BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001N12

Length=549
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006365061.1|  PREDICTED: wall-associated receptor kinase-l...  72.0    3e-11   Solanum tuberosum [potatoes]
ref|XP_008229723.1|  PREDICTED: wall-associated receptor kinase-l...  69.7    1e-10   
ref|XP_009773751.1|  PREDICTED: wall-associated receptor kinase-l...  69.7    1e-10   Nicotiana sylvestris
ref|XP_010317039.1|  PREDICTED: wall-associated receptor kinase-l...  69.7    2e-10   Solanum lycopersicum
ref|XP_011468189.1|  PREDICTED: wall-associated receptor kinase-l...  68.2    5e-10   Fragaria vesca subsp. vesca
emb|CDP11262.1|  unnamed protein product                              66.6    1e-09   Coffea canephora [robusta coffee]
ref|XP_006368666.1|  hypothetical protein POPTR_0001s07550g           66.6    1e-09   
ref|XP_003594613.1|  Wall-associated receptor kinase-like protein     66.2    2e-09   Medicago truncatula
ref|XP_002297682.1|  kinase family protein                            65.9    2e-09   Populus trichocarpa [western balsam poplar]
ref|XP_008229613.1|  PREDICTED: wall-associated receptor kinase-l...  65.9    3e-09   Prunus mume [ume]
ref|XP_008380327.1|  PREDICTED: wall-associated receptor kinase-l...  62.8    3e-09   Malus domestica [apple tree]
ref|XP_007209854.1|  hypothetical protein PRUPE_ppa014824mg           65.5    3e-09   
ref|XP_008229686.1|  PREDICTED: wall-associated receptor kinase-l...  65.1    4e-09   Prunus mume [ume]
emb|CAN65979.1|  hypothetical protein VITISV_017968                   63.5    5e-09   Vitis vinifera
emb|CAN64180.1|  hypothetical protein VITISV_007798                   63.2    6e-09   Vitis vinifera
emb|CDP11260.1|  unnamed protein product                              65.1    6e-09   Coffea canephora [robusta coffee]
ref|XP_010476729.1|  PREDICTED: wall-associated receptor kinase-l...  64.3    8e-09   Camelina sativa [gold-of-pleasure]
ref|XP_007216280.1|  hypothetical protein PRUPE_ppa019342mg           64.3    9e-09   
ref|XP_008229608.1|  PREDICTED: wall-associated receptor kinase-l...  63.9    1e-08   Prunus mume [ume]
emb|CBI15393.3|  unnamed protein product                              63.9    1e-08   Vitis vinifera
emb|CDP11258.1|  unnamed protein product                              63.5    1e-08   Coffea canephora [robusta coffee]
ref|XP_008229496.1|  PREDICTED: wall-associated receptor kinase-l...  63.2    2e-08   Prunus mume [ume]
ref|XP_009627286.1|  PREDICTED: wall-associated receptor kinase-l...  63.2    2e-08   Nicotiana tomentosiformis
ref|XP_007217318.1|  hypothetical protein PRUPE_ppa017167mg           63.2    2e-08   
emb|CAN82289.1|  hypothetical protein VITISV_028339                   62.4    2e-08   Vitis vinifera
ref|XP_007217301.1|  hypothetical protein PRUPE_ppa018696mg           62.8    3e-08   
ref|XP_010532062.1|  PREDICTED: wall-associated receptor kinase-l...  62.8    3e-08   Tarenaya hassleriana [spider flower]
gb|KJB44159.1|  hypothetical protein B456_007G238000                  62.4    3e-08   Gossypium raimondii
ref|XP_010663682.1|  PREDICTED: wall-associated receptor kinase-l...  62.4    4e-08   Vitis vinifera
ref|XP_006368481.1|  hypothetical protein POPTR_0001s032401g          58.9    4e-08   
emb|CAN64181.1|  hypothetical protein VITISV_007799                   62.4    4e-08   Vitis vinifera
emb|CDP20610.1|  unnamed protein product                              62.4    4e-08   Coffea canephora [robusta coffee]
emb|CBI15571.3|  unnamed protein product                              62.4    4e-08   Vitis vinifera
ref|XP_002512762.1|  kinase, putative                                 62.0    4e-08   
ref|XP_006368667.1|  hypothetical protein POPTR_0001s07560g           60.8    5e-08   
ref|XP_011468703.1|  PREDICTED: wall-associated receptor kinase-l...  58.5    6e-08   Fragaria vesca subsp. vesca
ref|XP_011034599.1|  PREDICTED: wall-associated receptor kinase-l...  61.6    6e-08   Populus euphratica
ref|XP_010497736.1|  PREDICTED: wall-associated receptor kinase-l...  61.6    7e-08   Camelina sativa [gold-of-pleasure]
ref|XP_008229610.1|  PREDICTED: wall-associated receptor kinase-l...  61.2    8e-08   
ref|XP_008229721.1|  PREDICTED: wall-associated receptor kinase-l...  61.2    8e-08   
ref|XP_008229609.1|  PREDICTED: wall-associated receptor kinase-l...  61.2    8e-08   Prunus mume [ume]
ref|XP_006368665.1|  hypothetical protein POPTR_0001s07540g           61.2    9e-08   
ref|XP_010663521.1|  PREDICTED: wall-associated receptor kinase-l...  60.8    1e-07   Vitis vinifera
ref|XP_003634276.1|  PREDICTED: wall-associated receptor kinase-l...  60.8    1e-07   Vitis vinifera
ref|XP_010663520.1|  PREDICTED: wall-associated receptor kinase-l...  60.8    1e-07   Vitis vinifera
ref|XP_007211126.1|  hypothetical protein PRUPE_ppa025607mg           60.8    1e-07   
ref|XP_011077655.1|  PREDICTED: wall-associated receptor kinase 5...  60.8    1e-07   Sesamum indicum [beniseed]
emb|CBI15394.3|  unnamed protein product                              60.8    1e-07   Vitis vinifera
ref|XP_002274962.1|  PREDICTED: wall-associated receptor kinase-l...  60.1    2e-07   Vitis vinifera
emb|CAN65983.1|  hypothetical protein VITISV_017972                   60.1    2e-07   Vitis vinifera
ref|XP_002297684.2|  wall-associated kinase family protein            60.1    2e-07   
ref|XP_006384698.1|  hypothetical protein POPTR_0004s20290g           60.1    2e-07   
ref|XP_003594614.1|  Wall-associated receptor kinase-like protein     60.1    2e-07   Medicago truncatula
ref|XP_006368673.1|  hypothetical protein POPTR_0001s076201g          59.7    2e-07   
ref|XP_007034139.1|  Wall associated kinase-like 6, putative          59.7    2e-07   
ref|XP_004306302.2|  PREDICTED: wall-associated receptor kinase-l...  59.3    2e-07   Fragaria vesca subsp. vesca
ref|XP_008229716.1|  PREDICTED: wall-associated receptor kinase-l...  59.7    3e-07   Prunus mume [ume]
ref|XP_011011594.1|  PREDICTED: wall-associated receptor kinase-l...  59.7    3e-07   Populus euphratica
ref|XP_009597018.1|  PREDICTED: wall-associated receptor kinase 2...  59.7    3e-07   
ref|XP_011011593.1|  PREDICTED: wall-associated receptor kinase-l...  59.7    3e-07   Populus euphratica
ref|XP_007216825.1|  hypothetical protein PRUPE_ppa022857mg           59.3    3e-07   
emb|CDP20609.1|  unnamed protein product                              59.3    3e-07   Coffea canephora [robusta coffee]
ref|XP_010655831.1|  PREDICTED: wall-associated receptor kinase 5...  59.3    3e-07   
ref|NP_173076.1|  wall-associated receptor kinase-like 8              59.3    3e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008229719.1|  PREDICTED: wall-associated receptor kinase-l...  59.3    3e-07   Prunus mume [ume]
ref|XP_008380153.1|  PREDICTED: wall-associated receptor kinase-l...  59.3    3e-07   
ref|XP_006387117.1|  hypothetical protein POPTR_1809s00200g           59.3    3e-07   Populus trichocarpa [western balsam poplar]
emb|CDY22288.1|  BnaC02g25920D                                        58.9    4e-07   Brassica napus [oilseed rape]
ref|XP_011077656.1|  PREDICTED: wall-associated receptor kinase 2...  58.9    4e-07   Sesamum indicum [beniseed]
ref|XP_007216176.1|  hypothetical protein PRUPE_ppa015763mg           58.9    4e-07   
ref|XP_010674686.1|  PREDICTED: putative wall-associated receptor...  58.9    4e-07   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011011597.1|  PREDICTED: wall-associated receptor kinase-l...  58.9    4e-07   Populus euphratica
emb|CAN65982.1|  hypothetical protein VITISV_017971                   58.9    5e-07   Vitis vinifera
emb|CDP06459.1|  unnamed protein product                              58.9    5e-07   Coffea canephora [robusta coffee]
ref|XP_011077536.1|  PREDICTED: wall-associated receptor kinase 2...  58.5    6e-07   Sesamum indicum [beniseed]
ref|XP_002297686.2|  putative wall-associated kinase family protein   58.5    6e-07   Populus trichocarpa [western balsam poplar]
ref|XP_011013613.1|  PREDICTED: wall-associated receptor kinase-l...  58.5    6e-07   Populus euphratica
ref|XP_010663523.1|  PREDICTED: wall-associated receptor kinase-l...  58.5    6e-07   Vitis vinifera
ref|XP_011034598.1|  PREDICTED: wall-associated receptor kinase-l...  58.5    6e-07   Populus euphratica
ref|XP_011013615.1|  PREDICTED: wall-associated receptor kinase-l...  58.5    7e-07   Populus euphratica
gb|KJB28012.1|  hypothetical protein B456_005G021600                  58.5    7e-07   Gossypium raimondii
ref|XP_007216693.1|  hypothetical protein PRUPE_ppa026738mg           58.2    8e-07   
ref|XP_007216118.1|  hypothetical protein PRUPE_ppa018817mg           58.2    8e-07   
ref|XP_009798996.1|  PREDICTED: wall-associated receptor kinase 2...  58.2    9e-07   Nicotiana sylvestris
ref|XP_006416845.1|  hypothetical protein EUTSA_v10006943mg           58.2    9e-07   
ref|XP_006368675.1|  hypothetical protein POPTR_0001s07640g           57.0    1e-06   
ref|XP_009771761.1|  PREDICTED: wall-associated receptor kinase 2...  57.8    1e-06   Nicotiana sylvestris
ref|XP_002264787.2|  PREDICTED: wall-associated receptor kinase 2...  57.4    1e-06   Vitis vinifera
ref|XP_002892899.1|  kinase family protein                            57.4    1e-06   Arabidopsis lyrata subsp. lyrata
ref|NP_173067.1|  wall-associated receptor kinase-like 5              57.4    1e-06   
sp|Q9S9M1.2|WAKLE_ARATH  RecName: Full=Wall-associated receptor k...  57.4    1e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010432907.1|  PREDICTED: wall-associated receptor kinase-l...  57.4    2e-06   Camelina sativa [gold-of-pleasure]
ref|XP_002890151.1|  predicted protein                                57.0    2e-06   
gb|KFK28619.1|  hypothetical protein AALP_AA7G023000                  57.0    2e-06   Arabis alpina [alpine rockcress]
emb|CBI31033.3|  unnamed protein product                              57.0    2e-06   Vitis vinifera
ref|XP_011013612.1|  PREDICTED: wall-associated receptor kinase-l...  57.0    2e-06   Populus euphratica
ref|XP_011034597.1|  PREDICTED: wall-associated receptor kinase-l...  57.0    2e-06   Populus euphratica
ref|XP_010648088.1|  PREDICTED: wall-associated receptor kinase-l...  57.0    2e-06   
ref|XP_004306300.2|  PREDICTED: wall-associated receptor kinase-l...  57.0    2e-06   Fragaria vesca subsp. vesca
gb|KJB28017.1|  hypothetical protein B456_005G022000                  57.0    2e-06   Gossypium raimondii
gb|EMT06507.1|  Wall-associated receptor kinase 5                     57.0    2e-06   
ref|XP_009798995.1|  PREDICTED: putative wall-associated receptor...  56.6    3e-06   Nicotiana sylvestris
ref|XP_011082235.1|  PREDICTED: wall-associated receptor kinase-l...  56.6    3e-06   
ref|XP_008337069.1|  PREDICTED: putative wall-associated receptor...  56.6    3e-06   
ref|XP_010532063.1|  PREDICTED: wall-associated receptor kinase-l...  56.6    3e-06   Tarenaya hassleriana [spider flower]
emb|CBI29387.3|  unnamed protein product                              55.8    3e-06   Vitis vinifera
ref|XP_010415630.1|  PREDICTED: wall-associated receptor kinase-l...  56.2    3e-06   Camelina sativa [gold-of-pleasure]
gb|EMS56893.1|  Wall-associated receptor kinase 5                     56.2    4e-06   Triticum urartu
ref|XP_003534747.2|  PREDICTED: wall-associated receptor kinase-l...  55.8    4e-06   
emb|CDY52851.1|  BnaA09g56430D                                        55.5    5e-06   Brassica napus [oilseed rape]
ref|XP_008229606.1|  PREDICTED: wall-associated receptor kinase-l...  55.5    5e-06   Prunus mume [ume]
ref|XP_010512026.1|  PREDICTED: wall-associated receptor kinase-l...  55.5    6e-06   
ref|XP_009356568.1|  PREDICTED: wall-associated receptor kinase-l...  55.5    6e-06   Pyrus x bretschneideri [bai li]
ref|XP_010447619.1|  PREDICTED: wall-associated receptor kinase-l...  55.5    6e-06   Camelina sativa [gold-of-pleasure]
ref|XP_010512027.1|  PREDICTED: wall-associated receptor kinase-l...  55.5    6e-06   Camelina sativa [gold-of-pleasure]
ref|XP_009117775.1|  PREDICTED: wall-associated receptor kinase-l...  55.5    6e-06   Brassica rapa
emb|CDY49737.1|  BnaA02g19350D                                        52.8    6e-06   Brassica napus [oilseed rape]
ref|XP_010688363.1|  PREDICTED: wall-associated receptor kinase-l...  55.5    6e-06   
ref|XP_010417636.1|  PREDICTED: wall-associated receptor kinase-l...  55.5    6e-06   Camelina sativa [gold-of-pleasure]
ref|XP_002885626.1|  hypothetical protein ARALYDRAFT_898987           55.5    7e-06   
emb|CAN62684.1|  hypothetical protein VITISV_018338                   55.1    7e-06   Vitis vinifera
gb|KJB42573.1|  hypothetical protein B456_007G158100                  55.1    8e-06   Gossypium raimondii
ref|XP_010688364.1|  PREDICTED: wall-associated receptor kinase-l...  55.1    8e-06   
ref|XP_011020556.1|  PREDICTED: wall-associated receptor kinase-l...  55.1    9e-06   Populus euphratica
ref|XP_010246169.1|  PREDICTED: uncharacterized protein LOC104589520  55.1    9e-06   Nelumbo nucifera [Indian lotus]
ref|XP_006653603.1|  PREDICTED: wall-associated receptor kinase 3...  54.7    9e-06   
ref|XP_010088576.1|  Wall-associated receptor kinase-like 9           54.7    1e-05   
ref|XP_008220151.1|  PREDICTED: putative wall-associated receptor...  54.7    1e-05   Prunus mume [ume]
ref|XP_007225548.1|  hypothetical protein PRUPE_ppa002432m1g          53.5    1e-05   
ref|XP_006300756.1|  hypothetical protein CARUB_v10019823mg           54.7    1e-05   Capsella rubella
ref|XP_004306243.2|  PREDICTED: wall-associated receptor kinase-l...  54.7    1e-05   Fragaria vesca subsp. vesca
emb|CDX96662.1|  BnaA08g22050D                                        54.7    1e-05   
ref|XP_007216943.1|  hypothetical protein PRUPE_ppa016387mg           54.3    1e-05   
ref|XP_006387204.1|  hypothetical protein POPTR_1539s002002g          51.2    1e-05   
ref|XP_009111225.1|  PREDICTED: wall-associated receptor kinase-l...  54.3    1e-05   Brassica rapa
ref|XP_006416846.1|  hypothetical protein EUTSA_v10009310mg           54.3    1e-05   
ref|XP_010519689.1|  PREDICTED: wall-associated receptor kinase-l...  54.3    1e-05   Tarenaya hassleriana [spider flower]
gb|KJB28013.1|  hypothetical protein B456_005G021700                  54.3    1e-05   Gossypium raimondii
emb|CDX88557.1|  BnaC06g40010D                                        54.3    1e-05   
ref|XP_002457827.1|  hypothetical protein SORBIDRAFT_03g014450        53.9    2e-05   Sorghum bicolor [broomcorn]
ref|XP_007147445.1|  hypothetical protein PHAVU_006G125300g           53.9    2e-05   Phaseolus vulgaris [French bean]
emb|CDX81750.1|  BnaC08g38510D                                        53.9    2e-05   
ref|XP_006384699.1|  hypothetical protein POPTR_0004s20300g           53.9    2e-05   
ref|XP_010545975.1|  PREDICTED: wall-associated receptor kinase-l...  53.9    2e-05   Tarenaya hassleriana [spider flower]
ref|XP_007035467.1|  Wall associated kinase-like 6, putative          53.9    2e-05   
ref|XP_007147446.1|  hypothetical protein PHAVU_006G125300g           53.9    2e-05   Phaseolus vulgaris [French bean]
ref|XP_008779714.1|  PREDICTED: wall-associated receptor kinase 2...  53.5    2e-05   
ref|XP_007019259.1|  Wall-associated kinase 2, putative               53.9    2e-05   
ref|XP_008225753.1|  PREDICTED: uncharacterized protein LOC103325366  53.9    2e-05   
ref|XP_002264371.1|  PREDICTED: wall-associated receptor kinase 2...  53.9    2e-05   Vitis vinifera
emb|CAN66582.1|  hypothetical protein VITISV_029054                   53.9    2e-05   Vitis vinifera
emb|CBI31032.3|  unnamed protein product                              53.9    2e-05   Vitis vinifera
emb|CDP22017.1|  unnamed protein product                              53.1    2e-05   Coffea canephora [robusta coffee]
emb|CAN70918.1|  hypothetical protein VITISV_009580                   53.5    2e-05   Vitis vinifera
ref|XP_007212912.1|  hypothetical protein PRUPE_ppa022237mg           53.5    2e-05   
ref|XP_010438083.1|  PREDICTED: wall-associated receptor kinase-l...  53.5    2e-05   Camelina sativa [gold-of-pleasure]
ref|XP_002304841.2|  putative wall-associated kinase family protein   53.5    2e-05   Populus trichocarpa [western balsam poplar]
gb|KHN40782.1|  Wall-associated receptor kinase-like 22               53.5    2e-05   Glycine soja [wild soybean]
gb|AAF18508.1|AC010924_21  Contains similarity to gb|AJ009696 wal...  53.5    2e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010476715.1|  PREDICTED: wall-associated receptor kinase-l...  53.5    2e-05   Camelina sativa [gold-of-pleasure]
ref|XP_007217680.1|  hypothetical protein PRUPE_ppa021669mg           53.5    3e-05   
gb|KFK42837.1|  hypothetical protein AALP_AA1G045500                  53.5    3e-05   Arabis alpina [alpine rockcress]
emb|CDX83762.1|  BnaC08g18830D                                        50.4    3e-05   
ref|XP_006389860.1|  hypothetical protein EUTSA_v10018175mg           53.5    3e-05   Eutrema salsugineum [saltwater cress]
gb|KJB33602.1|  hypothetical protein B456_006G020900                  53.5    3e-05   Gossypium raimondii
ref|XP_010688575.1|  PREDICTED: wall-associated receptor kinase-l...  53.1    3e-05   Beta vulgaris subsp. vulgaris [field beet]
gb|EEE70225.1|  hypothetical protein OsJ_30339                        53.5    3e-05   Oryza sativa Japonica Group [Japonica rice]
emb|CAN70175.1|  hypothetical protein VITISV_025099                   53.1    3e-05   Vitis vinifera
ref|XP_010655829.1|  PREDICTED: wall-associated receptor kinase 2...  53.1    3e-05   
dbj|BAD46086.1|  putative wall-associated kinase 4                    53.1    3e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007217600.1|  hypothetical protein PRUPE_ppa018374mg           53.1    3e-05   
ref|XP_010655828.1|  PREDICTED: wall-associated receptor kinase 5...  53.1    3e-05   Vitis vinifera
ref|XP_010655765.1|  PREDICTED: wall-associated receptor kinase 5...  53.1    4e-05   
ref|XP_010497664.1|  PREDICTED: wall-associated receptor kinase-l...  53.1    4e-05   Camelina sativa [gold-of-pleasure]
ref|XP_007147589.1|  hypothetical protein PHAVU_006G137300g           52.8    4e-05   Phaseolus vulgaris [French bean]
gb|EMT10672.1|  Wall-associated receptor kinase 3                     52.8    4e-05   
ref|NP_173064.1|  wall-associated receptor kinase-like 2              52.8    4e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007034133.1|  Wall associated kinase-like 6, putative          52.8    4e-05   
ref|XP_008342477.1|  PREDICTED: wall-associated receptor kinase-l...  52.8    4e-05   
ref|XP_006304551.1|  hypothetical protein CARUB_v10011541mg           52.4    4e-05   Capsella rubella
ref|XP_002891113.1|  predicted protein                                52.8    4e-05   
emb|CBI31039.3|  unnamed protein product                              52.8    5e-05   Vitis vinifera
ref|XP_006305972.1|  hypothetical protein CARUB_v10011235mg           52.8    5e-05   Capsella rubella
ref|XP_010539154.1|  PREDICTED: wall-associated receptor kinase 2...  52.8    5e-05   Tarenaya hassleriana [spider flower]
ref|XP_010459161.1|  PREDICTED: wall-associated receptor kinase-l...  52.8    5e-05   Camelina sativa [gold-of-pleasure]
ref|XP_009793165.1|  PREDICTED: wall-associated receptor kinase-l...  52.8    5e-05   Nicotiana sylvestris
ref|XP_010497621.1|  PREDICTED: wall-associated receptor kinase-l...  52.4    5e-05   Camelina sativa [gold-of-pleasure]
ref|XP_002265153.1|  PREDICTED: wall-associated receptor kinase 5...  52.4    5e-05   Vitis vinifera
ref|XP_006306734.1|  hypothetical protein CARUB_v10008263mg           52.4    6e-05   
ref|XP_010474237.1|  PREDICTED: wall-associated receptor kinase-l...  52.4    6e-05   Camelina sativa [gold-of-pleasure]
ref|XP_011078223.1|  PREDICTED: wall-associated receptor kinase-l...  52.4    6e-05   
ref|NP_177131.1|  wall-associated receptor kinase-like 9              52.4    6e-05   Arabidopsis thaliana [mouse-ear cress]
gb|KJB28014.1|  hypothetical protein B456_005G021800                  52.4    6e-05   Gossypium raimondii
ref|XP_010245932.1|  PREDICTED: uncharacterized protein LOC104589347  52.4    6e-05   
ref|XP_006441107.1|  hypothetical protein CICLE_v10023909mg           52.4    6e-05   
ref|XP_008365150.1|  PREDICTED: wall-associated receptor kinase 2...  52.4    7e-05   
gb|KFK43950.1|  hypothetical protein AALP_AA1G195700                  52.4    7e-05   Arabis alpina [alpine rockcress]
gb|KJB29144.1|  hypothetical protein B456_005G086700                  52.4    7e-05   Gossypium raimondii
ref|XP_011082236.1|  PREDICTED: wall-associated receptor kinase-l...  52.0    7e-05   
ref|XP_010459150.1|  PREDICTED: wall-associated receptor kinase-l...  52.0    7e-05   Camelina sativa [gold-of-pleasure]
ref|XP_007034131.1|  Wall associated kinase-like 6                    52.0    7e-05   
ref|XP_006349531.1|  PREDICTED: wall-associated receptor kinase-l...  50.8    8e-05   
ref|XP_004486489.1|  PREDICTED: wall-associated receptor kinase-l...  52.0    8e-05   Cicer arietinum [garbanzo]
ref|XP_010525668.1|  PREDICTED: putative wall-associated receptor...  52.0    8e-05   Tarenaya hassleriana [spider flower]
emb|CAN75091.1|  hypothetical protein VITISV_032867                   52.0    8e-05   Vitis vinifera
gb|AFW85650.1|  hypothetical protein ZEAMMB73_166927                  51.6    8e-05   
ref|XP_011078212.1|  PREDICTED: wall-associated receptor kinase-l...  52.0    8e-05   Sesamum indicum [beniseed]
emb|CDX86600.1|  BnaC08g01030D                                        52.0    9e-05   
ref|XP_010476713.1|  PREDICTED: wall-associated receptor kinase-l...  52.0    9e-05   Camelina sativa [gold-of-pleasure]
ref|XP_006349532.1|  PREDICTED: uncharacterized protein LOC102582197  52.0    9e-05   Solanum tuberosum [potatoes]
ref|XP_010655763.1|  PREDICTED: putative wall-associated receptor...  51.6    1e-04   Vitis vinifera
ref|XP_008352005.1|  PREDICTED: putative wall-associated receptor...  51.6    1e-04   
gb|EMT18053.1|  Wall-associated receptor kinase-like protein 8        51.6    1e-04   
ref|XP_006384702.1|  hypothetical protein POPTR_0004s20330g           51.6    1e-04   
ref|XP_010497656.1|  PREDICTED: wall-associated receptor kinase-l...  51.6    1e-04   Camelina sativa [gold-of-pleasure]
gb|EMS57976.1|  Wall-associated receptor kinase 3                     51.6    1e-04   Triticum urartu
ref|XP_010664899.1|  PREDICTED: putative wall-associated receptor...  51.6    1e-04   
ref|XP_006384710.1|  hypothetical protein POPTR_0004s20410g           51.6    1e-04   
gb|EMS61208.1|  Wall-associated receptor kinase 3                     51.6    1e-04   Triticum urartu
emb|CDY33355.1|  BnaC05g12280D                                        51.2    1e-04   Brassica napus [oilseed rape]
ref|XP_010648089.1|  PREDICTED: wall-associated receptor kinase-l...  51.6    1e-04   Vitis vinifera
ref|XP_011006010.1|  PREDICTED: wall-associated receptor kinase 2...  51.6    1e-04   Populus euphratica
emb|CDX72291.1|  BnaC07g43130D                                        51.6    1e-04   
ref|XP_010680098.1|  PREDICTED: wall-associated receptor kinase 2...  51.6    1e-04   Beta vulgaris subsp. vulgaris [field beet]
gb|KFK28618.1|  hypothetical protein AALP_AA7G022800                  51.6    1e-04   Arabis alpina [alpine rockcress]
emb|CBI31034.3|  unnamed protein product                              51.2    1e-04   Vitis vinifera
ref|XP_008225633.1|  PREDICTED: putative wall-associated receptor...  51.6    1e-04   
ref|XP_003534784.1|  PREDICTED: wall-associated receptor kinase-l...  51.6    1e-04   Glycine max [soybeans]
ref|XP_006385946.1|  hypothetical protein POPTR_0003s18480g           51.2    1e-04   
ref|XP_008353664.1|  PREDICTED: wall-associated receptor kinase-l...  51.2    1e-04   
emb|CDX83955.1|  BnaC08g16900D                                        51.2    1e-04   
ref|XP_011095218.1|  PREDICTED: wall-associated receptor kinase 2...  51.2    1e-04   Sesamum indicum [beniseed]
ref|XP_009793166.1|  PREDICTED: wall-associated receptor kinase 2...  51.2    1e-04   Nicotiana sylvestris
ref|XP_010277680.1|  PREDICTED: wall-associated receptor kinase 2...  51.2    1e-04   Nelumbo nucifera [Indian lotus]
emb|CAN70207.1|  hypothetical protein VITISV_007744                   51.2    1e-04   Vitis vinifera
ref|XP_002513974.1|  kinase, putative                                 51.2    1e-04   
ref|XP_011082237.1|  PREDICTED: wall-associated receptor kinase-l...  51.2    1e-04   
ref|XP_002265985.1|  PREDICTED: wall-associated receptor kinase 5...  51.2    1e-04   Vitis vinifera
ref|XP_007035468.1|  Wall associated kinase-like 6, putative          51.2    1e-04   
gb|KEH35370.1|  wall-associated receptor kinase-like protein          51.2    1e-04   Medicago truncatula
ref|XP_010691609.1|  PREDICTED: wall-associated receptor kinase-l...  51.2    1e-04   
ref|XP_006388728.1|  hypothetical protein POPTR_0112s00230g           51.2    1e-04   Populus trichocarpa [western balsam poplar]
ref|XP_010269758.1|  PREDICTED: wall-associated receptor kinase-l...  51.2    2e-04   Nelumbo nucifera [Indian lotus]
ref|XP_007147592.1|  hypothetical protein PHAVU_006G137600g           50.8    2e-04   Phaseolus vulgaris [French bean]
ref|XP_010655830.1|  PREDICTED: wall-associated receptor kinase 2...  50.8    2e-04   Vitis vinifera
ref|XP_009106689.1|  PREDICTED: wall-associated receptor kinase-l...  51.2    2e-04   Brassica rapa
ref|XP_004979730.1|  PREDICTED: wall-associated receptor kinase 5...  51.2    2e-04   Setaria italica
gb|AGT16313.1|  wall-associated kinase                                51.2    2e-04   Saccharum hybrid cultivar R570
ref|XP_006385943.1|  hypothetical protein POPTR_0003s18440g           50.8    2e-04   
ref|XP_010648101.1|  PREDICTED: wall-associated receptor kinase-l...  50.8    2e-04   Vitis vinifera
ref|XP_011095036.1|  PREDICTED: wall-associated receptor kinase 2...  50.8    2e-04   Sesamum indicum [beniseed]
ref|XP_010248293.1|  PREDICTED: wall-associated receptor kinase 2...  50.4    2e-04   Nelumbo nucifera [Indian lotus]
ref|XP_004966694.1|  PREDICTED: wall-associated receptor kinase 5...  50.8    2e-04   
gb|EPS59073.1|  hypothetical protein M569_15737                       49.7    2e-04   Genlisea aurea
ref|XP_008441592.1|  PREDICTED: wall-associated receptor kinase 2...  50.8    2e-04   Cucumis melo [Oriental melon]
ref|XP_006306876.1|  hypothetical protein CARUB_v10008430mg           50.8    2e-04   Capsella rubella
ref|XP_006304509.1|  hypothetical protein CARUB_v10011311mg           50.8    2e-04   Capsella rubella
ref|XP_004953048.1|  PREDICTED: wall-associated receptor kinase-l...  50.1    2e-04   
emb|CDY15527.1|  BnaA08g28110D                                        50.8    2e-04   Brassica napus [oilseed rape]
ref|XP_010516829.1|  PREDICTED: wall-associated receptor kinase-l...  50.8    2e-04   Camelina sativa [gold-of-pleasure]
ref|XP_010472841.1|  PREDICTED: wall-associated receptor kinase-l...  50.8    2e-04   Camelina sativa [gold-of-pleasure]
gb|KFK29692.1|  hypothetical protein AALP_AA7G166300                  50.8    2e-04   Arabis alpina [alpine rockcress]
ref|XP_010058352.1|  PREDICTED: wall-associated receptor kinase 2...  50.8    2e-04   
emb|CDY15528.1|  BnaA08g28120D                                        50.8    2e-04   Brassica napus [oilseed rape]
emb|CBI29390.3|  unnamed protein product                              50.8    2e-04   Vitis vinifera
gb|EMT30697.1|  Wall-associated receptor kinase 3                     50.8    2e-04   
ref|XP_010472839.1|  PREDICTED: wall-associated receptor kinase-l...  50.8    2e-04   
ref|XP_010463079.1|  PREDICTED: wall-associated receptor kinase-l...  50.8    2e-04   Camelina sativa [gold-of-pleasure]
gb|EEC85059.1|  hypothetical protein OsI_32393                        50.4    2e-04   Oryza sativa Indica Group [Indian rice]
gb|KJB28225.1|  hypothetical protein B456_005G035300                  50.8    2e-04   Gossypium raimondii
ref|XP_010655836.1|  PREDICTED: wall-associated receptor kinase 5...  50.4    2e-04   
ref|XP_002274809.1|  PREDICTED: wall-associated receptor kinase-l...  50.8    2e-04   Vitis vinifera
ref|NP_173061.2|  wall associated kinase-like 7                       50.4    2e-04   Arabidopsis thaliana [mouse-ear cress]
gb|KJB73057.1|  hypothetical protein B456_011G212600                  50.4    2e-04   Gossypium raimondii
ref|XP_010655764.1|  PREDICTED: wall-associated receptor kinase 5...  50.4    2e-04   Vitis vinifera
ref|XP_006388916.1|  hypothetical protein POPTR_0075s00210g           50.4    2e-04   
ref|XP_008380330.1|  PREDICTED: LOW QUALITY PROTEIN: wall-associa...  50.4    2e-04   
ref|XP_010101391.1|  T-complex protein 1 subunit gamma                50.4    2e-04   
ref|XP_008365116.1|  PREDICTED: putative wall-associated receptor...  50.4    3e-04   
ref|XP_003534786.1|  PREDICTED: wall-associated receptor kinase-l...  50.4    3e-04   
gb|KHN44654.1|  Wall-associated receptor kinase-like 8                50.4    3e-04   
gb|KFK42376.1|  hypothetical protein AALP_AA2G248200                  50.4    3e-04   
gb|EMT18055.1|  Wall-associated receptor kinase 5                     50.4    3e-04   
ref|XP_006388919.1|  hypothetical protein POPTR_0075s00240g           50.1    3e-04   
emb|CAN71409.1|  hypothetical protein VITISV_031032                   50.4    3e-04   
ref|XP_010497676.1|  PREDICTED: wall-associated receptor kinase-l...  50.1    3e-04   
ref|XP_010472840.1|  PREDICTED: wall-associated receptor kinase-l...  50.1    3e-04   
emb|CBI31042.3|  unnamed protein product                              50.4    3e-04   
ref|XP_011015692.1|  PREDICTED: wall-associated receptor kinase 2...  50.1    3e-04   
ref|XP_009111072.1|  PREDICTED: wall-associated receptor kinase-l...  50.1    3e-04   
ref|XP_010098545.1|  Wall-associated receptor kinase 2                50.1    3e-04   
ref|XP_002265582.3|  PREDICTED: wall-associated receptor kinase 5...  50.1    3e-04   
gb|EMT15002.1|  hypothetical protein F775_25777                       49.7    3e-04   
ref|XP_011077535.1|  PREDICTED: wall-associated receptor kinase 2...  50.1    3e-04   
ref|XP_010497671.1|  PREDICTED: wall-associated receptor kinase-l...  50.1    4e-04   
ref|XP_010240140.1|  PREDICTED: wall-associated receptor kinase 1...  50.1    4e-04   
gb|KHN44650.1|  Wall-associated receptor kinase-like 8                50.1    4e-04   
gb|KJB28018.1|  hypothetical protein B456_005G022100                  50.1    4e-04   
ref|XP_002890150.1|  hypothetical protein ARALYDRAFT_471814           50.1    4e-04   
ref|XP_010088575.1|  Wall-associated receptor kinase-like 9           50.1    4e-04   
ref|XP_006665099.1|  PREDICTED: wall-associated receptor kinase 2...  49.7    4e-04   
gb|EMS60448.1|  Wall-associated receptor kinase 5                     49.7    4e-04   
ref|XP_002893045.1|  hypothetical protein ARALYDRAFT_889371           49.7    4e-04   
ref|XP_002888731.1|  hypothetical protein ARALYDRAFT_476104           49.7    4e-04   
ref|XP_010472838.1|  PREDICTED: wall-associated receptor kinase-l...  49.7    4e-04   
ref|XP_010472837.1|  PREDICTED: wall-associated receptor kinase-l...  49.7    5e-04   
ref|XP_010472836.1|  PREDICTED: wall-associated receptor kinase-l...  49.7    5e-04   
ref|XP_008791610.1|  PREDICTED: wall-associated receptor kinase 3...  49.7    5e-04   
ref|XP_002449153.1|  hypothetical protein SORBIDRAFT_05g005830        49.7    5e-04   
ref|XP_002527558.1|  serine-threonine protein kinase, plant-type,...  49.7    5e-04   
ref|XP_010539015.1|  PREDICTED: wall-associated receptor kinase-l...  49.7    5e-04   
ref|XP_002448648.1|  hypothetical protein SORBIDRAFT_06g030770        49.7    5e-04   
ref|XP_010472833.1|  PREDICTED: wall-associated receptor kinase-l...  49.7    5e-04   
ref|XP_002450467.1|  hypothetical protein SORBIDRAFT_05g005794        49.3    5e-04   
ref|XP_010096380.1|  Wall-associated receptor kinase 2                49.7    5e-04   
gb|KHN44652.1|  Wall-associated receptor kinase-like 22               49.3    5e-04   
emb|CDX86598.1|  BnaC08g01050D                                        49.3    5e-04   
ref|NP_849908.1|  wall-associated receptor kinase-like 22             49.7    5e-04   
ref|XP_003527958.1|  PREDICTED: wall-associated receptor kinase 2...  49.7    5e-04   
gb|AAF18506.1|AC010924_19  Similar to gb|U44028 Arabidopsis thali...  49.7    5e-04   
ref|XP_006595272.1|  PREDICTED: uncharacterized protein LOC100784078  49.7    5e-04   
ref|XP_004953046.1|  PREDICTED: wall-associated receptor kinase-l...  48.9    5e-04   
gb|KJB33567.1|  hypothetical protein B456_006G018200                  49.7    5e-04   
ref|XP_010476722.1|  PREDICTED: wall-associated receptor kinase-l...  49.7    5e-04   
ref|XP_002511965.1|  kinase, putative                                 49.7    5e-04   
ref|XP_006385941.1|  hypothetical protein POPTR_0003s18390g           47.8    6e-04   
gb|AAY86486.1|  RFO1                                                  49.3    6e-04   
ref|XP_006301027.1|  hypothetical protein CARUB_v10021418mg           49.3    6e-04   
gb|EMS63828.1|  hypothetical protein TRIUR3_06243                     49.3    6e-04   
ref|XP_002869345.1|  kinase                                           49.3    6e-04   
ref|XP_002302209.2|  hypothetical protein POPTR_0002s07670g           49.3    6e-04   
gb|EMS66469.1|  Wall-associated receptor kinase 2                     49.3    6e-04   
ref|XP_010059280.1|  PREDICTED: wall-associated receptor kinase-l...  49.3    6e-04   
ref|XP_004952174.1|  PREDICTED: wall-associated receptor kinase 2...  49.3    6e-04   
gb|EMT12544.1|  Wall-associated receptor kinase 3                     49.3    6e-04   
ref|XP_010247991.1|  PREDICTED: wall-associated receptor kinase-l...  48.5    6e-04   
ref|XP_006388773.1|  hypothetical protein POPTR_0103s00200g           49.3    6e-04   
gb|EMS67550.1|  Wall-associated receptor kinase 3                     49.3    6e-04   
ref|NP_194839.2|  wall-associated receptor kinase-like 17             49.3    6e-04   
ref|NP_178085.1|  wall-associated receptor kinase-like 22             49.3    6e-04   
ref|XP_008225634.1|  PREDICTED: putative wall-associated receptor...  49.3    7e-04   
ref|XP_010476719.1|  PREDICTED: wall-associated receptor kinase-l...  49.3    7e-04   
emb|CDX83765.1|  BnaC08g18800D                                        49.3    7e-04   
gb|KCW71198.1|  hypothetical protein EUGRSUZ_F04288                   49.3    7e-04   
gb|EMT22096.1|  Wall-associated receptor kinase 5                     49.3    7e-04   
ref|XP_007147586.1|  hypothetical protein PHAVU_006G137000g           48.9    7e-04   
dbj|BAJ96809.1|  predicted protein                                    49.3    7e-04   
ref|XP_010065118.1|  PREDICTED: uncharacterized protein LOC104452338  49.3    7e-04   
gb|KDO37147.1|  hypothetical protein CISIN_1g044892mg                 47.4    7e-04   
ref|XP_007214754.1|  hypothetical protein PRUPE_ppa024967mg           48.9    7e-04   
ref|XP_006384709.1|  hypothetical protein POPTR_0004s204001g          48.9    8e-04   
ref|XP_008225752.1|  PREDICTED: putative wall-associated receptor...  48.9    8e-04   
gb|KHN44651.1|  Wall-associated receptor kinase-like 9                48.9    9e-04   
gb|AAF18510.1|AC010924_23  Contains similarity to gb|AJ009695 wal...  48.9    9e-04   
ref|XP_009624419.1|  PREDICTED: wall-associated receptor kinase 2...  48.9    9e-04   
ref|XP_009411366.1|  PREDICTED: putative wall-associated receptor...  48.9    0.001   



