDLRVHFRFIYCVEDLVVNHKQREWESCFGKLNLDPKPVTDCYK  148

Query  547  SGRGKELELSYA  582
              RG +L L Y 
Sbjct  149  GERGHQLSLKYG  160



>ref|XP_011024903.1| PREDICTED: gamma-interferon-inducible lysosomal thiol reductase, 
partial [Populus euphratica]
Length=270

 Score =   171 bits (434),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 82/142 (58%), Positives = 107/142 (75%), Gaps = 2/142 (1%)
 Frame = +1

Query  163  TSLSPISCGKVSLDLYYESLCPYSANFIVNYLAKIYENG-IIDIVDLTLFPWGNAKLKGN  339
            T++ P +  KV L LYYESLCPYSAN IV+YL K+ E+  ++ IV+L L PWGNAK +GN
Sbjct  6    TTILPSNTDKVFLALYYESLCPYSANSIVSYLNKLVEDDELLSIVNLYLSPWGNAKFRGN  65

Query  340  NTFECQHGAAECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWETCYEKLGKD  519
            +TF CQHG  ECLLNT+E CA+ AWP L++HFPF YCVE LV   +Y +WE+C+++LG D
Sbjct  66   DTFFCQHGPYECLLNTVEVCAVHAWPKLEDHFPFAYCVERLVYERKYPEWESCFKELGLD  125

Query  520  PKQISDCY-ASGRGKELELSYA  582
            P+ +S+CY   G G +LEL YA
Sbjct  126  PRAVSECYTGGGYGDDLELKYA  147



>ref|XP_004145239.1| PREDICTED: gamma-interferon-inducible lysosomal thiol reductase-like 
[Cucumis sativus]
 gb|KGN65848.1| hypothetical protein Csa_1G533550 [Cucumis sativus]
Length=226

 Score =   170 bits (430),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 80/136 (59%), Positives = 103/136 (76%), Gaps = 3/136 (2%)
 Frame = +1

Query  184  CGKVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKLKGNNTFECQHG  363
            C KVSLD+YYESLCP S  FIV+ L +++E  ++ IVDL   P+GNA+L  N++  CQHG
Sbjct  36   CEKVSLDVYYESLCPDSVKFIVDNLIELFEGDLLSIVDLRFVPYGNARLDRNSSITCQHG  95

Query  364  AAECLLNTIEACAIDAWPDL---KEHFPFIYCVESLVNNGEYSKWETCYEKLGKDPKQIS  534
              ECLLNT+EACAI AWPDL     HFPFIYCV+++V   +Y++W+TC+EKLG + K + 
Sbjct  96   PNECLLNTVEACAIHAWPDLTGATGHFPFIYCVQTVVYERKYTQWKTCFEKLGLNSKPVY  155

Query  535  DCYASGRGKELELSYA  582
            DCY+SG GKELEL YA
Sbjct  156  DCYSSGLGKELELQYA  171



>ref|XP_004164408.1| PREDICTED: gamma-interferon-inducible lysosomal thiol reductase-like 
[Cucumis sativus]
Length=226

 Score =   169 bits (429),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 80/136 (59%), Positives = 103/136 (76%), Gaps = 3/136 (2%)
 Frame = +1

Query  184  CGKVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKLKGNNTFECQHG  363
            C KVSLD+YYESLCP S  FIV+ L +++E  ++ IVDL   P+GNA+L  N++  CQHG
Sbjct  36   CEKVSLDVYYESLCPDSVKFIVDNLIELFEGDLLSIVDLRFVPYGNARLDRNSSITCQHG  95

Query  364  AAECLLNTIEACAIDAWPDL---KEHFPFIYCVESLVNNGEYSKWETCYEKLGKDPKQIS  534
              ECLLNT+EACAI AWPDL     HFPFIYCV+++V   +Y++W+TC+EKLG + K + 
Sbjct  96   PNECLLNTVEACAIHAWPDLTGATGHFPFIYCVQTVVYERKYTQWKTCFEKLGLNSKPVY  155

Query  535  DCYASGRGKELELSYA  582
            DCY+SG GKELEL YA
Sbjct  156  DCYSSGLGKELELQYA  171



>gb|KFK43004.1| hypothetical protein AALP_AA1G067000 [Arabis alpina]
Length=484

 Score =   176 bits (445),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 86/142 (61%), Positives = 104/142 (73%), Gaps = 1/142 (1%)
 Frame = +1

Query  160  FTSLSPISCGKVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKLKGN  339
            F+ +S  S  KV+L LYYESLCP  + FIVN L K++E+ +I IVDL L PWGN  L+ +
Sbjct  248  FSGISLPSSPKVTLSLYYESLCPACSYFIVNNLVKLFEDDLISIVDLHLSPWGNTNLRPD  307

Query  340  N-TFECQHGAAECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWETCYEKLGK  516
            N T  CQHGA EC L+T+E CAIDAWP L +HFPFIYC+ESLV   +Y KWETCYEKL  
Sbjct  308  NVTAVCQHGAYECFLDTLEVCAIDAWPKLSDHFPFIYCIESLVTEHKYDKWETCYEKLNL  367

Query  517  DPKQISDCYASGRGKELELSYA  582
            + K I+DC  SG GKEL+L YA
Sbjct  368  NSKPIADCLNSGHGKELQLQYA  389


 Score =   173 bits (439),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 80/129 (62%), Positives = 99/129 (77%), Gaps = 1/129 (1%)
 Frame = +1

Query  199  LDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKLKGNN-TFECQHGAAEC  375
            L LYYESLCPY + FIVN+L K++E+ +I IVDL L PWGN KL+ +N T  CQHGA EC
Sbjct  41   LGLYYESLCPYCSAFIVNHLVKLFEDDLISIVDLHLSPWGNTKLRPDNVTVVCQHGAFEC  100

Query  376  LLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWETCYEKLGKDPKQISDCYASGR  555
             L+T+EACAIDAWP L +HFPFI+C+ESLV   +Y +WETCYEKL  D + I+DC  SG 
Sbjct  101  FLDTVEACAIDAWPKLSDHFPFIFCIESLVTERKYDQWETCYEKLNLDSRPITDCLESGH  160

Query  556  GKELELSYA  582
            G +L+L YA
Sbjct  161  GNKLQLQYA  169



>ref|XP_009400003.1| PREDICTED: gamma-interferon-inducible lysosomal thiol reductase-like 
[Musa acuminata subsp. malaccensis]
Length=248

 Score =   169 bits (429),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 79/144 (55%), Positives = 103/144 (72%), Gaps = 1/144 (1%)
 Frame = +1

Query  148  CLLFFTSLSPISCGKVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAK  327
            C +F T +  +S  KVSL LYYE+LCP+ ++FIVN+L KI+ NG+I IVDL   P+GNA 
Sbjct  18   CHVFSTPVV-VSGRKVSLSLYYEALCPFCSSFIVNHLPKIFSNGLISIVDLDFIPFGNAM  76

Query  328  LKGNNTFECQHGAAECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWETCYEK  507
            L  N +  CQHG  ECLLNT+EACAI +WP +++HF FIYC+E LV  G+Y+ WE C+++
Sbjct  77   LDPNGSISCQHGQYECLLNTVEACAISSWPIVQQHFRFIYCIEHLVEEGQYTNWEACFQQ  136

Query  508  LGKDPKQISDCYASGRGKELELSY  579
             G   K + DCY SG G ELEL Y
Sbjct  137  TGFGSKPVIDCYNSGYGDELELQY  160



>gb|EMT12528.1| hypothetical protein F775_29715 [Aegilops tauschii]
Length=257

 Score =   169 bits (427),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 74/132 (56%), Positives = 98/132 (74%), Gaps = 0/132 (0%)
 Frame = +1

Query  187  GKVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKLKGNNTFECQHGA  366
            GKVS+ LYYESLCP+SA+F+VN L +++++G++D  DLTL P+GNAK+  +    CQHG 
Sbjct  35   GKVSMALYYESLCPFSAHFVVNSLTRVFKDGLLDAADLTLVPYGNAKVDAHGAITCQHGP  94

Query  367  AECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWETCYEKLGKDPKQISDCYA  546
             ECLLN +EACAIDAWPDL  HF FI CVE LV N +  +WE+C++K G DPK + +CY 
Sbjct  95   DECLLNNVEACAIDAWPDLNVHFGFINCVEDLVMNRKREEWESCFQKQGLDPKPVMECYN  154

Query  547  SGRGKELELSYA  582
            S +G +L L Y 
Sbjct  155  SDQGHKLSLKYG  166



>ref|XP_003558136.1| PREDICTED: gamma-interferon-inducible lysosomal thiol reductase-like 
isoform X1 [Brachypodium distachyon]
Length=246

 Score =   167 bits (424),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 73/133 (55%), Positives = 98/133 (74%), Gaps = 0/133 (0%)
 Frame = +1

Query  184  CGKVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKLKGNNTFECQHG  363
             GKV L LYYESLCP+SA+F+V  L +++++G+++  DLTL P+GNA++  + +  CQHG
Sbjct  31   AGKVRLALYYESLCPFSASFVVENLTRVFKDGLLEAADLTLVPYGNAEVGADRSISCQHG  90

Query  364  AAECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWETCYEKLGKDPKQISDCY  543
              ECLLNT+EACA+DAWPDLK HF FI CVE LV      +WE+C+ KLG D K+++DCY
Sbjct  91   PDECLLNTVEACAMDAWPDLKVHFGFINCVEDLVMKRRRGEWESCFNKLGLDSKRVTDCY  150

Query  544  ASGRGKELELSYA  582
             S RG EL L + 
Sbjct  151  KSERGHELSLKFG  163



>gb|EAZ26583.1| hypothetical protein OsJ_10480 [Oryza sativa Japonica Group]
Length=258

 Score =   167 bits (423),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 76/133 (57%), Positives = 100/133 (75%), Gaps = 1/133 (1%)
 Frame = +1

Query  187  GKVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKLK-GNNTFECQHG  363
            GKV + LYYESLCPYSA F+V  LAK++ +G++D VDL+L P+GNA++K G  + + +HG
Sbjct  30   GKVDVALYYESLCPYSAMFVVGSLAKVFRDGLLDAVDLSLVPYGNARVKDGKISCQVEHG  89

Query  364  AAECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWETCYEKLGKDPKQISDCY  543
            + EC LNT+EACAIDAWPDL+ HF FIYCVE LV N +  +WE+C+ KL  DPK ++DCY
Sbjct  90   SEECFLNTVEACAIDAWPDLRVHFRFIYCVEDLVVNHKQREWESCFGKLNLDPKPVTDCY  149

Query  544  ASGRGKELELSYA  582
               RG +L L Y 
Sbjct  150  KGERGHQLSLKYG  162



>gb|EMS63318.1| hypothetical protein TRIUR3_04864 [Triticum urartu]
Length=259

 Score =   166 bits (421),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 74/132 (56%), Positives = 98/132 (74%), Gaps = 0/132 (0%)
 Frame = +1

Query  187  GKVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKLKGNNTFECQHGA  366
            GKVS+ LYYESLCP+SA+F+VN LA+++++G++D  DLTL P+GNAK+  +    CQHG 
Sbjct  35   GKVSMALYYESLCPFSAHFVVNSLARLFKDGLLDAADLTLVPYGNAKVDAHGAITCQHGP  94

Query  367  AECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWETCYEKLGKDPKQISDCYA  546
             ECLLN +EACAI+AWPDL  HF FI CVE LV N +  +WE+C++K G DPK + +CY 
Sbjct  95   DECLLNNVEACAIEAWPDLNVHFGFINCVEDLVMNRKREEWESCFQKQGLDPKPVMECYN  154

Query  547  SGRGKELELSYA  582
            S  G +L L Y 
Sbjct  155  SEHGHKLSLKYG  166



>ref|XP_010543187.1| PREDICTED: gamma-interferon-inducible lysosomal thiol reductase 
[Tarenaya hassleriana]
Length=265

 Score =   166 bits (421),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 76/157 (48%), Positives = 104/157 (66%), Gaps = 1/157 (1%)
 Frame = +1

Query  112  GSHQQTKICFLVCLLFFTSLSPISCGKVSLDLYYESLCPYSANFIVNYLAKIYENGIIDI  291
              H   ++C  +  +FF   SP  C KV+L LYYE+LCPY A+FIVN+LA ++ENG+I I
Sbjct  23   ADHGFFRLCLAIFTIFFCLKSPCLCQKVTLSLYYETLCPYCADFIVNHLANVFENGLISI  82

Query  292  VDLTLFPWGNAKLKGNNTFECQHGAAECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNN  471
            +DL L PWGNA ++ + TF CQHG +EC LN I ACAI+A+PD+++HFPFIYC E L   
Sbjct  83   IDLRLVPWGNALIRPDRTFVCQHGDSECALNIIHACAINAYPDVEKHFPFIYCAERLALE  142

Query  472  GEYSKWETCYEKLGKDPKQISDCYASGRGKELELSYA  582
               ++W  C +  G   + + DCY +G G  +E  YA
Sbjct  143  NRLNEWVNCLDMAGLS-RALIDCYTNGYGNLMEQRYA  178



>gb|ABK27097.1| unknown [Picea sitchensis]
Length=238

 Score =   165 bits (418),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 78/130 (60%), Positives = 99/130 (76%), Gaps = 2/130 (2%)
 Frame = +1

Query  193  VSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKLKGNNTFECQHGAAE  372
            VS++LYYESLCPYSANFIVNYL K++ NG+IDIVDL L P+GNA++  N+T  CQHG  E
Sbjct  35   VSVELYYESLCPYSANFIVNYLDKLFTNGLIDIVDLRLIPYGNARIGANDTISCQHGPYE  94

Query  373  CLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWETCYEKLGKDPKQISDCYASG  552
            C+LNT+EACAI+AWP+L  +FPFI C+E  V   E + W+ CY+    + K + DCY SG
Sbjct  95   CVLNTVEACAINAWPNL--NFPFINCIEKFVLAHEPTAWDACYKNTSLNMKLVGDCYESG  152

Query  553  RGKELELSYA  582
             GK+LEL YA
Sbjct  153  YGKKLELQYA  162



>gb|EMS53982.1| hypothetical protein TRIUR3_28410 [Triticum urartu]
Length=251

 Score =   166 bits (419),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 74/144 (51%), Positives = 97/144 (67%), Gaps = 4/144 (3%)
 Frame = +1

Query  163  TSLSPISCG----KVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKL  330
            TS   ++ G    KV + +YYESLCPYSA F+ N+L K Y +G++D  DLTL P+GNAK+
Sbjct  21   TSAGDVATGSGGEKVHVAIYYESLCPYSARFVTNHLLKAYRDGLLDAADLTLVPYGNAKV  80

Query  331  KGNNTFECQHGAAECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWETCYEKL  510
              +    CQHG  ECLLNT++ACAIDAWPD+K H  FIYCV  LV    + +WE+C++K 
Sbjct  81   DAHGAITCQHGPDECLLNTVQACAIDAWPDVKVHLGFIYCVSDLVMKNRHREWESCFQKQ  140

Query  511  GKDPKQISDCYASGRGKELELSYA  582
            G DPK +++CY   RG  L L Y 
Sbjct  141  GLDPKPVTECYKGERGHNLSLEYG  164



>dbj|BAI78303.1| 27k protein [Triticum aestivum]
Length=215

 Score =   162 bits (411),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 70/131 (53%), Positives = 93/131 (71%), Gaps = 0/131 (0%)
 Frame = +1

Query  190  KVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKLKGNNTFECQHGAA  369
            KV + +YYESLCPYS  F+ N+L K Y +G++D  +LTL P+GNA ++ + T  CQHG  
Sbjct  23   KVHVAIYYESLCPYSVRFVANHLFKAYRDGLLDAANLTLVPYGNAVVRNDGTISCQHGPE  82

Query  370  ECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWETCYEKLGKDPKQISDCYAS  549
            ECLLNT+EACAIDAWPD+K H  FIYCV  LV   ++ +WE+C++K G DPK +++CY  
Sbjct  83   ECLLNTVEACAIDAWPDVKVHLGFIYCVSDLVLKNKHREWESCFQKQGLDPKPVTECYKG  142

Query  550  GRGKELELSYA  582
             RG  L L Y 
Sbjct  143  ERGHNLSLEYG  153



>gb|EMT18017.1| hypothetical protein F775_31970 [Aegilops tauschii]
Length=229

 Score =   163 bits (412),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 70/131 (53%), Positives = 91/131 (69%), Gaps = 0/131 (0%)
 Frame = +1

Query  190  KVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKLKGNNTFECQHGAA  369
            KV + +YYESLCPYS  F+ N+L K Y +G++D  DLTL P+GNAK+  +    CQHG  
Sbjct  37   KVHVAIYYESLCPYSVRFVANHLLKAYRDGLLDAADLTLVPYGNAKVNAHGAITCQHGPE  96

Query  370  ECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWETCYEKLGKDPKQISDCYAS  549
            ECLLNT+EACAIDAWPD+K H  FIYCV  LV   ++ +WE+C +K G DP+ +++CY  
Sbjct  97   ECLLNTVEACAIDAWPDVKVHLGFIYCVSDLVMKNKHREWESCIQKQGLDPRPVTECYKG  156

Query  550  GRGKELELSYA  582
             RG  L L Y 
Sbjct  157  ERGHNLSLEYG  167



>dbj|BAC76688.1| 27K protein [Triticum aestivum]
Length=203

 Score =   162 bits (409),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 70/131 (53%), Positives = 93/131 (71%), Gaps = 0/131 (0%)
 Frame = +1

Query  190  KVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKLKGNNTFECQHGAA  369
            KV + +YYESLCPYS  F+ N+L K Y +G++D  +LTL P+GNA ++ + T  CQHG  
Sbjct  11   KVHVAIYYESLCPYSVRFVANHLFKAYRDGLLDAANLTLVPYGNAVVRNDGTISCQHGPE  70

Query  370  ECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWETCYEKLGKDPKQISDCYAS  549
            ECLLNT+EACAIDAWPD+K H  FIYCV  LV   ++ +WE+C++K G DPK +++CY  
Sbjct  71   ECLLNTVEACAIDAWPDVKVHLGFIYCVSDLVLKNKHREWESCFQKQGLDPKPVTECYKG  130

Query  550  GRGKELELSYA  582
             RG  L L Y 
Sbjct  131  ERGHNLSLEYG  141



>emb|CAY85464.1| Tri a Bd 27K, partial [Triticum aestivum]
Length=202

 Score =   161 bits (408),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 70/131 (53%), Positives = 93/131 (71%), Gaps = 0/131 (0%)
 Frame = +1

Query  190  KVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKLKGNNTFECQHGAA  369
            KV + +YYESLCPYS  F+ N+L K Y +G++D  +LTL P+GNA ++ + T  CQHG  
Sbjct  10   KVHVAIYYESLCPYSVRFVANHLFKAYRDGLLDAANLTLVPYGNAVVRNDGTISCQHGPE  69

Query  370  ECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWETCYEKLGKDPKQISDCYAS  549
            ECLLNT+EACAIDAWPD+K H  FIYCV  LV   ++ +WE+C++K G DPK +++CY  
Sbjct  70   ECLLNTVEACAIDAWPDVKVHLGFIYCVSDLVLKNKHREWESCFQKQGLDPKPVTECYKG  129

Query  550  GRGKELELSYA  582
             RG  L L Y 
Sbjct  130  ERGHNLSLEYG  140



>emb|CBI18121.3| unnamed protein product [Vitis vinifera]
Length=317

 Score =   162 bits (410),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 85/179 (47%), Positives = 113/179 (63%), Gaps = 21/179 (12%)
 Frame = +1

Query  100  SQMAGSHQQTKICFLVCLL---FFTSLS-------------PISCGKVSLDLYYESLCPY  231
            SQMA S Q   +   +  L   FFTS S              +   +V+L +YYE+LCPY
Sbjct  55   SQMASSRQLLSLILRISTLLTFFFTSPSHSSSDVFSGVSVSSVDPNRVTLSVYYETLCPY  114

Query  232  SANFIVNYLAKIYENGIIDIVDLTLFPWGNAKLKGNNTFECQHGAAECLLNTIEACAIDA  411
             +NFIV  L KI+ENG+I IV+L + PWGNA L+ + TF+CQHG AEC+LNT+EAC I+ 
Sbjct  115  CSNFIVRDLLKIFENGLISIVNLRMIPWGNAVLRPDKTFQCQHGPAECVLNTVEACVINI  174

Query  412  WPDLKEHFPFIYCVESLVNNGEYSKWETCYEK--LGKDPKQISDCYASGRGKELELSYA  582
            +P +  HF FIYCVE L   G+ ++W +C+++  LGK P    DCY SG G +LEL YA
Sbjct  175  YPRVDMHFRFIYCVEYLALEGKQAEWASCFDRSQLGKVP---IDCYTSGYGNQLELKYA  230



>ref|NP_195778.1| protein OAS HIGH ACCUMULATION 1 [Arabidopsis thaliana]
 emb|CAB82274.1| putative protein [Arabidopsis thaliana]
 gb|AED90362.1| gamma interferon responsive lysosomal thiol (GILT) reductase 
family protein [Arabidopsis thaliana]
Length=233

 Score =   158 bits (400),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 76/151 (50%), Positives = 98/151 (65%), Gaps = 1/151 (1%)
 Frame = +1

Query  130  KICFLVCLLFFTSLSPISCGKVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLF  309
            ++C   C +FF  LS  S  KV+L LYYE+LCP+ A FIVN L KI+E G+I  +DL L 
Sbjct  6    RLCITSCTIFFCLLSLSSSQKVTLSLYYEALCPFCAEFIVNRLPKIFETGLISSIDLQLV  65

Query  310  PWGNAKLKGNNTFECQHGAAECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKW  489
            PWGNA ++ + T  CQHG AEC LN I ACAI+A+PD+ +HF +IYC E LV   +  KW
Sbjct  66   PWGNAAIRPDGTILCQHGEAECALNAIHACAINAYPDVMKHFGYIYCTEQLVLENKLEKW  125

Query  490  ETCYEKLGKDPKQISDCYASGRGKELELSYA  582
              C E +G     + DCY +G G +LE  YA
Sbjct  126  ADCLEMVGLSRAAV-DCYINGYGNQLEQRYA  155



>ref|XP_002267105.1| PREDICTED: gamma-interferon-inducible lysosomal thiol reductase 
[Vitis vinifera]
Length=261

 Score =   157 bits (397),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 84/177 (47%), Positives = 111/177 (63%), Gaps = 21/177 (12%)
 Frame = +1

Query  106  MAGSHQQTKICFLVCLL---FFTSLSPISC-------------GKVSLDLYYESLCPYSA  237
            MA S Q   +   +  L   FFTS S  S               +V+L +YYE+LCPY +
Sbjct  1    MASSRQLLSLILRISTLLTFFFTSPSHSSSDVFSGVSVSSVDPNRVTLSVYYETLCPYCS  60

Query  238  NFIVNYLAKIYENGIIDIVDLTLFPWGNAKLKGNNTFECQHGAAECLLNTIEACAIDAWP  417
            NFIV  L KI+ENG+I IV+L + PWGNA L+ + TF+CQHG AEC+LNT+EAC I+ +P
Sbjct  61   NFIVRDLLKIFENGLISIVNLRMIPWGNAVLRPDKTFQCQHGPAECVLNTVEACVINIYP  120

Query  418  DLKEHFPFIYCVESLVNNGEYSKWETCYEK--LGKDPKQISDCYASGRGKELELSYA  582
             +  HF FIYCVE L   G+ ++W +C+++  LGK P    DCY SG G +LEL YA
Sbjct  121  RVDMHFRFIYCVEYLALEGKQAEWASCFDRSQLGKVP---IDCYTSGYGNQLELKYA  174



>emb|CAN83947.1| hypothetical protein VITISV_043667 [Vitis vinifera]
Length=261

 Score =   157 bits (397),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 73/134 (54%), Positives = 98/134 (73%), Gaps = 5/134 (4%)
 Frame = +1

Query  187  GKVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKLKGNNTFECQHGA  366
             +V+L +YYE+LCPY +NFIV  L KI+ENG+I IV+L + PWGNA L+ + TF+CQHG 
Sbjct  44   NRVTLSVYYETLCPYCSNFIVRDLLKIFENGLISIVNLRMIPWGNAVLRPDKTFQCQHGP  103

Query  367  AECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWETCYEK--LGKDPKQISDC  540
            AEC+LNT+EAC I+ +P +  HF FIYCVE L   G+ ++W +C+++  LGK P    DC
Sbjct  104  AECVLNTVEACVINIYPRVDMHFRFIYCVEYLALEGKQAEWASCFDRSQLGKVP---IDC  160

Query  541  YASGRGKELELSYA  582
            Y SG G +LEL YA
Sbjct  161  YTSGYGNQLELKYA  174



>ref|XP_002870911.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47170.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=236

 Score =   156 bits (395),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 77/159 (48%), Positives = 100/159 (63%), Gaps = 1/159 (1%)
 Frame = +1

Query  106  MAGSHQQTKICFLVCLLFFTSLSPISCGKVSLDLYYESLCPYSANFIVNYLAKIYENGII  285
            MA   +  ++      +FF  LS  S  KV+L LYYE+LCPY A FIVN+L KI+E G+I
Sbjct  1    MASYQRLLRLAITSFTIFFCLLSLSSSQKVTLSLYYEALCPYCAEFIVNHLPKIFETGLI  60

Query  286  DIVDLTLFPWGNAKLKGNNTFECQHGAAECLLNTIEACAIDAWPDLKEHFPFIYCVESLV  465
              +DL L PWGNA ++ + T  CQHG AEC LN I ACAI+A+PD+ +HF +IYC E LV
Sbjct  61   SSIDLQLVPWGNAVIRPDGTILCQHGEAECALNAIHACAINAYPDVMKHFGYIYCTERLV  120

Query  466  NNGEYSKWETCYEKLGKDPKQISDCYASGRGKELELSYA  582
               +  KW  C E +G     + DCY +G G +LE  YA
Sbjct  121  LENKLEKWADCLEMVGLSRAAV-DCYINGYGNQLEQRYA  158



>dbj|BAK04070.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=249

 Score =   155 bits (391),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 69/132 (52%), Positives = 94/132 (71%), Gaps = 0/132 (0%)
 Frame = +1

Query  187  GKVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKLKGNNTFECQHGA  366
            GKV ++LYYESLCP SA F+   LA+ +E+G++++ D+TL P+GNA++  +    C+HG 
Sbjct  32   GKVPVELYYESLCPPSALFVTYRLAEAFEDGLLEVADVTLVPYGNAEVGKDGIITCEHGP  91

Query  367  AECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWETCYEKLGKDPKQISDCYA  546
             ECLLNT+EACAIDAWPD+  HF FI CVE L  N    +WE+C+ KLG DPK +++CY 
Sbjct  92   EECLLNTVEACAIDAWPDVNVHFGFINCVEELAMNETQGEWESCFHKLGLDPKPVTECYK  151

Query  547  SGRGKELELSYA  582
            S  G +L L Y 
Sbjct  152  SEHGHKLSLKYG  163



>gb|EMS63316.1| hypothetical protein TRIUR3_04862 [Triticum urartu]
Length=254

 Score =   154 bits (390),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 68/140 (49%), Positives = 95/140 (68%), Gaps = 0/140 (0%)
 Frame = +1

Query  163  TSLSPISCGKVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKLKGNN  342
            +S      GKV ++LYYE LCP S  F+V+ LA+++++G++D  DLTL P+GNAK+  + 
Sbjct  22   SSAGDAGNGKVRMELYYEFLCPDSFQFMVDSLARVFKDGLLDAADLTLVPYGNAKVDAHG  81

Query  343  TFECQHGAAECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWETCYEKLGKDP  522
               CQHG  ECLLNT+EACAIDAWPD+  HF FI CVE L    ++ +W++C++K G  P
Sbjct  82   AITCQHGPEECLLNTVEACAIDAWPDVNVHFGFIICVEELAMEYKHQEWQSCFQKQGLHP  141

Query  523  KQISDCYASGRGKELELSYA  582
            K + +CY S  G +L L Y 
Sbjct  142  KPVMECYESEHGHKLSLKYG  161



>ref|XP_006398604.1| hypothetical protein EUTSA_v10015266mg [Eutrema salsugineum]
 gb|ESQ40057.1| hypothetical protein EUTSA_v10015266mg [Eutrema salsugineum]
Length=233

 Score =   154 bits (388),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 74/151 (49%), Positives = 99/151 (66%), Gaps = 1/151 (1%)
 Frame = +1

Query  130  KICFLVCLLFFTSLSPISCGKVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLF  309
            ++C     +FF  +S  S  KV+L LYYE+LCPY A FIVN+L KI++NG+I  +DL L 
Sbjct  6    RLCIRNFTIFFCLVSLASSQKVTLSLYYEALCPYCAEFIVNHLPKIFQNGLISAIDLQLV  65

Query  310  PWGNAKLKGNNTFECQHGAAECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKW  489
            PWGN  ++ + T  CQHG AEC LN I ACAI+A+PD+ +HF +IYC E LV   +  KW
Sbjct  66   PWGNTVIRPDGTILCQHGEAECALNAIHACAINAYPDVMKHFGYIYCTEQLVLENKLEKW  125

Query  490  ETCYEKLGKDPKQISDCYASGRGKELELSYA  582
              C+E +G     + DC  +G G +LEL YA
Sbjct  126  ADCFEMVGLSRAAL-DCCFNGYGNQLELRYA  155



>ref|XP_009804795.1| PREDICTED: gamma-interferon-inducible lysosomal thiol reductase 
isoform X2 [Nicotiana sylvestris]
Length=229

 Score =   153 bits (386),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 78/160 (49%), Positives = 100/160 (63%), Gaps = 3/160 (2%)
 Frame = +1

Query  106  MAGSHQQTKICFLVCLLFFTSLSPISC-GKVSLDLYYESLCPYSANFIVNYLAKIYENGI  282
            MA  +Q   +  L+  L F S  P+S   KV+L LYYESLCPY A+FIVN LAK+ E  +
Sbjct  1    MASHNQNFILIILISWLMFQS--PVSSQDKVNLSLYYESLCPYCADFIVNKLAKVLETDL  58

Query  283  IDIVDLTLFPWGNAKLKGNNTFECQHGAAECLLNTIEACAIDAWPDLKEHFPFIYCVESL  462
              IV+L L PWGN ++  N ++ CQHG AECLLNT+EACAI  W +L+ HF FI CVE L
Sbjct  59   ASIVNLRLVPWGNTQIAPNTSWICQHGPAECLLNTVEACAIKVWSNLETHFKFINCVERL  118

Query  463  VNNGEYSKWETCYEKLGKDPKQISDCYASGRGKELELSYA  582
                  S W++C+   G     I +CY +G G  LE +YA
Sbjct  119  HLENRQSSWQSCFSATGLSQTPIKNCYNNGLGYRLEKAYA  158



>ref|XP_008370179.1| PREDICTED: gamma-interferon-inducible lysosomal thiol reductase 
[Malus domestica]
Length=234

 Score =   153 bits (386),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 76/161 (47%), Positives = 100/161 (62%), Gaps = 5/161 (3%)
 Frame = +1

Query  106  MAGSHQQTKICFLVCLLFFTSLSPISCGKVSLDLYYESLCPYSANFIVNYLAKIYENGII  285
            M    +  ++    CLL    +   +  KVS+ LYYE+LCPY A+FIVN L KI++NG+I
Sbjct  1    MGFIRKSFRLFIFFCLLGIMVIPSAASEKVSVTLYYETLCPYCADFIVNRLVKIFQNGLI  60

Query  286  DIVDLTLFPWGNAKLKGNNTFECQHGAAECLLNTIEACAIDAWPDLKEHFPFIYCVESLV  465
              V+L L PWGNA    + +F CQHG+ ECLLNTIEAC I  +PD+  HF FI+CVE   
Sbjct  61   SAVNLRLVPWGNAWFNPDGSFACQHGSDECLLNTIEACTISIYPDVNRHFTFIHCVERFT  120

Query  466  NNGEYSKWETCYE--KLGKDPKQISDCYASGRGKELELSYA  582
              G++  W  C+E  +LG +P    DCY SG G  +E SYA
Sbjct  121  LGGKHGAWANCFEMTRLGTEP---IDCYNSGNGYVIEGSYA  158



>ref|XP_011077526.1| PREDICTED: gamma-interferon-inducible lysosomal thiol reductase 
[Sesamum indicum]
Length=290

 Score =   154 bits (388),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 68/134 (51%), Positives = 95/134 (71%), Gaps = 0/134 (0%)
 Frame = +1

Query  181  SCGKVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKLKGNNTFECQH  360
            S  +V+L +YYESLCPY ANFIVN+L  I+   +++IV+L L PWGN +++ N+++ CQH
Sbjct  57   SENRVNLSVYYESLCPYCANFIVNHLVNIFHTDLLNIVNLRLVPWGNTQIRSNDSWICQH  116

Query  361  GAAECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWETCYEKLGKDPKQISDC  540
            G  EC L+  EACAI+AWP ++ HF FIYCVE L     +++W +CY   G DP+ I DC
Sbjct  117  GVDECELDVTEACAINAWPRVEAHFKFIYCVERLHLMNRHAEWPSCYAANGLDPQPIEDC  176

Query  541  YASGRGKELELSYA  582
            Y +G G +LE +YA
Sbjct  177  YNNGLGYQLEKAYA  190



>gb|EYU26691.1| hypothetical protein MIMGU_mgv1a010676mg [Erythranthe guttata]
Length=305

 Score =   154 bits (389),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 66/132 (50%), Positives = 96/132 (73%), Gaps = 0/132 (0%)
 Frame = +1

Query  187  GKVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKLKGNNTFECQHGA  366
             +V+L +YYESLCPY ANFIVN+L  I++  +I+IV+L L PWGN +++ N+T+ CQHG 
Sbjct  99   NRVNLSVYYESLCPYCANFIVNHLVNIFQTDLINIVNLRLIPWGNTQIQPNDTWICQHGI  158

Query  367  AECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWETCYEKLGKDPKQISDCYA  546
             EC L+  EACAI+ WP ++ HF FIYCVE L    ++++W++C+   G DPK + +CY 
Sbjct  159  DECKLDVTEACAINEWPQVETHFRFIYCVERLHLMNKHTQWQSCFASNGFDPKPLDNCYN  218

Query  547  SGRGKELELSYA  582
            +G G +LE +YA
Sbjct  219  NGLGYQLEKTYA  230



>ref|XP_004302276.1| PREDICTED: gamma-interferon-inducible lysosomal thiol reductase-like 
isoform X2 [Fragaria vesca subsp. vesca]
Length=217

 Score =   151 bits (382),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 76/143 (53%), Positives = 96/143 (67%), Gaps = 7/143 (5%)
 Frame = +1

Query  160  FTSLSPISCGKVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKLKGN  339
            F  LSP     VS+ LYYE+LCPY A+FIVN+LAKI++NG+I +V L + PWGNA L  +
Sbjct  4    FEMLSPQE--NVSVTLYYETLCPYCADFIVNHLAKIFDNGLISVVTLRMVPWGNAWLNSD  61

Query  340  NTFECQHGAAECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWETCYE--KLG  513
             +F CQHG  ECLLNTIEAC I  +P++  HF FI CVE L    +++KW  C+E  KLG
Sbjct  62   GSFACQHGTDECLLNTIEACTITIYPNVNRHFRFIQCVERLTLQNKHNKWADCFEMSKLG  121

Query  514  KDPKQISDCYASGRGKELELSYA  582
              P    DCY SG G ++E  YA
Sbjct  122  TVP---IDCYNSGYGNQIETKYA  141



>ref|XP_010423970.1| PREDICTED: gamma-interferon-inducible lysosomal thiol reductase-like 
[Camelina sativa]
Length=233

 Score =   151 bits (382),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 72/159 (45%), Positives = 100/159 (63%), Gaps = 4/159 (3%)
 Frame = +1

Query  106  MAGSHQQTKICFLVCLLFFTSLSPISCGKVSLDLYYESLCPYSANFIVNYLAKIYENGII  285
            MA   +  + C  +   FF  LS  S  KV+L LYYE+LCPY A FI+N+L K++E G+I
Sbjct  1    MASYQRPLRFCITI---FFCFLSLSSSQKVTLSLYYEALCPYCAEFIINHLPKVFETGLI  57

Query  286  DIVDLTLFPWGNAKLKGNNTFECQHGAAECLLNTIEACAIDAWPDLKEHFPFIYCVESLV  465
              +DL L PWGN  ++ + T  CQHG  EC LN++ ACAI+A+PD+++HF +IYC E LV
Sbjct  58   SAIDLQLVPWGNTVIRPDGTILCQHGETECALNSVHACAINAYPDVRKHFGYIYCTEQLV  117

Query  466  NNGEYSKWETCYEKLGKDPKQISDCYASGRGKELELSYA  582
               +  KW  C E +G     + +CY +G G +LE  YA
Sbjct  118  LENKLEKWADCLEMVGLSRAAV-ECYINGYGNKLEQRYA  155



>gb|EMT15047.1| hypothetical protein F775_26223 [Aegilops tauschii]
Length=283

 Score =   152 bits (385),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 66/132 (50%), Positives = 93/132 (70%), Gaps = 0/132 (0%)
 Frame = +1

Query  187  GKVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKLKGNNTFECQHGA  366
            GKV ++LYYESLCP S  F+V+ LA+++++G++D  DLTL P+GNAK+  +    CQ G 
Sbjct  33   GKVRMELYYESLCPDSFEFMVDSLARVFKDGLLDAADLTLVPYGNAKVDAHGAITCQRGP  92

Query  367  AECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWETCYEKLGKDPKQISDCYA  546
             ECLLNT+EACAIDAWPD+  HF FI C+E L    ++ +W++C++K G  PK + +CY 
Sbjct  93   DECLLNTVEACAIDAWPDVNVHFGFINCMEELAMEYKHQEWQSCFQKQGLHPKPVMECYK  152

Query  547  SGRGKELELSYA  582
            S  G +L L Y 
Sbjct  153  SEHGHKLSLRYG  164



>ref|XP_008370183.1| PREDICTED: gamma-interferon-inducible lysosomal thiol reductase-like 
[Malus domestica]
Length=271

 Score =   152 bits (384),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 72/139 (52%), Positives = 100/139 (72%), Gaps = 3/139 (2%)
 Frame = +1

Query  175  PISCGKVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKLKG-NNTFE  351
            P    KV L LYYE+LCP+ A FIVN L+K+++  +I+IV+L L P+GNA ++G N+T  
Sbjct  52   PTKAKKVDLTLYYETLCPFCAQFIVNGLSKVFDTDLINIVNLRLVPYGNAHIQGPNSTIV  111

Query  352  CQHGAAECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSK--WETCYEKLGKDPK  525
            CQHG  EC LN+IEACAI+++PD  +HF FI+C+E+    G+ SK  W++C ++LG DPK
Sbjct  112  CQHGPDECYLNSIEACAINSYPDATQHFKFIHCIENQTIQGKQSKDEWKSCSQQLGMDPK  171

Query  526  QISDCYASGRGKELELSYA  582
             + DCY SG  K+L L YA
Sbjct  172  PVQDCYDSGLEKKLILQYA  190



>ref|XP_008243096.1| PREDICTED: gamma-interferon-inducible lysosomal thiol reductase 
[Prunus mume]
Length=242

 Score =   151 bits (382),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 71/133 (53%), Positives = 92/133 (69%), Gaps = 5/133 (4%)
 Frame = +1

Query  190  KVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKLKGNNTFECQHGAA  369
            KVS+ LYYE+LCPY A+FIVN+L K+++NG+I I++L L PWGNA L  + +F CQHG+ 
Sbjct  28   KVSVALYYETLCPYCADFIVNHLVKLFQNGLISIINLRLVPWGNAWLNSDGSFSCQHGSD  87

Query  370  ECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWETCYE--KLGKDPKQISDCY  543
            ECLLNTIEAC +  +PD+  HF FI+CVE L   G +S W  C+E  +LG  P    DCY
Sbjct  88   ECLLNTIEACTMSIYPDVNRHFAFIHCVERLSLQGRHSAWANCFEMSRLGTTP---IDCY  144

Query  544  ASGRGKELELSYA  582
             SG G  +E  Y 
Sbjct  145  NSGNGNVIEGKYG  157



>gb|EPS59926.1| hypothetical protein M569_14879, partial [Genlisea aurea]
Length=200

 Score =   150 bits (378),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 69/131 (53%), Positives = 92/131 (70%), Gaps = 1/131 (1%)
 Frame = +1

Query  190  KVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKLKGNNTFECQHGAA  369
            +VSL LYYESLCPY A+FIVN L+KI++N +ID+VDL L PWGN  +  N+T+ CQHGA 
Sbjct  8    RVSLSLYYESLCPYCADFIVNKLSKIFQNRLIDVVDLRLIPWGNTHILPNSTWACQHGAD  67

Query  370  ECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWETCYEKLGKDPKQISDCYAS  549
            EC L+ ++ACAI  WP+   HF FI+CVE L   G++++W +C+  L  DP  + +CY  
Sbjct  68   ECFLDVVDACAIRVWPEWT-HFRFIHCVERLHLMGKHTEWRSCFTTLALDPTPLYNCYNY  126

Query  550  GRGKELELSYA  582
            G G  LE  YA
Sbjct  127  GLGYRLEKQYA  137



>ref|XP_006481420.1| PREDICTED: GILT-like protein F37H8.5-like [Citrus sinensis]
Length=209

 Score =   150 bits (378),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 73/151 (48%), Positives = 99/151 (66%), Gaps = 6/151 (4%)
 Frame = +1

Query  139  FLVCLLFFTSLSPI-SCGKVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPW  315
            F    L   S+SP  S   V++ +YYE+LCPY A+FIVN+L K+++ G+  IV+L + PW
Sbjct  10   FFPASLLLLSISPFGSSENVTVSVYYETLCPYCADFIVNHLVKLFQKGLNSIVNLRMIPW  69

Query  316  GNAKLKGNNTFECQHGAAECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWET  495
            GN+ ++ + TF CQHG  ECLLNTIEAC I  +PD+ +HF FI+CVE L      ++W  
Sbjct  70   GNSMMQPDGTFVCQHGPGECLLNTIEACTISIYPDVVQHFSFIHCVERLALEKRQAEWIN  129

Query  496  CYE--KLGKDPKQISDCYASGRGKELELSYA  582
            C+E  KLG+ P    DCY +G GK LE  YA
Sbjct  130  CFELTKLGRVP---IDCYRNGLGKLLEQKYA  157



>ref|XP_007205797.1| hypothetical protein PRUPE_ppa010639mg [Prunus persica]
 gb|EMJ06996.1| hypothetical protein PRUPE_ppa010639mg [Prunus persica]
Length=242

 Score =   150 bits (380),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 71/133 (53%), Positives = 92/133 (69%), Gaps = 5/133 (4%)
 Frame = +1

Query  190  KVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKLKGNNTFECQHGAA  369
            KVS+ LYYE+LCPY A+FIVN+L K+++NG+I I++L L PWGNA L  + +F CQHG+ 
Sbjct  28   KVSVALYYETLCPYCADFIVNHLVKLFQNGLISIINLRLVPWGNAWLNSDGSFSCQHGSD  87

Query  370  ECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWETCYE--KLGKDPKQISDCY  543
            ECLLNTI+AC I  +PD+  HF FI+CVE L   G +S W  C+E  +LG  P    DCY
Sbjct  88   ECLLNTIDACTISIYPDVNRHFAFIHCVERLSLQGRHSAWANCFEMSRLGTTP---IDCY  144

Query  544  ASGRGKELELSYA  582
             SG G  +E  Y 
Sbjct  145  NSGNGNVIEGKYG  157



>ref|XP_010490539.1| PREDICTED: GILT-like protein F37H8.5 [Camelina sativa]
Length=233

 Score =   150 bits (379),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 72/155 (46%), Positives = 99/155 (64%), Gaps = 4/155 (3%)
 Frame = +1

Query  106  MAGSHQQTKICFLVCLLFFTSLSPISCGKVSLDLYYESLCPYSANFIVNYLAKIYENGII  285
            MA   +  + C  +   FF  LS  S  KV+L LYYE+LCPY A FI+N+L K++E G+I
Sbjct  1    MASYQRPLRFCITI---FFCFLSLSSSQKVTLSLYYEALCPYCAEFIINHLPKVFETGLI  57

Query  286  DIVDLTLFPWGNAKLKGNNTFECQHGAAECLLNTIEACAIDAWPDLKEHFPFIYCVESLV  465
              +DL L PWGNA ++ + T  CQHG  EC LN+I ACAI+A+PD+++HF +IYC E LV
Sbjct  58   SAIDLQLVPWGNAVIRPDGTILCQHGETECALNSIHACAINAYPDVRKHFGYIYCTEQLV  117

Query  466  NNGEYSKWETCYEKLGKDPKQISDCYASGRGKELE  570
               +  KW  C E +G     + +CY +G G +LE
Sbjct  118  LENKLEKWADCLEMVGLSRAAV-ECYINGYGNKLE  151



>emb|CDY11193.1| BnaA03g00290D [Brassica napus]
Length=231

 Score =   149 bits (377),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 72/138 (52%), Positives = 93/138 (67%), Gaps = 1/138 (1%)
 Frame = +1

Query  169  LSPISCGKVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKLKGNNTF  348
            LS  S  KV+L LYYE+LCP+ A+FIVN+L +I++NG+I  +DL L PWGN   K + T 
Sbjct  17   LSLSSSQKVTLSLYYEALCPFCADFIVNHLPQIFQNGLISSIDLQLVPWGNTLFKPDGTI  76

Query  349  ECQHGAAECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWETCYEKLGKDPKQ  528
             CQHG AEC LN I ACAIDA+PD+ +H  +IYC E LV   +  +W  C+E +G     
Sbjct  77   LCQHGEAECALNAIHACAIDAYPDVMKHVGYIYCTERLVLENKLEQWADCFELVGLSRAP  136