>ref|XP_006365061.1| PREDICTED: wall-associated receptor kinase-like 1-like [Solanum 
tuberosum]
Length=701

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 68/121 (56%), Gaps = 12/121 (10%)
 Frame = +1

Query  187  NYKEDGISMVPKGCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSS  366
            ++     S+   GC + CGN++I YPFG+  S  C LN W+LI C KS +    KPF++S
Sbjct  19   DHSTAATSLAKPGCEERCGNLTIPYPFGLSAS--CSLNSWYLIKCDKSYNP--PKPFMNS  74

Query  367  FSDGKNGVREILSISNVRQSIIMKESFSPLCH-TTAGSAVGSNNLSIISNTKLSGTPFFY  543
            F   +    E++S+S   Q+II   S    C+ ++ GS +      I + T LSG+PF+Y
Sbjct  75   FLQVELQ-SEVISVSIENQTIITSVSIVNFCNKSSEGSKI------ITTGTDLSGSPFYY  127

Query  544  S  546
            +
Sbjct  128  A  128



>ref|XP_008229723.1| PREDICTED: wall-associated receptor kinase-like 8 [Prunus mume]
Length=765

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 41/62 (66%), Gaps = 9/62 (15%)
 Frame = +1

Query  226  CRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGKNGVREILS  405
            CR  CGNVSI YPFGIGP+KDCY ++WF + C KS+ D   KPFL      +    E+LS
Sbjct  43   CRTHCGNVSIPYPFGIGPNKDCYYDEWFQLECNKSTGD---KPFL------RLAQLEVLS  93

Query  406  IS  411
            IS
Sbjct  94   IS  95



>ref|XP_009773751.1| PREDICTED: wall-associated receptor kinase-like 1 [Nicotiana 
sylvestris]
Length=699

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 44/113 (39%), Positives = 66/113 (58%), Gaps = 10/113 (9%)
 Frame = +1

Query  208  SMVPKGCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGKNG  387
            S+  +GC ++CG ++I +PFG+  S  C LN W+LI C +S +    KPFL+SF   +  
Sbjct  26   SLAKRGCEESCGKLTIPFPFGL--SASCSLNSWYLIKCDRSYNP--PKPFLNSFLQVELQ  81

Query  388  VREILSISNVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSGTPFFYS  546
              E++S+S   Q+I    S    C+   GS+ GS    I + T LSG+PF+YS
Sbjct  82   -SEVISVSLENQTITTLISIINFCN---GSSQGSR--IITTGTDLSGSPFYYS  128



>ref|XP_010317039.1| PREDICTED: wall-associated receptor kinase-like 1 [Solanum lycopersicum]
Length=708

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 42/114 (37%), Positives = 65/114 (57%), Gaps = 12/114 (11%)
 Frame = +1

Query  208  SMVPKGCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGKNG  387
            S+   GC + CGN++I YPFG+  S  C LN W++I C +SS     KPF++SF   +  
Sbjct  33   SLAKPGCEERCGNLTIPYPFGLSAS--CSLNSWYVIKCDRSSDP--PKPFMNSFLQVELQ  88

Query  388  VREILSISNVRQSIIMKESFSPLCH-TTAGSAVGSNNLSIISNTKLSGTPFFYS  546
              E++S+S   Q+I    S    C+ ++ GS +      I + T LSG+PF+Y+
Sbjct  89   -SEVISVSIENQTITTSVSIVNFCNKSSEGSRI------ITTGTDLSGSPFYYA  135



>ref|XP_011468189.1| PREDICTED: wall-associated receptor kinase-like 1 [Fragaria vesca 
subsp. vesca]
Length=743

 Score = 68.2 bits (165),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 55/108 (51%), Gaps = 19/108 (18%)
 Frame = +1

Query  226  CRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGKNGVREILS  405
            C++ CGNVSI +PFGIGP KDCY ++WF I+C  S+     KPFL      K    E+L+
Sbjct  41   CQEKCGNVSIPFPFGIGPDKDCYFDEWFEIDCNLSTR---HKPFL------KLTQLEVLN  91

Query  406  ISNVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSGTPFFYSS  549
            IS    ++ +    +  C+    S              L+G+PF YS 
Sbjct  92   ISIKAGALQVNSPVTFFCNVKGSSQPAD----------LTGSPFVYSQ  129



>emb|CDP11262.1| unnamed protein product [Coffea canephora]
Length=580

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 62/116 (53%), Gaps = 14/116 (12%)
 Frame = +1

Query  211  MVPKGCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLS-SFSDGKNG  387
            M  +GC DTCG V+I YPFG+GP  DC LN  + I C  + + G  KP+LS  F      
Sbjct  1    MAIRGCNDTCGGVTIPYPFGVGP--DCALNDSYTIICVDNYASG-SKPYLSFLFQSVSQF  57

Query  388  VREILSISNVRQSIIMKESFSPLC--HTTAGSAVGSNNLSIISNTKLSGTPFFYSS  549
              E+L IS + Q++ + +S + +C  H  A  A+ S          L G+PFF ++
Sbjct  58   FVEVLEISLIDQTVTINKSATRICSDHRQADLAMAS--------YLLDGSPFFVAA  105



>ref|XP_006368666.1| hypothetical protein POPTR_0001s07550g [Populus trichocarpa]
 gb|ERP65235.1| hypothetical protein POPTR_0001s07550g [Populus trichocarpa]
Length=701

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 41/113 (36%), Positives = 62/113 (55%), Gaps = 15/113 (13%)
 Frame = +1

Query  211  MVPKGCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGKNGV  390
            M    C +TCGN+SI +PFGIG    CY+N WF ++C K+++D   + FLS  +      
Sbjct  1    MARPNCTETCGNISIPFPFGIGAG--CYMNDWFSVDCNKTTADSPSRAFLSRIN------  52

Query  391  REILSISNVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSGTPFFYSS  549
             E+L IS +R    M    SP+  ++  S  G+N     S   ++G+PF +SS
Sbjct  53   MEVLEIS-IRDMSNMVRVNSPII-SSGCSGRGAN-----SAINMTGSPFAFSS  98



>ref|XP_003594613.1| Wall-associated receptor kinase-like protein [Medicago truncatula]
 gb|AES64864.1| wall associated kinase-like protein [Medicago truncatula]
Length=712

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 39/119 (33%), Positives = 61/119 (51%), Gaps = 15/119 (13%)
 Frame = +1

Query  193  KEDGISMVPKGCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFS  372
            +EDGI +  +GC  TCG +SI +PFG+   + CY +KWF I C   +S    KP+L S +
Sbjct  27   QEDGI-IAQQGCNSTCGTMSIPFPFGMKEPR-CYADKWFEIECKLDNSSQNPKPYLKSLN  84

Query  373  DGKNGVREILSISNVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSGTPFFYSS  549
                     L ++NV   + M E  +P+ H+     + +  ++I     L  +PF YS 
Sbjct  85   ---------LEVNNVYLDLGMVEIMNPIYHSNCQQNINNKTVTI----NLGVSPFMYSQ  130



>ref|XP_002297682.1| kinase family protein [Populus trichocarpa]
 gb|EEE82487.1| kinase family protein [Populus trichocarpa]
Length=741

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 40/113 (35%), Positives = 62/113 (55%), Gaps = 14/113 (12%)
 Frame = +1

Query  211  MVPKGCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGKNGV  390
            M    C +TCGN+SI +PFGIG    C +N WF ++C K+++D   + FLS  +      
Sbjct  26   MTKPNCTETCGNISISFPFGIGTG--CSMNDWFSVDCNKTTADSPSRAFLSRIN------  77