Query  529  ISDCYASGRGKELELSYA  582
            + DCY SG G +LEL YA
Sbjct  137  L-DCYISGYGHQLELKYA  153



>ref|XP_010451968.1| PREDICTED: GILT-like protein F37H8.5 isoform X1 [Camelina sativa]
Length=233

 Score =   149 bits (377),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 74/159 (47%), Positives = 98/159 (62%), Gaps = 4/159 (3%)
 Frame = +1

Query  106  MAGSHQQTKICFLVCLLFFTSLSPISCGKVSLDLYYESLCPYSANFIVNYLAKIYENGII  285
            MA   +  + C  +   FF  LS  S  KV+L LYYE+LCPY A FI+N+L K++E G+I
Sbjct  1    MASYQRLLRFCITI---FFCFLSLSSSQKVTLSLYYEALCPYCAEFIINHLPKVFETGLI  57

Query  286  DIVDLTLFPWGNAKLKGNNTFECQHGAAECLLNTIEACAIDAWPDLKEHFPFIYCVESLV  465
              +DL L PWGN  +K + T  CQHG  EC LN+I ACAI+A+PD+ +HF +IYC E LV
Sbjct  58   SAIDLQLVPWGNTVIKPDGTILCQHGEIECALNSIHACAINAYPDVMQHFGYIYCTEQLV  117

Query  466  NNGEYSKWETCYEKLGKDPKQISDCYASGRGKELELSYA  582
               +  KW  C E +G     +  CY +G G +LE  YA
Sbjct  118  LENKLEKWADCLEMVGLSRAAVV-CYINGYGNKLEQRYA  155



>emb|CDX80764.1| BnaC03g00180D [Brassica napus]
Length=231

 Score =   149 bits (377),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 73/142 (51%), Positives = 96/142 (68%), Gaps = 3/142 (2%)
 Frame = +1

Query  157  FFTSLSPISCGKVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKLKG  336
            FF SLS  S  KV+L LYYE+LCP+ A+FIVN+L +I++NG+I  +DL L PWGN   K 
Sbjct  15   FFLSLS--SSQKVTLSLYYEALCPFCADFIVNHLPQIFQNGLISSIDLHLVPWGNTLFKP  72

Query  337  NNTFECQHGAAECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWETCYEKLGK  516
            + T  CQHG AEC LN I ACAI+A+PD+ +H  +IYC E LV   +  +W  C+E +G 
Sbjct  73   DGTILCQHGEAECALNAIHACAINAYPDVMKHVGYIYCTERLVLENKLEQWADCFELVGL  132

Query  517  DPKQISDCYASGRGKELELSYA  582
                + DCY +G G +LEL YA
Sbjct  133  SRAAL-DCYINGYGHQLELKYA  153



>ref|XP_009376399.1| PREDICTED: gamma-interferon-inducible lysosomal thiol reductase 
[Pyrus x bretschneideri]
Length=234

 Score =   149 bits (377),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 73/136 (54%), Positives = 92/136 (68%), Gaps = 5/136 (4%)
 Frame = +1

Query  181  SCGKVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKLKGNNTFECQH  360
            S  KVS+ LYYE+LCPY ANFIVN+L KI++N +I  V+L L PWGNA L  + +F CQH
Sbjct  26   SSEKVSVTLYYETLCPYCANFIVNHLVKIFQNDLISAVNLRLVPWGNAWLNPDGSFACQH  85

Query  361  GAAECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWETCYE--KLGKDPKQIS  534
            G+ ECLLNTIEAC I  +PD+  HF FI+CVE     G++  W  C+E  +LG +P    
Sbjct  86   GSDECLLNTIEACTISIYPDVNRHFTFIHCVERFTLGGKHGAWANCFEMTRLGTEP---I  142

Query  535  DCYASGRGKELELSYA  582
            DCY SG G  +E  YA
Sbjct  143  DCYNSGNGYVIEGRYA  158



>ref|XP_009376405.1| PREDICTED: gamma-interferon-inducible lysosomal thiol reductase-like 
[Pyrus x bretschneideri]
Length=271

 Score =   150 bits (379),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 71/139 (51%), Positives = 99/139 (71%), Gaps = 3/139 (2%)
 Frame = +1

Query  175  PISCGKVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKLKG-NNTFE  351
            P    KV L LYYE+LCP+ A FIVN L+K++   +I+IV+  L P+GNA ++G N+T  
Sbjct  52   PTKAKKVDLTLYYETLCPFCAQFIVNGLSKVFNTDLINIVNFRLVPYGNAHIQGPNSTIV  111

Query  352  CQHGAAECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSK--WETCYEKLGKDPK  525
            CQHG  EC LN+IEACAI+++PD+ +HF FI+C+E+    G+ SK  W++C ++LG DPK
Sbjct  112  CQHGPDECYLNSIEACAINSYPDVTQHFKFIHCIENQTIQGKQSKDEWKSCSQELGMDPK  171

Query  526  QISDCYASGRGKELELSYA  582
             + DCY SG  K+L L YA
Sbjct  172  PVQDCYDSGLEKKLILQYA  190



>ref|XP_004970433.1| PREDICTED: gamma-interferon-inducible lysosomal thiol reductase-like 
[Setaria italica]
Length=242

 Score =   149 bits (377),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 63/139 (45%), Positives = 96/139 (69%), Gaps = 1/139 (1%)
 Frame = +1

Query  169  LSPI-SCGKVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKLKGNNT  345
            LSP  + G+V++ +YYE+LCP+ + F+VN LA+I+ NG+  I DL L P+GN ++  + +
Sbjct  20   LSPACAAGRVTVSVYYETLCPFCSAFVVNDLARIFNNGVSSIADLRLVPFGNGRVSADGS  79

Query  346  FECQHGAAECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWETCYEKLGKDPK  525
              CQHG  EC LN IEAC I  WP+ ++HFPFI+CVE L    ++  W++C+++ G   +
Sbjct  80   ITCQHGEDECQLNAIEACVIRLWPNAEQHFPFIHCVEHLALTRKWDSWQSCFQETGLPSQ  139

Query  526  QISDCYASGRGKELELSYA  582
             + DCY SG G++LE+ YA
Sbjct  140  PVIDCYNSGYGRQLEMQYA  158



>ref|XP_006288581.1| hypothetical protein CARUB_v10001872mg [Capsella rubella]
 gb|EOA21479.1| hypothetical protein CARUB_v10001872mg [Capsella rubella]
Length=233

 Score =   149 bits (376),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 73/159 (46%), Positives = 99/159 (62%), Gaps = 4/159 (3%)
 Frame = +1

Query  106  MAGSHQQTKICFLVCLLFFTSLSPISCGKVSLDLYYESLCPYSANFIVNYLAKIYENGII  285
            MA   +  + C  +   F   LS  S  KV+L LYYE+LCPY A FIVN+L KI+E G+I
Sbjct  1    MASYQRLLRFCITIICCF---LSLSSSQKVTLSLYYEALCPYCAEFIVNHLPKIFETGLI  57

Query  286  DIVDLTLFPWGNAKLKGNNTFECQHGAAECLLNTIEACAIDAWPDLKEHFPFIYCVESLV  465
              +DL L PWGN  ++ + +  CQHG  EC LN+I ACAI+A+PD+++HF +IYC E LV
Sbjct  58   SAIDLQLVPWGNTVIRPDGSILCQHGETECALNSIHACAINAYPDVRKHFGYIYCTEQLV  117

Query  466  NNGEYSKWETCYEKLGKDPKQISDCYASGRGKELELSYA  582
               +  KW  C E +G     + +CY +G G +LE  YA
Sbjct  118  LENKLEKWADCLEMVGLSRAAV-ECYINGYGNQLERRYA  155



>ref|XP_002300002.2| hypothetical protein POPTR_0001s28790g, partial [Populus trichocarpa]
 gb|EEE84807.2| hypothetical protein POPTR_0001s28790g, partial [Populus trichocarpa]
Length=200

 Score =   148 bits (373),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 68/113 (60%), Positives = 87/113 (77%), Gaps = 1/113 (1%)
 Frame = +1

Query  235  ANFIVNYLAKIYENG-IIDIVDLTLFPWGNAKLKGNNTFECQHGAAECLLNTIEACAIDA  411
            AN IV+YL K+ E+  ++ IVDL L PWGNAK++GN+TF CQHG  ECLL+T+EACAI  
Sbjct  1    ANSIVSYLNKLVEDDELLSIVDLYLSPWGNAKIRGNDTFVCQHGPYECLLSTVEACAIHP  60

Query  412  WPDLKEHFPFIYCVESLVNNGEYSKWETCYEKLGKDPKQISDCYASGRGKELE  570
            WP L++HFPF+YCVE LV   +Y +WE+C+E LG DPK +S+CY  G G ELE
Sbjct  61   WPKLEDHFPFVYCVERLVYERKYPEWESCFEDLGLDPKAVSECYTGGYGDELE  113



>ref|XP_011466176.1| PREDICTED: gamma-interferon-inducible lysosomal thiol reductase-like 
isoform X1 [Fragaria vesca subsp. vesca]
Length=293

 Score =   150 bits (380),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 72/132 (55%), Positives = 92/132 (70%), Gaps = 5/132 (4%)
 Frame = +1

Query  193  VSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKLKGNNTFECQHGAAE  372
            VS+ LYYE+LCPY A+FIVN+LAKI++NG+I +V L + PWGNA L  + +F CQHG  E
Sbjct  89   VSVTLYYETLCPYCADFIVNHLAKIFDNGLISVVTLRMVPWGNAWLNSDGSFACQHGTDE  148

Query  373  CLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWETCYE--KLGKDPKQISDCYA  546
            CLLNTIEAC I  +P++  HF FI CVE L    +++KW  C+E  KLG  P    DCY 
Sbjct  149  CLLNTIEACTITIYPNVNRHFRFIQCVERLTLQNKHNKWADCFEMSKLGTVP---IDCYN  205

Query  547  SGRGKELELSYA  582
            SG G ++E  YA
Sbjct  206  SGYGNQIETKYA  217



>ref|XP_006429474.1| hypothetical protein CICLE_v10012699mg [Citrus clementina]
 gb|ESR42714.1| hypothetical protein CICLE_v10012699mg [Citrus clementina]
Length=221

 Score =   148 bits (373),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 73/151 (48%), Positives = 99/151 (66%), Gaps = 6/151 (4%)
 Frame = +1

Query  139  FLVCLLFFTSLSPI-SCGKVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPW  315
            F    L   S+SP  S   V++ +YYE+LCPY A+FIVN+L K+++ G+  IV+L + PW
Sbjct  10   FFPASLLLLSISPFGSSENVTVSVYYETLCPYCADFIVNHLVKLFQKGLNSIVNLRMIPW  69

Query  316  GNAKLKGNNTFECQHGAAECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWET  495
            GN+ ++ + TF CQHG  ECLLNTIEAC I  +PD+ +HF FI+CVE L      ++W  
Sbjct  70   GNSMMQPDGTFVCQHGPGECLLNTIEACTISIYPDVVQHFSFIHCVERLALEKRQAEWIN  129

Query  496  CYE--KLGKDPKQISDCYASGRGKELELSYA  582
            C+E  KLG+ P    DCY +G GK LE  YA
Sbjct  130  CFELTKLGRVP---IDCYRNGLGKLLEQKYA  157



>ref|XP_006481419.1| PREDICTED: gamma-interferon-inducible lysosomal thiol reductase-like 
[Citrus sinensis]
Length=229

 Score =   148 bits (374),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 73/151 (48%), Positives = 99/151 (66%), Gaps = 6/151 (4%)
 Frame = +1

Query  139  FLVCLLFFTSLSPI-SCGKVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPW  315
            F    L   S+SP  S   V++ +YYE+LCPY A+FIVN+L K+++ G+  IV+L + PW
Sbjct  10   FFPASLLLLSISPFGSSENVTVSVYYETLCPYCADFIVNHLVKLFQKGLNSIVNLRMIPW  69

Query  316  GNAKLKGNNTFECQHGAAECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWET  495
            GN+ ++ + TF CQHG  ECLLNTIEAC I  +PD+ +HF FI+CVE L      ++W  
Sbjct  70   GNSMMQPDGTFVCQHGPGECLLNTIEACTISIYPDVVQHFSFIHCVERLALEKRQAEWIN  129

Query  496  CYE--KLGKDPKQISDCYASGRGKELELSYA  582
            C+E  KLG+ P    DCY +G GK LE  YA
Sbjct  130  CFELTKLGRVP---IDCYRNGLGKLLEQKYA  157



>gb|KDO63236.1| hypothetical protein CISIN_1g042427mg [Citrus sinensis]
Length=229

 Score =   148 bits (373),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 73/151 (48%), Positives = 99/151 (66%), Gaps = 6/151 (4%)
 Frame = +1

Query  139  FLVCLLFFTSLSPI-SCGKVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPW  315
            F    L   S+SP  S   V++ +YYE+LCPY A+FIVN+L K+++ G+  IV+L + PW
Sbjct  10   FFPASLLLLSISPFGSSENVTVSVYYETLCPYCADFIVNHLVKLFQKGLNSIVNLRMIPW  69

Query  316  GNAKLKGNNTFECQHGAAECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWET  495
            GN+ ++ + TF CQHG  ECLLNTIEAC I  +PD+ +HF FI+CVE L      ++W  
Sbjct  70   GNSMMQPDGTFVCQHGPGECLLNTIEACTISIYPDVVQHFSFIHCVERLALEKRQAEWIN  129

Query  496  CYE--KLGKDPKQISDCYASGRGKELELSYA  582
            C+E  KLG+ P    DCY +G GK LE  YA
Sbjct  130  CFELTKLGRVP---IDCYRNGLGKLLEQKYA  157



>ref|XP_009621639.1| PREDICTED: gamma-interferon-inducible lysosomal thiol reductase 
isoform X1 [Nicotiana tomentosiformis]
Length=231

 Score =   148 bits (373),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 73/144 (51%), Positives = 94/144 (65%), Gaps = 2/144 (1%)
 Frame = +1

Query  151  LLFFTSLSPISCGKVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKL  330
            L+F + +S  S  KV+L LYYESLCPY A+FIVN LAK+ E  +  IV+L L PWGN ++
Sbjct  20   LIFQSHVS--SQDKVNLSLYYESLCPYCADFIVNKLAKVLETDLASIVNLRLVPWGNTQI  77

Query  331  KGNNTFECQHGAAECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWETCYEKL  510
              N ++ CQHG AECLLNT+EACAI  W +L  HF FI CVE L     +S W++C+   
Sbjct  78   APNTSWICQHGPAECLLNTVEACAIKVWSNLDTHFKFINCVEQLHLENRHSSWQSCFSAT  137

Query  511  GKDPKQISDCYASGRGKELELSYA  582
            G     I +CY +G G  LE +YA
Sbjct  138  GLSQTPIKNCYNNGLGYRLEKAYA  161



>ref|XP_003516977.1| PREDICTED: gamma-interferon-inducible lysosomal thiol reductase-like 
isoform X1 [Glycine max]
Length=263

 Score =   149 bits (375),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 68/142 (48%), Positives = 96/142 (68%), Gaps = 5/142 (4%)
 Frame = +1

Query  169  LSPISCG----KVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKLKG  336
            ++P S G    KV+L LYYESLCPY A+FIVN+L ++++ G+I I++L L PWGNA++  
Sbjct  32   VAPSSSGAPNEKVTLSLYYESLCPYRADFIVNHLVRLFQTGLISILNLRLVPWGNARIAP  91

Query  337  NNTFECQHGAAECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWETCYEKLGK  516
            + T  CQHG  EC LNTIEACAI  +PD+ +HF F+ C+E L   G +++W  C++  G 
Sbjct  92   DGTVVCQHGDDECFLNTIEACAITIYPDVVQHFRFVRCLERLTLEGRHNQWVNCFQMTGL  151

Query  517  DPKQISDCYASGRGKELELSYA  582
                I DCY +G GK ++  YA
Sbjct  152  GTSPI-DCYTNGNGKAIDQKYA  172



>ref|XP_003604571.1| Gamma-interferon-inducible lysosomal thiol reductase [Medicago 
truncatula]
 gb|AES86768.1| gamma interferon inducible lysosomal thiol reductase [Medicago 
truncatula]
Length=261

 Score =   149 bits (375),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 66/131 (50%), Positives = 91/131 (69%), Gaps = 0/131 (0%)
 Frame = +1

Query  190  KVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKLKGNNTFECQHGAA  369
            KV++ +YYESLCPYSA+FIVN+L K+++  +I IV+L + PWGNA++  N TF CQHG  
Sbjct  44   KVTMSIYYESLCPYSADFIVNHLVKLFQTNLISIVNLKMVPWGNARIATNGTFVCQHGND  103

Query  370  ECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWETCYEKLGKDPKQISDCYAS  549
            ECLLN+IEAC I A+ D++ HF FI+C+ESL   G Y++W  C    G     I +CY S
Sbjct  104  ECLLNSIEACTIKAYADVEHHFRFIHCLESLTIEGRYNEWFNCIRMTGLGALPILNCYKS  163

Query  550  GRGKELELSYA  582
             +G  +E  +A
Sbjct  164  RKGISIEQKFA  174



>ref|XP_008464223.1| PREDICTED: gamma-interferon-inducible lysosomal thiol reductase 
[Cucumis melo]
Length=238

 Score =   148 bits (373),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 70/149 (47%), Positives = 100/149 (67%), Gaps = 5/149 (3%)
 Frame = +1

Query  142  LVCLLFFTSLSPISCGKVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGN  321
            L  +L  +SL P    KV++ +YYE+LCP+ ANF+V +L K++ENG+I  V+L + PWGN
Sbjct  15   LCAVLLLSSLPPSVSEKVTVSVYYEALCPFCANFVVYHLVKLFENGLISAVNLRMIPWGN  74

Query  322  AKLKGNNTFECQHGAAECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWETCY  501
            A ++ + +F CQHG  EC+LNTIEAC I  +PD+++HF FI+CVE L     +++W  C+
Sbjct  75   AWIQPDGSFFCQHGPDECMLNTIEACTISIYPDIEKHFRFIHCVEGLTVQNRHNEWTKCF  134

Query  502  E--KLGKDPKQISDCYASGRGKELELSYA  582
            +  KL   P    DCY +G GK LE  YA
Sbjct  135  DIAKLSAIP---IDCYRNGHGKMLEQYYA  160



>ref|XP_009130643.1| PREDICTED: GILT-like protein F37H8.5 [Brassica rapa]
Length=231

 Score =   147 bits (372),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 71/138 (51%), Positives = 92/138 (67%), Gaps = 1/138 (1%)
 Frame = +1

Query  169  LSPISCGKVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKLKGNNTF  348
            LS  S  KV+L LYYE+LCP+ A+FIVN+L +I++NG+I  +DL L PWGN   K + T 
Sbjct  17   LSLSSSQKVTLSLYYEALCPFCADFIVNHLPQIFQNGLISSIDLHLVPWGNTLFKPDGTI  76

Query  349  ECQHGAAECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWETCYEKLGKDPKQ  528
             CQHG AEC L  I ACAIDA+PD+ +H  +IYC E LV   +  +W  C+E +G     
Sbjct  77   LCQHGEAECALTAIHACAIDAYPDVMKHVGYIYCTERLVLENKLEQWADCFELVGLSRAA  136

Query  529  ISDCYASGRGKELELSYA  582
            + DCY SG G +LEL YA
Sbjct  137  L-DCYISGYGHQLELKYA  153



>ref|XP_009804788.1| PREDICTED: gamma-interferon-inducible lysosomal thiol reductase 
isoform X1 [Nicotiana sylvestris]
Length=234

 Score =   147 bits (371),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 78/165 (47%), Positives = 100/165 (61%), Gaps = 8/165 (5%)
 Frame = +1

Query  106  MAGSHQQTKICFLVCLLFFTSLSPISC-GKVSLDLYYESLCPYSANFIVNYLAKIYENGI  282
            MA  +Q   +  L+  L F S  P+S   KV+L LYYESLCPY A+FIVN LAK+ E  +
Sbjct  1    MASHNQNFILIILISWLMFQS--PVSSQDKVNLSLYYESLCPYCADFIVNKLAKVLETDL  58

Query  283  IDIVDLTLFPWGNAKLKGNNTFECQHGAAECLLNTIEACAIDAWPDL-----KEHFPFIY  447
              IV+L L PWGN ++  N ++ CQHG AECLLNT+EACAI  W +L     + HF FI 
Sbjct  59   ASIVNLRLVPWGNTQIAPNTSWICQHGPAECLLNTVEACAIKVWSNLMLMIQETHFKFIN  118

Query  448  CVESLVNNGEYSKWETCYEKLGKDPKQISDCYASGRGKELELSYA  582
            CVE L      S W++C+   G     I +CY +G G  LE +YA
Sbjct  119  CVERLHLENRQSSWQSCFSATGLSQTPIKNCYNNGLGYRLEKAYA  163



>ref|XP_011046836.1| PREDICTED: gamma-interferon-inducible lysosomal thiol reductase-like 
[Populus euphratica]
 ref|XP_011046837.1| PREDICTED: gamma-interferon-inducible lysosomal thiol reductase-like 
[Populus euphratica]
Length=242

 Score =   147 bits (372),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 76/161 (47%), Positives = 97/161 (60%), Gaps = 7/161 (4%)
 Frame = +1

Query  112  GSHQQTKICFL--VCLLFFTSLSPISCGKVSLDLYYESLCPYSANFIVNYLAKIYENGII  285
             SH      FL  +C   F   S  S   V+L LYYE+LCPY A+FIVN+L K+++ G+I
Sbjct  2    ASHPSLFTAFLLFICTALFLIASTSSSQNVTLSLYYETLCPYCADFIVNHLVKVFDKGLI  61

Query  286  DIVDLTLFPWGNAKLKGNNTFECQHGAAECLLNTIEACAIDAWPDLKEHFPFIYCVESLV  465
             IV+L L PWGNA L+ N +F CQHG  EC LN IEAC +  +PD   HF FI+CVE + 
Sbjct  62   SIVNLRLIPWGNAFLQPNGSFVCQHGTNECFLNAIEACTVTIYPDAVRHFRFIHCVEKMS  121

Query  466  NNGEYSKWETCY--EKLGKDPKQISDCYASGRGKELELSYA  582
               + ++W  C+    LGK P    DCY SG G+ LE  YA
Sbjct  122  LENKMNEWVNCFGMSGLGKAPI---DCYTSGYGEVLERKYA  159



>ref|XP_007026601.1| Gamma-interferon-inducible lysosomal thiol reductase, putative 
[Theobroma cacao]
 gb|EOY07103.1| Gamma-interferon-inducible lysosomal thiol reductase, putative 
[Theobroma cacao]
Length=254

 Score =   147 bits (371),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 78/177 (44%), Positives = 106/177 (60%), Gaps = 16/177 (9%)
 Frame = +1

Query  100  SQMAGSHQQTKICFLVCLLF-FTSLSPISCG--------------KVSLDLYYESLCPYS  234
            S+MA       +  + CLLF FT  S +S                KV++ +YYE+LC   
Sbjct  3    SKMAFCKLAFPVLVMACLLFPFTFPSHVSVRNDAGVKVSTSNSSQKVNVSIYYEALCVRC  62

Query  235  ANFIVNYLAKIYENGIIDIVDLTLFPWGNAKL-KGNNTFECQHGAAECLLNTIEACAIDA  411
            A FIVN L  ++ENG+I I++L L PWG + + K NNT  C+HG  EC LNTI+ACAI  
Sbjct  63   AKFIVNKLEDVFENGLISIINLRLVPWGASYISKSNNTIICKHGQDECQLNTIQACAIYV  122

Query  412  WPDLKEHFPFIYCVESLVNNGEYSKWETCYEKLGKDPKQISDCYASGRGKELELSYA  582
            WPD+ +H+  IYC+E L       +WE+C++ LG   K I DCY SG+G+ LEL+YA
Sbjct  123  WPDVNKHYGLIYCIEFLAIEERQKEWESCFKSLGLPQKHILDCYNSGKGRTLELAYA  179



>ref|XP_003567241.1| PREDICTED: gamma-interferon-inducible lysosomal thiol reductase-like 
[Brachypodium distachyon]
Length=243

 Score =   146 bits (369),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 61/131 (47%), Positives = 91/131 (69%), Gaps = 0/131 (0%)
 Frame = +1

Query  190  KVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKLKGNNTFECQHGAA  369
            +VS+ +YYE+LCP+ + F+VN LA+I++NG+  IVDL L P+GN ++  + +  CQHG  
Sbjct  30   RVSVSVYYETLCPFCSGFVVNDLARIFQNGLSSIVDLRLVPFGNGRVSPDGSMTCQHGQD  89

Query  370  ECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWETCYEKLGKDPKQISDCYAS  549
            EC LN IEAC I  WP  ++HFPFI+C+E L    ++  W++C+ + G   + + DCY S
Sbjct  90   ECRLNAIEACVIRLWPQAEQHFPFIHCIEHLALTQKWGAWQSCFHESGLVSQPVIDCYNS  149

Query  550  GRGKELELSYA  582
            G G++LEL YA
Sbjct  150  GYGRKLELQYA  160



>emb|CDM84815.1| unnamed protein product [Triticum aestivum]
Length=226

 Score =   145 bits (367),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 61/131 (47%), Positives = 89/131 (68%), Gaps = 0/131 (0%)
 Frame = +1

Query  190  KVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKLKGNNTFECQHGAA  369
            +VS+ +YYE+LCP+ + F+VN LA+I+ NG+   VDL L P+GN ++  + +  CQHG  
Sbjct  28   RVSVAVYYETLCPFCSGFVVNDLARIFRNGLSSNVDLRLVPFGNGRVSPDGSMTCQHGED  87

Query  370  ECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWETCYEKLGKDPKQISDCYAS  549
            EC LN I+AC I  WPD + HFPFIYC+E L    ++  W++C+ + G   + + DCY S
Sbjct  88   ECRLNAIQACVISVWPDAERHFPFIYCIEHLALTQKWGAWQSCFHEAGLVSQPVLDCYNS  147

Query  550  GRGKELELSYA  582
            G G++LEL YA
Sbjct  148  GYGRQLELRYA  158



>ref|XP_011466447.1| PREDICTED: gamma-interferon-inducible-lysosomal thiol reductase 
[Fragaria vesca subsp. vesca]
Length=222

 Score =   145 bits (365),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 68/132 (52%), Positives = 91/132 (69%), Gaps = 5/132 (4%)
 Frame = +1

Query  193  VSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKLKGNNTFECQHGAAE  372
            VS+ LYYE+LCPY A+FIVN L+KI++NG+I +V+L + PWGN  L  + +F CQHG  E
Sbjct  18   VSVTLYYETLCPYCADFIVNNLSKIFDNGLISVVNLIMVPWGNTWLNSDGSFACQHGTNE  77

Query  373  CLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWETCYE--KLGKDPKQISDCYA  546
            CLLNTIEAC I  +P++  HF FI+CV+ L    ++ KW  C+E  KLG  P    +CY 
Sbjct  78   CLLNTIEACTITIYPNVNRHFRFIHCVQRLTLQNKHGKWADCFEMLKLGTVP---INCYN  134

Query  547  SGRGKELELSYA  582
            SG G ++E  YA
Sbjct  135  SGYGNQIETKYA  146



>ref|XP_002323009.1| gamma interferon responsive lysosomal thiol reductase family 
protein [Populus trichocarpa]
 gb|ABK93083.1| unknown [Populus trichocarpa]
 gb|EEF04770.1| gamma interferon responsive lysosomal thiol reductase family 
protein [Populus trichocarpa]
Length=242

 Score =   145 bits (367),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 71/154 (46%), Positives = 94/154 (61%), Gaps = 5/154 (3%)
 Frame = +1

Query  127  TKICFLVCLLFFTSLSPISCGKVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTL  306
            T     +C   F   S  S   V+L LYYE+LCPY A+FIVN+L K+++ G+I IV+L L
Sbjct  9    TAFLLFICTALFLIASTSSSQNVTLSLYYETLCPYCADFIVNHLVKVFDKGLISIVNLRL  68

Query  307  FPWGNAKLKGNNTFECQHGAAECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSK  486
             PWGNA ++ N +F CQHG  EC LN IEAC +  +PD   HF FI+CVE +    + ++
Sbjct  69   IPWGNAFIQPNGSFVCQHGTNECFLNAIEACTVTIYPDAVRHFRFIHCVEKMSLENKMNE  128

Query  487  WETCY--EKLGKDPKQISDCYASGRGKELELSYA  582
            W  C+    LGK P    DCY SG G+ L+  YA
Sbjct  129  WVNCFGMSGLGKAPI---DCYTSGYGEVLQRKYA  159



>gb|KFK24661.1| hypothetical protein AALP_AA8G008600 [Arabis alpina]
Length=252

 Score =   145 bits (367),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 68/125 (54%), Positives = 87/125 (70%), Gaps = 1/125 (1%)
 Frame = +1

Query  208  YYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKLKGNNTFECQHGAAECLLNT  387
            YYE+LCPY A FIVN+L+KI+EN +I  +DL L PWGNA ++ + TF CQHG AEC LN 
Sbjct  34   YYEALCPYCAEFIVNHLSKIFENDLISAIDLQLIPWGNAIIRSDGTFLCQHGKAECALNA  93

Query  388  IEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWETCYEKLGKDPKQISDCYASGRGKEL  567
            I ACAI+A+PD+ +HF +IYC E LV   +  KW  CYE +G   +   DCY +G G +L
Sbjct  94   IHACAINAYPDVMKHFGYIYCTERLVLENKLEKWGDCYEMVGLS-RAAFDCYINGYGNKL  152

Query  568  ELSYA  582
            E  YA
Sbjct  153  EQRYA  157



>ref|XP_011046831.1| PREDICTED: gamma-interferon-inducible lysosomal thiol reductase-like 
[Populus euphratica]
Length=268

 Score =   145 bits (367),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 71/132 (54%), Positives = 86/132 (65%), Gaps = 4/132 (3%)
 Frame = +1

Query  190  KVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKLKGNNTFECQHGAA  369
            KV++ LYYESLCPY ++FIV  LA++ E  ++ I++L L PWGNA L  NNT ECQHG  
Sbjct  47   KVTMSLYYESLCPYCSSFIVGPLAQVLETDLMTILNLRLVPWGNAILDSNNTIECQHGED  106

Query  370  ECLLNTIEACAIDAWPDLKEHFPFIYCVESLV----NNGEYSKWETCYEKLGKDPKQISD  537
            EC LN I ACAI+ WPDLK+HF FI C+E        NG    WE C  KL    + I  
Sbjct  107  ECYLNIIHACAINLWPDLKKHFDFIKCIEKQYKAPDRNGAEESWEVCSRKLRLPTQSIKK  166

Query  538  CYASGRGKELEL  573
            CY SG+GKEL L
Sbjct  167  CYDSGQGKELVL  178



>ref|XP_010450256.1| PREDICTED: gamma-interferon-inducible-lysosomal thiol reductase-like 
[Camelina sativa]
Length=225

 Score =   144 bits (363),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 77/155 (50%), Positives = 96/155 (62%), Gaps = 9/155 (6%)
 Frame = +1

Query  127  TKICFLVCLLFFTSLSPISCG---KVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVD  297
            TK+ FL CL+ FTS + +  G   KV L+LYYESLCP   NFIV+YL K++   +  I D
Sbjct  10   TKLVFLACLVLFTSSNKLVAGESDKVKLNLYYESLCPSCQNFIVHYLGKVFSTDLHTITD  69

Query  298  LTLFPWGNAKLKGNNTFECQHGAAECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGE  477
            L L P+GNA +  + T  CQHG  EC LN +EACAI  WP+ + H+ FI CVE+  N   
Sbjct  70   LKLVPFGNAHVSDDLTVTCQHGEEECKLNALEACAISTWPNQRLHYRFIRCVETNTN---  126

Query  478  YSKWETCYEKLGKDPKQISDCYASGRGKELELSYA  582
               WE+C +K G D K ISDCY     KEL L YA
Sbjct  127  --AWESCAKKYGGD-KAISDCYNGDLSKELILGYA  158



>ref|XP_010676804.1| PREDICTED: gamma-interferon-inducible lysosomal thiol reductase 
[Beta vulgaris subsp. vulgaris]
Length=262

 Score =   145 bits (366),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 77/166 (46%), Positives = 107/166 (64%), Gaps = 4/166 (2%)
 Frame = +1

Query  97   SSQMAGSHQQTKICFLVCLLFFT---SLSPISCGKVSLDLYYESLCPYSANFIVNYLAKI  267
            +SQ  G HQ T   FL+ L   T    L+ ++  KV L LYYE+LCPY + FI + L ++
Sbjct  2    ASQSYGYHQITLFFFLLLLHIITCYAQLTDLNQEKVDLTLYYETLCPYCSYFIAHDLVRL  61

Query  268  YE-NGIIDIVDLTLFPWGNAKLKGNNTFECQHGAAECLLNTIEACAIDAWPDLKEHFPFI  444
            +  +G+I IV+L L PWGNA L+ +  F+CQHG+ ECLLNT+EACAIDA+PD  +H+  I
Sbjct  62   FTIDGLISIVNLRLVPWGNAALQSSGYFQCQHGSGECLLNTVEACAIDAYPDTFKHYFLI  121

Query  445  YCVESLVNNGEYSKWETCYEKLGKDPKQISDCYASGRGKELELSYA  582
             C+ESL      ++W++C  K+  +   I +CY  G GK LEL YA
Sbjct  122  QCIESLAYQKREAEWQSCLTKVSLNSNPIFECYNQGNGKRLELQYA  167



>ref|XP_007026603.1| Gamma-interferon-inducible lysosomal thiol reductase precursor, 
putative [Theobroma cacao]
 gb|EOY07105.1| Gamma-interferon-inducible lysosomal thiol reductase precursor, 
putative [Theobroma cacao]
Length=276

 Score =   145 bits (366),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 71/140 (51%), Positives = 95/140 (68%), Gaps = 9/140 (6%)
 Frame = +1

Query  190  KVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKL-KGNNTFECQHGA  366
            +V+L LYYESLCPY   FIVN L K++ + +++I++L L PWGNAK+ K + T  CQHG 
Sbjct  41   RVNLSLYYESLCPYCRRFIVNQLVKVFNSDLLNIINLRLVPWGNAKVVKPDKTINCQHGE  100

Query  367  AECLLNTIEACAIDAWPDLKEHFPFIYCVESL---VNNGEYSK-----WETCYEKLGKDP  522
             EC LNTI ACAI+ WPDL++HF FIYC E+    + +G++S      W+ C  +LG D 
Sbjct  101  DECYLNTIHACAINIWPDLRKHFNFIYCTENQGVHIKDGQHSDGADAVWKACSARLGMDQ  160

Query  523  KQISDCYASGRGKELELSYA  582
            K I  CY SG G++L L YA
Sbjct  161  KLIKKCYDSGYGRKLLLQYA  180



>ref|XP_006576222.1| PREDICTED: uncharacterized protein LOC100784702 isoform X1 [Glycine 
max]
Length=262

 Score =   145 bits (365),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 68/142 (48%), Positives = 96/142 (68%), Gaps = 5/142 (4%)
 Frame = +1

Query  169  LSPISCG----KVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKLKG  336
            ++P S G    KV++ LYYESLCPY A+FIVN+L ++++ G+I IV+L L PWGNA +  
Sbjct  33   VAPSSSGAPNEKVTVSLYYESLCPYCADFIVNHLVRLFQTGLISIVNLRLVPWGNAWIAP  92

Query  337  NNTFECQHGAAECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWETCYEKLGK  516
            + T  CQHG  EC LNTIEACAI  +PD+ +HF ++ C+E+L   G +++W  C++  G 
Sbjct  93   DGTVVCQHGDDECFLNTIEACAITIYPDVVQHFRYVRCLENLTLEGRHNQWVNCFQMTGL  152

Query  517  DPKQISDCYASGRGKELELSYA  582
                I DCY SG GK ++  YA
Sbjct  153  GTSPI-DCYTSGNGKAIDQKYA  173



>gb|KHN03097.1| Gamma-interferon-inducible lysosomal thiol reductase [Glycine 
soja]
Length=260

 Score =   144 bits (364),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 68/142 (48%), Positives = 96/142 (68%), Gaps = 5/142 (4%)
 Frame = +1

Query  169  LSPISCG----KVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKLKG  336
            ++P S G    KV++ LYYESLCPY A+FIVN+L ++++ G+I IV+L L PWGNA +  
Sbjct  31   VAPSSSGAPNEKVTVSLYYESLCPYCADFIVNHLVRLFQTGLISIVNLRLVPWGNAWIAP  90

Query  337  NNTFECQHGAAECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWETCYEKLGK  516
            + T  CQHG  EC LNTIEACAI  +PD+ +HF ++ C+E+L   G +++W  C++  G 
Sbjct  91   DGTVVCQHGDDECFLNTIEACAITIYPDVVQHFRYVRCLENLTLEGRHNQWVNCFQMTGL  150

Query  517  DPKQISDCYASGRGKELELSYA  582
                I DCY SG GK ++  YA
Sbjct  151  GTSPI-DCYTSGNGKAIDQKYA  171



>ref|XP_010325745.1| PREDICTED: gamma-interferon-inducible lysosomal thiol reductase 
isoform X4 [Solanum lycopersicum]
Length=186

 Score =   142 bits (359),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 70/161 (43%), Positives = 97/161 (60%), Gaps = 2/161 (1%)
 Frame = +1

Query  106  MAGSHQQTKICFLVCLLFFTSLSPISCG--KVSLDLYYESLCPYSANFIVNYLAKIYENG  279
            MA  +Q T+I     L+   +     C   KV+L LYYESLCPY A+FIVN L K+ +  
Sbjct  1    MASHNQITRIIITFVLIPLLTFQCHVCSQDKVNLSLYYESLCPYCADFIVNQLVKVLQTD  60

Query  280  IIDIVDLTLFPWGNAKLKGNNTFECQHGAAECLLNTIEACAIDAWPDLKEHFPFIYCVES  459
            +  IV+L L PWGN ++  N ++ CQHG  EC LNT+EACAI  W +L+ HF  I C+E 
Sbjct  61   LGSIVNLRLVPWGNTQIAPNTSWICQHGTDECQLNTVEACAIKVWSNLETHFKLISCIEQ  120

Query  460  LVNNGEYSKWETCYEKLGKDPKQISDCYASGRGKELELSYA  582
            L    ++S W++C+   G     I +CY +G G +LE +YA
Sbjct  121  LHLQNKHSSWQSCFGSTGLSLNPIENCYNNGLGYQLETAYA  161



>gb|AES86767.2| gamma interferon inducible lysosomal thiol reductase [Medicago 
truncatula]
Length=263

 Score =   144 bits (364),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 65/131 (50%), Positives = 91/131 (69%), Gaps = 1/131 (1%)
 Frame = +1

Query  190  KVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKLKGNNTFECQHGAA  369
            KV++ +YYESLCP+ A+FIVN L ++++ G+I IVDL + PWGNA +K + TF+CQHG  
Sbjct  46   KVTMSIYYESLCPFCADFIVNDLVRLFQTGLISIVDLRMVPWGNAGIKPDGTFDCQHGND  105

Query  370  ECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWETCYEKLGKDPKQISDCYAS  549
            EC LNTIEACAI+ +PD+ +HF FI C+E L     +++W  C++  G     I DC  +
Sbjct  106  ECYLNTIEACAINIYPDVAQHFKFIRCLERLTLENRHNEWFNCFQMTGLGTMPI-DCSKT  164

Query  550  GRGKELELSYA  582
            G GK +E  YA
Sbjct  165  GNGKSIEQKYA  175



>gb|EMS56591.1| hypothetical protein TRIUR3_02402 [Triticum urartu]
Length=249

 Score =   144 bits (363),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 64/145 (44%), Positives = 92/145 (63%), Gaps = 1/145 (1%)
 Frame = +1

Query  142  LVCLLFFTSLSPI-SCGKVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWG  318
            LV  L    LSP  +  +VS+ +YYE+LCP+ + F+VN LA+I+ NG+   VDL L P+G
Sbjct  11   LVPFLVLLCLSPACAARRVSVAVYYETLCPFCSGFVVNELARIFRNGLSSNVDLRLVPFG  70

Query  319  NAKLKGNNTFECQHGAAECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWETC  498
            N +   + +  CQHG  EC LN I+AC I  WPD + HFPFIYC+E L    ++  W++C
Sbjct  71   NGRFSPDGSMTCQHGEDECRLNAIQACVISVWPDAERHFPFIYCIEHLALTQKWGAWQSC  130

Query  499  YEKLGKDPKQISDCYASGRGKELEL  573
            + + G   + + DCY SG G++L L
Sbjct  131  FHETGLASQPVLDCYNSGYGRQLRL  155



>ref|XP_002456575.1| hypothetical protein SORBIDRAFT_03g038650 [Sorghum bicolor]
 gb|EES01695.1| hypothetical protein SORBIDRAFT_03g038650 [Sorghum bicolor]
Length=232

 Score =   144 bits (362),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 61/134 (46%), Positives = 88/134 (66%), Gaps = 0/134 (0%)
 Frame = +1

Query  181  SCGKVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKLKGNNTFECQH  360
            + G+V + +YYE+LCP+ + F+VN L++++ NGI  I DL L P+GN ++  + T  CQH
Sbjct  26   AAGRVPVSVYYETLCPFCSAFVVNDLSRVFRNGISSIADLRLVPFGNGRVSADGTITCQH  85

Query  361  GAAECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWETCYEKLGKDPKQISDC  540
            G  EC LN IEAC I  WPD ++HFPFI CVE L    ++  W+ C+++ G   +   DC
Sbjct  86   GEEECQLNAIEACVIRIWPDAEQHFPFIQCVEHLALTRKWDAWQACFQETGLPYQPAIDC  145

Query  541  YASGRGKELELSYA  582
            Y SG G++L L YA
Sbjct  146  YNSGYGRQLVLQYA  159



>ref|XP_010325744.1| PREDICTED: gamma-interferon-inducible lysosomal thiol reductase 
isoform X3 [Solanum lycopersicum]
Length=189

 Score =   142 bits (359),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 70/161 (43%), Positives = 97/161 (60%), Gaps = 2/161 (1%)
 Frame = +1

Query  106  MAGSHQQTKICFLVCLLFFTSLSPISCG--KVSLDLYYESLCPYSANFIVNYLAKIYENG  279
            MA  +Q T+I     L+   +     C   KV+L LYYESLCPY A+FIVN L K+ +  
Sbjct  1    MASHNQITRIIITFVLIPLLTFQCHVCSQDKVNLSLYYESLCPYCADFIVNQLVKVLQTD  60

Query  280  IIDIVDLTLFPWGNAKLKGNNTFECQHGAAECLLNTIEACAIDAWPDLKEHFPFIYCVES  459
            +  IV+L L PWGN ++  N ++ CQHG  EC LNT+EACAI  W +L+ HF  I C+E 
Sbjct  61   LGSIVNLRLVPWGNTQIAPNTSWICQHGTDECQLNTVEACAIKVWSNLETHFKLISCIEQ  120

Query  460  LVNNGEYSKWETCYEKLGKDPKQISDCYASGRGKELELSYA  582
            L    ++S W++C+   G     I +CY +G G +LE +YA
Sbjct  121  LHLQNKHSSWQSCFGSTGLSLNPIENCYNNGLGYQLETAYA  161



>ref|XP_004246266.1| PREDICTED: gamma-interferon-inducible lysosomal thiol reductase 
isoform X2 [Solanum lycopersicum]
Length=207

 Score =   142 bits (359),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 70/161 (43%), Positives = 97/161 (60%), Gaps = 2/161 (1%)
 Frame = +1

Query  106  MAGSHQQTKICFLVCLLFFTSLSPISCG--KVSLDLYYESLCPYSANFIVNYLAKIYENG  279
            MA  +Q T+I     L+   +     C   KV+L LYYESLCPY A+FIVN L K+ +  
Sbjct  1    MASHNQITRIIITFVLIPLLTFQCHVCSQDKVNLSLYYESLCPYCADFIVNQLVKVLQTD  60

Query  280  IIDIVDLTLFPWGNAKLKGNNTFECQHGAAECLLNTIEACAIDAWPDLKEHFPFIYCVES  459
            +  IV+L L PWGN ++  N ++ CQHG  EC LNT+EACAI  W +L+ HF  I C+E 
Sbjct  61   LGSIVNLRLVPWGNTQIAPNTSWICQHGTDECQLNTVEACAIKVWSNLETHFKLISCIEQ  120

Query  460  LVNNGEYSKWETCYEKLGKDPKQISDCYASGRGKELELSYA  582
            L    ++S W++C+   G     I +CY +G G +LE +YA
Sbjct  121  LHLQNKHSSWQSCFGSTGLSLNPIENCYNNGLGYQLETAYA  161



>ref|XP_007026600.1| Gamma interferon responsive lysosomal thiol reductase family 
protein, putative [Theobroma cacao]
 gb|EOY07102.1| Gamma interferon responsive lysosomal thiol reductase family 
protein, putative [Theobroma cacao]
Length=249

 Score =   144 bits (362),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 69/146 (47%), Positives = 95/146 (65%), Gaps = 5/146 (3%)
 Frame = +1

Query  151  LLFFTSLSPISCGKVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKL  330
            +LF  S+SP     V+L LYYE+LCPY A+FIVN+L K+++ G+  IV+L L PWGNA +
Sbjct  16   MLFLLSISPCHAQNVTLSLYYETLCPYCADFIVNHLVKLFDKGLNSIVNLRLVPWGNAVM  75

Query  331  KGNNTFECQHGAAECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWETCYEK-  507
            + +  F CQHG  EC+LN I+AC I  +P+++ HF FI CVE L    + ++W  C++  
Sbjct  76   QRDGNFVCQHGPDECVLNAIDACTITIYPEVERHFRFILCVERLALENKVNEWVNCFDMT  135

Query  508  -LGKDPKQISDCYASGRGKELELSYA  582
             LG+ P    DCY SG G  LE  YA
Sbjct  136  GLGRVP---VDCYKSGYGNMLEKHYA  158