Query  391  REILSISNVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSGTPFFYSS  549
             E+L IS    +I +    SP+   ++G A    NL+I     ++G+PF +SS
Sbjct  78   MEVLEISLGYSTIPLVRVNSPI--ISSGCAGSGANLAI----NMTGSPFAFSS  124



>ref|XP_008229613.1| PREDICTED: wall-associated receptor kinase-like 1 isoform X1 
[Prunus mume]
Length=782

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 61/108 (56%), Gaps = 16/108 (15%)
 Frame = +1

Query  226  CRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGKNGVREILS  405
            C   CG VSI YPFGIGPS +C+LN WF I+C KS+     KPFL      +    E+L 
Sbjct  39   CTTLCGGVSIPYPFGIGPSTNCFLNGWFQIDCNKSTG---HKPFL------RRAQLEVLD  89

Query  406  ISNVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSGTPFFYSS  549
            IS +  ++ +    + LC+T  G++    +  +++N  L+G+ F +S 
Sbjct  90   IS-INGTLRVNSPITFLCNTKKGNS----SHQLLAN--LTGSFFVFSQ  130



>ref|XP_008380327.1| PREDICTED: wall-associated receptor kinase-like 8 [Malus domestica]
Length=190

 Score = 62.8 bits (151),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 38/62 (61%), Gaps = 8/62 (13%)
 Frame = +1

Query  226  CRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGKNGVREILS  405
            C   CGNVSI YPFGIGPS +CYL  WF I+C  S+S    KPFL      KN   E+L 
Sbjct  35   CESHCGNVSIPYPFGIGPSINCYLYDWFEIDCKNSTSG--PKPFL------KNTTIEVLD  86

Query  406  IS  411
            IS
Sbjct  87   IS  88



>ref|XP_007209854.1| hypothetical protein PRUPE_ppa014824mg [Prunus persica]
 gb|EMJ11053.1| hypothetical protein PRUPE_ppa014824mg [Prunus persica]
Length=728

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 47/117 (40%), Positives = 62/117 (53%), Gaps = 25/117 (21%)
 Frame = +1

Query  226  CRDTCGNVSIYYPFGIGPSKDCYLNKWFLINC-----TKSSSDGVEKPFLSSFSDGKNGV  390
            C   CG+V+I YPFGIGPSKDCYL+KWF I+C     T S++   + PFL S +      
Sbjct  37   CTTHCGDVAIPYPFGIGPSKDCYLDKWFQIDCRHTNSTTSANYSRQVPFLKSVN------  90

Query  391  REILSISNVR-----QSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSGTPFFYS  546
             E+LSIS        QS+ +K   +P+   T  S  G           L+G+PF YS
Sbjct  91   LELLSISPFEDGSGTQSVQVK---NPI---TFFSCKGKETR---QPQNLTGSPFIYS  138



>ref|XP_008229686.1| PREDICTED: wall-associated receptor kinase-like 3 [Prunus mume]
Length=747

 Score = 65.1 bits (157),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 42/112 (38%), Positives = 59/112 (53%), Gaps = 17/112 (15%)
 Frame = +1

Query  226  CRDTCGNVSIYYPFGIGPSKDCYLNKWFLINC-----TKSSSDGVEKPFLSSFSDGKNGV  390
            C   CG+V+I YPFGIGP+KDCYL++WF I+C     T S++   + PFL S +      
Sbjct  24   CTAHCGDVAIPYPFGIGPNKDCYLDEWFQIDCRHNNSTTSANYSRQVPFLKSVN------  77

Query  391  REILSISNVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSGTPFFYS  546
             E+LSI  V+    +    +P+   T  S  G           L+G+PF YS
Sbjct  78   LELLSIFPVKDGRQLVRVKNPI---TLFSCEGKETRQA---QNLTGSPFIYS  123



>emb|CAN65979.1| hypothetical protein VITISV_017968 [Vitis vinifera]
Length=294

 Score = 63.5 bits (153),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 44/112 (39%), Positives = 57/112 (51%), Gaps = 12/112 (11%)
 Frame = +1

Query  211  MVPKGCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGKNGV  390
            MV   CR  CGNV+I +PFGIG S  CYLN W+ +NC+ + S G EKPFL       N  
Sbjct  28   MVKPNCRYRCGNVTIPFPFGIGDS--CYLNVWYSVNCSVNMSSGAEKPFL-------NHT  78

Query  391  REILSISNVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSGTPFFYS  546
            +  L + NV       E  SP+   +     G +N S  S   L  +PF +S
Sbjct  79   KLNLELLNVSLEHRTVEVNSPI--ASYDQRQGESNTSQPS-IDLDKSPFLFS  127



>emb|CAN64180.1| hypothetical protein VITISV_007798 [Vitis vinifera]
Length=264

 Score = 63.2 bits (152),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 39/113 (35%), Positives = 57/113 (50%), Gaps = 16/113 (14%)
 Frame = +1

Query  208  SMVPKGCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGKNG  387
            S+   GC D  G+VSI YPFG+G  KDCYLN+WF INC  S+      PF   F+     
Sbjct  25   SLAQPGCNDASGSVSIPYPFGVG--KDCYLNEWFSINCNHST------PF---FTHPNLN  73

Query  388  VREILSISNVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSGTPFFYS  546
              ++ SIS   Q+++++ +    C         S +  ++    L G PF +S
Sbjct  74   GSQVSSISLEGQTVVVQIATVDFCKLPE-----SQHTQVLDRVDLEGNPFLFS  121



>emb|CDP11260.1| unnamed protein product [Coffea canephora]
Length=1288

 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 41/120 (34%), Positives = 59/120 (49%), Gaps = 10/120 (8%)
 Frame = +1

Query  196  EDGISMVPKGCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVE--KPFLSSF  369
            E    M   GC DTCGNV+I YPFG+GP  DC LN+ + I CT  S D +   +P+L   
Sbjct  823  ETRFPMAKPGCNDTCGNVTIPYPFGVGP--DCALNEAYSILCTDVSGDSIHGLRPYLGLH  880

Query  370  -SDGKNGVREILSISNVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSGTPFFYS  546
                   + E+L IS   Q++ +      +C     S  GS   +   ++ L+  PF+ S
Sbjct  881  PGQSSQTIMEVLGISLSDQTVTINYPVYQIC-----SVNGSTVDTAFMDSSLAQVPFYVS  935


 Score = 61.2 bits (147),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 41/113 (36%), Positives = 59/113 (52%), Gaps = 13/113 (12%)
 Frame = +1

Query  223  GCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTK-SSSDGVE--KPFLSSFSDGKNGVR  393
            GC+DTCG+V I YPFGIGP  DC LN+ + I CT  S  D +   +P+L     G++  R
Sbjct  215  GCKDTCGSVKIPYPFGIGP--DCALNEAYSIRCTDPSGGDSINGLRPYL-GLQPGQSAQR  271

Query  394  --EILSISNVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSGTPFFYS  546
              E+L +S   Q+I +    S +C     +   S     +  + L+  PFF S
Sbjct  272  IVEVLEVSLRDQTITINYPLSKICSFNRTTLDAS-----VFESSLAQAPFFVS  319



>ref|XP_010476729.1| PREDICTED: wall-associated receptor kinase-like 8 [Camelina sativa]
Length=738

 Score = 64.3 bits (155),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 48/118 (41%), Positives = 65/118 (55%), Gaps = 23/118 (19%)
 Frame = +1

Query  226  CRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGKNGVREILS  405
            C+D CG+VS+ YPFGIG  + CY +KWF + C+ +SSD V  PFL S        RE+LS
Sbjct  34   CKDHCGDVSVLYPFGIG--QGCYKDKWFEVVCS-NSSDQVSVPFLLSIR------REVLS  84

Query  406  --ISNVRQSIIMKESF--------SPLCHTTAGSAVGSNNLSIISNTKLSGTPFFYSS  549
              + +   SI  +  +        SPL HT  G + GS   S  S+  L+G+PFF S 
Sbjct  85   FDLGSYSNSIYGRSRYQSNKIRILSPLKHT--GCSNGSIGDS--SSLNLTGSPFFISD  138



>ref|XP_007216280.1| hypothetical protein PRUPE_ppa019342mg [Prunus persica]
 gb|EMJ17479.1| hypothetical protein PRUPE_ppa019342mg [Prunus persica]
Length=1064

 Score = 64.3 bits (155),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 38/114 (33%), Positives = 53/114 (46%), Gaps = 21/114 (18%)
 Frame = +1

Query  211  MVPKGCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGKNGV  390
            M    C   CG++SI YPFGIGP+KDCY ++WF + C +SSS    K +L          
Sbjct  341  MAKHNCATHCGDISIPYPFGIGPNKDCYFDEWFEMVCNQSSSTSPHKLYLR---------  391

Query  391  REILSISNVRQ--SIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSGTPFFYS  546
            R  L + NV    ++ +    +  C    G    +          LSG+PF YS
Sbjct  392  RAQLEVLNVYANGTLRVNNPIAFFCQEYRGQQPAN----------LSGSPFVYS  435



>ref|XP_008229608.1| PREDICTED: wall-associated receptor kinase-like 3 [Prunus mume]
Length=750

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/107 (34%), Positives = 54/107 (50%), Gaps = 17/107 (16%)
 Frame = +1

Query  226  CRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGKNGVREILS  405
            C   CG++SI YPFGIGP KDCY ++WF + C +SSS+   K +L      +    E+L+
Sbjct  41   CATHCGDISIPYPFGIGPHKDCYFDEWFEMVCNQSSSNSPHKLYL------RRAQLEVLN  94

Query  406  ISNVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSGTPFFYS  546
            +     ++ +K   +  C    G    +          LSG+PF YS
Sbjct  95   VY-ANGTLRVKNPIAFFCGEYKGQQPAN----------LSGSPFVYS  130



>emb|CBI15393.3| unnamed protein product [Vitis vinifera]
Length=1029

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/51 (57%), Positives = 36/51 (71%), Gaps = 2/51 (4%)
 Frame = +1

Query  211  MVPKGCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLS  363
            MV   CR  CGNV+I +PFGIG S  CYLN W+ +NC+ + S G EKPFL+
Sbjct  800  MVKPNCRYRCGNVTIPFPFGIGDS--CYLNVWYSVNCSVNMSSGAEKPFLN  848


 Score = 48.9 bits (115),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 41/114 (36%), Positives = 56/114 (49%), Gaps = 15/114 (13%)
 Frame = +1

Query  211  MVPKGC-RDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGKNG  387
            M   GC +D CG++ I YPFG+G  K CY ++WF I+C+ S      KP LS  +     
Sbjct  1    MAKPGCEQDHCGDILIPYPFGMG--KSCYKDEWFSISCSHSFDP--PKPILSKLN-----  51

Query  388  VREILSISNVR-QSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSGTPFFYS  546
              E+LSI   R Q  +M    SP+        V   + S   +  L G+PF YS
Sbjct  52   -LEVLSIEMDRFQKSVMVN--SPIYSNCENGEVEVTS-SPWQSRDLWGSPFLYS  101



>emb|CDP11258.1| unnamed protein product [Coffea canephora]
Length=765

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 60/108 (56%), Gaps = 16/108 (15%)
 Frame = +1

Query  223  GCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGKNGVREIL  402
            GC D+CGNV I YPFG+  S+ C +N+ ++I C  S      KP+LS+ +       E+L
Sbjct  86   GCSDSCGNVLIPYPFGL--SRRCAVNQSYIIICNYS------KPYLSNLN------LEVL  131

Query  403  SISNVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSGTPFFYS  546
            +IS    ++ +  S +  C+       GS+   I S+  L+GTPFFYS
Sbjct  132  NISLENHTVTVNSSLASFCNADQAQRNGSSTTWISSD--LAGTPFFYS  177



>ref|XP_008229496.1| PREDICTED: wall-associated receptor kinase-like 3 [Prunus mume]
Length=771

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 43/123 (35%), Positives = 63/123 (51%), Gaps = 26/123 (21%)
 Frame = +1

Query  226  CRDTCGNVSIYYPFGIGPSKDCYLNKWFLINC-----TKSSSDGVEKPFLSSFSDG----  378
            C   CG+V+I YPFGIGP  DCYL++WF I+C     T S++   + PFL++ S      
Sbjct  37   CTTHCGDVAIPYPFGIGPHTDCYLDEWFQIDCRHNNYTTSTNYSRQAPFLTTSSANYSRQ  96

Query  379  ----KNGVREILS---ISNVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSGTPF  537
                K+   E+LS   I + RQS+ +K   +P+  +  G               L+G+PF
Sbjct  97   APFLKSLNLELLSIFPIKDGRQSVQVK---NPIFFSCEGKETRQPQ-------NLTGSPF  146

Query  538  FYS  546
             YS
Sbjct  147  LYS  149



>ref|XP_009627286.1| PREDICTED: wall-associated receptor kinase-like 1 [Nicotiana 
tomentosiformis]
Length=700

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 41/109 (38%), Positives = 62/109 (57%), Gaps = 12/109 (11%)
 Frame = +1

Query  223  GCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGKNGVREIL  402
            GC ++CGN +I YPFG+  S  C LN W+LI C ++ +    K FL+SF   +    E++
Sbjct  31   GCEESCGNFTIPYPFGL--SASCSLNSWYLIKCDRNYNP--PKLFLNSFLQVELQ-SEVI  85

Query  403  SISNVRQSIIMKESFSPLCH-TTAGSAVGSNNLSIISNTKLSGTPFFYS  546
            S+S   Q+I    S    C+ ++ GS +      I + T LSG+PF+YS
Sbjct  86   SVSLKNQTITTLVSIINFCNDSSQGSRI------ITTGTNLSGSPFYYS  128



>ref|XP_007217318.1| hypothetical protein PRUPE_ppa017167mg, partial [Prunus persica]
 gb|EMJ18517.1| hypothetical protein PRUPE_ppa017167mg, partial [Prunus persica]
Length=715

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 59/107 (55%), Gaps = 19/107 (18%)
 Frame = +1

Query  226  CRDTCG-NVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGKNGVREIL  402
            C   CG NVSI YPFG+GP+KDCY N+WF I+C +S+     KPFL      +    E+L
Sbjct  22   CPTHCGINVSIPYPFGVGPNKDCYFNEWFQIDCNESTG---HKPFL------RRSQMEVL  72

Query  403  SISNVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSGTPFFY  543
            +IS +  ++ +K   SP+  T +G   G           L+G+PF Y
Sbjct  73   NIS-IDGTLQVK---SPV--TFSGGCKGKETRQA---PNLTGSPFVY  110



>emb|CAN82289.1| hypothetical protein VITISV_028339 [Vitis vinifera]
Length=352

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 38/110 (35%), Positives = 58/110 (53%), Gaps = 15/110 (14%)
 Frame = +1

Query  223  GCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGKNGVREIL  402
            GC++ CG+V I YPFGIG S  CY N+WF + C  S    + KPFL   +       E+L
Sbjct  81   GCKEXCGDVDIPYPFGIG-SASCYFNEWFEVTCNNSIHPHIPKPFLKRLN------LEVL  133

Query  403  SISNVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISN--TKLSGTPFFYS  546
            ++S  R +I +    +P+    +G A   +N ++  N   +  G PF +S
Sbjct  134  NVSLDRGTIQVN---NPVLFDCSGKA---SNFTVTPNFTVRWEGGPFSFS  177



>ref|XP_007217301.1| hypothetical protein PRUPE_ppa018696mg, partial [Prunus persica]
 gb|EMJ18500.1| hypothetical protein PRUPE_ppa018696mg, partial [Prunus persica]
Length=725

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 40/63 (63%), Gaps = 10/63 (16%)
 Frame = +1

Query  226  CRDTCG-NVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGKNGVREIL  402
            C   CG NVSI YPFGIGP+KDCY N+WF I+C +S+     KPFL      +    E+L
Sbjct  22   CMTHCGINVSIPYPFGIGPNKDCYFNEWFQIDCNESTG---HKPFL------RRAQMEVL  72

Query  403  SIS  411
            +IS
Sbjct  73   NIS  75



>ref|XP_010532062.1| PREDICTED: wall-associated receptor kinase-like 22 [Tarenaya 
hassleriana]
Length=753

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 61/120 (51%), Gaps = 11/120 (9%)
 Frame = +1

Query  181  AENYKEDGISMVPKGCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFL  360
            AE    D    +   C+  CG+++I YPFGIG  K CYLNKWF I C KS+S G+  PFL
Sbjct  30   AEEENTDQYLTISSSCQSRCGDITIPYPFGIG--KGCYLNKWFEITCNKSTSGGL-VPFL  86

Query  361  SSFSDGKNGVREILSISNVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSGTPFF  540
               +      +++++I N  +      + S      +    G  ++  + N  L+G+PFF
Sbjct  87   PGIN------KQVVNIPNYVRLASSDLTVSITSPIASSGCSGREDVGSLLN--LTGSPFF  138



>gb|KJB44159.1| hypothetical protein B456_007G238000 [Gossypium raimondii]
Length=730

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 41/120 (34%), Positives = 63/120 (53%), Gaps = 23/120 (19%)
 Frame = +1

Query  202  GISMVPKGCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDG--VEKPFLSSFS-  372
             IS     C+D+CGNVS+ YPFGIGP  DC+LN WF ++C +SS+    ++K  +  F+ 
Sbjct  29   AISGAKDWCKDSCGNVSVPYPFGIGP--DCFLNSWFEVSCNESSTPPTILKKINMEVFNF  86

Query  373  --DGKNGVREILSISNVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSGTPFFYS  546
              D   G   +     V+  +I+        H  +G    + N ++     L+G+PFFYS
Sbjct  87   SYDLGYGWEYL----RVKSPVIL--------HNCSGRERETKNQTV----HLTGSPFFYS  130



>ref|XP_010663682.1| PREDICTED: wall-associated receptor kinase-like 8 [Vitis vinifera]
Length=705

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 40/113 (35%), Positives = 55/113 (49%), Gaps = 14/113 (12%)
 Frame = +1

Query  208  SMVPKGCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGKNG  387
            SM  + C++ CG+V+I YPFGIG  KDCYLN+WF +NC  S +     P+LS        
Sbjct  24   SMAKQNCQERCGDVTIPYPFGIG--KDCYLNEWFAVNCNDSFNPPT--PYLSH----PEL  75

Query  388  VREILSISNVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSGTPFFYS  546
              ++  +S   Q + +    +  C           N S      LS TPFFYS
Sbjct  76   NLKLTFVSLAYQLVTVISPMAVYCQD------HDRNRSTWKGIDLSKTPFFYS  122



>ref|XP_006368481.1| hypothetical protein POPTR_0001s032401g, partial [Populus trichocarpa]
 gb|ERP65050.1| hypothetical protein POPTR_0001s032401g, partial [Populus trichocarpa]
Length=126

 Score = 58.9 bits (141),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 56/108 (52%), Gaps = 19/108 (18%)
 Frame = +1

Query  223  GCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGKNGVREIL  402
            GC D CG++SI YPFGI   KDCY+N+WF I C  S +    + F+S  +       E+L
Sbjct  29   GCPDRCGDISIPYPFGI--RKDCYMNEWFAIECKASVNPA--RAFISRIN------MEVL  78

Query  403  SISNVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSGTPFFYS  546
            +IS  R +  +K   SP+  +          L+      L+GTPF +S
Sbjct  79   NISAERATATVK---SPIISSNCTGREDGVPLN------LTGTPFVFS  117



>emb|CAN64181.1| hypothetical protein VITISV_007799 [Vitis vinifera]
Length=705

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 40/113 (35%), Positives = 55/113 (49%), Gaps = 14/113 (12%)
 Frame = +1

Query  208  SMVPKGCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGKNG  387
            SM  + C++ CG+V+I YPFGIG  KDCYLN+WF +NC  S +     P+LS        
Sbjct  24   SMAKQNCQERCGDVTIPYPFGIG--KDCYLNEWFAVNCNDSFNPPT--PYLSHPELN---  76

Query  388  VREILSISNVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSGTPFFYS  546
              ++  +S   Q + +    +  C           N S      LS TPFFYS
Sbjct  77   -LKLTFVSLAYQLVTVISPMAVYCQD------HDRNRSTWKGIDLSKTPFFYS  122



>emb|CDP20610.1| unnamed protein product [Coffea canephora]
Length=706

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 44/113 (39%), Positives = 65/113 (58%), Gaps = 16/113 (14%)
 Frame = +1

Query  208  SMVPKGCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGKNG  387
            S+   GC DTCGNV I YPFGIGP   C LN+ + I CT S      KP+LS+ +     
Sbjct  27   SLAKPGCSDTCGNVRIPYPFGIGPG--CSLNESYTIICTSS------KPYLSNLN-----  73

Query  388  VREILSISNVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSGTPFFYS  546
              E+L++S   +++ +  + +P C + + ++  S+  S  S+  L GTPFFYS
Sbjct  74   -LEVLNVSLRNRTVTVSTTVTPFCSSGSQTSSISSWRSNSSD--LGGTPFFYS  123



>emb|CBI15571.3| unnamed protein product [Vitis vinifera]
Length=908

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 40/113 (35%), Positives = 55/113 (49%), Gaps = 14/113 (12%)
 Frame = +1

Query  208  SMVPKGCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGKNG  387
            SM  + C++ CG+V+I YPFGIG  KDCYLN+WF +NC  S +     P+LS        
Sbjct  206  SMAKQNCQERCGDVTIPYPFGIG--KDCYLNEWFAVNCNDSFNP--PTPYLSHPELN---  258

Query  388  VREILSISNVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSGTPFFYS  546
              ++  +S   Q + +    +  C           N S      LS TPFFYS
Sbjct  259  -LKLTFVSLAYQLVTVISPMAVYCQDH------DRNRSTWKGIDLSKTPFFYS  304


 Score = 61.2 bits (147),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 31/42 (74%), Gaps = 2/42 (5%)
 Frame = +1

Query  208  SMVPKGCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSS  333
            S+   GC D CG+VSI YPFG+G  KDCYLN+WF INC  S+
Sbjct  25   SLAQPGCNDACGSVSIPYPFGVG--KDCYLNEWFSINCKHST  64



>ref|XP_002512762.1| kinase, putative [Ricinus communis]
 gb|EEF49265.1| kinase, putative [Ricinus communis]
Length=631

 Score = 62.0 bits (149),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 38/114 (33%), Positives = 56/114 (49%), Gaps = 16/114 (14%)
 Frame = +1

Query  208  SMVPKGCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGKNG  387
            S+    C D CGN+ I YPFG+G S DCY N+W+ + C K+       PFL         
Sbjct  6    SVAKPKCVDRCGNLIIPYPFGMGAS-DCYWNEWYAVGCKKTKKSHT--PFLRKVKS----  58

Query  388  VREILSISNVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSGTPFFYSS  549
              EIL IS    ++++K   SP+  +     VG     +     L G+PF++S+
Sbjct  59   --EILKISLEESTLLLK---SPVISSNCSGVVGETGEGL----NLKGSPFYFST  103



>ref|XP_006368667.1| hypothetical protein POPTR_0001s07560g [Populus trichocarpa]
 gb|ERP65236.1| hypothetical protein POPTR_0001s07560g [Populus trichocarpa]
Length=319

 Score = 60.8 bits (146),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 40/113 (35%), Positives = 61/113 (54%), Gaps = 17/113 (15%)
 Frame = +1

Query  211  MVPKGCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGKNGV  390
            M    C DTCGN+SI +PFGIG    CY+N WF ++C K+++D   + FLS  +      
Sbjct  57   MAKPNCIDTCGNISIPFPFGIGTG--CYMNDWFSVDCNKTTADSPSRAFLSRIN------  108

Query  391  REILSISNVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSGTPFFYSS  549
             E L IS   + + +    SP+   ++G A    NL+I     ++ +PF +SS
Sbjct  109  MEFLGISLEDRVVRVN---SPI--ISSGCAGRGANLAI----NMTRSPFAFSS  152



>ref|XP_011468703.1| PREDICTED: wall-associated receptor kinase-like 1 [Fragaria vesca 
subsp. vesca]
Length=136

 Score = 58.5 bits (140),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 30/50 (60%), Gaps = 0/50 (0%)
 Frame = +1

Query  178  EAENYKEDGISMVPKGCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTK  327
            +A    +  I      C+  CG+VSI YPFGIGP KDCY N W+ I+C +
Sbjct  24   DAAELSDQFIPTAKPNCQQFCGDVSIPYPFGIGPDKDCYFNNWYQIDCNE  73