>ref|NP_001140474.1| hypothetical protein precursor [Zea mays]
 gb|ACF83909.1| unknown [Zea mays]
 gb|AFW84711.1| hypothetical protein ZEAMMB73_074099 [Zea mays]
Length=237

 Score =   143 bits (361),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 64/139 (46%), Positives = 91/139 (65%), Gaps = 1/139 (1%)
 Frame = +1

Query  169  LSP-ISCGKVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKLKGNNT  345
            LSP  + G+V + +YYE+LCP+ + F+VN L++I+ +GI  I DL L P+GN ++  + T
Sbjct  26   LSPGCAAGRVPVSVYYETLCPFCSAFVVNDLSRIFRDGIFSIADLRLVPFGNGRVSADGT  85

Query  346  FECQHGAAECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWETCYEKLGKDPK  525
              CQHG  EC LN IEAC I  WPD ++HFPFI CVE L    ++  W++C+ + G   +
Sbjct  86   VTCQHGEDECQLNAIEACVIRIWPDAEQHFPFIQCVEHLALTRKWDAWQSCFHETGLAYQ  145

Query  526  QISDCYASGRGKELELSYA  582
               DCY SG G++L L YA
Sbjct  146  PAIDCYNSGYGRQLVLQYA  164



>ref|XP_008654524.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
Length=249

 Score =   144 bits (362),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 64/139 (46%), Positives = 91/139 (65%), Gaps = 1/139 (1%)
 Frame = +1

Query  169  LSP-ISCGKVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKLKGNNT  345
            LSP  + G+V + +YYE+LCP+ + F+VN L++I+ +GI  I DL L P+GN ++  + T
Sbjct  26   LSPGCAAGRVPVSVYYETLCPFCSAFVVNDLSRIFRDGIFSIADLRLVPFGNGRVSADGT  85

Query  346  FECQHGAAECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWETCYEKLGKDPK  525
              CQHG  EC LN IEAC I  WPD ++HFPFI CVE L    ++  W++C+ + G   +
Sbjct  86   VTCQHGEDECQLNAIEACVIRIWPDAEQHFPFIQCVEHLALTRKWDAWQSCFHETGLAYQ  145

Query  526  QISDCYASGRGKELELSYA  582
               DCY SG G++L L YA
Sbjct  146  PAIDCYNSGYGRQLVLQYA  164



>emb|CDX86505.1| BnaC08g01980D [Brassica napus]
Length=248

 Score =   143 bits (361),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 66/108 (61%), Positives = 80/108 (74%), Gaps = 1/108 (1%)
 Frame = +1

Query  262  KIYENGIIDIVDLTLFPWGNAKLKGNN-TFECQHGAAECLLNTIEACAIDAWPDLKEHFP  438
            K++E+ +  IVDL L PWGN  L+ +N T  CQHGA EC L+T+EACAID+WP L  HFP
Sbjct  45   KLFEDDLTYIVDLHLSPWGNTYLRPDNVTALCQHGATECFLDTVEACAIDSWPKLSHHFP  104

Query  439  FIYCVESLVNNGEYSKWETCYEKLGKDPKQISDCYASGRGKELELSYA  582
            FIYCVESLV   +Y KWETCYEKL    K ++DC +SG G+ELEL YA
Sbjct  105  FIYCVESLVTEDKYDKWETCYEKLNLSSKPVADCLSSGHGQELELQYA  152



>gb|EMT22579.1| hypothetical protein F775_21058 [Aegilops tauschii]
Length=240

 Score =   143 bits (360),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 65/145 (45%), Positives = 93/145 (64%), Gaps = 1/145 (1%)
 Frame = +1

Query  142  LVCLLFFTSLSPI-SCGKVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWG  318
            LV  L    LSP  +  +VS+ +YYE+LCP+ + F+VN LA+I+ NG+   VDL L P+G
Sbjct  11   LVPALVLLCLSPACAARRVSVAVYYETLCPFCSGFVVNDLARIFRNGLSSNVDLRLVPFG  70

Query  319  NAKLKGNNTFECQHGAAECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWETC  498
            N ++  + +  CQHG  EC LN IEAC I  WPD + HFPFIYC+E L    ++  W++C
Sbjct  71   NGRVSPDGSMSCQHGEDECQLNAIEACVISVWPDAERHFPFIYCIEHLSLTRKWGAWQSC  130

Query  499  YEKLGKDPKQISDCYASGRGKELEL  573
            + + G   + + DCY SG G++L L
Sbjct  131  FHETGLPSQPVIDCYNSGYGRQLIL  155



>gb|KCW49429.1| hypothetical protein EUGRSUZ_K02963 [Eucalyptus grandis]
Length=235

 Score =   142 bits (359),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 75/170 (44%), Positives = 97/170 (57%), Gaps = 21/170 (12%)
 Frame = +1

Query  133  ICFLVCLLFFTSLSPISCGKVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFP  312
            +   +CL F +        KV L LYYESLCP SA+FI N+L K  +NG+I+I+DL + P
Sbjct  13   VTLFLCLTFPSPSLSSDDDKVKLSLYYESLCPGSADFIANHLVKAIDNGLINIIDLQIVP  72

Query  313  WGNAKLKGNN-TFECQHGAAECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSK-  486
            WGNA++   +  F CQHG  EC LNTI+ACAI+ W DL+ HF FI CVE  ++ G     
Sbjct  73   WGNAQIDNRSGAFICQHGEDECYLNTIQACAIEVWSDLQPHFNFIRCVEDKISKGGLRSG  132

Query  487  -------------------WETCYEKLGKDPKQISDCYASGRGKELELSY  579
                               WE+C E+L  +   I  CY SGRG+ELEL Y
Sbjct  133  KVSAAYQEKPSSNVAASKVWESCAEELKLEEAGIYKCYTSGRGRELELQY  182



>ref|XP_007134663.1| hypothetical protein PHAVU_010G065800g [Phaseolus vulgaris]
 gb|ESW06657.1| hypothetical protein PHAVU_010G065800g [Phaseolus vulgaris]
Length=266

 Score =   143 bits (361),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 65/131 (50%), Positives = 88/131 (67%), Gaps = 1/131 (1%)
 Frame = +1

Query  190  KVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKLKGNNTFECQHGAA  369
            KV++ LYYESLCPY A+FIVN+L ++++  +I IV+L L PWGNA +  N +  CQHG  
Sbjct  47   KVTVSLYYESLCPYCADFIVNHLVRLFQTDLISIVNLRLVPWGNAWIAPNASIICQHGED  106

Query  370  ECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWETCYEKLGKDPKQISDCYAS  549
            EC LNTIEAC I  +PD+ +HF F+ C+E L   G + +W  C++  G     I DCY S
Sbjct  107  ECFLNTIEACTITIYPDMMQHFRFVECLERLSLEGRHRQWMNCFQMTGLGTSPI-DCYTS  165

Query  550  GRGKELELSYA  582
            G GK ++L YA
Sbjct  166  GNGKTIDLRYA  176



>ref|XP_004506797.1| PREDICTED: gamma-interferon-inducible lysosomal thiol reductase-like 
[Cicer arietinum]
Length=252

 Score =   143 bits (360),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 64/131 (49%), Positives = 85/131 (65%), Gaps = 5/131 (4%)
 Frame = +1

Query  190  KVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKLKGNNTFECQHGAA  369
            KV++  YYE+LCPY A+FIVN+L K+++  +I IV+L + PWGNA +  N TF+CQHG  
Sbjct  46   KVTMSFYYETLCPYCADFIVNHLVKLFQTDLISIVNLRMVPWGNAGIAPNGTFDCQHGKD  105

Query  370  ECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWETCYEKLGKDPKQISDCYAS  549
            EC LNTIEAC I  +PD+ +HF FI C+E L     Y +W  C++        I DCY S
Sbjct  106  ECFLNTIEACTIAIYPDVAKHFRFIECIERLTLQDRYREWSNCFQTTS-----IIDCYNS  160

Query  550  GRGKELELSYA  582
            G G  +E  YA
Sbjct  161  GNGNSIEQKYA  171



>ref|XP_010325743.1| PREDICTED: gamma-interferon-inducible lysosomal thiol reductase 
isoform X1 [Solanum lycopersicum]
Length=230

 Score =   142 bits (357),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 70/161 (43%), Positives = 97/161 (60%), Gaps = 2/161 (1%)
 Frame = +1

Query  106  MAGSHQQTKICFLVCLLFFTSLSPISCG--KVSLDLYYESLCPYSANFIVNYLAKIYENG  279
            MA  +Q T+I     L+   +     C   KV+L LYYESLCPY A+FIVN L K+ +  
Sbjct  1    MASHNQITRIIITFVLIPLLTFQCHVCSQDKVNLSLYYESLCPYCADFIVNQLVKVLQTD  60

Query  280  IIDIVDLTLFPWGNAKLKGNNTFECQHGAAECLLNTIEACAIDAWPDLKEHFPFIYCVES  459
            +  IV+L L PWGN ++  N ++ CQHG  EC LNT+EACAI  W +L+ HF  I C+E 
Sbjct  61   LGSIVNLRLVPWGNTQIAPNTSWICQHGTDECQLNTVEACAIKVWSNLETHFKLISCIEQ  120

Query  460  LVNNGEYSKWETCYEKLGKDPKQISDCYASGRGKELELSYA  582
            L    ++S W++C+   G     I +CY +G G +LE +YA
Sbjct  121  LHLQNKHSSWQSCFGSTGLSLNPIENCYNNGLGYQLETAYA  161



>ref|XP_003604570.1| Gamma-interferon-inducible lysosomal thiol reductase [Medicago 
truncatula]
Length=351

 Score =   145 bits (365),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 65/131 (50%), Positives = 91/131 (69%), Gaps = 1/131 (1%)
 Frame = +1

Query  190  KVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKLKGNNTFECQHGAA  369
            KV++ +YYESLCP+ A+FIVN L ++++ G+I IVDL + PWGNA +K + TF+CQHG  
Sbjct  46   KVTMSIYYESLCPFCADFIVNDLVRLFQTGLISIVDLRMVPWGNAGIKPDGTFDCQHGND  105

Query  370  ECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWETCYEKLGKDPKQISDCYAS  549
            EC LNTIEACAI+ +PD+ +HF FI C+E L     +++W  C++  G     I DC  +
Sbjct  106  ECYLNTIEACAINIYPDVAQHFKFIRCLERLTLENRHNEWFNCFQMTGLGTMPI-DCSKT  164

Query  550  GRGKELELSYA  582
            G GK +E  YA
Sbjct  165  GNGKSIEQKYA  175



>ref|XP_009804800.1| PREDICTED: gamma-interferon-inducible lysosomal thiol reductase 
isoform X3 [Nicotiana sylvestris]
Length=224

 Score =   141 bits (355),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 76/160 (48%), Positives = 97/160 (61%), Gaps = 8/160 (5%)
 Frame = +1

Query  106  MAGSHQQTKICFLVCLLFFTSLSPISC-GKVSLDLYYESLCPYSANFIVNYLAKIYENGI  282
            MA  +Q   +  L+  L F S  P+S   KV+L LYYESLCPY A+FIVN LAK+ E  +
Sbjct  1    MASHNQNFILIILISWLMFQS--PVSSQDKVNLSLYYESLCPYCADFIVNKLAKVLETDL  58

Query  283  IDIVDLTLFPWGNAKLKGNNTFECQHGAAECLLNTIEACAIDAWPDLKEHFPFIYCVESL  462
              IV+L L PWGN ++  N ++ CQHG AECLLNT+EACAI      + HF FI CVE L
Sbjct  59   ASIVNLRLVPWGNTQIAPNTSWICQHGPAECLLNTVEACAIK-----ETHFKFINCVERL  113

Query  463  VNNGEYSKWETCYEKLGKDPKQISDCYASGRGKELELSYA  582
                  S W++C+   G     I +CY +G G  LE +YA
Sbjct  114  HLENRQSSWQSCFSATGLSQTPIKNCYNNGLGYRLEKAYA  153



>ref|XP_010435333.1| PREDICTED: gamma-interferon-inducible-lysosomal thiol reductase-like 
[Camelina sativa]
Length=230

 Score =   141 bits (355),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 75/154 (49%), Positives = 94/154 (61%), Gaps = 9/154 (6%)
 Frame = +1

Query  130  KICFLVCLLFFTSLSPISCG---KVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDL  300
            K+ FL CL+ FTS   +  G   KV L+LYYESLCP   NFIV+YL K++   +  I DL
Sbjct  16   KLVFLACLVLFTSSDKLVAGESDKVKLNLYYESLCPSCQNFIVHYLGKVFSTDLHTITDL  75

Query  301  TLFPWGNAKLKGNNTFECQHGAAECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEY  480
             L P+GNA +  + T  CQHG  EC LN +EACAI  WP+ + H+ FI CVE+  N    
Sbjct  76   KLVPFGNAHVSDDLTVTCQHGEEECKLNALEACAISTWPNQRLHYRFIRCVETNTN----  131

Query  481  SKWETCYEKLGKDPKQISDCYASGRGKELELSYA  582
              WE+C +K G D K ISDCY     K+L L YA
Sbjct  132  -AWESCVKKYGGD-KAISDCYNGDLSKKLILGYA  163



>ref|XP_006359552.1| PREDICTED: gamma-interferon-inducible lysosomal thiol reductase-like 
[Solanum tuberosum]
Length=230

 Score =   141 bits (355),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 70/161 (43%), Positives = 97/161 (60%), Gaps = 2/161 (1%)
 Frame = +1

Query  106  MAGSHQQTKI--CFLVCLLFFTSLSPISCGKVSLDLYYESLCPYSANFIVNYLAKIYENG  279
            MA  +Q ++I   F++  L        S  KV L LYYESLCPY A+FIVN L K+ +  
Sbjct  1    MASHNQISRIIITFVLIPLLIFQCHVCSQDKVILSLYYESLCPYCADFIVNQLVKVLQTD  60

Query  280  IIDIVDLTLFPWGNAKLKGNNTFECQHGAAECLLNTIEACAIDAWPDLKEHFPFIYCVES  459
            +  IV+L L PWGN ++  N ++ CQHG  EC LNT+EACAI  W +L+ HF  I C+E 
Sbjct  61   LGSIVNLRLVPWGNTQIAPNTSWICQHGTDECQLNTVEACAIKVWSNLETHFKLISCIEQ  120

Query  460  LVNNGEYSKWETCYEKLGKDPKQISDCYASGRGKELELSYA  582
            L    ++S W++C+   G +   I +CY +G G  LE +YA
Sbjct  121  LHLQNKHSSWQSCFASTGLNQNPIENCYNNGLGYRLETAYA  161



>gb|ACG36171.1| hypothetical protein [Zea mays]
Length=235

 Score =   140 bits (354),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 62/139 (45%), Positives = 91/139 (65%), Gaps = 1/139 (1%)
 Frame = +1

Query  169  LSPI-SCGKVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKLKGNNT  345
            LSP  + G+V + +YYE+LCP+ + F+VN L++++ +GI  I +L L P+GN ++  + T
Sbjct  24   LSPACAAGRVPVSVYYEALCPFCSAFVVNDLSRVFRDGISSIAELRLVPFGNGRVSADGT  83

Query  346  FECQHGAAECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWETCYEKLGKDPK  525
              CQHG  EC LN IEAC I  WPD ++HFPFI CVE L    ++  W++C+ + G   +
Sbjct  84   VTCQHGEDECQLNAIEACVIRIWPDAEQHFPFIQCVEHLALTRKWDAWQSCFHETGLAYQ  143

Query  526  QISDCYASGRGKELELSYA  582
               DCY SG G++L L YA
Sbjct  144  PAIDCYISGYGRQLVLQYA  162



>gb|EAY76352.1| hypothetical protein OsI_04287 [Oryza sativa Indica Group]
Length=246

 Score =   141 bits (355),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 57/128 (45%), Positives = 88/128 (69%), Gaps = 0/128 (0%)
 Frame = +1

Query  199  LDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKLKGNNTFECQHGAAECL  378
            + +YYE+LCP+ + F+VN LA+I+ +G+  +VDL L P+GN ++  + +  CQHG  EC 
Sbjct  1    MSVYYETLCPFCSGFVVNDLARIFRDGLSPVVDLRLVPFGNGRVSPDGSITCQHGEEECQ  60

Query  379  LNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWETCYEKLGKDPKQISDCYASGRG  558
            LN IEAC I  WPD ++HFPFI C+E L    +++ W++C+++ G   + + DCY SG G
Sbjct  61   LNAIEACVIRLWPDAEQHFPFINCIEHLALTQKWNAWQSCFQETGLASQPVMDCYNSGYG  120

Query  559  KELELSYA  582
             +L+L YA
Sbjct  121  TQLQLQYA  128



>ref|XP_006286071.1| hypothetical protein CARUB_v10007604mg [Capsella rubella]
 gb|EOA18969.1| hypothetical protein CARUB_v10007604mg [Capsella rubella]
Length=229

 Score =   140 bits (353),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 78/164 (48%), Positives = 94/164 (57%), Gaps = 11/164 (7%)
 Frame = +1

Query  106  MAGSHQQTKICFLVCLLFFTSLSPI-----SCGKVSLDLYYESLCPYSANFIVNYLAKIY  270
            M  S     + FL CL  FT  + +     S  KV L+LYYESLCPY  NFIVN L KI+
Sbjct  1    MVSSSSTKFVLFLACLFMFTFSNNLVAAEESDDKVKLNLYYESLCPYCQNFIVNDLGKIF  60

Query  271  ENGIIDIVDLTLFPWGNAKLKGNNTFECQHGAAECLLNTIEACAIDAWPDLKEHFPFIYC  450
            +  +  I DL LFP+GNA +  N T  CQHG  EC LN +EACAI  WP+ K H+ FI C
Sbjct  61   DTDLYTITDLKLFPFGNAHVSTNLTITCQHGEEECKLNALEACAIRTWPNPKLHYKFIQC  120

Query  451  VESLVNNGEYSKWETCYEKLGKDPKQISDCYASGRGKELELSYA  582
            VE   N     KWETC ++  +  K I DCY     K+L L YA
Sbjct  121  VEKDTN-----KWETCVKR-SRYEKAIKDCYNGDLSKKLILEYA  158



>dbj|BAD73620.1| putative legumaturain [Oryza sativa Japonica Group]
 gb|EAZ14014.1| hypothetical protein OsJ_03939 [Oryza sativa Japonica Group]
Length=246

 Score =   140 bits (354),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 57/128 (45%), Positives = 88/128 (69%), Gaps = 0/128 (0%)
 Frame = +1

Query  199  LDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKLKGNNTFECQHGAAECL  378
            + +YYE+LCP+ + F+VN LA+I+ +G+  +VDL L P+GN ++  + +  CQHG  EC 
Sbjct  1    MSVYYETLCPFCSGFVVNDLARIFRDGLSPVVDLRLVPFGNGRVSPDGSITCQHGEEECQ  60

Query  379  LNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWETCYEKLGKDPKQISDCYASGRG  558
            LN IEAC I  WPD ++HFPFI C+E L    +++ W++C+++ G   + + DCY SG G
Sbjct  61   LNAIEACVIRLWPDAEQHFPFINCIEHLALTQKWNAWQSCFQETGLASQPVMDCYNSGYG  120

Query  559  KELELSYA  582
             +L+L YA
Sbjct  121  TQLQLQYA  128



>gb|KJB36937.1| hypothetical protein B456_006G184500 [Gossypium raimondii]
Length=224

 Score =   140 bits (353),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 69/150 (46%), Positives = 93/150 (62%), Gaps = 3/150 (2%)
 Frame = +1

Query  139  FLVCLLF--FTSLSPISCGKVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFP  312
            F  C+L   F  + P     V+L +YYE+LCPY ++FIVN+L K++ + +  IV+L L P
Sbjct  6    FFTCMLLALFIGIWPCHAQNVTLSVYYETLCPYCSDFIVNHLVKLFHSRLFSIVNLRLVP  65

Query  313  WGNAKLKGNNTFECQHGAAECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWE  492
            WGNA L+ N +F CQHG  ECLLNTIEAC I  +P+ ++H  FI C+E L +  E ++W 
Sbjct  66   WGNAVLQSNGSFLCQHGPEECLLNTIEACTISVYPNEEQHLSFILCLERLASANELNEWI  125

Query  493  TCYEKLGKDPKQISDCYASGRGKELELSYA  582
             C+   G     I DCY SG G  LE  YA
Sbjct  126  NCFNTTGLATVPI-DCYKSGYGNVLENQYA  154



>gb|KJB36938.1| hypothetical protein B456_006G184500 [Gossypium raimondii]
Length=242

 Score =   140 bits (354),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 69/150 (46%), Positives = 93/150 (62%), Gaps = 3/150 (2%)
 Frame = +1

Query  139  FLVCLLF--FTSLSPISCGKVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFP  312
            F  C+L   F  + P     V+L +YYE+LCPY ++FIVN+L K++ + +  IV+L L P
Sbjct  6    FFTCMLLALFIGIWPCHAQNVTLSVYYETLCPYCSDFIVNHLVKLFHSRLFSIVNLRLVP  65

Query  313  WGNAKLKGNNTFECQHGAAECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWE  492
            WGNA L+ N +F CQHG  ECLLNTIEAC I  +P+ ++H  FI C+E L +  E ++W 
Sbjct  66   WGNAVLQSNGSFLCQHGPEECLLNTIEACTISVYPNEEQHLSFILCLERLASANELNEWI  125

Query  493  TCYEKLGKDPKQISDCYASGRGKELELSYA  582
             C+   G     I DCY SG G  LE  YA
Sbjct  126  NCFNTTGLATVPI-DCYKSGYGNVLENQYA  154



>gb|KJB77052.1| hypothetical protein B456_012G118100 [Gossypium raimondii]
Length=263

 Score =   141 bits (355),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 71/146 (49%), Positives = 95/146 (65%), Gaps = 9/146 (6%)
 Frame = +1

Query  172  SPISCGKVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAK-LKGNNTF  348
            S I   KV L LYYESLCPY  +FIV+ L K++   +++I++L L PWGNA+ +K N T 
Sbjct  34   SHIKPKKVHLSLYYESLCPYCRSFIVSQLVKVFNTDLLNIINLRLVPWGNAQYVKPNKTI  93

Query  349  ECQHGAAECLLNTIEACAIDAWPDLKEHFPFIYCVESL---VNNGEYSK-----WETCYE  504
             CQHG  EC LNTI ACAI  WPD ++HF FIYC+E+    + + ++S+     W+ C  
Sbjct  94   ICQHGEDECYLNTIHACAISIWPDPRKHFNFIYCIENQGLPIKDNQHSEGMEAVWKACSA  153

Query  505  KLGKDPKQISDCYASGRGKELELSYA  582
            + G D K I DCY SG G++L L YA
Sbjct  154  RSGMDQKLIKDCYDSGYGRKLLLQYA  179



>ref|XP_008243106.1| PREDICTED: gamma-interferon-inducible lysosomal thiol reductase-like 
[Prunus mume]
Length=260

 Score =   140 bits (354),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 69/140 (49%), Positives = 94/140 (67%), Gaps = 4/140 (3%)
 Frame = +1

Query  175  PISCGKVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKLK-GNNTFE  351
            P    KV L LYYE+LCPY   FIV  L K+++ G+I+IV+L L P+GNA ++  + T  
Sbjct  45   PTKVEKVELVLYYETLCPYCKEFIVKELIKVFDRGLINIVNLRLVPYGNAHIQEPDKTIV  104

Query  352  CQHGAAECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSK---WETCYEKLGKDP  522
            CQHG  EC LN+I+ACAI +WPD+K+HF  I+CVE+    G+ SK   W++C  KLG + 
Sbjct  105  CQHGPDECYLNSIQACAISSWPDVKQHFKLIHCVENQTIEGKQSKEEGWKSCCRKLGMNQ  164

Query  523  KQISDCYASGRGKELELSYA  582
            K + DCY SG  ++L L YA
Sbjct  165  KPVQDCYDSGLERKLILQYA  184



>ref|XP_004148608.1| PREDICTED: gamma-interferon-inducible lysosomal thiol reductase-like 
[Cucumis sativus]
 ref|XP_004167009.1| PREDICTED: gamma-interferon-inducible lysosomal thiol reductase-like 
[Cucumis sativus]
 gb|KGN54401.1| hypothetical protein Csa_4G312830 [Cucumis sativus]
Length=238

 Score =   140 bits (352),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 65/135 (48%), Positives = 92/135 (68%), Gaps = 9/135 (7%)
 Frame = +1

Query  190  KVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKLKGNNTFECQHGAA  369
            KV++ +YYE+LCP+ ANF+V +L K+++NG+I  V+L + PWGNA ++ + +F CQHG  
Sbjct  31   KVTVSVYYEALCPFCANFVVYHLVKLFQNGLISAVNLRMIPWGNAWIQPDGSFFCQHGPD  90

Query  370  ECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWETCYEKLGKDPKQIS----D  537
            EC+LNTIEAC I  +PD +EHF FI+CVE L     +++W  C+     D  Q+S    D
Sbjct  91   ECMLNTIEACTISVYPDTEEHFRFIHCVEGLTVQNRHNEWTKCF-----DIAQLSAIPID  145

Query  538  CYASGRGKELELSYA  582
            CY +G GK LE  YA
Sbjct  146  CYRNGHGKMLEQYYA  160



>ref|XP_010450255.1| PREDICTED: gamma-interferon-inducible lysosomal thiol reductase-like 
[Camelina sativa]
Length=233

 Score =   139 bits (351),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 78/168 (46%), Positives = 97/168 (58%), Gaps = 15/168 (9%)
 Frame = +1

Query  106  MAGSHQQTKICF-----LVCLLFFTSLSPISCGK----VSLDLYYESLCPYSANFIVNYL  258
            MA S   TK        L CL  FT  + +   K    V L+LYYESLCPY  NFIV+ L
Sbjct  1    MASSSSSTKFVLFPYLLLACLFLFTFSTNLVVAKESDKVKLNLYYESLCPYCQNFIVDDL  60

Query  259  AKIYENGIIDIVDLTLFPWGNAKLKGNNTFECQHGAAECLLNTIEACAIDAWPDLKEHFP  438
             KI+++ +  I DL L P+GNA +  N T  CQHG  EC+LN +EACAI  WPD K H+ 
Sbjct  61   GKIFDSDLYTITDLKLVPFGNAHVSNNLTITCQHGEEECILNALEACAIRIWPDPKLHYK  120

Query  439  FIYCVESLVNNGEYSKWETCYEKLGKDPKQISDCYASGRGKELELSYA  582
            FI CVE   N     +WETC ++ G++ K I DCY     K+L L YA
Sbjct  121  FIQCVEKDTN-----EWETCVQRSGRE-KAIKDCYNGDLSKKLILGYA  162



>ref|XP_002863284.1| gamma interferon responsive lysosomal thiol reductase family 
protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH39543.1| gamma interferon responsive lysosomal thiol reductase family 
protein [Arabidopsis lyrata subsp. lyrata]
Length=228

 Score =   139 bits (351),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 77/162 (48%), Positives = 96/162 (59%), Gaps = 9/162 (6%)
 Frame = +1

Query  106  MAGSHQQTKICFLVCLLFFTSLSPISCG---KVSLDLYYESLCPYSANFIVNYLAKIYEN  276
            M+ S   TK CF  CLL FT    +  G   KV L+LYYESLCP   NFIV++L KI+  
Sbjct  1    MSSSSSSTKFCFFACLLLFTFSHNLVAGESDKVKLNLYYESLCPSCQNFIVHHLGKIFNT  60

Query  277  GIIDIVDLTLFPWGNAKLKGNNTFECQHGAAECLLNTIEACAIDAWPDLKEHFPFIYCVE  456
             +  I DL L P+GNA +  + T  CQHG  EC LN +EACAI  WP+ + H+ FI CVE
Sbjct  61   DLHTITDLKLIPFGNAHVSDDLTVTCQHGEEECKLNALEACAIRTWPNQRLHYKFIRCVE  120

Query  457  SLVNNGEYSKWETCYEKLGKDPKQISDCYASGRGKELELSYA  582
            +  N      WE+C +K G + K I+DCY     KEL L YA
Sbjct  121  TNTN-----AWESCVKKYGGE-KAINDCYNGDLSKELILGYA  156



>gb|KDP20259.1| hypothetical protein JCGZ_08854 [Jatropha curcas]
Length=256

 Score =   140 bits (352),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 68/137 (50%), Positives = 87/137 (64%), Gaps = 6/137 (4%)
 Frame = +1

Query  190  KVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKLKGNNTFECQHGAA  369
            KV+L LYYE+LCPY  NFIV  LAK+ +  ++ I+DL L PWGNA  + NNT  CQHG  
Sbjct  40   KVALSLYYETLCPYCRNFIVVDLAKVVKTDLMSILDLKLIPWGNAIRQSNNTIICQHGED  99

Query  370  ECLLNTIEACAIDAWPDLKEHFPFIYCVES------LVNNGEYSKWETCYEKLGKDPKQI  531
            EC LNTI AC I+  PD+ +HF FI C+E       +  NG  + W+ C ++L    + I
Sbjct  100  ECYLNTIHACIINILPDVMKHFKFIKCIEEQSSPPIIAQNGAEASWKLCAQQLKFSSEAI  159

Query  532  SDCYASGRGKELELSYA  582
             DCY SGRGK+L L Y 
Sbjct  160  KDCYDSGRGKQLLLQYG  176



>ref|XP_002318774.1| hypothetical protein POPTR_0012s10920g [Populus trichocarpa]
 gb|EEE96994.1| hypothetical protein POPTR_0012s10920g [Populus trichocarpa]
Length=269

 Score =   140 bits (352),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 69/132 (52%), Positives = 84/132 (64%), Gaps = 4/132 (3%)
 Frame = +1

Query  190  KVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKLKGNNTFECQHGAA  369
            KV++ LYYESLCPY ++FIV  LA++ E  ++ I++L L PWGNA L  N+T ECQHG  
Sbjct  48   KVTMSLYYESLCPYCSSFIVGPLAQVLETDLMTILNLRLVPWGNAILDSNSTIECQHGED  107

Query  370  ECLLNTIEACAIDAWPDLKEHFPFIYCVESLV----NNGEYSKWETCYEKLGKDPKQISD  537
            EC LN I  CAI+ WPDLK+HF FI C+E        NG    WE C  KL    K I  
Sbjct  108  ECYLNIIHTCAINLWPDLKKHFNFIKCIEKQYKAPDRNGAEESWEVCSGKLRLSTKSIKK  167

Query  538  CYASGRGKELEL  573
            CY SG GK+L L
Sbjct  168  CYDSGHGKKLVL  179



>ref|XP_002528051.1| Gamma-interferon-inducible lysosomal thiol reductase precursor, 
putative [Ricinus communis]
 gb|EEF34301.1| Gamma-interferon-inducible lysosomal thiol reductase precursor, 
putative [Ricinus communis]
Length=275

 Score =   140 bits (352),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 68/140 (49%), Positives = 88/140 (63%), Gaps = 5/140 (4%)
 Frame = +1

Query  178  ISCGKVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKLKGNNTFECQ  357
            +   KV+L LYYESLCPY  NFIV  LA+  ++ ++ IVDL LFPWGNA L+ NNT  CQ
Sbjct  41   VDTQKVALSLYYESLCPYCQNFIVKPLAEAVKSDLMTIVDLQLFPWGNAVLQPNNTVVCQ  100

Query  358  HGAAECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNG-----EYSKWETCYEKLGKDP  522
            HG  EC LNTI ACAI+ WPD+ +HF  + C+E   + G         W+ C EKL    
Sbjct  101  HGEDECYLNTIHACAINLWPDVMKHFNLVKCIEEQQHPGITRVSAEESWQVCAEKLKLPS  160

Query  523  KQISDCYASGRGKELELSYA  582
            ++I DCY +G G +L L + 
Sbjct  161  QRIKDCYDTGLGGQLLLQFG  180



>ref|XP_006376928.1| hypothetical protein POPTR_0012s10950g [Populus trichocarpa]
 gb|ERP54725.1| hypothetical protein POPTR_0012s10950g [Populus trichocarpa]
Length=269

 Score =   139 bits (350),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 68/132 (52%), Positives = 84/132 (64%), Gaps = 4/132 (3%)
 Frame = +1

Query  190  KVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKLKGNNTFECQHGAA  369
            KV++ LYYESLCPY ++FIV  LA++ E  ++ I++L L PWGNA L  N+T ECQHG  
Sbjct  48   KVTMSLYYESLCPYCSSFIVGPLAQVLETDLMTILNLRLVPWGNAILDSNSTIECQHGED  107

Query  370  ECLLNTIEACAIDAWPDLKEHFPFIYCVESLV----NNGEYSKWETCYEKLGKDPKQISD  537
            EC LN I  CAI+ WPDLK+HF FI C+E        NG    WE C  KL    + I  
Sbjct  108  ECYLNIIHTCAINLWPDLKKHFNFIKCIEKQYKAPDRNGAEESWEVCSGKLRLSTQSIKK  167

Query  538  CYASGRGKELEL  573
            CY SG GK+L L
Sbjct  168  CYDSGHGKKLVL  179



>ref|XP_010036388.1| PREDICTED: gamma-interferon-inducible lysosomal thiol reductase 
[Eucalyptus grandis]
 gb|KCW88213.1| hypothetical protein EUGRSUZ_A00606 [Eucalyptus grandis]
Length=245

 Score =   138 bits (348),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 66/131 (50%), Positives = 81/131 (62%), Gaps = 1/131 (1%)
 Frame = +1

Query  190  KVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKLKGNNTFECQHGAA  369
            +V L LYYE+LCPY ANFIVN L+K+++ G+I IVDL L PWGN  +  + +  CQHG  
Sbjct  36   RVKLSLYYEALCPYCANFIVNSLSKVFDTGLISIVDLRLVPWGNGWISPDGSLSCQHGPD  95

Query  370  ECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWETCYEKLGKDPKQISDCYAS  549
            ECLLN IEACAI  +PD+  HF FI CVE L   G   +W  C    G     + DCY  
Sbjct  96   ECLLNAIEACAITIYPDVNRHFRFINCVEQLTLQGRQGEWRNCLGATGVGNAPV-DCYNG  154

Query  550  GRGKELELSYA  582
            G G +LE   A
Sbjct  155  GFGNKLERRNA  165



>ref|XP_002526664.1| Gamma-interferon-inducible lysosomal thiol reductase precursor, 
putative [Ricinus communis]
 gb|EEF35686.1| Gamma-interferon-inducible lysosomal thiol reductase precursor, 
putative [Ricinus communis]
Length=251

 Score =   138 bits (347),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 68/149 (46%), Positives = 94/149 (63%), Gaps = 3/149 (2%)
 Frame = +1

Query  142  LVCLLFFTSLSPISCG--KVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPW  315
            + C+ F    S  S G   V+L +YYE+LCPY A+FIVN L K+++ G+  IV L + PW
Sbjct  14   ITCIFFCCLASSPSSGDDTVTLYVYYETLCPYCADFIVNRLVKVFDKGLFSIVKLRMIPW  73

Query  316  GNAKLKGNNTFECQHGAAECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWET  495
            GNA ++ + +F CQHG  EC LN IEACAI  +PD++ HF FI+C+ESL    + ++W  
Sbjct  74   GNAFVQSDGSFVCQHGPNECFLNAIEACAITIYPDVERHFRFIHCMESLALENKLNEWVN  133

Query  496  CYEKLGKDPKQISDCYASGRGKELELSYA  582
            C+E      + I DCY SG G  LE  +A
Sbjct  134  CFEMSALGTEAI-DCYTSGYGNMLEQKFA  161



>gb|KFK23482.1| hypothetical protein AALP_AAs46213U000200 [Arabis alpina]
Length=233

 Score =   137 bits (345),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 76/163 (47%), Positives = 93/163 (57%), Gaps = 12/163 (7%)
 Frame = +1

Query  115  SHQQTKICFLVCLLFFT----SLSPISCGKVSLDLYYESLCPYSANFIVNYLAKIYENGI  282
            S Q+    FL CLL FT    +L      KV L+LYYESLCP   +FIV+ L KI+   +
Sbjct  5    SSQKRVFFFLACLLMFTFSDNNLVAGDSDKVKLNLYYESLCPSCQDFIVDDLVKIFATDL  64

Query  283  IDIVDLTLFPWGNAKLKGNNTFECQHGAAECLLNTIEACAIDAWPDLKEHFPFIYCVESL  462
              I DL   P+GNAK+ G++T  CQHG  EC  N IEACAI+ WPD + H+ FI CVE  
Sbjct  65   HTITDLKFVPFGNAKISGDSTVTCQHGEEECKPNAIEACAINTWPDQETHYSFIRCVEQ-  123

Query  463  VNNGEYSKWETCYEKLGKD---PKQISDCYASGRGKELELSYA  582
                E   WETC + +  D    K I+DCY S   K L L YA
Sbjct  124  ----ETENWETCVDSISADSTSAKAINDCYNSDLSKNLILGYA  162



>ref|XP_006374008.1| hypothetical protein POPTR_0016s13020g, partial [Populus trichocarpa]
 gb|ERP51805.1| hypothetical protein POPTR_0016s13020g, partial [Populus trichocarpa]
Length=253

 Score =   137 bits (346),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 68/132 (52%), Positives = 83/132 (63%), Gaps = 4/132 (3%)
 Frame = +1

Query  190  KVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKLKGNNTFECQHGAA  369
            KV++ LYYESLCPY ++FI   LA++ E  ++ I++L L PWGNA L  NNT ECQHG  
Sbjct  49   KVTMSLYYESLCPYCSSFIAGPLAQVLETDLMTILNLRLVPWGNAILDSNNTIECQHGED  108

Query  370  ECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNN----GEYSKWETCYEKLGKDPKQISD  537
            EC LN I+ACAI+ WPDLK+HF FI C+E         G    WE C   L    + I  
Sbjct  109  ECYLNIIQACAINLWPDLKKHFDFIKCIEKQYKAPDRYGAEESWEVCSGILRLSTQSIKK  168

Query  538  CYASGRGKELEL  573
            CY SG GKEL L
Sbjct  169  CYDSGHGKELVL  180



>gb|KDO63232.1| hypothetical protein CISIN_1g025043mg [Citrus sinensis]
Length=258

 Score =   137 bits (346),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 73/168 (43%), Positives = 97/168 (58%), Gaps = 9/168 (5%)
 Frame = +1

Query  106  MAGSHQQTKICFLVCLLF------FTSLSPISCGKVSLDLYYESLCPYSANFIVNYLAKI  267
            MA  H    +  ++ L+F      F+  +     KV L LYYESLCPY ANFI N L K+
Sbjct  1    MAACHSLPFVLSILLLIFISPSLSFSEDAAAKSQKVKLSLYYESLCPYCANFIENQLVKV  60

Query  268  YENGIIDIVDLTLFPWGNAKLKG-NNTFECQHGAAECLLNTIEACAIDAWPDLKEHFPFI  444
            +   +  IV+L L P+GNA+++G + T  CQHG  EC LNTI ACAI+AWPD++ HF  I
Sbjct  61   FNTDLSTIVNLRLVPYGNAQIRGPDKTIICQHGQNECYLNTIHACAINAWPDVRIHFKLI  120

Query  445  YCVESLVNNGEY--SKWETCYEKLGKDPKQISDCYASGRGKELELSYA  582
             C+E   +  E   + W  C   LG   + I +CY SG G +L L YA
Sbjct  121  QCIEGQASASEQPEAAWRKCCNDLGFSQQPIDNCYQSGEGTKLTLKYA  168



>gb|KHG26319.1| Gamma-interferon-inducible lysosomal thiol reductase [Gossypium 
arboreum]
Length=224

 Score =   137 bits (344),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 67/150 (45%), Positives = 93/150 (62%), Gaps = 3/150 (2%)
 Frame = +1

Query  139  FLVCLLF--FTSLSPISCGKVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFP  312
            F  C+L   F  + P     V+L +YYE+LCPY ++FIVN+L K++ + +  IV+L L P
Sbjct  6    FFTCMLLALFIGIWPCHAQNVTLSVYYETLCPYCSDFIVNHLVKLFHSRLFSIVNLRLVP  65

Query  313  WGNAKLKGNNTFECQHGAAECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWE  492
            WGNA L+ + +F CQHG  ECLLNTIEAC I  +P+ ++H  FI C+E L +  + ++W 
Sbjct  66   WGNAVLQSDGSFLCQHGPNECLLNTIEACTISVYPNEEQHLSFILCLERLASANKLNEWI  125

Query  493  TCYEKLGKDPKQISDCYASGRGKELELSYA  582
             C+   G     I DCY SG G  LE  YA
Sbjct  126  NCFNTTGLATVPI-DCYKSGYGNVLENQYA  154



>ref|XP_006481098.1| PREDICTED: gamma-interferon-inducible lysosomal thiol reductase-like 
isoform X2 [Citrus sinensis]
Length=258

 Score =   137 bits (346),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 73/168 (43%), Positives = 97/168 (58%), Gaps = 9/168 (5%)
 Frame = +1

Query  106  MAGSHQQTKICFLVCLLF------FTSLSPISCGKVSLDLYYESLCPYSANFIVNYLAKI  267
            MA  H    +  ++ L+F      F+  +     KV L LYYESLCPY ANFI N L K+
Sbjct  1    MAACHSLPFVLSILLLIFISPSLSFSEDAAAKSQKVKLSLYYESLCPYCANFIENQLVKV  60

Query  268  YENGIIDIVDLTLFPWGNAKLKG-NNTFECQHGAAECLLNTIEACAIDAWPDLKEHFPFI  444
            +   +  IV+L L P+GNA+++G + T  CQHG  EC LNTI ACAI+AWPD++ HF  I
Sbjct  61   FNTDLSTIVNLRLVPYGNAQIRGPDKTIICQHGQNECYLNTIHACAINAWPDVRIHFKLI  120

Query  445  YCVESLVNNGEY--SKWETCYEKLGKDPKQISDCYASGRGKELELSYA  582
             C+E   +  E   + W  C   LG   + I +CY SG G +L L YA
Sbjct  121  QCIEGQASASEQPEAAWRKCCNDLGFSQQPIDNCYQSGEGTKLTLKYA  168



>ref|XP_002323011.2| hypothetical protein POPTR_0016s12980g [Populus trichocarpa]
 gb|EEF04772.2| hypothetical protein POPTR_0016s12980g [Populus trichocarpa]
Length=270

 Score =   137 bits (346),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 68/132 (52%), Positives = 83/132 (63%), Gaps = 4/132 (3%)
 Frame = +1

Query  190  KVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKLKGNNTFECQHGAA  369
            KV++ LYYESLCPY ++FI   LA++ E  ++ I++L L PWGNA L  NNT ECQHG  
Sbjct  49   KVTMSLYYESLCPYCSSFIAGPLAQVLETDLMTILNLRLVPWGNAILDSNNTIECQHGED  108

Query  370  ECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNN----GEYSKWETCYEKLGKDPKQISD  537
            EC LN I+ACAI+ WPDLK+HF FI C+E         G    WE C   L    + I  
Sbjct  109  ECYLNIIQACAINLWPDLKKHFDFIKCIEKQYKAPDRYGAEESWEVCSGILRLSTQSIKK  168

Query  538  CYASGRGKELEL  573
            CY SG GKEL L
Sbjct  169  CYDSGHGKELVL  180



>ref|XP_009114146.1| PREDICTED: gamma-interferon-inducible-lysosomal thiol reductase-like 
[Brassica rapa]
Length=234

 Score =   137 bits (344),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 74/150 (49%), Positives = 92/150 (61%), Gaps = 8/150 (5%)
 Frame = +1

Query  139  FLVCLLFFTSLSPIS--CGKVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFP  312
            F  C+LF  S   ++    KV L+LYYESLCP    FIVNYL KI+++ +  + DL L P
Sbjct  16   FFACILFTISEKLVAGESDKVKLNLYYESLCPGCQVFIVNYLVKIFDSDLHTVTDLKLVP  75

Query  313  WGNAKLKGNNTFECQHGAAECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWE  492
            +GNAK+  N T  CQHG  EC LN IEACAI  WPD K+H+ FI CVE      + +KWE
Sbjct  76   FGNAKVSDNLTVTCQHGEEECRLNAIEACAIRTWPDSKKHYSFIRCVE-----NDTTKWE  130

Query  493  TCYEKLGKDPKQISDCYASGRGKELELSYA  582
            +C  K  +  K I+DCY S   K L L YA
Sbjct  131  SCL-KNSRSEKAINDCYNSDLPKTLILGYA  159



>ref|XP_006481097.1| PREDICTED: gamma-interferon-inducible lysosomal thiol reductase-like 
isoform X1 [Citrus sinensis]
Length=295

 Score =   138 bits (347),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 73/168 (43%), Positives = 97/168 (58%), Gaps = 9/168 (5%)
 Frame = +1

Query  106  MAGSHQQTKICFLVCLLF------FTSLSPISCGKVSLDLYYESLCPYSANFIVNYLAKI  267
            MA  H    +  ++ L+F      F+  +     KV L LYYESLCPY ANFI N L K+
Sbjct  1    MAACHSLPFVLSILLLIFISPSLSFSEDAAAKSQKVKLSLYYESLCPYCANFIENQLVKV  60

Query  268  YENGIIDIVDLTLFPWGNAKLKG-NNTFECQHGAAECLLNTIEACAIDAWPDLKEHFPFI  444
            +   +  IV+L L P+GNA+++G + T  CQHG  EC LNTI ACAI+AWPD++ HF  I
Sbjct  61   FNTDLSTIVNLRLVPYGNAQIRGPDKTIICQHGQNECYLNTIHACAINAWPDVRIHFKLI  120

Query  445  YCVESLVNNGEY--SKWETCYEKLGKDPKQISDCYASGRGKELELSYA  582
             C+E   +  E   + W  C   LG   + I +CY SG G +L L YA
Sbjct  121  QCIEGQASASEQPEAAWRKCCNDLGFSQQPIDNCYQSGEGTKLTLKYA  168



>emb|CDY04160.1| BnaA09g19380D [Brassica napus]
Length=218

 Score =   136 bits (342),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 75/150 (50%), Positives = 92/150 (61%), Gaps = 8/150 (5%)
 Frame = +1