>ref|XP_011034599.1| PREDICTED: wall-associated receptor kinase-like 22 [Populus euphratica]
Length=697

 Score = 61.6 bits (148),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 38/108 (35%), Positives = 60/108 (56%), Gaps = 19/108 (18%)
 Frame = +1

Query  223  GCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGKNGVREIL  402
            GC D CG++SI YPFGIG  KDCY+N+WF I C  + +    + F+S  +       E+L
Sbjct  30   GCPDRCGDISIPYPFGIG--KDCYMNEWFAIECNATVNPA--RAFISGIN------MEVL  79

Query  403  SISNVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSGTPFFYS  546
            +IS  R ++ +K   SP+   ++    G + + +      +GTPF +S
Sbjct  80   NISAERATVTVK---SPI--ISSNCTGGEDGVPL----NFTGTPFVFS  118



>ref|XP_010497736.1| PREDICTED: wall-associated receptor kinase-like 8 [Camelina sativa]
Length=736

 Score = 61.6 bits (148),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 48/117 (41%), Positives = 63/117 (54%), Gaps = 22/117 (19%)
 Frame = +1

Query  226  CRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGKNGVREILS  405
            C+D CG+VS+ YPFGIG  + CY +KWF + C+ +SSD V  PFL S        RE+LS
Sbjct  33   CKDHCGDVSVLYPFGIG--QGCYKDKWFEVVCS-NSSDQVSVPFLLSIR------REVLS  83

Query  406  IS-NVRQSIIMKESF--------SPLCHTTAGSAVGSNNLSIISNTKLSGTPFFYSS  549
                   SI  +  +        SPL HT  G + GS   S  S+  L+G+PFF S 
Sbjct  84   FDLGSYYSIDGRFHYQSNKIHILSPLKHT--GCSNGSVGDS--SSLNLTGSPFFISD  136



>ref|XP_008229610.1| PREDICTED: wall-associated receptor kinase-like 1 isoform X2 
[Prunus mume]
Length=706

 Score = 61.2 bits (147),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 37/114 (32%), Positives = 56/114 (49%), Gaps = 14/114 (12%)
 Frame = +1

Query  211  MVPKGCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEK-PFLSSFSDGKNG  387
            M   GC++ CG+V I YPFGIG +K CYL+ WF ++C+  SS      P        K  
Sbjct  29   MAKYGCQEYCGDVLIPYPFGIGSNKHCYLDDWFEMDCSNQSSKTTSSAPHYKLVL--KRA  86

Query  388  VREILSISNVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSGTPFFYSS  549
              E+L+IS +R ++ +    +  C+    S +            L+G+PF YS 
Sbjct  87   QLEVLNIS-IRGTLRVNSPVTKFCNGNGSSQMAD----------LTGSPFVYSQ  129



>ref|XP_008229721.1| PREDICTED: wall-associated receptor kinase-like 6 [Prunus mume]
Length=794

 Score = 61.2 bits (147),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 57/107 (53%), Gaps = 19/107 (18%)
 Frame = +1

Query  226  CRDTCG-NVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGKNGVREIL  402
            C   CG NVSI YPFG+GP+KDCY N+WF I+C +S+     KPFL           E+L
Sbjct  45   CTTHCGINVSIPYPFGVGPNKDCYFNEWFQIDCNESTG---HKPFLRRVQ------MEVL  95

Query  403  SISNVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSGTPFFY  543
            +IS +  ++ +K   SP+  T  G   G           L+G+PF Y
Sbjct  96   NIS-IDGTLQVK---SPV--TFFGGCKGKETHQA---PNLTGSPFVY  133



>ref|XP_008229609.1| PREDICTED: wall-associated receptor kinase-like 1 isoform X1 
[Prunus mume]
Length=745

 Score = 61.2 bits (147),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 37/114 (32%), Positives = 56/114 (49%), Gaps = 14/114 (12%)
 Frame = +1

Query  211  MVPKGCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEK-PFLSSFSDGKNG  387
            M   GC++ CG+V I YPFGIG +K CYL+ WF ++C+  SS      P        K  
Sbjct  29   MAKYGCQEYCGDVLIPYPFGIGSNKHCYLDDWFEMDCSNQSSKTTSSAPHYKLVL--KRA  86

Query  388  VREILSISNVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSGTPFFYSS  549
              E+L+IS +R ++ +    +  C+    S +            L+G+PF YS 
Sbjct  87   QLEVLNIS-IRGTLRVNSPVTKFCNGNGSSQMAD----------LTGSPFVYSQ  129



>ref|XP_006368665.1| hypothetical protein POPTR_0001s07540g [Populus trichocarpa]
 gb|ERP65234.1| hypothetical protein POPTR_0001s07540g [Populus trichocarpa]
Length=657

 Score = 61.2 bits (147),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 38/113 (34%), Positives = 63/113 (56%), Gaps = 17/113 (15%)
 Frame = +1

Query  211  MVPKGCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGKNGV  390
            M    C +TCGN+SI +PFGIG    CY+N WF ++C ++++    + FLSS +      
Sbjct  1    MARPNCAETCGNISIPFPFGIGTG--CYMNNWFSVDCNETTAGSPSRAFLSSIN------  52

Query  391  REILSISNVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSGTPFFYSS  549
             E+L IS    ++ +   +SP+   ++G A    NL+I     ++ +PF +SS
Sbjct  53   MEVLEISLEDSTVRV---YSPI--ISSGCAGRGANLAI----NMTTSPFAFSS  96



>ref|XP_010663521.1| PREDICTED: wall-associated receptor kinase-like 1 isoform X2 
[Vitis vinifera]
Length=685

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 39/113 (35%), Positives = 63/113 (56%), Gaps = 15/113 (13%)
 Frame = +1

Query  211  MVPKGCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGKNGV  390
            +V   C+  CGNV I +PFGIG S  CYLN+W+ +NC+ +S  G  KPFL+         
Sbjct  31   LVKPNCQSQCGNVVIPFPFGIGES--CYLNEWYSVNCSNTS--GAAKPFLNPTKLN----  82

Query  391  REILSISNVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSGTPFFYSS  549
             E+L++S   Q++ +   +SP+   +     GS+ L   ++  L  +PF +S+
Sbjct  83   LELLNVSLEYQTVTV---YSPI--ASYDQQKGSSELQ--TSINLDQSPFLFST  128



>ref|XP_003634276.1| PREDICTED: wall-associated receptor kinase-like 8 [Vitis vinifera]
Length=706

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 39/109 (36%), Positives = 53/109 (49%), Gaps = 14/109 (13%)
 Frame = +1

Query  223  GCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGKNGVREIL  402
            GC D CGN SI YPFG+G  KDCY N+WF I+C  SSS     P LS          E+ 
Sbjct  29   GCEDRCGNYSIPYPFGVG--KDCYYNEWFAISCNSSSS--FPTPLLSH----PRINLEVQ  80

Query  403  SISNVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSGTPFFYSS  549
             IS   Q++ ++      C     +    +++       L  TPFF+S+
Sbjct  81   QISVEYQTVSVQTPMPAYCQNQEETNRTWDSID------LKETPFFFSA  123



>ref|XP_010663520.1| PREDICTED: wall-associated receptor kinase-like 1 isoform X1 
[Vitis vinifera]
 emb|CAN76906.1| hypothetical protein VITISV_006595 [Vitis vinifera]
Length=726

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 39/113 (35%), Positives = 63/113 (56%), Gaps = 15/113 (13%)
 Frame = +1

Query  211  MVPKGCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGKNGV  390
            +V   C+  CGNV I +PFGIG S  CYLN+W+ +NC+ +S  G  KPFL+         
Sbjct  31   LVKPNCQSQCGNVVIPFPFGIGES--CYLNEWYSVNCSNTS--GAAKPFLNPTKLN----  82

Query  391  REILSISNVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSGTPFFYSS  549
             E+L++S   Q++ +   +SP+   +     GS+ L   ++  L  +PF +S+
Sbjct  83   LELLNVSLEYQTVTV---YSPI--ASYDQQKGSSELQ--TSINLDQSPFLFST  128



>ref|XP_007211126.1| hypothetical protein PRUPE_ppa025607mg [Prunus persica]
 gb|EMJ12325.1| hypothetical protein PRUPE_ppa025607mg [Prunus persica]
Length=712

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 35/52 (67%), Gaps = 5/52 (10%)
 Frame = +1

Query  226  CRDTCGNVSIYYPFGIGPSKDCYLNKWFLINC-----TKSSSDGVEKPFLSS  366
            C   CG+++I YPFGIGP KDCYL++WF I+C     T S++   + PFL S
Sbjct  40   CTTHCGDIAIPYPFGIGPHKDCYLDEWFQIDCRHDNSTTSANYSRQAPFLKS  91



>ref|XP_011077655.1| PREDICTED: wall-associated receptor kinase 5-like [Sesamum indicum]
Length=760

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 37/115 (32%), Positives = 62/115 (54%), Gaps = 14/115 (12%)
 Frame = +1

Query  202  GISMVPKGCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGK  381
            G ++    C+  CGN+++ YPFGIG +  C ++ WF +NC  S S    KPF+++     
Sbjct  32   GTTITKPNCQRKCGNLTVPYPFGIGINTGCSISSWFDVNCNTSFS--TPKPFIAT-----  84

Query  382  NGVREILSISNVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSGTPFFYS  546
             G  EIL IS+ +  +++K   +  C++ +G+    N   I     L+ TPF +S
Sbjct  85   -GNLEILDISDDK--VLIKNWVAASCYSQSGNLTRRNPAFI----NLATTPFSFS  132



>emb|CBI15394.3| unnamed protein product [Vitis vinifera]
Length=1912

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 39/109 (36%), Positives = 53/109 (49%), Gaps = 14/109 (13%)
 Frame = +1

Query  223   GCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGKNGVREIL  402
             GC D CGN SI YPFG+G  KDCY N+WF I+C  SSS     P LS          E+ 
Sbjct  1467  GCEDRCGNYSIPYPFGVG--KDCYYNEWFAISCNSSSS--FPTPLLSHPRIN----LEVQ  1518

Query  403   SISNVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSGTPFFYSS  549
              IS   Q++ ++      C     +    +++       L  TPFF+S+
Sbjct  1519  QISVEYQTVSVQTPMPAYCQNQEETNRTWDSID------LKETPFFFSA  1561


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 42/114 (37%), Positives = 60/114 (53%), Gaps = 18/114 (16%)
 Frame = +1

Query  208  SMVPKGCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGKNG  387
            S+  +GC   CG+VSI YPFGIG  KDCY N +F INC  SSS    KPFL+        
Sbjct  860  SLAKQGCVAYCGDVSIPYPFGIG--KDCYFNDYFSINCNDSSSP--PKPFLNHTELN---  912

Query  388  VREILSISNVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSGTPFFYSS  549
              E+ ++S   +++++      LC         ++N +  SN    G+PF +SS
Sbjct  913  -LELFNVSLEYKTVMVNSPIPSLC---------ADNGTWKSN-DFGGSPFRFSS  955


 Score = 58.5 bits (140),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 40/113 (35%), Positives = 57/113 (50%), Gaps = 18/113 (16%)
 Frame = +1

Query  208  SMVPKGCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGKNG  387
            S+  +GC   CG+VSI YPFGIG    CY N +F INC  SS+    KPFL+        
Sbjct  319  SLAKQGCVAHCGDVSIPYPFGIGTG--CYFNDYFSINCNDSSTP--PKPFLNHSKLN---  371

Query  388  VREILSISNVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSGTPFFYS  546
              E+L++S   +++++    +PLC        G N       T + G PF +S
Sbjct  372  -LELLNVSLEYKTVMVNSPITPLC--------GGN--GTWRTTDVGGRPFRFS  413



>ref|XP_002274962.1| PREDICTED: wall-associated receptor kinase-like 2 [Vitis vinifera]
Length=717

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 42/114 (37%), Positives = 60/114 (53%), Gaps = 18/114 (16%)
 Frame = +1

Query  208  SMVPKGCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGKNG  387
            S+  +GC   CG+VSI YPFGIG  KDCY N +F INC  SSS    KPFL+        
Sbjct  25   SLAKQGCVAYCGDVSIPYPFGIG--KDCYFNDYFSINCNDSSSP--PKPFLNHTELN---  77

Query  388  VREILSISNVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSGTPFFYSS  549
              E+ ++S   +++++      LC         ++N +  SN    G+PF +SS
Sbjct  78   -LELFNVSLEYKTVMVNSPIPSLC---------ADNGTWKSN-DFGGSPFRFSS  120



>emb|CAN65983.1| hypothetical protein VITISV_017972 [Vitis vinifera]
Length=649

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 42/114 (37%), Positives = 60/114 (53%), Gaps = 18/114 (16%)
 Frame = +1

Query  208  SMVPKGCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGKNG  387
            S+  +GC   CG+VSI YPFGIG  KDCY N +F INC  SSS    KPFL+        
Sbjct  25   SLAKQGCVAYCGDVSIPYPFGIG--KDCYFNDYFSINCNDSSSP--PKPFLNHTELN---  77

Query  388  VREILSISNVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSGTPFFYSS  549
              E+ ++S   +++++      LC         ++N +  SN    G+PF +SS
Sbjct  78   -LELFNVSLEYKTVMVNSPIPSLC---------ADNGTWKSN-DFGGSPFRFSS  120



>ref|XP_002297684.2| wall-associated kinase family protein [Populus trichocarpa]
 gb|EEE82489.2| wall-associated kinase family protein [Populus trichocarpa]
Length=711

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/113 (33%), Positives = 63/113 (56%), Gaps = 17/113 (15%)
 Frame = +1

Query  211  MVPKGCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGKNGV  390
            M    C +TCGN++I +PFGIG    CY+N WF ++C ++++D   + FLS  +      
Sbjct  27   MARPNCTETCGNITIPFPFGIGTG--CYMNDWFSVHCNETTADSPSRAFLSRIN------  78

Query  391  REILSISNVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSGTPFFYSS  549
             E+  IS +  S++     SP+   ++G +    NL+I     ++G+PF +SS
Sbjct  79   MEVFKIS-LESSVVRVN--SPI--ISSGCSGRGANLAI----NMTGSPFSFSS  122



>ref|XP_006384698.1| hypothetical protein POPTR_0004s20290g [Populus trichocarpa]
 gb|ERP62495.1| hypothetical protein POPTR_0004s20290g [Populus trichocarpa]
Length=713

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 38/110 (35%), Positives = 59/110 (54%), Gaps = 15/110 (14%)
 Frame = +1

Query  223  GCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGKNGVREIL  402
            GCRD CGNVS+ YPFGI  S  C  N++  +NC++S   G EK + ++          +L
Sbjct  33   GCRDKCGNVSVPYPFGIDESS-CAENQYLFLNCSQSDGHGPEKLWFANIP--------VL  83

Query  403  SISNVRQSIIMKESFSPL-CHTTAGSAVGSNNLSIISNTKLSGTPFFYSS  549
            SIS V + +++   F+   C+  +G+ +   NLSI     L   P+ +S 
Sbjct  84   SIS-VLEGLMVVSIFTAYDCYNQSGAKMKETNLSI----HLGQGPYMFSD  128



>ref|XP_003594614.1| Wall-associated receptor kinase-like protein [Medicago truncatula]
 gb|AES64865.1| wall associated kinase-like protein [Medicago truncatula]
Length=726

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 39/119 (33%), Positives = 60/119 (50%), Gaps = 15/119 (13%)
 Frame = +1

Query  193  KEDGISMVPKGCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFS  372
            +EDGI +  +GC  TCG +SI +PFG+   + CY +KWF I C   ++    KP+L S +
Sbjct  27   QEDGI-IAQQGCNSTCGTMSIPFPFGMKEPR-CYADKWFEIECKLDNNSQNPKPYLKSLN  84

Query  373  DGKNGVREILSISNVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSGTPFFYSS  549
                     L ++N    + + E  +P+          +NN ++I N  L G PF YS 
Sbjct  85   ---------LEVNNFYLDLGLVEIMNPIHRPNCRKY--NNNKTVIIN--LGGGPFIYSQ  130



>ref|XP_006368673.1| hypothetical protein POPTR_0001s076201g, partial [Populus trichocarpa]
 gb|ERP65242.1| hypothetical protein POPTR_0001s076201g, partial [Populus trichocarpa]
Length=678

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 38/113 (34%), Positives = 60/113 (53%), Gaps = 17/113 (15%)
 Frame = +1

Query  211  MVPKGCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGKNGV  390
            M    C +TCGN+SI +PFGIG    C +N WF ++C K+++D   + FLS  +      
Sbjct  29   MTKPNCTETCGNISIPFPFGIGTG--CSMNDWFSVDCNKTTADSPSRAFLSRIN------  80

Query  391  REILSISNVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSGTPFFYSS  549
             E+L IS     + +    SP+   ++G +    NLS      ++G+PF +SS
Sbjct  81   MEVLKISLGSSRVRVN---SPI--ISSGCSGRGANLSF----DMTGSPFVFSS  124



>ref|XP_007034139.1| Wall associated kinase-like 6, putative [Theobroma cacao]
 gb|EOY05065.1| Wall associated kinase-like 6, putative [Theobroma cacao]
Length=884

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/116 (31%), Positives = 60/116 (52%), Gaps = 17/116 (15%)
 Frame = +1

Query  196  EDGISMVPKGCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSD  375
            + G S   +GC +TCG + I YPFGI P   CY N WF + C ++ +   +KPF++  + 
Sbjct  17   QAGASQDGRGCVETCGKIIIPYPFGIKPG--CYTNTWFRVTCNETVNG--QKPFINRIN-  71

Query  376  GKNGVREILSISNVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSGTPFFY  543
                  E+L   + R +I+      P+ +   G+    +N    ++  L+GTPFF+
Sbjct  72   -----LELLGSYSTRNAIVN----GPVTYVNCGN---KDNKGAATSVNLTGTPFFF  115


 Score = 58.5 bits (140),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 40/117 (34%), Positives = 58/117 (50%), Gaps = 22/117 (19%)
 Frame = +1

Query  208  SMVPK--GCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGK  381
            S VP    C   CGNV I YPFG+  S  CY+N WF + C +++  G  KPF+S  +   
Sbjct  235  SAVPHKPNCTKKCGNVEITYPFGMEAS--CYMNDWFRVTCNETT--GGPKPFISRIN---  287

Query  382  NGVREILSISNVRQSIIMKESFSPL-CHTTAGSAVGSNNLSIISNTKLSGTPFFYSS  549
                 +LS+S    S+++  S +   C     S V  N         L+G+PFF+S+
Sbjct  288  ---LPLLSVSFFEGSVLVNNSVTYFNCRNKENSGVSVN---------LTGSPFFFSN  332



>ref|XP_004306302.2| PREDICTED: wall-associated receptor kinase-like 8 [Fragaria vesca 
subsp. vesca]
Length=432

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 38/115 (33%), Positives = 59/115 (51%), Gaps = 19/115 (17%)
 Frame = +1

Query  202  GISMVPKGCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGK  381
             + M    C+  CG V+I YPFGIGP++ CY ++WF I+C KS+     KPFL      +
Sbjct  47   ALQMAVGDCQSNCGGVTIPYPFGIGPNQSCYYDEWFRIDCNKSTKG---KPFL------R  97

Query  382  NGVREILSISNVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSGTPFFYS  546
                E+L+IS ++ ++ +    +  C          N+   +SN  L  +PF YS
Sbjct  98   LAKLEVLNIS-IKGTLRVNSPVTFFCE-------DYNSWPAVSN--LRQSPFVYS  142



>ref|XP_008229716.1| PREDICTED: wall-associated receptor kinase-like 22 [Prunus mume]
Length=643

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 35/55 (64%), Gaps = 3/55 (5%)
 Frame = +1

Query  199  DGISMVPK-GCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFL  360
            D ++ + K  C   CG+VSI YPFGIGPS +CYL  WF I C  S+S    KPFL
Sbjct  24   DQLAPIAKPNCESHCGDVSIPYPFGIGPSSNCYLYDWFEIECDNSTSP--PKPFL  76



>ref|XP_011011594.1| PREDICTED: wall-associated receptor kinase-like 2 isoform X2 
[Populus euphratica]
 ref|XP_011011595.1| PREDICTED: wall-associated receptor kinase-like 2 isoform X3 
[Populus euphratica]
Length=739

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 38/113 (34%), Positives = 60/113 (53%), Gaps = 17/113 (15%)
 Frame = +1

Query  211  MVPKGCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGKNGV  390
            M    C +TCGN+SI +PFGIG    C +N WF ++C K+++D   + FLS  +      
Sbjct  26   MTKPNCPETCGNISIPFPFGIGTG--CSMNDWFSVDCNKTTADSPSRAFLSRIN------  77

Query  391  REILSISNVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSGTPFFYSS  549
             E+L IS     + +    SP+   ++G +    NL+      +SG+PF +SS
Sbjct  78   MEVLGISLGNSRVRVN---SPI--ISSGCSGRGANLAF----DMSGSPFIFSS  121



>ref|XP_009597018.1| PREDICTED: wall-associated receptor kinase 2-like [Nicotiana 
tomentosiformis]
Length=762

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 40/115 (35%), Positives = 60/115 (52%), Gaps = 15/115 (13%)
 Frame = +1

Query  202  GISMVPKGCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGK  381
            GI++  +GCR  CGNV++ YPFGIG    C +N  F I C   SSDG +KP +       
Sbjct  42   GINITKRGCRKQCGNVTVPYPFGIGKGSGCAINAGFEIKCN-ISSDGSQKPLI-------  93

Query  382  NGVREILSISNVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSGTPFFYS  546
             G  E+ +IS+    + +  S +  C+ + G AV +  L  I   +L  + + YS
Sbjct  94   -GTLEVYNISDT--EVRISNSIAWRCYNSNG-AVRNEYLDYI---RLGNSTYPYS  141



>ref|XP_011011593.1| PREDICTED: wall-associated receptor kinase-like 2 isoform X1 
[Populus euphratica]
Length=739

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 38/113 (34%), Positives = 60/113 (53%), Gaps = 17/113 (15%)
 Frame = +1

Query  211  MVPKGCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGKNGV  390
            M    C +TCGN+SI +PFGIG    C +N WF ++C K+++D   + FLS  +      
Sbjct  26   MTKPNCPETCGNISIPFPFGIGTG--CSMNDWFSVDCNKTTADSPSRAFLSRIN------  77

Query  391  REILSISNVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSGTPFFYSS  549
             E+L IS     + +    SP+   ++G +    NL+      +SG+PF +SS
Sbjct  78   MEVLGISLGNSRVRVN---SPI--ISSGCSGRGANLAF----DMSGSPFIFSS  121



>ref|XP_007216825.1| hypothetical protein PRUPE_ppa022857mg, partial [Prunus persica]
 gb|EMJ18024.1| hypothetical protein PRUPE_ppa022857mg, partial [Prunus persica]
Length=692

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 38/108 (35%), Positives = 56/108 (52%), Gaps = 19/108 (18%)
 Frame = +1

Query  226  CRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGKNGVREILS  405
            C   CG+VSI YPFGIGPS  CY+  WF I+C  S+S    KPFL      +    E+L+
Sbjct  17   CETHCGDVSIPYPFGIGPSSSCYMYDWFEIHCDNSTSP--HKPFL------RVAKLEVLN  68

Query  406  ISNVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSGTPFFYSS  549
            IS +  ++++K   +   +    + +  N         L+G+PF YS 
Sbjct  69   IS-IEGTLLVKNPVTFFFYRRK-TPLAPN---------LTGSPFLYSQ  105



>emb|CDP20609.1| unnamed protein product [Coffea canephora]
Length=709

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 59/108 (55%), Gaps = 15/108 (14%)
 Frame = +1

Query  223  GCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGKNGVREIL  402
            GC DTCG+V I YPFGIGP   C LN+ + I C  S      KP+LSS +       E+L
Sbjct  39   GCSDTCGSVRIPYPFGIGPG--CSLNESYTIICASS------KPYLSSLN------LEVL  84

Query  403  SISNVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSGTPFFYS  546
             +S +R   +   +       ++G+  G+ +    +++ L+GTPFFYS
Sbjct  85   KVS-LRNLTVTVNTPITASSCSSGAQTGAISSWRSNSSDLAGTPFFYS  131