Query  139  FLVCLLFFTSLSPIS--CGKVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFP  312
            F  CLLF  S   ++    KV L+LYYESLCP    FIVNYL KI+++ +  + DL L P
Sbjct  16   FFACLLFTISEKLVAGESDKVKLNLYYESLCPGCQVFIVNYLVKIFDSDLHTVTDLKLVP  75

Query  313  WGNAKLKGNNTFECQHGAAECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWE  492
            +GNAK+  N T  CQHG  EC LN IEACAI  WPD K+H+ FI CVE      + +KWE
Sbjct  76   FGNAKVSDNLTVTCQHGEEECKLNAIEACAIRTWPDSKKHYSFIRCVE-----NDTTKWE  130

Query  493  TCYEKLGKDPKQISDCYASGRGKELELSYA  582
            +C  K  +  K I+DCY S   K L L YA
Sbjct  131  SCL-KNSRSEKAINDCYNSDLPKTLILGYA  159



>ref|NP_193026.1| Gamma interferon responsive lysosomal thiol (GILT) reductase 
family protein [Arabidopsis thaliana]
 emb|CAB53090.1| putative protein [Arabidopsis thaliana]
 emb|CAB78332.1| putative protein [Arabidopsis thaliana]
 gb|AEE83201.1| Gamma interferon responsive lysosomal thiol (GILT) reductase 
family protein [Arabidopsis thaliana]
Length=231

 Score =   136 bits (342),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 74/156 (47%), Positives = 93/156 (60%), Gaps = 10/156 (6%)
 Frame = +1

Query  127  TKICFLVCLLFFT----SLSPISCGKVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIV  294
            TK+ F  CLL FT    +L      KV L+LYYESLCP   NFIV++L KI+   +  I 
Sbjct  11   TKLVFFACLLLFTFSSHNLVAGESDKVKLNLYYESLCPSCQNFIVHHLGKIFNTDLHTIT  70

Query  295  DLTLFPWGNAKLKGNNTFECQHGAAECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNG  474
            DL L P+GNA +  + T  CQHG  EC LN +EACAI  WP+ + H+ FI CVE+  N  
Sbjct  71   DLKLIPFGNAHVSDDLTVTCQHGEEECKLNALEACAIRTWPNQRLHYKFIRCVETNTN--  128

Query  475  EYSKWETCYEKLGKDPKQISDCYASGRGKELELSYA  582
                WE+C +K G + K I+DCY     KEL L YA
Sbjct  129  ---AWESCVKKYGGE-KAINDCYNGDLSKELILGYA  160



>ref|XP_009621640.1| PREDICTED: gamma-interferon-inducible lysosomal thiol reductase 
isoform X2 [Nicotiana tomentosiformis]
Length=226

 Score =   136 bits (342),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 71/144 (49%), Positives = 91/144 (63%), Gaps = 7/144 (5%)
 Frame = +1

Query  151  LLFFTSLSPISCGKVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKL  330
            L+F + +S  S  KV+L LYYESLCPY A+FIVN LAK+ E  +  IV+L L PWGN ++
Sbjct  20   LIFQSHVS--SQDKVNLSLYYESLCPYCADFIVNKLAKVLETDLASIVNLRLVPWGNTQI  77

Query  331  KGNNTFECQHGAAECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWETCYEKL  510
              N ++ CQHG AECLLNT+EACAI        HF FI CVE L     +S W++C+   
Sbjct  78   APNTSWICQHGPAECLLNTVEACAIK-----DTHFKFINCVEQLHLENRHSSWQSCFSAT  132

Query  511  GKDPKQISDCYASGRGKELELSYA  582
            G     I +CY +G G  LE +YA
Sbjct  133  GLSQTPIKNCYNNGLGYRLEKAYA  156



>gb|KJB77051.1| hypothetical protein B456_012G118100 [Gossypium raimondii]
Length=216

 Score =   135 bits (341),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 67/140 (48%), Positives = 91/140 (65%), Gaps = 9/140 (6%)
 Frame = +1

Query  172  SPISCGKVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAK-LKGNNTF  348
            S I   KV L LYYESLCPY  +FIV+ L K++   +++I++L L PWGNA+ +K N T 
Sbjct  34   SHIKPKKVHLSLYYESLCPYCRSFIVSQLVKVFNTDLLNIINLRLVPWGNAQYVKPNKTI  93

Query  349  ECQHGAAECLLNTIEACAIDAWPDLKEHFPFIYCVESL---VNNGEYSK-----WETCYE  504
             CQHG  EC LNTI ACAI  WPD ++HF FIYC+E+    + + ++S+     W+ C  
Sbjct  94   ICQHGEDECYLNTIHACAISIWPDPRKHFNFIYCIENQGLPIKDNQHSEGMEAVWKACSA  153

Query  505  KLGKDPKQISDCYASGRGKE  564
            + G D K I DCY SG G++
Sbjct  154  RSGMDQKLIKDCYDSGYGRK  173



>ref|XP_002308232.1| hypothetical protein POPTR_0006s10390g [Populus trichocarpa]
 gb|EEE91755.1| hypothetical protein POPTR_0006s10390g [Populus trichocarpa]
Length=260

 Score =   136 bits (343),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 63/138 (46%), Positives = 95/138 (69%), Gaps = 1/138 (1%)
 Frame = +1

Query  172  SPISCGKVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKL-KGNNTF  348
            S I+  KV+L +YYE+LCP  ANFIV  LA+++ + +I+I++L + PWGNA + K ++T 
Sbjct  38   SSINRQKVNLSVYYEALCPSCANFIVQSLARVFNDDLINIINLRMVPWGNAHVNKTDSTI  97

Query  349  ECQHGAAECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWETCYEKLGKDPKQ  528
             CQ+G  EC+LNTI+ACAI+ W D+ +++  IYC+E L   G +S W++C+  LG   K 
Sbjct  98   ICQNGLDECVLNTIQACAINVWHDVNKYYALIYCIEFLTIEGRHSNWQSCFSSLGLPEKP  157

Query  529  ISDCYASGRGKELELSYA  582
            I DCY +G G +L+  Y 
Sbjct  158  ILDCYNNGTGAKLQALYG  175



>ref|XP_010435334.1| PREDICTED: gamma-interferon-inducible lysosomal thiol reductase-like 
[Camelina sativa]
Length=235

 Score =   135 bits (340),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 76/168 (45%), Positives = 96/168 (57%), Gaps = 15/168 (9%)
 Frame = +1

Query  106  MAGSHQQTKICF-----LVCLLFFTSLSPISCGK----VSLDLYYESLCPYSANFIVNYL  258
            MA S   TK        L CL  FT  + +   K    V L+LYYESLCPY  NFIV+ L
Sbjct  1    MASSSSSTKFVLSPYLLLACLFLFTFSTNLVVAKESDKVKLNLYYESLCPYCQNFIVDDL  60

Query  259  AKIYENGIIDIVDLTLFPWGNAKLKGNNTFECQHGAAECLLNTIEACAIDAWPDLKEHFP  438
            +KI+++ +  I DL L P+GNA +  N T  CQHG  EC+LN +EACAI  WPD K H+ 
Sbjct  61   SKIFDSDLYTITDLKLVPFGNAHVSNNLTITCQHGEEECILNALEACAIRTWPDPKLHYK  120

Query  439  FIYCVESLVNNGEYSKWETCYEKLGKDPKQISDCYASGRGKELELSYA  582
            FI CVE   N     +W  C ++ G++ K I DCY     K+L L YA
Sbjct  121  FIQCVEKNTN-----EWGRCVQRSGRE-KAIKDCYNGDISKKLILGYA  162



>ref|XP_002526663.1| Gamma-interferon-inducible lysosomal thiol reductase precursor, 
putative [Ricinus communis]
 gb|EEF35685.1| Gamma-interferon-inducible lysosomal thiol reductase precursor, 
putative [Ricinus communis]
Length=271

 Score =   136 bits (342),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 61/135 (45%), Positives = 90/135 (67%), Gaps = 1/135 (1%)
 Frame = +1

Query  181  SCGKVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKL-KGNNTFECQ  357
            +  KV+L +YYE+LCP  A+FIV  L  I+ NG+IDI++L + PWGNA + + NNT  CQ
Sbjct  40   NAAKVNLSVYYEALCPSCADFIVRNLMTIFNNGLIDIINLRMIPWGNAHVNRVNNTMVCQ  99

Query  358  HGAAECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWETCYEKLGKDPKQISD  537
            +G  EC LNTI+ACAI+ W ++ +++  IYC+E L   G +  W TC+  LG   K + +
Sbjct  100  NGLDECELNTIQACAINVWNNVNKYYALIYCIEFLAIEGRHRNWLTCFSSLGLSKKPVME  159

Query  538  CYASGRGKELELSYA  582
            CY +G G +L++ Y 
Sbjct  160  CYKNGNGTKLDVVYG  174



>emb|CDP06442.1| unnamed protein product [Coffea canephora]
Length=288

 Score =   136 bits (343),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 63/128 (49%), Positives = 84/128 (66%), Gaps = 3/128 (2%)
 Frame = +1

Query  199  LDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKLKGNNTFECQHGAAECL  378
            L LYYESLCPY ANFIVN LAK+++  +  IV L L PWGN ++   N + CQHG  EC 
Sbjct  76   LSLYYESLCPYCANFIVNQLAKVFQTDLASIVKLRLVPWGNTQITPTNAWVCQHGPDECK  135

Query  379  LNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWETCYEKLGKDPKQISDCYASGRG  558
            LN +EACAI AWP+ + H+  IYC+E L  N   ++W++C+  LG     IS+C ++G  
Sbjct  136  LNMVEACAIYAWPNPRTHYQIIYCIEQLRLN---NRWQSCFPTLGLTSTPISNCLSTGLA  192

Query  559  KELELSYA  582
             +LE  YA
Sbjct  193  VKLERGYA  200



>gb|AAM65819.1| unknown [Arabidopsis thaliana]
Length=233

 Score =   134 bits (337),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 74/159 (47%), Positives = 94/159 (59%), Gaps = 9/159 (6%)
 Frame = +1

Query  115  SHQQTKICFLVCLLFFT---SLSPISCGKVSLDLYYESLCPYSANFIVNYLAKIYENGII  285
            S   TK+ F  CLL  T   +L     GKV L+LYYESLCP    FIV+ L KI++  + 
Sbjct  3    SSSLTKLVFFGCLLLLTFTDNLVAGKSGKVKLNLYYESLCPGCQEFIVDDLGKIFDYDLY  62

Query  286  DIVDLTLFPWGNAKLKGNNTFECQHGAAECLLNTIEACAIDAWPDLKEHFPFIYCVESLV  465
             I DL LFP+GNA+L  N T  CQHG  EC LN +EACA+  WPD K  + FI CVES  
Sbjct  63   TITDLKLFPFGNAELSDNLTVTCQHGEEECKLNALEACALRTWPDQKSQYSFIRCVES--  120

Query  466  NNGEYSKWETCYEKLGKDPKQISDCYASGRGKELELSYA  582
               +   WE+C +  G++ K I+DCY     ++L L YA
Sbjct  121  ---DTKGWESCVKNSGRE-KAINDCYNGDLSRKLILGYA  155



>ref|NP_193032.1| Gamma interferon responsive lysosomal thiol (GILT) reductase 
family protein [Arabidopsis thaliana]
 emb|CAB45495.1| putative protein [Arabidopsis thaliana]
 emb|CAB78338.1| putative protein [Arabidopsis thaliana]
 gb|AAL25536.1| AT4g12960/F25G13_50 [Arabidopsis thaliana]
 gb|AAN18052.1| At4g12960/F25G13_50 [Arabidopsis thaliana]
 gb|AEE83207.1| Gamma interferon responsive lysosomal thiol (GILT) reductase 
family protein [Arabidopsis thaliana]
Length=233

 Score =   134 bits (337),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 74/159 (47%), Positives = 94/159 (59%), Gaps = 9/159 (6%)
 Frame = +1

Query  115  SHQQTKICFLVCLLFFT---SLSPISCGKVSLDLYYESLCPYSANFIVNYLAKIYENGII  285
            S   TK+ F  CLL  T   +L     GKV L+LYYESLCP    FIV+ L KI++  + 
Sbjct  3    SSSLTKLVFFGCLLLLTFTDNLVAGKSGKVKLNLYYESLCPGCQEFIVDDLGKIFDYDLY  62

Query  286  DIVDLTLFPWGNAKLKGNNTFECQHGAAECLLNTIEACAIDAWPDLKEHFPFIYCVESLV  465
             I DL LFP+GNA+L  N T  CQHG  EC LN +EACA+  WPD K  + FI CVES  
Sbjct  63   TITDLKLFPFGNAELSDNLTVTCQHGEEECKLNALEACALRTWPDQKSQYSFIRCVES--  120

Query  466  NNGEYSKWETCYEKLGKDPKQISDCYASGRGKELELSYA  582
               +   WE+C +  G++ K I+DCY     ++L L YA
Sbjct  121  ---DTKGWESCVKNSGRE-KAINDCYNGDLSRKLILGYA  155



>ref|XP_006481417.1| PREDICTED: gamma-interferon-inducible lysosomal thiol reductase-like 
[Citrus sinensis]
Length=262

 Score =   134 bits (336),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 80/177 (45%), Positives = 95/177 (54%), Gaps = 21/177 (12%)
 Frame = +1

Query  115  SHQQTKICFLVCLLFFTSLSPISC---------------GKVSLDLYYESLCPYSANFIV  249
            SHQ         L+F    SP SC                 V+L LYYE+LCP SA FI 
Sbjct  3    SHQLYFFIVFTSLMFMFISSPCSCVEYDGATNFPPSKHNDNVNLSLYYETLCPGSAEFIS  62

Query  250  NYLAKIYENGIIDIVDLTLFPWGNAKL-KGNNTFECQHGAAECLLNTIEACAIDAWPDL-  423
              L K++E G+I IV+L L PWGNA++ + N T +CQHG  EC  NTIEACAI AWPD  
Sbjct  63   EGLGKVFEKGLISIVNLRLIPWGNAEIVEPNKTIDCQHGEDECYFNTIEACAILAWPDQP  122

Query  424  KEHFPFIYCVESLVNNG----EYSKWETCYEKLGKDPKQISDCYASGRGKELELSYA  582
            K HF FI C+E+    G        W TC + L   P  I DCY SG G+ LEL Y 
Sbjct  123  KNHFDFIQCLENRTLRGPIRDRKEAWLTCCKDLELSPNFIKDCYESGIGRLLELKYG  179



>gb|KDO63233.1| hypothetical protein CISIN_1g040358mg [Citrus sinensis]
Length=236

 Score =   132 bits (332),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 80/177 (45%), Positives = 94/177 (53%), Gaps = 21/177 (12%)
 Frame = +1

Query  115  SHQQTKICFLVCLLFFTSLSPISC---------------GKVSLDLYYESLCPYSANFIV  249
            SHQ         L+F    SP SC                 V+L LYYE+LCP  A FI 
Sbjct  3    SHQLYFFIVFTSLMFMFISSPCSCVEYDGATNLPPPKHNDNVNLSLYYETLCPGCAEFIS  62

Query  250  NYLAKIYENGIIDIVDLTLFPWGNAKL-KGNNTFECQHGAAECLLNTIEACAIDAWPDL-  423
              L K++E G+I IV+L L PWGNAK+ + N T +CQHG  EC  NTIEACAI AWPD  
Sbjct  63   EGLGKLFEKGLISIVNLRLIPWGNAKIVEPNKTIDCQHGEDECYFNTIEACAILAWPDQP  122

Query  424  KEHFPFIYCVESLVNNG----EYSKWETCYEKLGKDPKQISDCYASGRGKELELSYA  582
            K HF FI C+E+    G        W TC + L   P  I DCY SG G+ LEL Y 
Sbjct  123  KNHFDFIQCLENRTLRGPIRDRKEAWLTCCKDLELSPNFIKDCYESGIGRLLELKYG  179



>ref|XP_009337735.1| PREDICTED: gamma-interferon-inducible lysosomal thiol reductase-like 
[Pyrus x bretschneideri]
Length=218

 Score =   131 bits (330),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 66/141 (47%), Positives = 90/141 (64%), Gaps = 1/141 (1%)
 Frame = +1

Query  160  FTSLSPISCGKVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKLKGN  339
            F S+S I   K++L +YYE+LCP  A FIV  LA+I++N +I I++L L PWGNA    +
Sbjct  20   FGSVSSIEAQKLTLSVYYETLCPRCATFIVKNLARIFDNELITILNLRLVPWGNASTNNS  79

Query  340  NTFE-CQHGAAECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWETCYEKLGK  516
            N    CQHG  EC L+++EACAID   D+ +HF  IYC+E L   G + +W+TC+  LG 
Sbjct  80   NNATFCQHGPDECRLDSLEACAIDVLHDVNKHFALIYCIEFLAIEGRHKEWQTCFSSLGL  139

Query  517  DPKQISDCYASGRGKELELSY  579
              K + DCY S    +LEL Y
Sbjct  140  PLKPVLDCYKSANATKLELKY  160



>ref|XP_006481418.1| PREDICTED: gamma-interferon-inducible lysosomal thiol reductase-like 
[Citrus sinensis]
Length=258

 Score =   132 bits (332),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 71/166 (43%), Positives = 97/166 (58%), Gaps = 18/166 (11%)
 Frame = +1

Query  139  FLVCLLF-FTSLS----------------PISCGKVSLDLYYESLCPYSANFIVNYLAKI  267
            F  CLLF FTS S                P   G V+L +YYE+L P  +NFIV  L  +
Sbjct  11   FCACLLFLFTSPSHVAASYTHIDGSEASLPAKPGNVNLSVYYETLSPTCSNFIVKNLEGV  70

Query  268  YENGIIDIVDLTLFPWGNAKL-KGNNTFECQHGAAECLLNTIEACAIDAWPDLKEHFPFI  444
            + N +I I++L L PWG+A + K NN F C+HG  ECLLN +EACAI+   ++ +++ FI
Sbjct  71   FNNDLISIINLRLVPWGDANISKFNNAFICKHGPDECLLNEVEACAINVLKNVNKYYGFI  130

Query  445  YCVESLVNNGEYSKWETCYEKLGKDPKQISDCYASGRGKELELSYA  582
            YC+E L   G +  W+TC+  LG   K + DCY SG G +L L +A
Sbjct  131  YCIEFLAIEGRHKDWQTCFNTLGLPAKPVLDCYKSGNGTKLLLQHA  176



>ref|XP_006429471.1| hypothetical protein CICLE_v10013559mg [Citrus clementina]
 gb|ESR42711.1| hypothetical protein CICLE_v10013559mg [Citrus clementina]
Length=443

 Score =   134 bits (338),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 80/177 (45%), Positives = 95/177 (54%), Gaps = 21/177 (12%)
 Frame = +1

Query  115  SHQQTKICFLVCLLFFTSLSPISC---------------GKVSLDLYYESLCPYSANFIV  249
            SHQ         L+F    SP SC                 V+L LYYE+LCP SA FI 
Sbjct  3    SHQLYFFIVFTSLMFMFISSPCSCVEYDGATNLPPSKHNDNVNLSLYYETLCPGSAEFIS  62

Query  250  NYLAKIYENGIIDIVDLTLFPWGNAKL-KGNNTFECQHGAAECLLNTIEACAIDAWPDL-  423
              L K++E G+I IV+L L PWGNA++ + N T +CQHG  EC  NTIEACAI AWPD  
Sbjct  63   EVLGKVFEKGLISIVNLRLIPWGNAEIVEPNKTIDCQHGEDECYFNTIEACAILAWPDQP  122

Query  424  KEHFPFIYCVESLVNNG----EYSKWETCYEKLGKDPKQISDCYASGRGKELELSYA  582
            K HF FI C+E+    G        W TC + L   P  I DCY SG G+ LEL Y 
Sbjct  123  KNHFDFIQCLENRTLRGPIRDRKEAWLTCCKDLELSPNFIKDCYESGIGRLLELKYG  179


 Score =   126 bits (317),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 63/126 (50%), Positives = 80/126 (63%), Gaps = 3/126 (2%)
 Frame = +1

Query  190  KVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKLKG-NNTFECQHGA  366
            KV L LYYESLCPY ANFI N L K++   +  IV+L L P+GNA+++G + T  CQHG 
Sbjct  251  KVKLSLYYESLCPYCANFIENQLVKVFNTDLRIIVNLRLVPYGNAQIRGPDKTIICQHGQ  310

Query  367  AECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEY--SKWETCYEKLGKDPKQISDC  540
             EC LNTI ACAI+AWPD++ HF  I C+E   +  E   + W  C   LG   + I +C
Sbjct  311  NECYLNTIHACAINAWPDVRIHFKLIQCIEGQASASEQPEAAWRKCCNDLGFSQQPIDNC  370

Query  541  YASGRG  558
            Y SG G
Sbjct  371  YQSGEG  376



>gb|KJB77058.1| hypothetical protein B456_012G118200 [Gossypium raimondii]
Length=267

 Score =   130 bits (328),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 68/140 (49%), Positives = 87/140 (62%), Gaps = 8/140 (6%)
 Frame = +1

Query  181  SCGKVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKLKGNNTFECQH  360
            +  KV+L LYYE+LCPY A+FI N L K++ + +  IV+L L PWGNA + G+    CQH
Sbjct  40   TSDKVTLALYYETLCPYCADFITNDLVKVFLSDLFTIVNLKLVPWGNADILGDEP-HCQH  98

Query  361  GAAECLLNTIEACAIDAWPDLKEHFPFIYCVES------LVNNGEYSKWETCYEKLGKDP  522
            G  EC LNTI +C I  WPD+K+HF FI C E       LV N   + W+ C EKLG   
Sbjct  99   GEDECYLNTIHSCVIYYWPDVKKHFDFIRCTEQQSSKKPLVKN-RAAMWKQCSEKLGMSA  157

Query  523  KQISDCYASGRGKELELSYA  582
             +I+ CY SG G +L L YA
Sbjct  158  HRINKCYTSGYGLKLLLQYA  177



>gb|KHG04271.1| Gamma-interferon-inducible lysosomal thiol reductase [Gossypium 
arboreum]
Length=255

 Score =   130 bits (326),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 76/175 (43%), Positives = 97/175 (55%), Gaps = 24/175 (14%)
 Frame = +1

Query  124  QTKICFLVCLLFFTSLSPI----------------SCGKVSLDLYYESLCPYSANFIVNY  255
            Q  I F++  L F  +SP                 +  KV+L LYYESLCPY A+FI N 
Sbjct  5    QQFIFFILVALPFMFISPTHSSLANGNVNILPPTNTSDKVTLALYYESLCPYCADFITND  64

Query  256  LAKIYENGIIDIVDLTLFPWGNAKLKGNNTFECQHGAAECLLNTIEACAIDAWPDLKEHF  435
            L K++ + +  IV+L L PWGNA + G+    CQHG  EC LNTI +C I  WPD+K+HF
Sbjct  65   LVKVFLSDLYTIVNLKLVPWGNADILGDEP-HCQHGEDECYLNTIHSCVIYYWPDVKKHF  123