>ref|XP_010655831.1| PREDICTED: wall-associated receptor kinase 5-like [Vitis vinifera]
Length=665

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 46/118 (39%), Positives = 60/118 (51%), Gaps = 14/118 (12%)
 Frame = +1

Query  193  KEDGISMVPKGCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFS  372
            KE   SM   GC +TCGNVSI YPFGIG  K CYL+K F I C  SS   +  P    F 
Sbjct  25   KETAASMAKPGCPETCGNVSIVYPFGIG--KGCYLDKRFEITCNNSS---LPHPL---FH  76

Query  373  DGKNGVREILSISNVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSGTPFFYS  546
              +    E+L +S   + + +K+  SP+C+    S   S  L  I+  +    PF YS
Sbjct  77   VDEENEAEVLYMS--LEYMRIKDWTSPVCYANYTSEGQSYALFSIAPME----PFSYS  128



>ref|NP_173076.1| wall-associated receptor kinase-like 8 [Arabidopsis thaliana]
 ref|NP_001185009.1| wall-associated receptor kinase-like 8 [Arabidopsis thaliana]
 sp|Q9SA25.1|WAKLG_ARATH RecName: Full=Wall-associated receptor kinase-like 8; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAD34678.1|AC006341_6 Similar to gb|AJ012423 wall-associated kinase 2 from Arabidopsis 
thaliana [Arabidopsis thaliana]
 dbj|BAF01658.1| putative wall-associated kinase [Arabidopsis thaliana]
 gb|AEE29427.1| wall-associated receptor kinase-like 8 [Arabidopsis thaliana]
 gb|AEE29428.1| wall-associated receptor kinase-like 8 [Arabidopsis thaliana]
Length=720

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 48/118 (41%), Positives = 62/118 (53%), Gaps = 27/118 (23%)
 Frame = +1

Query  220  KGCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFL---------SSFS  372
            + C D CGNVS+ YPFGIG  K CY NKWF I C KSSSD  ++P L         +SF+
Sbjct  31   RNCSDHCGNVSVPYPFGIG--KGCYKNKWFEIVC-KSSSD--QQPILLLPRIRRAVTSFN  85

Query  373  DGKNGVREILSISNVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSGTPFFYS  546
             G     +  SIS   +  I     SPL H+   +  G ++ S+     L G+PFF S
Sbjct  86   LG-----DPFSISVYNKFYIQ----SPLKHSGCPNRDGYSSSSL----NLKGSPFFIS  130



>ref|XP_008229719.1| PREDICTED: wall-associated receptor kinase-like 1 [Prunus mume]
Length=677

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 38/108 (35%), Positives = 52/108 (48%), Gaps = 19/108 (18%)
 Frame = +1

Query  226  CRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGKNGVREILS  405
            C   CG+VSI YPFGIGPS  CY+  WF I+C  S+S    KPFL      +    E+L+
Sbjct  27   CETHCGDVSIPYPFGIGPSSSCYMYDWFEIHCDNSTSP--HKPFL------RAAKLEVLN  78

Query  406  ISNVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSGTPFFYSS  549
            IS +  ++++K   +             N         L G+PF YS 
Sbjct  79   IS-IEGTLLVKNPVTFF----------FNGRKTPQAPNLMGSPFLYSQ  115



>ref|XP_008380153.1| PREDICTED: wall-associated receptor kinase-like 1 [Malus domestica]
Length=764

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 38/107 (36%), Positives = 53/107 (50%), Gaps = 19/107 (18%)
 Frame = +1

Query  226  CRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGKNGVREILS  405
            C   CG VSI YPFGIGP++DCY ++ F I+C K++      P L   S       E+L+
Sbjct  54   CSRDCGGVSIPYPFGIGPNRDCYFDEGFEISCNKTTG---YAPVLRQTS------LEVLN  104

Query  406  ISNVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSGTPFFYS  546
            IS    +I +K   +  C   +G    +          L+GTPF YS
Sbjct  105  ISIADGTIQVKNPVAFFCGGKSGRQPAN----------LTGTPFVYS  141



>ref|XP_006387117.1| hypothetical protein POPTR_1809s00200g [Populus trichocarpa]
 gb|ERP46031.1| hypothetical protein POPTR_1809s00200g [Populus trichocarpa]
Length=739

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 37/108 (34%), Positives = 59/108 (55%), Gaps = 17/108 (16%)
 Frame = +1

Query  226  CRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGKNGVREILS  405
            C DTCGN+SI +PFGIG    C +N WF ++C K+++D   + FLS  +       E+L 
Sbjct  32   CADTCGNISIPFPFGIGTG--CSMNDWFSVDCNKTTADSPSRAFLSRIN------MEVLK  83

Query  406  ISNVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSGTPFFYSS  549
            IS     + +    SP+   ++G +    NL+      ++G+PF +SS
Sbjct  84   ISLGNSRVRVN---SPI--ISSGCSGRGANLAF----NMTGSPFVFSS  122



>emb|CDY22288.1| BnaC02g25920D [Brassica napus]
Length=703

 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 35/106 (33%), Positives = 55/106 (52%), Gaps = 9/106 (8%)
 Frame = +1

Query  226  CRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGKNGVREILS  405
            C   CG +SI +PFGIGP K CYLN W+ + C  +++  +  PFLS  +      RE++S
Sbjct  31   CNRFCGGISIPFPFGIGP-KHCYLNDWYEVVCNTNTTSSLSTPFLSKIN------RELMS  83

Query  406  ISNVRQSIIMKESFSPLCHTTAGSAVGSNNLSIIS-NTKLSGTPFF  540
            I+ +R++I   +    +  T   S     +   +  N    G+PFF
Sbjct  84   IT-LRKTIDSTQGVFHIKSTVTSSGCSQRDEKPLPLNLTGKGSPFF  128



>ref|XP_011077656.1| PREDICTED: wall-associated receptor kinase 2-like [Sesamum indicum]
Length=759

 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 37/115 (32%), Positives = 57/115 (50%), Gaps = 14/115 (12%)
 Frame = +1

Query  202  GISMVPKGCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGK  381
            G S+    C+  CGN+++ YPFGIG    C L  WF +NC  S +    +PF+ +     
Sbjct  29   GTSITRPNCQSKCGNLTVPYPFGIGLGTGCSLGSWFDVNCNTSFTP--PRPFIGT-----  81

Query  382  NGVREILSISNVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSGTPFFYS  546
             G  EIL IS    ++ +K   +  C+   G+    N +S+     L+ TPF +S
Sbjct  82   -GNLEILDIS--ANTLKIKNWVASRCYNQFGNITQDNKVSV----DLATTPFTFS  129



>ref|XP_007216176.1| hypothetical protein PRUPE_ppa015763mg, partial [Prunus persica]
 gb|EMJ17375.1| hypothetical protein PRUPE_ppa015763mg, partial [Prunus persica]
Length=664

 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 57/107 (53%), Gaps = 18/107 (17%)
 Frame = +1

Query  226  CRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGKNGVREILS  405
            C   CG+VSI YPFGIGPS +CYL  WF I C  S+S    KPFL      +    E+L+
Sbjct  18   CETHCGDVSIPYPFGIGPSSNCYLYDWFEIECDNSTSP--PKPFL------RLAKLEVLN  69

Query  406  ISNVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSGTPFFYS  546
            IS +  ++ +    +P+     G  +      ++ N  L+G+PF YS
Sbjct  70   IS-IYGTLRVN---NPVTFFYGGRGI----RKVLQN--LTGSPFVYS  106



>ref|XP_010674686.1| PREDICTED: putative wall-associated receptor kinase-like 11 [Beta 
vulgaris subsp. vulgaris]
Length=720

 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 38/107 (36%), Positives = 52/107 (49%), Gaps = 19/107 (18%)
 Frame = +1

Query  226  CRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGKNGVREILS  405
            C D CG+VSI YPFGIGPS  CY +K+F I C  S     +KPFL   +       E+  
Sbjct  41   CEDQCGDVSIPYPFGIGPS--CYHDKFFEIICNASFHH--KKPFLHHLN------LEVTY  90

Query  406  ISNVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSGTPFFYS  546
            I    + + +   F  +C          NN   +SN  L G+P+ +S
Sbjct  91   IDLGSERVSVTTQFQNICR---------NNTPFVSNINLQGSPYSFS  128



>ref|XP_011011597.1| PREDICTED: wall-associated receptor kinase-like 22 [Populus euphratica]
Length=738

 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 37/113 (33%), Positives = 61/113 (54%), Gaps = 17/113 (15%)
 Frame = +1

Query  211  MVPKGCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGKNGV  390
            M    C +TCGN+SI +PFGIG    C +N WF ++C K+++D   + FLS  +      
Sbjct  26   MAKPNCAETCGNISIPFPFGIGTG--CSMNDWFSVDCNKTTADSSSRAFLSRIN------  77

Query  391  REILSISNVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSGTPFFYSS  549
             E+L I    + + +    SP+   ++G +    NL+I     ++G+PF +SS
Sbjct  78   MEVLKIPLGERWVRVN---SPI--ISSGCSGRGANLAI----NMTGSPFAFSS  121



>emb|CAN65982.1| hypothetical protein VITISV_017971 [Vitis vinifera]
Length=671

 Score = 58.9 bits (141),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 40/113 (35%), Positives = 57/113 (50%), Gaps = 18/113 (16%)
 Frame = +1

Query  208  SMVPKGCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGKNG  387
            S+  +GC   CG+VSI YPFGIG    CY N +F INC  SS+    KPFL+        
Sbjct  24   SLAKQGCVAHCGDVSIPYPFGIGTG--CYFNDYFSINCNDSSTP--PKPFLNHTKLN---  76

Query  388  VREILSISNVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSGTPFFYS  546
              E+L++S   +++++    +PLC        G N       T + G PF +S
Sbjct  77   -LELLNVSLEYKTVMVNSPITPLC--------GGN--GTWRTTDVGGRPFRFS  118



>emb|CDP06459.1| unnamed protein product [Coffea canephora]
Length=761

 Score = 58.9 bits (141),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 39/116 (34%), Positives = 60/116 (52%), Gaps = 21/116 (18%)
 Frame = +1

Query  205  ISMVPKGCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGKN  384
            I+ +P GC+  CGN+++ YPFG+GP   C +  WF I C  S +    KPF+        
Sbjct  46   ITKLP-GCQRQCGNLTVPYPFGVGPGSGCAIGTWFEITCNTSFNP--PKPFI--------  94

Query  385  GVREILSISN--VRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSGTPFFYS  546
            G  EI  IS+  +R S +M +     C++ +G+ V  N     + T L  TP+ +S
Sbjct  95   GQLEIYDISDSQIRISNVMAKK----CYSQSGALVQDNT----AWTNLGSTPYSFS  142



>ref|XP_011077536.1| PREDICTED: wall-associated receptor kinase 2-like [Sesamum indicum]
Length=765

 Score = 58.5 bits (140),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 57/108 (53%), Gaps = 14/108 (13%)
 Frame = +1

Query  223  GCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGKNGVREIL  402
            GC+  CGN+++ YPFGIG +  C +  WF + C  SSS    KPF+++      G  EI+
Sbjct  52   GCQTKCGNLTVPYPFGIGLNSGCSIGPWFDVKCDNSSSP--PKPFIAT------GNLEIV  103

Query  403  SISNVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSGTPFFYS  546
             IS+    + +K   +  C+T  G+    N ++I      + TP+ +S
Sbjct  104  DISD--DQVRIKNWVAARCYTETGNITRQNIIAI----NFTSTPYSFS  145



>ref|XP_002297686.2| putative wall-associated kinase family protein [Populus trichocarpa]
 gb|EEE82491.2| putative wall-associated kinase family protein [Populus trichocarpa]
Length=686

 Score = 58.5 bits (140),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 56/108 (52%), Gaps = 19/108 (18%)
 Frame = +1

Query  223  GCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGKNGVREIL  402
            GC D CG++SI YPFGI   KDCY+N+WF I C  S +    + F+S  +       E+L
Sbjct  26   GCPDRCGDISIPYPFGI--RKDCYMNEWFAIECKASVNPA--RAFISRIN------MEVL  75

Query  403  SISNVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSGTPFFYS  546
            +IS  R +  +K   SP+  +          L+      L+GTPF +S
Sbjct  76   NISAERATATVK---SPIISSNCTGREDGVPLN------LTGTPFVFS  114



>ref|XP_011013613.1| PREDICTED: wall-associated receptor kinase-like 22 isoform X1 
[Populus euphratica]
 ref|XP_011013614.1| PREDICTED: wall-associated receptor kinase-like 22 isoform X2 
[Populus euphratica]
Length=739

 Score = 58.5 bits (140),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 37/113 (33%), Positives = 60/113 (53%), Gaps = 17/113 (15%)
 Frame = +1

Query  211  MVPKGCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGKNGV  390
            M    C +TCGN+SI +PFGIG    C +N WF ++C K+++D   + FLS  +      
Sbjct  26   MTKPNCPETCGNISIPFPFGIGTG--CSMNDWFSVDCNKTTADSPSRAFLSRIN------  77

Query  391  REILSISNVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSGTPFFYSS  549
             E+L IS     + +    SP+   ++G +    NL+      ++G+PF +SS
Sbjct  78   MEVLGISLGNSRVRVN---SPI--ISSGCSGRGANLAF----DMTGSPFIFSS  121



>ref|XP_010663523.1| PREDICTED: wall-associated receptor kinase-like 2 [Vitis vinifera]
Length=708

 Score = 58.5 bits (140),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 40/113 (35%), Positives = 57/113 (50%), Gaps = 18/113 (16%)
 Frame = +1

Query  208  SMVPKGCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGKNG  387
            S+  +GC   CG+VSI YPFGIG    CY N +F INC  SS+    KPFL+        
Sbjct  24   SLAKQGCVAHCGDVSIPYPFGIGTG--CYFNDYFSINCNDSSTP--PKPFLNHSKLN---  76

Query  388  VREILSISNVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSGTPFFYS  546
              E+L++S   +++++    +PLC        G N       T + G PF +S
Sbjct  77   -LELLNVSLEYKTVMVNSPITPLC--------GGN--GTWRTTDVGGRPFRFS  118



>ref|XP_011034598.1| PREDICTED: wall-associated receptor kinase-like 22 [Populus euphratica]
Length=739

 Score = 58.5 bits (140),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 37/113 (33%), Positives = 60/113 (53%), Gaps = 17/113 (15%)
 Frame = +1

Query  211  MVPKGCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGKNGV  390
            M    C +TCGN+SI +PFGIG    C +N WF ++C K+++D   + FLS  +      
Sbjct  26   MTKPNCTETCGNISIPFPFGIGTG--CSMNDWFSVDCNKTTADSPSRAFLSRIN------  77

Query  391  REILSISNVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSGTPFFYSS  549
             E+L IS     + +    SP+   ++G +    NL+      ++G+PF +SS
Sbjct  78   MEVLGISLGSSRVRVN---SPI--ISSGCSGRGANLAF----DMTGSPFVFSS  121



>ref|XP_011013615.1| PREDICTED: wall-associated receptor kinase-like 22 isoform X3 
[Populus euphratica]
Length=728

 Score = 58.5 bits (140),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 37/113 (33%), Positives = 60/113 (53%), Gaps = 17/113 (15%)
 Frame = +1

Query  211  MVPKGCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGKNGV  390
            M    C +TCGN+SI +PFGIG    C +N WF ++C K+++D   + FLS  +      
Sbjct  26   MTKPNCPETCGNISIPFPFGIGTG--CSMNDWFSVDCNKTTADSPSRAFLSRIN------  77

Query  391  REILSISNVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSGTPFFYSS  549
             E+L IS     + +    SP+   ++G +    NL+      ++G+PF +SS
Sbjct  78   MEVLGISLGNSRVRVN---SPI--ISSGCSGRGANLAF----DMTGSPFIFSS  121



>gb|KJB28012.1| hypothetical protein B456_005G021600 [Gossypium raimondii]
Length=892

 Score = 58.5 bits (140),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 39/107 (36%), Positives = 61/107 (57%), Gaps = 16/107 (15%)
 Frame = +1

Query  226  CRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGKNGVREILS  405
            C + CGNV I +PFGI     CY ++WF + C K ++DG EKPF+SS +       ++L+
Sbjct  249  CNERCGNVDIPFPFGIKVG--CYKSEWFRVTCNK-TADG-EKPFISSIN------MQLLN  298

Query  406  ISNVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSGTPFFYS  546
            IS    ++++K S   +     G  + +N  S+     L+GTPFF+S
Sbjct  299  ISFYEGTVLVKNSV--IYSYCPGKDLENNEGSV----NLTGTPFFFS  339


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 37/112 (33%), Positives = 57/112 (51%), Gaps = 20/112 (18%)
 Frame = +1

Query  223  GCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGKNGVREIL  402
            GC++TC NVSI YPFGI   + CY N WF + C K+ +    KPF+S  +       E+L
Sbjct  29   GCKETCENVSIPYPFGI--KRGCYHNSWFRVTCNKTING--TKPFISRIN------MELL  78

Query  403  ----SISNVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSGTPFFYS  546
                 + + R ++      +P+ +       G+N  +  S+  L G+PFF S
Sbjct  79   PSYWPVEDNRVTV-----NNPVTYLNCDDK-GNNGNTSSSSVNLQGSPFFLS  124



>ref|XP_007216693.1| hypothetical protein PRUPE_ppa026738mg, partial [Prunus persica]
 gb|EMJ17892.1| hypothetical protein PRUPE_ppa026738mg, partial [Prunus persica]
Length=767

 Score = 58.2 bits (139),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 39/111 (35%), Positives = 53/111 (48%), Gaps = 21/111 (19%)
 Frame = +1

Query  226  CRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSS---DGVEKPFLSSFSDGKNGVRE  396
            C++ CG V I YPFGIG  KDCYL+ WF I C+  SS       KP L      K    E
Sbjct  15   CKEKCGGVLIPYPFGIG-HKDCYLDDWFEIECSNQSSKTTSSAHKPVL------KRAQLE  67

Query  397  ILSISNVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSGTPFFYSS  549
            +LSIS +  ++ +    +  C+    S + +          L G+PF YS 
Sbjct  68   VLSIS-IEGTLRVNSPVTFFCNGNGSSEMAN----------LMGSPFVYSQ  107



>ref|XP_007216118.1| hypothetical protein PRUPE_ppa018817mg, partial [Prunus persica]
 gb|EMJ17317.1| hypothetical protein PRUPE_ppa018817mg, partial [Prunus persica]
Length=712

 Score = 58.2 bits (139),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 42/112 (38%), Positives = 58/112 (52%), Gaps = 21/112 (19%)
 Frame = +1

Query  223  GCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGKNGVREIL  402
            GC++ CG V I YPFGIG + DCYL+ WF I C+  SS    KPFL      K    E+L
Sbjct  41   GCKEKCGGVLIPYPFGIGGT-DCYLDDWFEIECSNQSS----KPFL------KRAQLEVL  89

Query  403  SIS---NVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSGTPFFYSS  549
            +IS    +   +   E  SP+     G+  GS+ ++      L+ +PF YS 
Sbjct  90   NISIGGTLEAMLGTLEVNSPVTFFCNGN--GSSKMA-----NLTDSPFVYSQ  134



>ref|XP_009798996.1| PREDICTED: wall-associated receptor kinase 2-like [Nicotiana 
sylvestris]
Length=794

 Score = 58.2 bits (139),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 57/108 (53%), Gaps = 14/108 (13%)
 Frame = +1

Query  223  GCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGKNGVREIL  402
            GCR  CGN+++ YPFGIG    C +N  F INC+ +S+DG +KP + +         E+ 
Sbjct  82   GCRKQCGNLTVPYPFGIGIGSGCAINSGFQINCS-TSTDGSQKPLIGNL--------EVY  132

Query  403  SISNVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSGTPFFYS  546
            +IS+    + +  + S  C+T+ G+      L     T+L  + + YS
Sbjct  133  NISD--SELRVSNAISWRCYTSTGAVRAEFQLGW---TRLGNSTYPYS  175



>ref|XP_006416845.1| hypothetical protein EUTSA_v10006943mg [Eutrema salsugineum]
 gb|ESQ35198.1| hypothetical protein EUTSA_v10006943mg [Eutrema salsugineum]
Length=715

 Score = 58.2 bits (139),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 40/67 (60%), Gaps = 9/67 (13%)
 Frame = +1

Query  217  PKGCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSS--SDGVEKPFLSSFSDGKNGV  390
            P  C  TCG +SI +PFGIG  KDCYLN W+ + C  S+  S G   PFLS  +      
Sbjct  36   PSSCNKTCGGISIPFPFGIG-GKDCYLNGWYEVVCNTSTSGSSGKTVPFLSRIN------  88

Query  391  REILSIS  411
            RE+++IS
Sbjct  89   REVVNIS  95



>ref|XP_006368675.1| hypothetical protein POPTR_0001s07640g, partial [Populus trichocarpa]
 gb|ERP65244.1| hypothetical protein POPTR_0001s07640g, partial [Populus trichocarpa]
Length=314

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 56/108 (52%), Gaps = 19/108 (18%)
 Frame = +1

Query  223  GCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGKNGVREIL  402
            GC D CG++SI YPFGI   KDCY+N+WF I C  S +    + F+S  +       E+L
Sbjct  27   GCPDRCGDISIPYPFGI--RKDCYMNEWFAIECNASVNPA--RAFISRIN------MEVL  76

Query  403  SISNVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSGTPFFYS  546
            +IS  R +  +K   SP+  +          L+      L+GTPF +S
Sbjct  77   NISAERATATVK---SPIISSNCTGREDGVPLN------LTGTPFVFS  115



>ref|XP_009771761.1| PREDICTED: wall-associated receptor kinase 2-like [Nicotiana 
sylvestris]
Length=791

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 35/115 (30%), Positives = 57/115 (50%), Gaps = 15/115 (13%)
 Frame = +1

Query  202  GISMVPKGCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGK  381
            G+++  +GCR  CGNV++ YPFGIG    C +N  F I C   S DG +KP +       
Sbjct  76   GVNVTKRGCRKQCGNVTVPYPFGIGEGSGCAINAGFEIKCN-ISRDGSQKPLI-------  127

Query  382  NGVREILSISNVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSGTPFFYS  546
             G  E+ +IS+    + +  S +  C+ + G+         +  T+L  + + YS
Sbjct  128  -GTLEVYNISDA--EVRISNSIAWRCYNSNGAVRN----EYLDYTRLGNSTYPYS  175



>ref|XP_002264787.2| PREDICTED: wall-associated receptor kinase 2-like [Vitis vinifera]
Length=761

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 50/89 (56%), Gaps = 10/89 (11%)
 Frame = +1

Query  196  EDGISMVPKGCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSD  375
            E   SM   GC +TCGNVSI YPFGIG  K CYL+K F I C+ SS   +  P    F  
Sbjct  26   ETSASMAKPGCPETCGNVSIVYPFGIG--KGCYLDKRFEITCSNSS---LPHPI---FQL  77

Query  376  GKNGVREILSISNVRQSIIMKESFSPLCH  462
             +    E+L IS   + + +++  SP+C+
Sbjct  78   DEENEAEVLLIS--LEYMRIRDWTSPICY  104



>ref|XP_002892899.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69158.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
Length=735

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 43/118 (36%), Positives = 58/118 (49%), Gaps = 24/118 (20%)
 Frame = +1

Query  226  CRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGKNGVREILS  405
            C+D CG+VS+ YPFGIG  + CY +KWF I C  +SS+ +  PFL S        RE++S
Sbjct  33   CKDHCGDVSVLYPFGIG--QGCYKDKWFEIVCI-NSSEQISVPFLLSIR------REVIS  83

Query  406  ISNVRQSIIMKES---------FSPLCHT-TAGSAVGSNNLSIISNTKLSGTPFFYSS  549
                    I   S           PL HT  +  +VG +     S+  L G+PFF S 
Sbjct  84   FDLGSYYSIDDRSHYQSNKIHILGPLKHTGCSNGSVGDS-----SSLNLKGSPFFISD  136



>ref|NP_173067.1| wall-associated receptor kinase-like 5 [Arabidopsis thaliana]
 gb|AAF18511.1|AC010924_24 Contains similarity to gb|AJ009695 wall-associated kinase 4 from 
Arabidopsis thaliana and contains a protein kinase PF|00069 
domain [Arabidopsis thaliana]
 gb|AEE29414.1| wall-associated receptor kinase-like 5 [Arabidopsis thaliana]
Length=711

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 39/64 (61%), Gaps = 9/64 (14%)
 Frame = +1

Query  226  CRDTCGNVSIYYPFGIGPSKDCYLNKWFLINC--TKSSSDGVEKPFLSSFSDGKNGVREI  399
            C  TCG +SI +PFGIG  KDCYLN W+ + C  T S S G   PFLS  +      RE+
Sbjct  22   CNRTCGGISIPFPFGIG-GKDCYLNGWYEVVCNATTSGSSGTTVPFLSRIN------REV  74

Query  400  LSIS  411
            ++IS
Sbjct  75   VNIS  78



>sp|Q9S9M1.2|WAKLE_ARATH RecName: Full=Wall-associated receptor kinase-like 5; Flags: 
Precursor [Arabidopsis thaliana]
Length=731

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 39/64 (61%), Gaps = 9/64 (14%)
 Frame = +1

Query  226  CRDTCGNVSIYYPFGIGPSKDCYLNKWFLINC--TKSSSDGVEKPFLSSFSDGKNGVREI  399
            C  TCG +SI +PFGIG  KDCYLN W+ + C  T S S G   PFLS  +      RE+
Sbjct  42   CNRTCGGISIPFPFGIG-GKDCYLNGWYEVVCNATTSGSSGTTVPFLSRIN------REV  94

Query  400  LSIS  411
            ++IS
Sbjct  95   VNIS  98



>ref|XP_010432907.1| PREDICTED: wall-associated receptor kinase-like 18 [Camelina 
sativa]
Length=799

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 41/123 (33%), Positives = 59/123 (48%), Gaps = 25/123 (20%)
 Frame = +1

Query  226  CRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGKNGVREILS  405
            C+  CG VSI YPFGIG  K CYL K++ I C ++++     PFLS+        +E++S
Sbjct  34   CQSECGRVSIRYPFGIG--KGCYLEKYYEIECRRNTTSRKPVPFLSAIG------KEVVS  85

Query  406  IS---------------NVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSGTPFF  540
            IS               ++ QS  +     P+  T+ G     N+ S  S    +GTPFF
Sbjct  86   ISPPSEERYFSFVSSDEDLHQSFGLVRVKFPI--TSTGCFSDGNDESGGSTMNFTGTPFF  143

Query  541  YSS  549
              S
Sbjct  144  IDS  146



>ref|XP_002890151.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH66410.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=682

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 39/64 (61%), Gaps = 9/64 (14%)
 Frame = +1

Query  226  CRDTCGNVSIYYPFGIGPSKDCYLNKWFLINC--TKSSSDGVEKPFLSSFSDGKNGVREI  399
            C  TCG +SI +PFGIG  KDCYLN W+ + C  T S S G   PFLS  +      RE+
Sbjct  39   CNRTCGGISIPFPFGIG-GKDCYLNGWYEVVCNPTTSGSSGTTVPFLSRIN------REV  91

Query  400  LSIS  411
            ++IS
Sbjct  92   VNIS  95



>gb|KFK28619.1| hypothetical protein AALP_AA7G023000 [Arabis alpina]
Length=708

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 38/69 (55%), Gaps = 7/69 (10%)
 Frame = +1

Query  205  ISMVPKGCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGKN  384
            IS     C  TCG VSI YPFGIG  KDCYLN W+ + C   S      PFLS  +    
Sbjct  35   ISNSSTSCNITCGGVSIPYPFGIG-GKDCYLNSWYEVVCKSPSGSDRNVPFLSRIN----  89

Query  385  GVREILSIS  411
              +E+L+IS
Sbjct  90   --KEVLNIS  96



>emb|CBI31033.3| unnamed protein product [Vitis vinifera]
Length=702

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 31/47 (66%), Gaps = 2/47 (4%)
 Frame = +1

Query  193  KEDGISMVPKGCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSS  333
            KE   SM   GC +TCGNVSI YPFGIG  K CYL+K F I C  SS
Sbjct  44   KETAASMAKPGCPETCGNVSIVYPFGIG--KGCYLDKRFEITCNNSS  88



>ref|XP_011013612.1| PREDICTED: wall-associated receptor kinase-like 22 [Populus euphratica]
Length=738

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/113 (32%), Positives = 60/113 (53%), Gaps = 17/113 (15%)
 Frame = +1

Query  211  MVPKGCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGKNGV  390
            M    C +TCGN+SI +PFGIG    C +N WF ++C K+++D   + FL   +      
Sbjct  26   MAKPNCAETCGNISIPFPFGIGTG--CSMNDWFSVDCNKTTADSSSRAFLRRIN------  77

Query  391  REILSISNVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSGTPFFYSS  549
             E+L I    + + +    SP+   ++G +    NL+I     ++G+PF +SS
Sbjct  78   MEVLGIPLGERWVRVN---SPI--ISSGCSGRGANLAI----NMTGSPFAFSS  121



>ref|XP_011034597.1| PREDICTED: wall-associated receptor kinase-like 22 [Populus euphratica]
Length=738

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/113 (32%), Positives = 60/113 (53%), Gaps = 17/113 (15%)
 Frame = +1

Query  211  MVPKGCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGKNGV  390
            M    C +TCGN+SI +PFGIG    C +N WF ++C K+++D   + FL   +      
Sbjct  26   MAKPNCAETCGNISIPFPFGIGTG--CSMNDWFSVDCNKTTADSSSRAFLRRIN------  77

Query  391  REILSISNVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSGTPFFYSS  549
             E+L I    + + +    SP+   ++G +    NL+I     ++G+PF +SS
Sbjct  78   MEVLGIPLGERWVRVN---SPI--ISSGCSGRGANLAI----NMTGSPFAFSS  121



>ref|XP_010648088.1| PREDICTED: wall-associated receptor kinase-like 1 [Vitis vinifera]
Length=771

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 40/69 (58%), Gaps = 7/69 (10%)
 Frame = +1

Query  223  GCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGKNGVREIL  402
            GC +TCG+V I YPFGIG S  CY ++WF + C  S    + KPFL   +       E+L
Sbjct  61   GCLETCGDVDIPYPFGIG-SAGCYFDEWFEVTCNNSIHPHIPKPFLKILN------LEVL  113

Query  403  SISNVRQSI  429
            ++S  R +I
Sbjct  114  NVSLNRSTI  122



>ref|XP_004306300.2| PREDICTED: wall-associated receptor kinase-like 22, partial [Fragaria 
vesca subsp. vesca]
Length=639

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 37/58 (64%), Gaps = 6/58 (10%)
 Frame = +1

Query  238  CGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGKNGVREILSIS  411
            CG+VSI YPFGIGP+ +CYL +W+ I C  ++S    KPFL       N   E+L+IS
Sbjct  5    CGDVSIPYPFGIGPNSECYLEEWYEIECNNATSP--HKPFLKH----TNPRLEVLNIS  56



>gb|KJB28017.1| hypothetical protein B456_005G022000 [Gossypium raimondii]
Length=976

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 38/107 (36%), Positives = 59/107 (55%), Gaps = 16/107 (15%)
 Frame = +1

Query  226  CRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGKNGVREILS  405
            C + CGNV I +PFGI     CY +KWF + C K ++DG EKPF+SS +       ++L+
Sbjct  257  CNERCGNVDIPFPFGI--KAGCYKSKWFRVTCNK-TADG-EKPFISSIN------MQLLN  306

Query  406  ISNVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSGTPFFYS  546
            +S    ++++  S   +     G    +N  S+     L+GTPFF+S
Sbjct  307  VSFYEGTVLVNNSV--IYSNCPGKDRENNEGSV----NLTGTPFFFS  347


 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/108 (31%), Positives = 57/108 (53%), Gaps = 12/108 (11%)
 Frame = +1

Query  226  CRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGKNGVREILS  405
            C++TCG V+I YPFGI     CY N WF + C K+ +    KPF++  +     +  + S
Sbjct  30   CKETCGAVAIPYPFGI--KTGCYYNSWFRVTCNKTVNG--TKPFITRIN-----MELLHS  80

Query  406  ISNVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSGTPFFYSS  549
              + R +++     +P+ +       G+N  +  S+  L G+PFF+SS
Sbjct  81   RWSFRDNVVTVN--NPVTYLNCDDK-GNNGTTSPSSVNLQGSPFFFSS  125



>gb|EMT06507.1| Wall-associated receptor kinase 5 [Aegilops tauschii]
Length=933

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/88 (40%), Positives = 45/88 (51%), Gaps = 12/88 (14%)
 Frame = +1

Query  226  CRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGKNGVREILS  405
            C+  CGNV I YPFGIG   +C L+K F INCT    DG+ KPF   F        E+L 
Sbjct  106  CQRQCGNVDIPYPFGIG--VNCSLSKRFTINCT--VQDGIHKPFRGDF--------EVLD  153

Query  406  ISNVRQSIIMKESFSPLCHTTAGSAVGS  489
            IS    +I M       C+ T+  ++ S
Sbjct  154  ISLTHATIRMLNYILGFCYNTSTRSMES  181



>ref|XP_009798995.1| PREDICTED: putative wall-associated receptor kinase-like 16 [Nicotiana 
sylvestris]
Length=745

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 32/92 (35%), Positives = 48/92 (52%), Gaps = 11/92 (12%)
 Frame = +1

Query  208  SMVPKGCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGKNG  387
            ++  +GCR  CGN+++ YPFGIG    C  +  F INC   SSDG +KP + +       
Sbjct  46   NITKRGCRKQCGNLTVPYPFGIGLGSGCAFDSGFEINC-DISSDGSQKPLIGNI------  98

Query  388  VREILSISNVRQSIIMKESFSPLCHTTAGSAV  483
              E+  IS+    II   + +  C+T  G+ V
Sbjct  99   --EVYDISDAEVRII--STVARRCYTPTGAMV  126



>ref|XP_011082235.1| PREDICTED: wall-associated receptor kinase-like 8 [Sesamum indicum]
Length=744

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 38/119 (32%), Positives = 61/119 (51%), Gaps = 21/119 (18%)
 Frame = +1

Query  199  DGISMVPKGCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDG  378
            DG  +    C+  CG++++ YPFGIG   +C +N +F INC  +SS    K FL      
Sbjct  38   DGPYIAKPDCQSKCGDLTVPYPFGIGIKANCSVNPFFDINC--NSSFNPPKAFL------  89

Query  379  KNGVREILSISNVRQSIIMKESFSPLCHTTAGSAVGSNNLSIIS--NTKLSGTPFFYSS  549
              G  E+L IS  +  ++++   + LC+         NN   ++  +T  SGTPF +S+
Sbjct  90   --GKHEVLGISETK--VLIRNKLASLCYI-------DNNTPEVNDFDTDFSGTPFSFSN  137



>ref|XP_008337069.1| PREDICTED: putative wall-associated receptor kinase-like 16 [Malus 
domestica]
Length=763

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 50/93 (54%), Gaps = 8/93 (9%)
 Frame = +1

Query  214  VPKGCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGKNGVR  393
            V +GCRD CGNVSI YPFG  P  DCY N+ FLI C  +  D   K FL   +D    V 
Sbjct  39   VKQGCRDKCGNVSIPYPFGTTP--DCYYNEEFLITCNDTHYDP-PKAFL-GLTDSNIVVT  94

Query  394  EILSISNVRQSIIMKESFSPLCHTTAGSAVGSN  492
             I    +V   + + +  +  C+  +G+++ SN
Sbjct  95   NI----SVDGKLHILQYIAKDCYNKSGASLESN  123



>ref|XP_010532063.1| PREDICTED: wall-associated receptor kinase-like 22 [Tarenaya 
hassleriana]
Length=797

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 37/54 (69%), Gaps = 4/54 (7%)
 Frame = +1

Query  184  ENYKEDGISMVPKGCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGV  345
            EN  +D +  +   C+  CG+++I YPFGIG  K CYLNKW+ I C+KS+S G+
Sbjct  76   ENTDQDLV--ISSSCQSRCGDIAIPYPFGIG--KGCYLNKWYEITCSKSTSGGL  125



>emb|CBI29387.3| unnamed protein product [Vitis vinifera]
Length=392

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 40/69 (58%), Gaps = 7/69 (10%)
 Frame = +1

Query  223  GCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGKNGVREIL  402
            GC +TCG+V I YPFGIG S  CY ++WF + C  S    + KPFL   +       E+L
Sbjct  61   GCLETCGDVDIPYPFGIG-SAGCYFDEWFEVTCNNSIHPHIPKPFLKILN------LEVL  113

Query  403  SISNVRQSI  429
            ++S  R +I
Sbjct  114  NVSLNRSTI  122



>ref|XP_010415630.1| PREDICTED: wall-associated receptor kinase-like 9 [Camelina sativa]
Length=799

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 32/55 (58%), Gaps = 2/55 (4%)
 Frame = +1

Query  199  DGISMVPKGCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLS  363
            D  ++    C+  CG + I YPFGIG  K CYL KW+ I C  SS+ G   PFLS
Sbjct  23   DSANLTVSSCQSDCGGIEIPYPFGIG--KGCYLEKWYEITCNASSTSGKLVPFLS  75



>gb|EMS56893.1| Wall-associated receptor kinase 5 [Triticum urartu]
Length=777

 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/64 (41%), Positives = 42/64 (66%), Gaps = 10/64 (16%)
 Frame = +1

Query  220  KGCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGKNGVREI  399
             GC+  CG+V I YPFGIG    C + + F I+C+++++DG+E+PF++ +        E+
Sbjct  90   HGCKTRCGDVEIPYPFGIGAG--CAIEQSFEISCSRTAADGIERPFINYW--------EV  139

Query  400  LSIS  411
            LSIS
Sbjct  140  LSIS  143



>ref|XP_003534747.2| PREDICTED: wall-associated receptor kinase-like 22-like [Glycine 
max]
Length=772

 Score = 55.8 bits (133),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 40/111 (36%), Positives = 51/111 (46%), Gaps = 18/111 (16%)
 Frame = +1

Query  223  GCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGKNGVREIL  402
            GC   CG+V I YPFG+  S DCY  KWF I C  S+     +P+L S   G     E+L
Sbjct  52   GCDSGCGDVPIPYPFGMNRS-DCYAGKWFEIECRNST-----RPYLKSIGLGV----EVL  101

Query  403  SISNVRQSIIMKESF--SPLCHTTAGSAVGSNNLSIISNTKLSGTPFFYSS  549
            S    R ++ +      S  C T        NN+S      L G+PF YS 
Sbjct  102  SFDVNRGTVDINNPIYRSNNCGTKTTKHPAVNNIS------LEGSPFVYSQ  146



>emb|CDY52851.1| BnaA09g56430D [Brassica napus]
Length=677

 Score = 55.5 bits (132),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 26/46 (57%), Positives = 32/46 (70%), Gaps = 2/46 (4%)
 Frame = +1

Query  226  CRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLS  363
            C  TCG VSI +PFGIG  KDCYLN+W+ + C  ++S G   PFLS
Sbjct  38   CNKTCGGVSIPFPFGIG-GKDCYLNRWYEVVCNATTS-GTTVPFLS  81



>ref|XP_008229606.1| PREDICTED: wall-associated receptor kinase-like 22 [Prunus mume]
Length=732

 Score = 55.5 bits (132),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 37/114 (32%), Positives = 63/114 (55%), Gaps = 20/114 (18%)
 Frame = +1

Query  208  SMVPKGCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGKNG  387
            ++   GC+  CGNV+I YPFGIG   +CY+++WF I+C ++ +    KPFL+S       
Sbjct  24   ALAKSGCQSQCGNVTIPYPFGIG--ANCYVDEWFSISCNETFNP--PKPFLNSTK-----  74

Query  388  VREILSISNVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSGTPFFYSS  549
              E+L +S   +  I++ +F    ++T G    +N +S      + G+PF +S 
Sbjct  75   -LEVLEVST--ELGIVRVNFP--VNSTCGDRSSANVMS------MEGSPFVFSQ  117



>ref|XP_010512026.1| PREDICTED: wall-associated receptor kinase-like 9 isoform X1 
[Camelina sativa]
Length=803

 Score = 55.5 bits (132),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 40/71 (56%), Gaps = 8/71 (11%)
 Frame = +1

Query  199  DGISMVPKGCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDG  378
            D  ++    C+  CG + I YPFGIG  K CY+ KW+ I C  SS+ G   PFLS  +  
Sbjct  38   DSANLTVSSCQSECGGIEIPYPFGIG--KGCYMEKWYEITCNASSTSGKLVPFLSVIN--  93

Query  379  KNGVREILSIS  411
                +E+++IS
Sbjct  94   ----KEVVNIS  100



>ref|XP_009356568.1| PREDICTED: wall-associated receptor kinase-like 1 [Pyrus x bretschneideri]
Length=744

 Score = 55.5 bits (132),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 41/112 (37%), Positives = 55/112 (49%), Gaps = 21/112 (19%)
 Frame = +1

Query  211  MVPKGCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGKNGV  390
            M    C   CGNV+I YPFGIGP  DCY ++ F I+C K++ +    P L   S      
Sbjct  30   MAKPKCLSRCGNVNIPYPFGIGP--DCYFDEGFEISCNKTTGN---VPVLRQTS------  78

Query  391  REILSISNVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSGTPFFYS  546
             E+L+IS    +I +K   +  C        G N+    +N  L GTPF YS
Sbjct  79   LEVLNISIAEGTIQVKNPVTFFC--------GGNSSRQPAN--LKGTPFVYS  120



>ref|XP_010447619.1| PREDICTED: wall-associated receptor kinase-like 18 [Camelina 
sativa]
Length=796

 Score = 55.5 bits (132),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 43/123 (35%), Positives = 58/123 (47%), Gaps = 26/123 (21%)
 Frame = +1

Query  226  CRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGKNGVREILS  405
            C+  CG VSI YPFGIG  KDCYL K++ I C  ++S     PFLS+        +E++S
Sbjct  34   CQSKCGGVSIRYPFGIG--KDCYLEKYYEIECRNTTSRK-PVPFLSAIG------KEVVS  84

Query  406  IS---------------NVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSGTPFF  540
            IS               +  QS  +     P+  T+ G     N+ S  S    +GTPFF
Sbjct  85   ISPPSEERYVTFLSFDEDRHQSFGLVRVKYPV--TSTGCFSDGNDESGGSKMNFTGTPFF  142

Query  541  YSS  549
              S
Sbjct  143  IDS  145



>ref|XP_010512027.1| PREDICTED: wall-associated receptor kinase-like 9 isoform X2 
[Camelina sativa]
Length=817

 Score = 55.5 bits (132),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 40/71 (56%), Gaps = 8/71 (11%)
 Frame = +1

Query  199  DGISMVPKGCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDG  378
            D  ++    C+  CG + I YPFGIG  K CY+ KW+ I C  SS+ G   PFLS  +  
Sbjct  38   DSANLTVSSCQSECGGIEIPYPFGIG--KGCYMEKWYEITCNASSTSGKLVPFLSVIN--  93

Query  379  KNGVREILSIS  411
                +E+++IS
Sbjct  94   ----KEVVNIS  100



>ref|XP_009117775.1| PREDICTED: wall-associated receptor kinase-like 5 isoform X1 
[Brassica rapa]
Length=796

 Score = 55.5 bits (132),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 26/46 (57%), Positives = 32/46 (70%), Gaps = 2/46 (4%)
 Frame = +1

Query  226  CRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLS  363
            C  TCG VSI +PFGIG  KDCYLN+W+ + C  ++S G   PFLS
Sbjct  38   CSKTCGGVSIPFPFGIG-GKDCYLNRWYEVVCNATTS-GTTVPFLS  81



>emb|CDY49737.1| BnaA02g19350D [Brassica napus]
Length=139

 Score = 52.8 bits (125),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 38/62 (61%), Gaps = 7/62 (11%)
 Frame = +1

Query  226  CRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGKNGVREILS  405
            C   CG +SI +PFGIGP K CYLN W+ + C  +++  +  PFLS  +      RE++S
Sbjct  31   CNSFCGGISIPFPFGIGP-KHCYLNDWYKVVCNTTTTTSLSTPFLSKIN------RELMS  83

Query  406  IS  411
            I+
Sbjct  84   IT  85



>ref|XP_010688363.1| PREDICTED: wall-associated receptor kinase-like 2 isoform X1 
[Beta vulgaris subsp. vulgaris]
Length=714

 Score = 55.5 bits (132),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 27/37 (73%), Gaps = 2/37 (5%)
 Frame = +1

Query  223  GCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSS  333
            GC+D CGN+SI YPFGIGP  +CY N WF + C  +S
Sbjct  37   GCKDHCGNISIPYPFGIGP--NCYHNPWFEVECDATS  71



>ref|XP_010417636.1| PREDICTED: wall-associated receptor kinase-like 10 [Camelina 
sativa]
Length=782

 Score = 55.5 bits (132),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 43/118 (36%), Positives = 57/118 (48%), Gaps = 26/118 (22%)
 Frame = +1

Query  214  VPKGCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGKNGVR  393
            V + C + CG V+I YPFGIG  K CYL KW+ I C  +S      PFLS  +      +
Sbjct  23   VVRSCPEECGRVNIPYPFGIG--KGCYLEKWYEIICVNNSV-----PFLSIIN------K  69

Query  394  EILSISNVRQSIIMKESFSPLCH---------TTAGSAVGSNNLSIISNTKLSGTPFF  540
            E++SIS       M   FS L +         T+ G + G   L I S   L+G PF+
Sbjct  70   EVVSISFSD----MSRHFSDLGYGSIRVKNPITSKGCSSGGEELGIGSLLNLTGYPFY  123



>ref|XP_002885626.1| hypothetical protein ARALYDRAFT_898987 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61885.1| hypothetical protein ARALYDRAFT_898987 [Arabidopsis lyrata subsp. 
lyrata]
Length=730

 Score = 55.5 bits (132),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 56/120 (47%), Gaps = 16/120 (13%)
 Frame = +1

Query  202  GISMVPKGCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGK  381
            G ++    C+  CG+VSI YPFGIG +  CYL+KW  + C ++ + G   PFL   +   
Sbjct  22   GSALAKNNCQRNCGSVSIPYPFGIGEA--CYLSKWHEVQCHRNPASGQLLPFLPGIN---  76

Query  382  NGVREILSISNVRQSI--------IMKESFSPLCHTTAGSAVGSNNLSIISNTKLSGTPF  537
               + +L I+  RQ          I  + FS  C +     +  +   +     L+GTPF
Sbjct  77   ---KTVLQINLPRQRASTPYGSIRIQMDIFSTGCGSPTNVFLKFDGNEVGDVLNLTGTPF  133



>emb|CAN62684.1| hypothetical protein VITISV_018338 [Vitis vinifera]
Length=722

 Score = 55.1 bits (131),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 43/112 (38%), Positives = 57/112 (51%), Gaps = 14/112 (13%)
 Frame = +1

Query  211  MVPKGCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGKNGV  390
            M   GC +TCGNVSI YPFGIG  K CYL+K F I C  SS   +  P    F   +   
Sbjct  1    MAKPGCPETCGNVSIVYPFGIG--KGCYLDKRFEITCNNSS---LPHPL---FHVDEENE  52

Query  391  REILSISNVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSGTPFFYS  546
             E+L +S   + + +K+  SP+C+    S   S  L  I+  +    PF YS
Sbjct  53   AEVLYMS--LEYMRIKDWTSPVCYANYTSEGQSYALFSIAPME----PFSYS  98



>gb|KJB42573.1| hypothetical protein B456_007G158100 [Gossypium raimondii]
Length=692

 Score = 55.1 bits (131),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 39/118 (33%), Positives = 54/118 (46%), Gaps = 20/118 (17%)
 Frame = +1

Query  202  GISMVPKGCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGK  381
             I +   GC DTCG V + YPFGIGP  DCY + WF + C ++ S           +  K
Sbjct  27   AIPIAKPGCNDTCGQVRVPYPFGIGP--DCYRDSWFEVLCNETLSPPT--------TLVK  76