Query  436  PFIYCVES------LVNNGEYSKWETCYEKLGKDPKQISDCYASGRGKELELSYA  582
             FI C E       LV N   + W+ C EKLG    +I+ CY SG G +L L YA
Sbjct  124  DFIRCTEQQSSKKRLVKN-RAAMWKQCSEKLGMSAHRINKCYTSGYGLKLLLQYA  177



>gb|AAM65025.1| unknown [Arabidopsis thaliana]
Length=232

 Score =   129 bits (324),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 70/152 (46%), Positives = 91/152 (60%), Gaps = 10/152 (7%)
 Frame = +1

Query  139  FLVCLLFFTSLSPI----SCGKVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTL  306
            FL CL  FT  + +    +  KV ++LYYESLCPY  NFIV+ L KI+++ ++ I DL L
Sbjct  17   FLACLFVFTYSNNLVVAENSNKVKINLYYESLCPYCQNFIVDDLGKIFDSDLLKITDLKL  76

Query  307  FPWGNAKLKGNNTFECQHGAAECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSK  486
             P+GNA +  N T  CQHG  EC LN +EAC I   PD K  + FI CVE   N     +
Sbjct  77   VPFGNAHISNNLTITCQHGEEECKLNALEACGIRTLPDPKLQYKFIRCVEKDTN-----E  131

Query  487  WETCYEKLGKDPKQISDCYASGRGKELELSYA  582
            WE+C +  G++ K ISDCY     K+L L YA
Sbjct  132  WESCVQNSGRE-KAISDCYNGDLSKKLILGYA  162



>ref|XP_002993226.1| hypothetical protein SELMODRAFT_162916 [Selaginella moellendorffii]
 gb|EFJ05746.1| hypothetical protein SELMODRAFT_162916 [Selaginella moellendorffii]
Length=236

 Score =   129 bits (323),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 61/131 (47%), Positives = 84/131 (64%), Gaps = 1/131 (1%)
 Frame = +1

Query  190  KVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKLKGNNTFECQHGAA  369
            KVS++LY ESLCP+ ANF+VNYL+K + NG+I+IVDL + P+GNA++  +    CQHG  
Sbjct  38   KVSVELYTESLCPFCANFVVNYLSKFFTNGLIEIVDLKIIPYGNARMDSSGHITCQHGPD  97

Query  370  ECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWETCYEKLGKDPKQISDCYAS  549
            EC LN I++CAI  WP +   FPFIYC+ESL        W++C   +  +   + +CY  
Sbjct  98   ECKLNIIQSCAIHLWPKVDAWFPFIYCLESLPRAIAAEAWKSCNSSIA-NITLVEECYKG  156

Query  550  GRGKELELSYA  582
              G  LE  YA
Sbjct  157  PTGLLLEKGYA  167



>gb|KFK23481.1| hypothetical protein AALP_AAs46213U000100 [Arabis alpina]
Length=229

 Score =   128 bits (322),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 73/165 (44%), Positives = 96/165 (58%), Gaps = 12/165 (7%)
 Frame = +1

Query  106  MAGSHQQTKI--CFLVCLLFFT----SLSPISCGKVSLDLYYESLCPYSANFIVNYLAKI  267
            MA S    K+   FL CLL FT    +L   +  KV L+LYYESLCPY   FIV+ L K+
Sbjct  1    MASSSASKKLEFFFLACLLMFTFSYDNLVAGNSDKVKLNLYYESLCPYCQEFIVDDLVKL  60

Query  268  YENGIIDIVDLTLFPWGNAKLKGNNTFECQHGAAECLLNTIEACAIDAWPDLKEHFPFIY  447
            ++  +  I DL L P+GNA +  + T  CQHG  EC LN +EACAI+ WP+ K H+ +I 
Sbjct  61   FDTDLHTITDLNLVPFGNAHVSDDLTVTCQHGEEECKLNALEACAINTWPNPKLHYRYIR  120

Query  448  CVESLVNNGEYSKWETCYEKLGKDPKQISDCYASGRGKELELSYA  582
            CVE    N     WE+C++  G + + I DCY     K+L L YA
Sbjct  121  CVEQNTEN-----WESCFKTYGGE-EAIKDCYNGDLSKKLILGYA  159



>ref|XP_002965810.1| hypothetical protein SELMODRAFT_406875 [Selaginella moellendorffii]
 gb|EFJ33230.1| hypothetical protein SELMODRAFT_406875 [Selaginella moellendorffii]
Length=234

 Score =   129 bits (323),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 61/131 (47%), Positives = 84/131 (64%), Gaps = 1/131 (1%)
 Frame = +1

Query  190  KVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKLKGNNTFECQHGAA  369
            KVS++LY ESLCP+ ANF+VNYL+K + NG+I+IVDL + P+GNA++  +    CQHG  
Sbjct  36   KVSVELYTESLCPFCANFVVNYLSKFFTNGLIEIVDLKIIPYGNARMDSSGHITCQHGPD  95

Query  370  ECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWETCYEKLGKDPKQISDCYAS  549
            EC LN I++CAI  WP +   FPFIYC+ESL        W++C   +  +   + +CY  
Sbjct  96   ECKLNIIQSCAISLWPKVDAWFPFIYCLESLPRAIAAEAWKSCNSSIA-NITLVEECYEG  154

Query  550  GRGKELELSYA  582
              G  LE  YA
Sbjct  155  PTGLLLEKGYA  165



>gb|KJB77056.1| hypothetical protein B456_012G118200 [Gossypium raimondii]
Length=255

 Score =   129 bits (324),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 75/175 (43%), Positives = 97/175 (55%), Gaps = 24/175 (14%)
 Frame = +1

Query  124  QTKICFLVCLLFFTSLSPI----------------SCGKVSLDLYYESLCPYSANFIVNY  255
            Q  I F++  L F  +SP                 +  KV+L LYYE+LCPY A+FI N 
Sbjct  5    QQFIFFILVALPFMFISPTHSSLANGKVNILPPTNTSDKVTLALYYETLCPYCADFITND  64

Query  256  LAKIYENGIIDIVDLTLFPWGNAKLKGNNTFECQHGAAECLLNTIEACAIDAWPDLKEHF  435
            L K++ + +  IV+L L PWGNA + G+    CQHG  EC LNTI +C I  WPD+K+HF
Sbjct  65   LVKVFLSDLFTIVNLKLVPWGNADILGDEP-HCQHGEDECYLNTIHSCVIYYWPDVKKHF  123

Query  436  PFIYCVES------LVNNGEYSKWETCYEKLGKDPKQISDCYASGRGKELELSYA  582
             FI C E       LV N   + W+ C EKLG    +I+ CY SG G +L L YA
Sbjct  124  DFIRCTEQQSSKKPLVKN-RAAMWKQCSEKLGMSAHRINKCYTSGYGLKLLLQYA  177



>ref|XP_010529036.1| PREDICTED: gamma-interferon-inducible lysosomal thiol reductase-like 
[Tarenaya hassleriana]
Length=238

 Score =   129 bits (323),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 67/133 (50%), Positives = 84/133 (63%), Gaps = 4/133 (3%)
 Frame = +1

Query  190  KVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKLKGNNTFECQHGAA  369
            KV+L+LYYESLCPY  +FI   L K++   +  I +L L P+GNAK+  +N   CQHG  
Sbjct  34   KVNLNLYYESLCPYCQSFIAESLVKVFSTDLYTITNLRLVPFGNAKIVSSNVV-CQHGED  92

Query  370  ECLLNTIEACAIDAWPDLKEHFPFIYCVES--LVNNGEYSKWETCYEKLGKDPKQISDCY  543
            EC LN IEACAI  WPD KEHF FI CVES   V +   + W+ C +K G   +QI DC+
Sbjct  93   ECYLNAIEACAIHIWPDQKEHFSFIRCVESSPKVGDDPTAAWKACADKFGGS-QQIQDCH  151

Query  544  ASGRGKELELSYA  582
             SG   +L L YA
Sbjct  152  DSGLSSQLILGYA  164



>gb|KDO63235.1| hypothetical protein CISIN_1g043330mg, partial [Citrus sinensis]
Length=225

 Score =   128 bits (322),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 61/137 (45%), Positives = 87/137 (64%), Gaps = 1/137 (1%)
 Frame = +1

Query  175  PISCGKVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKL-KGNNTFE  351
            P   G V+L +YYE+L P  +NFIV  L  ++ N +I I++L L PWG+A + K NN   
Sbjct  7    PAKPGNVNLSVYYETLSPTCSNFIVKNLEGVFNNDLISIINLRLVPWGDANISKSNNACI  66

Query  352  CQHGAAECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWETCYEKLGKDPKQI  531
            C+HG  ECLLN +EACAI+   ++ +++ FIYC+E L   G +  W+TC+  LG   K +
Sbjct  67   CKHGPDECLLNEVEACAINVLKNVNKYYGFIYCIEFLAIEGRHKDWQTCFNTLGLPAKPV  126

Query  532  SDCYASGRGKELELSYA  582
             DCY SG G +L L +A
Sbjct  127  LDCYKSGNGTKLLLQHA  143



>ref|XP_007026602.1| Gamma-interferon-inducible lysosomal thiol reductase precursor, 
putative [Theobroma cacao]
 gb|EOY07104.1| Gamma-interferon-inducible lysosomal thiol reductase precursor, 
putative [Theobroma cacao]
Length=290

 Score =   130 bits (326),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 71/145 (49%), Positives = 92/145 (63%), Gaps = 7/145 (5%)
 Frame = +1

Query  166  SLSP-ISCGKVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKLKGNN  342
            +LSP I+  KV+L LYYE+LCPY A+FI + L K+++N +  IV+L L PWGNA + GN 
Sbjct  58   TLSPAINNEKVNLSLYYETLCPYCASFISDNLVKVFQNDLDTIVNLRLVPWGNAFIVGNR  117

Query  343  TFECQHGAAECLLNTIEACAIDAWPDLKEHFPFIYCVESL-VNNGEYSK----WETCYEK  507
            T +CQHG  EC LNTI +C I  WPD+K HF FI C E   +  G  +     WE C EK
Sbjct  118  T-QCQHGEEECYLNTIHSCVIYLWPDVKTHFEFIDCTEKQNLKRGPVTTKEELWEPCCEK  176

Query  508  LGKDPKQISDCYASGRGKELELSYA  582
            L     +I +CY SG G +L+  YA
Sbjct  177  LILSEDRIKECYNSGYGNKLQRQYA  201



>ref|XP_009354192.1| PREDICTED: gamma-interferon-inducible lysosomal thiol reductase-like 
[Pyrus x bretschneideri]
Length=137

 Score =   125 bits (314),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 55/81 (68%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = +1

Query  175  PISCGKVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKLKGNNTFEC  354
            P+  GKVSL LYYES CPYSANFIVNYL K++++ +I IVDL L PWGNAKL+ N+TF C
Sbjct  37   PLDSGKVSLALYYESPCPYSANFIVNYLVKLFKDELISIVDLKLSPWGNAKLRSNDTFTC  96

Query  355  QHGAAECLLNTIEACAIDAWP  417
            QHG +ECLLNT+E CA + WP
Sbjct  97   QHGPSECLLNTMETCATEIWP  117



>ref|NP_567395.1| Gamma interferon responsive lysosomal thiol (GILT) reductase 
family protein [Arabidopsis thaliana]
 gb|ABH04518.1| At4g12890 [Arabidopsis thaliana]
 gb|AEE83200.1| Gamma interferon responsive lysosomal thiol (GILT) reductase 
family protein [Arabidopsis thaliana]
Length=232

 Score =   128 bits (321),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 69/152 (45%), Positives = 92/152 (61%), Gaps = 10/152 (7%)
 Frame = +1

Query  139  FLVCLLFFTSLSPI----SCGKVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTL  306
            FL CL  FT  + +    +  KV ++LYYESLCPY  NFIV+ L KI+++ ++ I DL L
Sbjct  17   FLACLFVFTYSNNLVVAENSNKVKINLYYESLCPYCQNFIVDDLGKIFDSDLLKITDLKL  76

Query  307  FPWGNAKLKGNNTFECQHGAAECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSK  486
             P+GNA +  N T  CQHG  EC LN +EAC I   PD K  + FI CVE   N     +
Sbjct  77   VPFGNAHISNNLTITCQHGEEECKLNALEACGIRTLPDPKLQYKFIRCVEKDTN-----E  131

Query  487  WETCYEKLGKDPKQISDCYASGRGKELELSYA  582
            WE+C +K G++ K I+DCY     ++L L YA
Sbjct  132  WESCVKKSGRE-KAINDCYNGDLSQKLILGYA  162



>emb|CAB41006.1| putative protein [Arabidopsis thaliana]
 emb|CAB78331.1| putative protein [Arabidopsis thaliana]
Length=250

 Score =   127 bits (319),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 69/152 (45%), Positives = 92/152 (61%), Gaps = 10/152 (7%)
 Frame = +1

Query  139  FLVCLLFFTSLSPI----SCGKVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTL  306
            FL CL  FT  + +    +  KV ++LYYESLCPY  NFIV+ L KI+++ ++ I DL L
Sbjct  17   FLACLFVFTYSNNLVVAENSNKVKINLYYESLCPYCQNFIVDDLGKIFDSDLLKITDLKL  76

Query  307  FPWGNAKLKGNNTFECQHGAAECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSK  486
             P+GNA +  N T  CQHG  EC LN +EAC I   PD K  + FI CVE   N     +
Sbjct  77   VPFGNAHISNNLTITCQHGEEECKLNALEACGIRTLPDPKLQYKFIRCVEKDTN-----E  131

Query  487  WETCYEKLGKDPKQISDCYASGRGKELELSYA  582
            WE+C +K G++ K I+DCY     ++L L YA
Sbjct  132  WESCVKKSGRE-KAINDCYNGDLSQKLILGYA  162



>ref|XP_002863285.1| gamma interferon responsive lysosomal thiol reductase family 
protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH39544.1| gamma interferon responsive lysosomal thiol reductase family 
protein [Arabidopsis lyrata subsp. lyrata]
Length=232

 Score =   126 bits (316),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 69/152 (45%), Positives = 90/152 (59%), Gaps = 10/152 (7%)
 Frame = +1

Query  139  FLVCLLFFTSLSPI----SCGKVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTL  306
            FL CL  FT  + +       KV L+LYYESLCPY  NFIV+ L KI+++ ++ I DL L
Sbjct  16   FLACLFLFTFSNNLIVAEKSDKVKLNLYYESLCPYCQNFIVHDLGKIFDSDLLKITDLKL  75

Query  307  FPWGNAKLKGNNTFECQHGAAECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSK  486
             P+GNA +  N T  CQHG  EC LN +EAC I   PD K  + FI CVE   N     +
Sbjct  76   VPFGNAHVSNNLTITCQHGEEECKLNALEACGIRTLPDPKLQYKFIQCVEKDTN-----E  130

Query  487  WETCYEKLGKDPKQISDCYASGRGKELELSYA  582
            W +C +K G++ K I+DCY     K+L + YA
Sbjct  131  WGSCVKKSGRE-KSINDCYNGDLSKKLIIGYA  161



>emb|CDX80703.1| BnaC08g05370D [Brassica napus]
Length=259

 Score =   126 bits (317),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 75/172 (44%), Positives = 96/172 (56%), Gaps = 8/172 (5%)
 Frame = +1

Query  73   NSIISNFASSQMAGSHQQTKICFLVCLLFFTSLSPIS--CGKVSLDLYYESLCPYSANFI  246
            N I+    +   + SH+    C L CLLF  S + ++    KV L+LYYES+CPY  +FI
Sbjct  13   NVILRMLFTMTSSSSHRLVFFC-LACLLFTFSYNFVAGESDKVKLNLYYESICPYCQSFI  71

Query  247  VNYLAKIYENGIIDIVDLTLFPWGNAKLKGNNTFECQHGAAECLLNTIEACAIDAWPDLK  426
             + L KI+++ +  I DL L P+GNA +    T  CQHG  EC LN IEACAI  WPD  
Sbjct  72   ADGLVKIFDSDLHTITDLKLVPFGNAHVSDKLTVTCQHGEEECKLNAIEACAIRTWPDPN  131

Query  427  EHFPFIYCVESLVNNGEYSKWETCYEKLGKDPKQISDCYASGRGKELELSYA  582
             H+ FI C+E+   N E S    C+ K G   K I DCY S   K L L YA
Sbjct  132  VHYWFIRCIENDTTNWESS----CFTKYG-GKKAIKDCYTSDLSKTLILGYA  178



>ref|NP_001154228.1| Gamma interferon responsive lysosomal thiol (GILT) reductase 
family protein [Arabidopsis thaliana]
 gb|AEE83208.1| Gamma interferon responsive lysosomal thiol (GILT) reductase 
family protein [Arabidopsis thaliana]
Length=243

 Score =   126 bits (316),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 74/169 (44%), Positives = 94/169 (56%), Gaps = 19/169 (11%)
 Frame = +1

Query  115  SHQQTKICFLVCLLFFT---SLSPISCGKVSLDLYYESLCPYSANFIVNYLAKIYENGII  285
            S   TK+ F  CLL  T   +L     GKV L+LYYESLCP    FIV+ L KI++  + 
Sbjct  3    SSSLTKLVFFGCLLLLTFTDNLVAGKSGKVKLNLYYESLCPGCQEFIVDDLGKIFDYDLY  62

Query  286  DIVDLTLFPWGNAKLKGNNTFECQHGAAECLLNTIEACAIDAWPD----------LKEHF  435
             I DL LFP+GNA+L  N T  CQHG  EC LN +EACA+  WPD           K  +
Sbjct  63   TITDLKLFPFGNAELSDNLTVTCQHGEEECKLNALEACALRTWPDQFDKCDGYGTQKSQY  122

Query  436  PFIYCVESLVNNGEYSKWETCYEKLGKDPKQISDCYASGRGKELELSYA  582
             FI CVES     +   WE+C +  G++ K I+DCY     ++L L YA
Sbjct  123  SFIRCVES-----DTKGWESCVKNSGRE-KAINDCYNGDLSRKLILGYA  165



>ref|XP_007207734.1| hypothetical protein PRUPE_ppb022512mg [Prunus persica]
 gb|EMJ08933.1| hypothetical protein PRUPE_ppb022512mg [Prunus persica]
Length=448

 Score =   129 bits (325),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 63/130 (48%), Positives = 87/130 (67%), Gaps = 4/130 (3%)
 Frame = +1

Query  175  PISCGKVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKLK-GNNTFE  351
            P     V L LYYE+LCPY   FIV  L K+++  +IDIV+L L P+GNA ++  +NT  
Sbjct  264  PTKVENVELVLYYETLCPYCKEFIVKELIKVFDRDLIDIVNLRLVPYGNAHIQEPDNTIV  323

Query  352  CQHGAAECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSK---WETCYEKLGKDP  522
            CQHG  EC LN+I+ACAI++ PD+K+HF  I+CVE+    G+ SK   W++C +KL  + 
Sbjct  324  CQHGPDECYLNSIQACAINSRPDVKQHFKLIHCVENQTIEGKQSKEEGWKSCCQKLRMNQ  383

Query  523  KQISDCYASG  552
            K + DCY SG
Sbjct  384  KPVQDCYDSG  393


 Score =   124 bits (312),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 65/159 (41%), Positives = 90/159 (57%), Gaps = 21/159 (13%)
 Frame = +1

Query  169  LSPISCGKVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKLKGN-NT  345
            +S I   KV+L +YYE+LCP+ A FIV  LA+I++N +I I++L L PWG A    + N+
Sbjct  33   VSRIEAQKVTLSVYYETLCPFCATFIVKNLAQIFDNNLITILNLRLVPWGKASTNSSKNS  92

Query  346  FECQHGAAECLLNTIEACAIDAWPDL--------------------KEHFPFIYCVESLV  465
              CQHG  EC LN++EACAI+   D+                     ++F  IYC+E L 
Sbjct  93   TVCQHGPDECRLNSVEACAINVLHDVLVNIFKSLHYLKPPNEFVMQNKYFALIYCIEFLA  152

Query  466  NNGEYSKWETCYEKLGKDPKQISDCYASGRGKELELSYA  582
              G   +W+TC+  LG   K I DCY SG G ++E  YA
Sbjct  153  IEGRQKEWQTCFSSLGLPSKPILDCYKSGNGTKIEQKYA  191



>ref|XP_010093552.1| hypothetical protein L484_013988 [Morus notabilis]
 gb|EXB54259.1| hypothetical protein L484_013988 [Morus notabilis]
Length=225

 Score =   125 bits (315),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 61/138 (44%), Positives = 87/138 (63%), Gaps = 1/138 (1%)
 Frame = +1

Query  172  SPISCGKVSLDLYYESLCPYSANFIVNYLAKIYENGIIDIVDLTLFPWGNAKL-KGNNTF  348
            S +   K++L +YYE+L P  A FIV  LA+I++NG+  I++L L PWGNA + K +N  
Sbjct  40   SKVVSKKLNLSVYYEALNPSCATFIVKNLARIFDNGLNTILNLRLIPWGNAYVNKSSNAI  99

Query  349  ECQHGAAECLLNTIEACAIDAWPDLKEHFPFIYCVESLVNNGEYSKWETCYEKLGKDPKQ  528
             CQ+G+ EC LNT++AC ++   D+ +HF  IYC E LV  G Y  W TC+  LG + K 
Sbjct  100  VCQNGSDECQLNTLQACTVNVLRDVNKHFALIYCFEFLVIEGRYKDWRTCFSSLGLNQKP  159

Query  529  ISDCYASGRGKELELSYA  582
            + +C  S  G +LE  YA
Sbjct  160  VLNCINSVNGTKLEQKYA  177



>ref|XP_002863286.1| gamma interferon responsive lysosomal thiol reductase family 
protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH39545.1| gamma interferon responsive lysosomal thiol reductase family 
protein [Arabidopsis lyrata subsp. lyrata]
Length=229

 Score =   125 bits (315),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 72/162 (44%), Positives = 91/162 (56%), Gaps = 8/162 (5%)
 Frame = +1

Query  106  MAGSHQQTKICFLVCLLFFTSLSPISCG---KVSLDLYYESLCPYSANFIVNYLAKIYEN  276
            M  S   TK+ F  C + FT    +  G   KV L+LYYESLCP    FIV+ L KI+++
Sbjct  1    MVSSSSSTKLVFFTCFVLFTFSDKLVAGESDKVQLNLYYESLCPGCQRFIVDELVKIFDS  60

Query  277  GIIDIVDLTLFPWGNAKLKGNNTFECQHGAAECLLNTIEACAIDAWPDLKEHFPFIYCVE  456
             +  I D+ L P+GNAK+  N T  CQHG  EC LN +EAC I+  P+ K  + FI CVE
Sbjct  61   DLDTITDVKLVPFGNAKVSNNLTVICQHGEEECKLNALEACVINTLPNQKLQYQFIRCVE  120

Query  457  SLVNNGEYSKWETCYEKLGKDPKQISDCYASGRGKELELSYA  582
            +   N E S    C    G D K I+DCY S   K+L L YA
Sbjct  121  NYTKNWESS----CLNGYG-DEKAINDCYNSDLSKKLILGYA  157



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 723952452455