Query  382  NGVREILSISNVRQSIIMKESFSPLCHTTAGSAVGSNNLS---IISNTKLSGTPFFYS  546
                E+L+ S V +       ++ +      S V S N S         L+G+PFFYS
Sbjct  77   KINMEVLNFSYVPE-------YTSIEFVRVKSPVISKNCSPRETEQRVNLTGSPFFYS  127



>ref|XP_010688364.1| PREDICTED: wall-associated receptor kinase-like 4 isoform X2 
[Beta vulgaris subsp. vulgaris]
Length=568

 Score = 55.1 bits (131),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 27/37 (73%), Gaps = 2/37 (5%)
 Frame = +1

Query  223  GCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSS  333
            GC+D CGN+SI YPFGIGP  +CY N WF + C  +S
Sbjct  37   GCKDHCGNISIPYPFGIGP--NCYHNPWFEVECDATS  71



>ref|XP_011020556.1| PREDICTED: wall-associated receptor kinase-like 8 [Populus euphratica]
Length=728

 Score = 55.1 bits (131),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 35/112 (31%), Positives = 60/112 (54%), Gaps = 18/112 (16%)
 Frame = +1

Query  211  MVPKGCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGKNGV  390
            M   GC++ CGN+SI YPFG   ++DCY N+ F I C +++++   + F+S  +      
Sbjct  27   MTKPGCQNRCGNISIPYPFGT--AQDCYANEMFKIVCREAANESAPRAFISMIN------  78

Query  391  REILSISNVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSGTPFFYS  546
             E+L+I++   +I+     S  C         S+  S +    L+G+PFF+S
Sbjct  79   MEVLNITD-GAAIVNGPIMSSNC---------SDRQSNLPALNLTGSPFFFS  120



>ref|XP_010246169.1| PREDICTED: uncharacterized protein LOC104589520 [Nelumbo nucifera]
Length=721

 Score = 55.1 bits (131),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 36/106 (34%), Positives = 53/106 (50%), Gaps = 16/106 (15%)
 Frame = +1

Query  205  ISMVPKGCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGKN  384
            +S    GC+D CGN+SI YPFGIG   +C+++  F + C  SS    + P L +  DG+ 
Sbjct  58   LSQTKPGCQDNCGNISIPYPFGIGDDPNCFMDYDFKLICNTSS----DNPVLQT-QDGQ-  111

Query  385  GVREILSISNVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKL  522
                +L+IS       ++   +   H      VG + L   SNTKL
Sbjct  112  ---PVLNIS-------LQGQLTTSIHVAVQCQVGDSKLWNSSNTKL  147



>ref|XP_006653603.1| PREDICTED: wall-associated receptor kinase 3-like [Oryza brachyantha]
Length=776

 Score = 54.7 bits (130),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 32/89 (36%), Positives = 50/89 (56%), Gaps = 13/89 (15%)
 Frame = +1

Query  214  VPKG-CRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGKNGV  390
            VP+  C+  CG++ + YPFGIG   DC  N  F INCT  + +GV KPF+  F       
Sbjct  63   VPRSDCQKQCGHIDMEYPFGIG--TDCSFNGGFDINCT--NQNGVFKPFIGDF-------  111

Query  391  REILSISNVRQSIIMKESFSPLCHTTAGS  477
             E+L+IS  + ++ +    +  C+ ++GS
Sbjct  112  -ELLNISLTQSTVRVLNFITAYCYNSSGS  139



>ref|XP_010088576.1| Wall-associated receptor kinase-like 9 [Morus notabilis]
 gb|EXB36717.1| Wall-associated receptor kinase-like 9 [Morus notabilis]
Length=774

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 42/73 (58%), Gaps = 10/73 (14%)
 Frame = +1

Query  196  EDGISMVPKGCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSD  375
            E  +++   GC   CGNV I +PFGIGP  +C L+KWF I+C  S+     +PFL     
Sbjct  36   EAALNISKPGCEQRCGNVHIPFPFGIGP--NCSLDKWFEISCNNSTIP--HRPFL-----  86

Query  376  GKNGVREILSISN  414
             K+   E+L IS+
Sbjct  87   -KHTQWEVLHISD  98



>ref|XP_008220151.1| PREDICTED: putative wall-associated receptor kinase-like 16 [Prunus 
mume]
Length=764

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 38/104 (37%), Positives = 59/104 (57%), Gaps = 13/104 (13%)
 Frame = +1

Query  199  DGISMVPKGCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDG  378
            D + + P GC+D CG+VSI YPFG   ++DCY N+ FLI C  + +    KPFL      
Sbjct  40   DQVEVKP-GCQDKCGDVSIPYPFGT--TQDCYYNQDFLITCNDTYNP--PKPFLR-----  89

Query  379  KNGVREILSISNVRQSIIMKESFSPLCHTTAGSAVG--SNNLSI  504
            K+   E+ +IS V   + +K+  +  C   +G+ +G   N+LS+
Sbjct  90   KSDSIEVTNIS-VDGKLYIKQYIAIQCFNKSGTPLGGLENSLSL  132



>ref|XP_007225548.1| hypothetical protein PRUPE_ppa002432m1g, partial [Prunus persica]
 gb|EMJ26747.1| hypothetical protein PRUPE_ppa002432m1g, partial [Prunus persica]
Length=245

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 37/99 (37%), Positives = 56/99 (57%), Gaps = 12/99 (12%)
 Frame = +1

Query  214  VPKGCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGKNGVR  393
            V  GC+D CG+VSI YPFG   ++DCY N+ FLI C  + +    KPFL      K+   
Sbjct  46   VKPGCQDKCGDVSIPYPFGT--TQDCYYNQDFLITCNDTYNP--PKPFLR-----KSDSI  96

Query  394  EILSISNVRQSIIMKESFSPLCHTTAGSAVG--SNNLSI  504
            E+ +IS V   + +K+  +  C   +G+ +G   N+LS+
Sbjct  97   EVTNIS-VDGKLYIKQYIAIQCFNKSGTPLGGLKNSLSL  134



>ref|XP_006300756.1| hypothetical protein CARUB_v10019823mg [Capsella rubella]
 gb|EOA33654.1| hypothetical protein CARUB_v10019823mg [Capsella rubella]
Length=794

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 35/107 (33%), Positives = 55/107 (51%), Gaps = 14/107 (13%)
 Frame = +1

Query  238  CGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGKNGVR------EI  399
            CG + I YPFG+G  K CYL KW+ I C  SS+ G   PFLS  +    G+       +I
Sbjct  36   CGGIEIPYPFGVG--KGCYLEKWYEITCNTSSTSGKLVPFLSVINKEVVGISLWNRNDDI  93

Query  400  LSISNVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSGTPFF  540
             +IS    S+ ++   + +  ++ G  +  + L+      L+GTPF+
Sbjct  94   HNISGNYSSVSIRNQITSMGCSSDGEELTGSLLN------LTGTPFY  134



>ref|XP_004306243.2| PREDICTED: wall-associated receptor kinase-like 1 [Fragaria vesca 
subsp. vesca]
 ref|XP_011468105.1| PREDICTED: wall-associated receptor kinase-like 1 [Fragaria vesca 
subsp. vesca]
Length=811

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 38/79 (48%), Gaps = 12/79 (15%)
 Frame = +1

Query  211  MVPKGCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKS------SSDGVEKPFLSSFS  372
            +  K C   CG V I YPFGIGP+  CY + WF I C  S      +S   E PFL    
Sbjct  53   IAQKNCTSLCGGVQIPYPFGIGPNNHCYFDGWFEIECRNSIDFQFFNSSVPETPFLRRLQ  112

Query  373  DGKNGVREILSISNVRQSI  429
                   E+LSIS V  ++
Sbjct  113  ------LEVLSISIVNATL  125



>emb|CDX96662.1| BnaA08g22050D [Brassica napus]
Length=786

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 37/120 (31%), Positives = 59/120 (49%), Gaps = 26/120 (22%)
 Frame = +1

Query  214  VPKGCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGKNGVR  393
            +P  C+  CGN++I YPFGI   + CYLN+W+ I C  ++S     PFL          +
Sbjct  28   LPSWCQTNCGNINISYPFGI--QEGCYLNEWYKITCRNATS-----PFLFKMD------K  74

Query  394  EILSISNVRQSIIMKESFSPLCHTTAGSAVGSNNLSII----------SNTKLSGTPFFY  543
            E++ IS+  +  +   SF  L   + GS    N ++ +          S   L+G+PFF+
Sbjct  75   EVVGISSPNEGSV---SFESLSTGSFGSIRVKNPITSVGCSRDGKESDSALNLTGSPFFF  131



>ref|XP_007216943.1| hypothetical protein PRUPE_ppa016387mg [Prunus persica]
 gb|EMJ18142.1| hypothetical protein PRUPE_ppa016387mg [Prunus persica]
Length=356

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 37/108 (34%), Positives = 54/108 (50%), Gaps = 19/108 (18%)
 Frame = +1

Query  223  GCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGKNGVREIL  402
             C   CG VSI YPFGIGPS  CY+  WF I+C  S+S     PFL      +    E+L
Sbjct  32   SCETHCGVVSIPYPFGIGPSSSCYMYDWFEIHCDNSTSP--HNPFL------RVAKLEVL  83

Query  403  SISNVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSGTPFFYS  546
            +IS +  ++++K   +   +    + +  N         L+G+PF YS
Sbjct  84   NIS-IEGTLLVKNPVTFFFYRRK-TPLAPN---------LTGSPFLYS  120



>ref|XP_006387204.1| hypothetical protein POPTR_1539s002002g, partial [Populus trichocarpa]
 gb|ERP46118.1| hypothetical protein POPTR_1539s002002g, partial [Populus trichocarpa]
Length=93

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 38/61 (62%), Gaps = 2/61 (3%)
 Frame = +1

Query  214  VPKGCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGKNGVR  393
            V  GC++ CGNVS+ YPFGIG   DC +++ F +NC+ S+  G E  F S+ +  K  V 
Sbjct  28   VKPGCQEKCGNVSVPYPFGIG-KPDCAMDEHFFLNCS-SNDGGAELWFRSNMTARKISVP  85

Query  394  E  396
            E
Sbjct  86   E  86



>ref|XP_009111225.1| PREDICTED: wall-associated receptor kinase-like 9 [Brassica rapa]
Length=701

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 44/115 (38%), Positives = 59/115 (51%), Gaps = 19/115 (17%)
 Frame = +1

Query  226  CRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGKNGVREILS  405
            C   CGN+SI YPFGIG  K CYL++WF I C  S+S G   P+L   +      RE++ 
Sbjct  31   CPSYCGNISIPYPFGIG--KGCYLDEWFAIKCNNSTS-GDLVPYLPKIN------REVVK  81

Query  406  ISNVRQSIIMK--ESFSPLCHTTAGSAVGSNNLSIISNTK------LSGTPFFYS  546
            IS    +   K  ES+  L   T  +++G +N S    TK       SG+PF  S
Sbjct  82   ISLPDANGFFKTTESYGSLGIKTNVTSMGCSNSS--DETKFGEPLNFSGSPFTIS  134



>ref|XP_006416846.1| hypothetical protein EUTSA_v10009310mg [Eutrema salsugineum]
 gb|ESQ35199.1| hypothetical protein EUTSA_v10009310mg [Eutrema salsugineum]
Length=767

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 37/116 (32%), Positives = 57/116 (49%), Gaps = 24/116 (21%)
 Frame = +1

Query  217  PKGCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGKNGVRE  396
            P  C   CG +SI +PFGIG  KDCYLN W+ + C ++S      PFLS  +      RE
Sbjct  32   PDLCNRACGGISIPFPFGIG-GKDCYLNPWYEVVCNRNSV-----PFLSRIN------RE  79

Query  397  ILSISNVRQSIIMKESFSPLCH-----TTAGSAVGSNNLSIISNTKLSGTPFFYSS  549
            ++ IS      +  +    L H     T++G + G++    + N    G+P+F + 
Sbjct  80   LVKIS------LPSDREDGLVHIKGPVTSSGCSTGTSQHPPL-NVAGQGSPYFLTD  128



>ref|XP_010519689.1| PREDICTED: wall-associated receptor kinase-like 22 [Tarenaya 
hassleriana]
Length=745

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 39/111 (35%), Positives = 55/111 (50%), Gaps = 13/111 (12%)
 Frame = +1

Query  214  VPKGCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGKNGV-  390
            +   CR  CG++ I YPFGIG  K CYL+KW+ I C   +S     PFL +       + 
Sbjct  31   ISSSCRSRCGDIRIPYPFGIG--KGCYLSKWYEIVCNNGTS-----PFLPAIDKEVVNIF  83

Query  391  -REILSISNVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSGTPFF  540
             R+  S  NV+         SP+  T++G A G  +   + N  L G+PFF
Sbjct  84   LRDDDSADNVQLYYRTVRIRSPV--TSSGCADGRGDSGSLLN--LRGSPFF  130



>gb|KJB28013.1| hypothetical protein B456_005G021700 [Gossypium raimondii]
Length=972

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 37/107 (35%), Positives = 59/107 (55%), Gaps = 16/107 (15%)
 Frame = +1

Query  226  CRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGKNGVREILS  405
            C + CGNV I +PFGI     CY ++WF + C K ++DG EKPF+SS +       ++L+
Sbjct  255  CNERCGNVDIPFPFGI--KVGCYKSEWFRVTCNK-TADG-EKPFISSIN------MQLLN  304

Query  406  ISNVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSGTPFFYS  546
            +S    ++++  S   +     G    +N  S+     L+GTPFF+S
Sbjct  305  VSFYEGTVLVNNSV--IYSYCPGKDRENNEGSV----NLTGTPFFFS  345


 Score = 52.4 bits (124),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 37/112 (33%), Positives = 57/112 (51%), Gaps = 20/112 (18%)
 Frame = +1

Query  223  GCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGKNGVREIL  402
            GC++TC NVSI YPFGI   + CY N WF + C K+ +    KPF+S  +       E+L
Sbjct  29   GCKETCENVSIPYPFGI--KRGCYQNSWFRVTCNKTING--TKPFISRIN------MELL  78

Query  403  S----ISNVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSGTPFFYS  546
                 + + R ++      +P+ +       G+N  +  S+  L G+PFF S
Sbjct  79   PSYWLVEDNRVTV-----NNPVTYLNCDDK-GNNGTTSSSSVNLQGSPFFLS  124



>emb|CDX88557.1| BnaC06g40010D [Brassica napus]
Length=756

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 43/71 (61%), Gaps = 11/71 (15%)
 Frame = +1

Query  226  CRDTCGNVSIYYPFGIGPSKDCYLNKWFLINC---TKSSSDGVEKPFLSSFSDGKNGVRE  396
            C  TCG +SI +PFGIG  K CYLN W+ + C   T SSS  +  PFLS  +      RE
Sbjct  39   CNRTCGGISIPFPFGIG-QKHCYLNDWYEVVCNTTTTSSSGNLLAPFLSKIN------RE  91

Query  397  ILSISNVRQSI  429
            +++I+ +R SI
Sbjct  92   LVTIT-LRNSI  101



>ref|XP_002457827.1| hypothetical protein SORBIDRAFT_03g014450 [Sorghum bicolor]
 gb|EES02947.1| hypothetical protein SORBIDRAFT_03g014450 [Sorghum bicolor]
Length=732

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/84 (42%), Positives = 46/84 (55%), Gaps = 13/84 (15%)
 Frame = +1

Query  223  GCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGKNGVREIL  402
            GC+  CG+V I YPFGIG  KDC ++  F INC  ++S G++KPF+        G  E+L
Sbjct  25   GCQARCGDVEIPYPFGIG--KDCAIDAGFKINCNTTAS-GIKKPFI--------GNVEVL  73

Query  403  SISNVRQSIIMKESFSPLC--HTT  468
            +IS  R         S  C  HTT
Sbjct  74   NISVSRGKTRALNKMSTYCYDHTT  97



>ref|XP_007147445.1| hypothetical protein PHAVU_006G125300g [Phaseolus vulgaris]
 gb|ESW19439.1| hypothetical protein PHAVU_006G125300g [Phaseolus vulgaris]
Length=689

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 56/120 (47%), Gaps = 19/120 (16%)
 Frame = +1

Query  190  YKEDGISMVPKGCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSF  369
            Y    + +   GC   CG V IYYPFG+   K CY++KWF I C + +S+G +KP+L S 
Sbjct  23   YSAHELIIAKPGCSSICGGVEIYYPFGMKDPK-CYVDKWFEIEC-RETSEG-QKPYLKSL  79

Query  370  SDGKNGVREILSISNVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSGTPFFYSS  549
                N    +L +  V    IM    +P+ H    S      +       L G+PF YS 
Sbjct  80   ----NLEVRVLGMHEV---YIM----NPIFHWNCPSRRAKPEV-----INLRGSPFVYSQ  123



>emb|CDX81750.1| BnaC08g38510D [Brassica napus]
Length=554

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 31/49 (63%), Gaps = 2/49 (4%)
 Frame = +1

Query  217  PKGCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLS  363
            P  C  TCG VSI +PFGIG  KDCYLN W+ + C  ++S     PFLS
Sbjct  34   PTSCNKTCGGVSIPFPFGIG-GKDCYLNNWYEVVCNATTSR-TTVPFLS  80



>ref|XP_006384699.1| hypothetical protein POPTR_0004s20300g [Populus trichocarpa]
 gb|ERP62496.1| hypothetical protein POPTR_0004s20300g [Populus trichocarpa]
Length=667

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 39/61 (64%), Gaps = 2/61 (3%)
 Frame = +1

Query  214  VPKGCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGKNGVR  393
            V  GC++ CGNVS+ YPFGIG   DC +++ F +NC+ S+ DG E  F S+ +  K  V 
Sbjct  28   VKPGCQEKCGNVSVPYPFGIG-KPDCAMDEHFFLNCS-SNDDGAEPWFRSNMTARKISVP  85

Query  394  E  396
            E
Sbjct  86   E  86



>ref|XP_010545975.1| PREDICTED: wall-associated receptor kinase-like 22 [Tarenaya 
hassleriana]
Length=756

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 40/114 (35%), Positives = 63/114 (55%), Gaps = 24/114 (21%)
 Frame = +1

Query  226  CRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGKNGVREILS  405
            CR  CG ++I YPFGIG  K CYL++W+ I C  +S+ G   PFLS  +      RE+++
Sbjct  40   CRSECGGITIPYPFGIG--KGCYLSEWYEIVC--NSTSGNPAPFLSRMN------REVVN  89

Query  406  ISNVR------QSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSGTPFFYSS  549
            IS  R       S+ +K   +P+  T++G + G       S   ++G+PFF ++
Sbjct  90   ISLERGFSSNFGSVRIK---API--TSSGCSDGE---EFSSTLDVTGSPFFLTT  135



>ref|XP_007035467.1| Wall associated kinase-like 6, putative [Theobroma cacao]
 gb|EOY06393.1| Wall associated kinase-like 6, putative [Theobroma cacao]
Length=758

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 29/43 (67%), Gaps = 2/43 (5%)
 Frame = +1

Query  208  SMVPKGCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSS  336
            S+   GC+D CGNVSI YPFGIG    C LN WF ++C  +SS
Sbjct  28   SIAKNGCKDRCGNVSIPYPFGIGAK--CSLNPWFEVSCNDTSS  68



>ref|XP_007147446.1| hypothetical protein PHAVU_006G125300g [Phaseolus vulgaris]
 gb|ESW19440.1| hypothetical protein PHAVU_006G125300g [Phaseolus vulgaris]
Length=691

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 56/120 (47%), Gaps = 19/120 (16%)
 Frame = +1

Query  190  YKEDGISMVPKGCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSF  369
            Y    + +   GC   CG V IYYPFG+   K CY++KWF I C + +S+G +KP+L S 
Sbjct  23   YSAHELIIAKPGCSSICGGVEIYYPFGMKDPK-CYVDKWFEIEC-RETSEG-QKPYLKSL  79

Query  370  SDGKNGVREILSISNVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSGTPFFYSS  549
                N    +L +  V    IM    +P+ H    S      +       L G+PF YS 
Sbjct  80   ----NLEVRVLGMHEV---YIM----NPIFHWNCPSRRAKPEV-----INLRGSPFVYSQ  123



>ref|XP_008779714.1| PREDICTED: wall-associated receptor kinase 2-like, partial [Phoenix 
dactylifera]
Length=468

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/46 (57%), Positives = 34/46 (74%), Gaps = 3/46 (7%)
 Frame = +1

Query  223  GCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFL  360
            GCR TCG+VSI YPFGI P  DC+L   F ++C K ++ GV+KPF+
Sbjct  50   GCRPTCGDVSIPYPFGIDP--DCFL-PGFNLSCNKDNATGVQKPFI  92



>ref|XP_007019259.1| Wall-associated kinase 2, putative [Theobroma cacao]
 gb|EOY16484.1| Wall-associated kinase 2, putative [Theobroma cacao]
Length=819

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 36/98 (37%), Positives = 47/98 (48%), Gaps = 26/98 (27%)
 Frame = +1

Query  223  GCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGKNGVREIL  402
            GC+D CGNVSI YPFG   ++DCY N+ F INCT S     + P            R  L
Sbjct  109  GCQDICGNVSIPYPFGT--TEDCYFNEDFFINCTSS-----DPP------------RAFL  149

Query  403  SISNVRQSIIMKESFSPL-------CHTTAGSAVGSNN  495
              SN+    I  E   P+       C+  +GS V +N+
Sbjct  150  RRSNIEVKNITLEGKLPIMQFIAHDCYNKSGSPVANND  187



>ref|XP_008225753.1| PREDICTED: uncharacterized protein LOC103325366 [Prunus mume]
Length=1540

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 36/62 (58%), Gaps = 5/62 (8%)
 Frame = +1

Query  196  EDGISMVPK---GCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSS  366
             D  +++P+   GC D CGN++I YPFGI P   CY +  F INCT +  D    P+L+ 
Sbjct  43   HDHQALLPQALLGCSDRCGNLTIPYPFGIAPG--CYRSPEFFINCTTTHDDENPVPYLTK  100

Query  367  FS  372
             S
Sbjct  101  RS  102



>ref|XP_002264371.1| PREDICTED: wall-associated receptor kinase 2-like [Vitis vinifera]
Length=751

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 48/92 (52%), Gaps = 10/92 (11%)
 Frame = +1

Query  193  KEDGISMVPKGCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFS  372
            KE   S    GC +TCGN++I YPFGIG  + CYL+K F I C  SS+     P L    
Sbjct  25   KETKASTAKPGCPETCGNLAIVYPFGIG--EGCYLDKRFEITCNNSSN---PHPVL-RLD  78

Query  373  DGKNGVREILSISNVRQSIIMKESFSPLCHTT  468
              K      +S+ +VR    +++  SPLC+  
Sbjct  79   QKKEAEVLDMSLEHVR----IRDWTSPLCYAN  106



>emb|CAN66582.1| hypothetical protein VITISV_029054 [Vitis vinifera]
Length=739

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 48/92 (52%), Gaps = 10/92 (11%)
 Frame = +1

Query  193  KEDGISMVPKGCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFS  372
            KE   S    GC +TCGN++I YPFGIG  + CYL+K F I C  SS+     P L    
Sbjct  25   KETKASTAKPGCPETCGNLAIVYPFGIG--EGCYLDKRFEITCNNSSN---PHPVL-RLD  78

Query  373  DGKNGVREILSISNVRQSIIMKESFSPLCHTT  468
              K      +S+ +VR    +++  SPLC+  
Sbjct  79   QKKEAEVLDMSLEHVR----IRDWTSPLCYAN  106



>emb|CBI31032.3| unnamed protein product [Vitis vinifera]
Length=1500

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/91 (38%), Positives = 48/91 (53%), Gaps = 10/91 (11%)
 Frame = +1

Query  193  KEDGISMVPKGCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFS  372
            KE   S    GC +TCGN++I YPFGIG  + CYL+K F I C  SS+     P L    
Sbjct  25   KETKASTAKPGCPETCGNLAIVYPFGIG--EGCYLDKRFEITCNNSSN---PHPVL-RLD  78

Query  373  DGKNGVREILSISNVRQSIIMKESFSPLCHT  465
              K      +S+ +VR    +++  SPLC+ 
Sbjct  79   QKKEAEVLDMSLEHVR----IRDWTSPLCYA  105


 Score = 52.8 bits (125),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 32/48 (67%), Gaps = 2/48 (4%)
 Frame = +1

Query  193  KEDGISMVPKGCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSS  336
            KE   SM   GC++TCGNV I YPFGIG  + CY +K F ++C  SS+
Sbjct  789  KETAASMAKPGCQETCGNVGIVYPFGIG--RGCYHDKNFEVSCAYSSN  834



>emb|CDP22017.1| unnamed protein product [Coffea canephora]
Length=353

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/44 (57%), Positives = 32/44 (73%), Gaps = 2/44 (5%)
 Frame = +1

Query  205  ISMVPKGCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSS  336
             S+   GC+D CGNVSI +PFGI  ++ CYLN+ F INCT SS+
Sbjct  31   FSIARPGCQDHCGNVSIPFPFGI--TEGCYLNEQFFINCTNSST  72



>emb|CAN70918.1| hypothetical protein VITISV_009580 [Vitis vinifera]
Length=732

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/92 (36%), Positives = 45/92 (49%), Gaps = 12/92 (13%)
 Frame = +1

Query  193  KEDGISMVPKGCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFS  372
            KE   SM   GC  TCGN++I YPFGIG  K CYL+K F I C  S +     P L    
Sbjct  25   KETAASMAKPGCPKTCGNIAIVYPFGIG--KGCYLDKRFEITCNNSFN-----PILHL--  75

Query  373  DGKNGVREILSISNVRQSIIMKESFSPLCHTT  468
               N +R+   +    + + ++    P C+T 
Sbjct  76   ---NHMRDAEVLDMSLEHLRIRVQTRPFCYTN  104



>ref|XP_007212912.1| hypothetical protein PRUPE_ppa022237mg, partial [Prunus persica]
 gb|EMJ14111.1| hypothetical protein PRUPE_ppa022237mg, partial [Prunus persica]
Length=737

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 35/62 (56%), Gaps = 5/62 (8%)
 Frame = +1

Query  196  EDGISMVPK---GCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSS  366
             D  +++P+   GC D CGN++I YPFG+ P   CY    F INCT +  D    P+L+ 
Sbjct  15   HDHQALLPQALLGCSDRCGNLTIPYPFGMAPG--CYRGPEFFINCTTTHEDENPVPYLTK  72

Query  367  FS  372
             S
Sbjct  73   IS  74



>ref|XP_010438083.1| PREDICTED: wall-associated receptor kinase-like 18 isoform X1 
[Camelina sativa]
Length=804

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 44/123 (36%), Positives = 59/123 (48%), Gaps = 26/123 (21%)
 Frame = +1

Query  226  CRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGKNGVREILS  405
            C+  CG VSI YPFGIG  K CYL K++ I C  ++S  +  PFLS         +E++S
Sbjct  34   CQSECGRVSIRYPFGIG--KGCYLEKYYEIECRNTTSRKL-VPFLSVIG------KEVVS  84

Query  406  ISNVR---------QSIIMKESFS------PLCHTTAGSAVGSNNLSIISNTKLSGTPFF  540
            IS             ++   ESF       P+  T+ G   G N+ S  S    +GTPFF
Sbjct  85   ISLPTAESYFAYEVSNLDRHESFGLVRVKFPI--TSTGCLSGGNDESGGSKMNFTGTPFF  142

Query  541  YSS  549
              S
Sbjct  143  IDS  145



>ref|XP_002304841.2| putative wall-associated kinase family protein [Populus trichocarpa]
 gb|EEE79820.2| putative wall-associated kinase family protein [Populus trichocarpa]
Length=729

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/108 (31%), Positives = 59/108 (55%), Gaps = 18/108 (17%)
 Frame = +1

Query  223  GCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGKNGVREIL  402
            GC++ CGN+SI YPFG   ++DCY N+ F I C +++++   + F+S  +       E+L
Sbjct  31   GCQNRCGNISIPYPFGT--AQDCYANEMFKIVCRETANESAPRAFISMIN------MEVL  82

Query  403  SISNVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSGTPFFYS  546
            +I++   +I+     S  C         S+  S +    L+G+PFF+S
Sbjct  83   NITD-GAAIVNGPIMSSNC---------SDRQSNLPALNLTGSPFFFS  120



>gb|KHN40782.1| Wall-associated receptor kinase-like 22 [Glycine soja]
Length=684

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/111 (35%), Positives = 51/111 (46%), Gaps = 18/111 (16%)
 Frame = +1

Query  223  GCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGKNGVREIL  402
            GC   CG+V I YPFG+  S +CY  KWF I C  S+     +P+L S   G     E+L
Sbjct  20   GCDSGCGDVPIPYPFGMNRS-ECYAGKWFEIECRNST-----RPYLKSIGLGV----EVL  69

Query  403  SISNVRQSIIMKESF--SPLCHTTAGSAVGSNNLSIISNTKLSGTPFFYSS  549
            SI     ++ +      S  C T        NN+S      L G+PF YS 
Sbjct  70   SIDVNEGTVDINNPIYRSNNCGTRTTKHPAVNNIS------LEGSPFVYSQ  114



>gb|AAF18508.1|AC010924_21 Contains similarity to gb|AJ009696 wall-associated kinase 1 from 
Arabidopsis thaliana and contains a protein kinase PF|00069 
domain [Arabidopsis thaliana]
Length=664

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 38/65 (58%), Gaps = 11/65 (17%)
 Frame = +1

Query  217  PKGCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGKNGVRE  396
            P  C   CG +SI +PFGIG  KDCYLN W+ + C  ++S     PFLS  +      RE
Sbjct  32   PDRCNRVCGEISIPFPFGIG-GKDCYLNPWYEVVCNSTNS----VPFLSRIN------RE  80

Query  397  ILSIS  411
            +++IS
Sbjct  81   LVNIS  85



>ref|XP_010476715.1| PREDICTED: wall-associated receptor kinase-like 1 [Camelina sativa]
Length=729

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 40/63 (63%), Gaps = 8/63 (13%)
 Frame = +1

Query  226  CRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEK-PFLSSFSDGKNGVREIL  402
            C  TCG +SI +PFGIG  K+CYLN W+ + C  ++SD  +  PFLS  +      RE++
Sbjct  39   CNKTCGGISIPFPFGIG-GKNCYLNGWYEVICNPTTSDSNKTVPFLSMIN------REVV  91

Query  403  SIS  411
            +IS
Sbjct  92   NIS  94



>ref|XP_007217680.1| hypothetical protein PRUPE_ppa021669mg, partial [Prunus persica]
 gb|EMJ18879.1| hypothetical protein PRUPE_ppa021669mg, partial [Prunus persica]
Length=612

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/45 (51%), Positives = 29/45 (64%), Gaps = 2/45 (4%)
 Frame = +1

Query  226  CRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFL  360
            C   CG+V+I YPFGIGPS +CYL  WF I C  ++     +PFL
Sbjct  10   CETHCGDVTIPYPFGIGPSSNCYLYDWFEIECDYTTIP--PRPFL  52



>gb|KFK42837.1| hypothetical protein AALP_AA1G045500 [Arabis alpina]
Length=563

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 52/100 (52%), Gaps = 11/100 (11%)
 Frame = +1

Query  238  CGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGKNGVREILSISNV  417
            CGN+SI YPFGIG  K CYLN WF I C  S+S G   P+L   +  K  VR  L  + +
Sbjct  33   CGNISIRYPFGIG--KGCYLNGWFEIQCNNSTS-GKLVPYLPKIN--KEVVRIYLP-TRL  86

Query  418  RQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSGTPF  537
              S+ +K +      T+ G +  SN +        +GTPF
Sbjct  87   YGSLRIKTNI-----TSMGCSNSSNGIKFGEPLNFTGTPF  121



>emb|CDX83762.1| BnaC08g18830D [Brassica napus]
Length=111

 Score = 50.4 bits (119),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 36/60 (60%), Gaps = 9/60 (15%)
 Frame = +1

Query  214  VPKGCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGKNGVR  393
            +P  C+  CGN++I YPFGI   + CYLN+W+ I C  ++S     PFL  F  GK  VR
Sbjct  28   LPSWCQTKCGNINIPYPFGI--QEGCYLNEWYKITCRNATS-----PFL--FKMGKEVVR  78



>ref|XP_006389860.1| hypothetical protein EUTSA_v10018175mg [Eutrema salsugineum]
 gb|ESQ27146.1| hypothetical protein EUTSA_v10018175mg [Eutrema salsugineum]
Length=759

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 40/66 (61%), Gaps = 10/66 (15%)
 Frame = +1

Query  238  CGNVSIYYPFGIGPSKDCYLNKWFLINC--TKSSSDGVEKPFLSSFSDGKNGVREILSIS  411
            CG VSI +PFGIG  KDCYLN W+ + C  T S S     PFLS  +      RE++SI+
Sbjct  43   CGGVSIPFPFGIG-RKDCYLNNWYEVVCDTTTSGSGQTHAPFLSKIN------RELVSIT  95

Query  412  NVRQSI  429
             +R SI
Sbjct  96   -LRNSI  100



>gb|KJB33602.1| hypothetical protein B456_006G020900 [Gossypium raimondii]
Length=734

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 39/112 (35%), Positives = 58/112 (52%), Gaps = 19/112 (17%)
 Frame = +1

Query  217  PKGCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGKNGVR-  393
            P   ++ CGN++I  PFGI  S  CY   WF + C K++ DG +KPF++      NG+  
Sbjct  33   PACGQEVCGNITISSPFGIHSS--CYTIPWFRVTC-KATRDG-QKPFINV-----NGIDL  83

Query  394  EILSISNVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSGTPFFYSS  549
            E+L  ++    +I        C  T+ ++V  N         LSGTPFF+SS
Sbjct  84   EVLDFTSADAILISNPVAYINCDHTSEASVSVN---------LSGTPFFFSS  126



>ref|XP_010688575.1| PREDICTED: wall-associated receptor kinase-like 2 [Beta vulgaris 
subsp. vulgaris]
Length=723

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/33 (67%), Positives = 24/33 (73%), Gaps = 2/33 (6%)
 Frame = +1

Query  223  GCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINC  321
            GC D CGNVSI YPFGIGP  +CY N WF + C
Sbjct  40   GCEDRCGNVSIPYPFGIGP--NCYHNPWFDVEC  70



>gb|EEE70225.1| hypothetical protein OsJ_30339 [Oryza sativa Japonica Group]
Length=1327

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 37/114 (32%), Positives = 56/114 (49%), Gaps = 13/114 (11%)
 Frame = +1

Query  217  PKGCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGKNGVRE  396
            P GC  TCGN+SI YPFGIG    C  ++ F + C  +SS  +    + S S G    ++
Sbjct  629  PPGCPSTCGNISIPYPFGIGAG--CARDEGFQLECNHTSSPPL---LIVSNSTGGRHRQQ  683

Query  397  ILSIS----NVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSGTPFFYS  546
            +LS+S      R  +  K      C+ ++   + S N    +   LSGTP+ +S
Sbjct  684  LLSLSLADGEARTFLTAKRR----CYNSSTGDMVSENDQNATEMSLSGTPYRFS  733



>emb|CAN70175.1| hypothetical protein VITISV_025099 [Vitis vinifera]
Length=941

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 32/48 (67%), Gaps = 2/48 (4%)
 Frame = +1

Query  193  KEDGISMVPKGCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSS  336
            KE   SM   GC++TCGNV I YPFGIG  + CY +K F ++C  SS+
Sbjct  22   KETAASMAKPGCQETCGNVGIVYPFGIG--RGCYHDKNFEVSCAYSSN  67



>ref|XP_010655829.1| PREDICTED: wall-associated receptor kinase 2-like [Vitis vinifera]
Length=764

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 28/41 (68%), Gaps = 2/41 (5%)
 Frame = +1

Query  211  MVPKGCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSS  333
            M   GC +TCGNVSI YPFGIG  K CYL+K F I C  SS
Sbjct  1    MAKPGCPETCGNVSIVYPFGIG--KGCYLDKRFEITCNNSS  39



>dbj|BAD46086.1| putative wall-associated kinase 4 [Oryza sativa Japonica Group]
Length=770

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 35/110 (32%), Positives = 54/110 (49%), Gaps = 5/110 (5%)
 Frame = +1

Query  217  PKGCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGKNGVRE  396
            P GC  TCGN+SI YPFGIG    C  ++ F + C  +SS  +    + S S G    ++
Sbjct  24   PPGCPSTCGNISIPYPFGIGAG--CARDEGFQLECNHTSSPPL---LIVSNSTGGRHRQQ  78

Query  397  ILSISNVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSGTPFFYS  546
            +LS+S          +    C+ ++   + S N    +   LSGTP+ +S
Sbjct  79   LLSLSLADGEARTFLTAKRRCYNSSTGDMVSENDQNATEMSLSGTPYRFS  128



>ref|XP_007217600.1| hypothetical protein PRUPE_ppa018374mg, partial [Prunus persica]
 gb|EMJ18799.1| hypothetical protein PRUPE_ppa018374mg, partial [Prunus persica]
Length=689

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 33/114 (29%), Positives = 58/114 (51%), Gaps = 20/114 (18%)
 Frame = +1

Query  208  SMVPKGCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGKNG  387
            ++   GC+  CG+V+I YPFGIG   +CY+++WF I+C ++ +    KPFL+S       
Sbjct  32   ALAKSGCQSQCGDVTIPYPFGIGA--NCYVDEWFSISCNETFNP--PKPFLNSTK-----  82

Query  388  VREILSISNVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSGTPFFYSS  549
              E+L +S    ++ +    +  C   + + V S          + G+PF +S 
Sbjct  83   -LEVLEVSTELGTVRVNFPVNSTCGDRSNANVMS----------MEGSPFVFSQ  125



>ref|XP_010655828.1| PREDICTED: wall-associated receptor kinase 5-like [Vitis vinifera]
Length=752

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 32/48 (67%), Gaps = 2/48 (4%)
 Frame = +1

Query  193  KEDGISMVPKGCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSS  336
            KE   SM   GC++TCGNV I YPFGIG  + CY +K F ++C  SS+
Sbjct  22   KETAASMAKPGCQETCGNVGIVYPFGIG--RGCYHDKNFEVSCAYSSN  67



>ref|XP_010655765.1| PREDICTED: wall-associated receptor kinase 5-like [Vitis vinifera]
 ref|XP_010655766.1| PREDICTED: wall-associated receptor kinase 5-like [Vitis vinifera]
Length=754

 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 32/48 (67%), Gaps = 2/48 (4%)
 Frame = +1

Query  193  KEDGISMVPKGCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSS  336
            +E G SM   GC + CGN++I YPFG+G  K CYLN+ F I C  SS+
Sbjct  25   QEAGASMTKPGCPEKCGNITIPYPFGMG--KGCYLNRNFEITCNMSSN  70



>ref|XP_010497664.1| PREDICTED: wall-associated receptor kinase-like 4 [Camelina sativa]
Length=760

 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 37/114 (32%), Positives = 60/114 (53%), Gaps = 21/114 (18%)
 Frame = +1

Query  217  PKGCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGKNGVRE  396
            P  C   CG++SI +PFGIG +KDCYLN W+ + C  S       PFLS  +      RE
Sbjct  40   PDLCNRVCGDLSIPFPFGIG-AKDCYLNPWYEVACKNSV------PFLSRIN------RE  86

Query  397  ILSIS---NVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSGTPFFYSS  549
            ++ IS   ++   ++  +   P+  T++G + G +    + N    G+PFF++ 
Sbjct  87   LVKISFPHHLGDGVVHIK--GPV--TSSGCSSGPSQHPPL-NIAGQGSPFFFTD  135



>ref|XP_007147589.1| hypothetical protein PHAVU_006G137300g [Phaseolus vulgaris]
 gb|ESW19583.1| hypothetical protein PHAVU_006G137300g [Phaseolus vulgaris]
Length=704

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 41/110 (37%), Positives = 57/110 (52%), Gaps = 17/110 (15%)
 Frame = +1

Query  223  GCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSS--DGVEKPFLSSFSDGKNGVRE  396
            GC   CG+VSI +PFG+  SK CY  KWF I C  +SS  +    P+L S      GV E
Sbjct  33   GCEWQCGDVSIPFPFGMKSSK-CYAGKWFEIECRNTSSYNNYSHTPYLKSI-----GV-E  85

Query  397  ILSISNVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSGTPFFYS  546
            ++S  ++R+ ++       + H    S  GS + S   N  L G+PF YS
Sbjct  86   VISF-DLRRGLVT------INHPIYRSNCGSKD-SPRVNQSLEGSPFVYS  127



>gb|EMT10672.1| Wall-associated receptor kinase 3 [Aegilops tauschii]
Length=793

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 39/77 (51%), Gaps = 12/77 (16%)
 Frame = +1

Query  181  AENYKEDGISMVPKGCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFL  360
            A  Y   G ++    CR  CGNV I YPFGI P   C L   F ++C     DG+E+PF 
Sbjct  64   AAQYAPAGSAVPSSHCRRQCGNVEIPYPFGIDPG--CSLRDGFHLDC--KVHDGIERPFR  119

Query  361  SSFSDGKNGVREILSIS  411
            S+F        E+L IS
Sbjct  120  SAF--------EVLDIS  128



>ref|NP_173064.1| wall-associated receptor kinase-like 2 [Arabidopsis thaliana]
 sp|Q7X8C5.1|WAKLB_ARATH RecName: Full=Wall-associated receptor kinase-like 2; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAP40396.1| putative WAK kinase (WLK) [Arabidopsis thaliana]
 gb|AAP40469.1| putative WAK kinase (WLK) [Arabidopsis thaliana]
 dbj|BAF01525.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE29412.1| wall-associated receptor kinase-like 2 [Arabidopsis thaliana]
Length=748

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 38/65 (58%), Gaps = 11/65 (17%)
 Frame = +1

Query  217  PKGCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGKNGVRE  396
            P  C   CG +SI +PFGIG  KDCYLN W+ + C  ++S     PFLS  +      RE
Sbjct  32   PDRCNRVCGEISIPFPFGIG-GKDCYLNPWYEVVCNSTNS----VPFLSRIN------RE  80

Query  397  ILSIS  411
            +++IS
Sbjct  81   LVNIS  85



>ref|XP_007034133.1| Wall associated kinase-like 6, putative [Theobroma cacao]
 gb|EOY05059.1| Wall associated kinase-like 6, putative [Theobroma cacao]
Length=844

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 37/108 (34%), Positives = 55/108 (51%), Gaps = 20/108 (19%)
 Frame = +1

Query  226  CRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGKNGVREILS  405
            C  +CG V I YPFG+     CY+N+WF + C + ++DG +KPFLSS         E+LS
Sbjct  249  CTVSCGEVDIAYPFGMDAR--CYMNEWFKVTCNE-TADG-KKPFLSSIG------LELLS  298

Query  406  ISNVRQSIIMKESFSPL-CHTTAGSAVGSNNLSIISNTKLSGTPFFYS  546
             S    S+ +    + + C     + V  N         L+G+PFF+S
Sbjct  299  SSFTLGSVQVNNPVTYIQCQDIHNNGVSVN---------LTGSPFFFS  337



>ref|XP_008342477.1| PREDICTED: wall-associated receptor kinase-like 22 [Malus domestica]
Length=729

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 34/47 (72%), Gaps = 4/47 (9%)
 Frame = +1

Query  226  CRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSS  366
            C+  CG+V+I YPFGIGP  +CYL++WF I+C  + +    KPFL+S
Sbjct  20   CQAQCGSVTIPYPFGIGP--NCYLDEWFSISCNDTYNPS--KPFLNS  62



>ref|XP_006304551.1| hypothetical protein CARUB_v10011541mg [Capsella rubella]
 gb|EOA37449.1| hypothetical protein CARUB_v10011541mg [Capsella rubella]
Length=366

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 31/47 (66%), Gaps = 6/47 (13%)
 Frame = +1

Query  226  CRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSS  366
            C   CGN+SI YPFGIG  KDCYLN W+ I C  +SS     PFL++
Sbjct  30   CPSHCGNISIPYPFGIG--KDCYLNDWYEIRCIHNSS----VPFLTT  70



>ref|XP_002891113.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH67372.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=708

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 30/45 (67%), Gaps = 3/45 (7%)
 Frame = +1

Query  226  CRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFL  360
            C+  CGNVSI YPFGIG    CYLN W+ INCT+ SS     PFL
Sbjct  28   CKSFCGNVSIPYPFGIG--NGCYLNHWYEINCTEISSRKF-IPFL  69



>emb|CBI31039.3| unnamed protein product [Vitis vinifera]
Length=738

 Score = 52.8 bits (125),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 35/95 (37%), Positives = 51/95 (54%), Gaps = 16/95 (17%)
 Frame = +1

Query  208  SMVPKGCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGKNG  387
            S+   GCR+TCGNV I YPFGIG  + CY ++ F ++C  SS+    +P L         
Sbjct  50   SIAKPGCRETCGNVRIVYPFGIG--RGCYHDRNFEVSCDNSSNP--PRPCLVVIET----  101

Query  388  VREIL--SISNVRQSIIMKESFSPLCHTTAGSAVG  486
              E+L  S+ NVR    + +  SP CH ++   +G
Sbjct  102  --EVLQTSLDNVR----IIDWVSPSCHISSTKGMG  130



>ref|XP_006305972.1| hypothetical protein CARUB_v10011235mg [Capsella rubella]
 gb|EOA38870.1| hypothetical protein CARUB_v10011235mg [Capsella rubella]
Length=725

 Score = 52.8 bits (125),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 45/115 (39%), Positives = 58/115 (50%), Gaps = 23/115 (20%)
 Frame = +1

Query  226  CRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEK-PFLSSFSDGKNGVREIL  402
            CRD CGN+SI YPFGIG  K CY +KWF I C  SSS   ++  FL S        RE+ 
Sbjct  34   CRDHCGNISIPYPFGIG--KGCYKSKWFEIVCKSSSSSYQQQILFLPSIK------REVT  85

Query  403  SIS-------NVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSGTPFFYS  546
            S +       +V     +K   SPL HT      G ++ S+     L+ +PFF S
Sbjct  86   SFNLGNYFSISVSNKFFIK---SPLKHTGCLGRDGDSSSSL----NLTDSPFFLS  133



>ref|XP_010539154.1| PREDICTED: wall-associated receptor kinase 2-like [Tarenaya hassleriana]
Length=742

 Score = 52.8 bits (125),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 40/67 (60%), Gaps = 12/67 (18%)
 Frame = +1

Query  214  VPKGCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGKNGVR  393
            V  GC   CG+V+I YPFG  P  DCYLN++FLI C ++     +K FL      + G  
Sbjct  26   VQPGCETRCGDVTIKYPFGTSP--DCYLNEYFLITCNETE----QKAFL------RGGNI  73

Query  394  EILSISN  414
            ++L+IS+
Sbjct  74   QVLNISH  80



>ref|XP_010459161.1| PREDICTED: wall-associated receptor kinase-like 8 [Camelina sativa]
Length=720

 Score = 52.8 bits (125),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 42/114 (37%), Positives = 58/114 (51%), Gaps = 17/114 (15%)
 Frame = +1

Query  220  KGCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINC-TKSSSDGVEKPFLSSFSDGKNGVRE  396
            + CRD CG+V + YPFGIG  K CY NKWF + C + SSSD  +  FL          RE
Sbjct  31   RNCRDHCGDVKVPYPFGIG--KGCYKNKWFKVVCKSSSSSDQQQILFLPGIQ------RE  82

Query  397  ILS--ISNVRQSIIMKESF--SPLCHTTAGSAVGSNNLSIISNTKLSGTPFFYS  546
            + S  + N     +    +  SPL HT   S  G ++ S+     L+ +PF+ S
Sbjct  83   VTSFNLGNFFSMSVYNRFYIQSPLIHTGCPSRDGDSSSSL----NLTESPFYIS  132



>ref|XP_009793165.1| PREDICTED: wall-associated receptor kinase-like 6 isoform X1 
[Nicotiana sylvestris]
Length=750

 Score = 52.8 bits (125),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 22/33 (67%), Positives = 26/33 (79%), Gaps = 2/33 (6%)
 Frame = +1

Query  223  GCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINC  321
            GC+D CGN++I YPFGIG  KDCY +K F INC
Sbjct  43   GCKDKCGNLTIPYPFGIG--KDCYFDKAFEINC  73



>ref|XP_010497621.1| PREDICTED: wall-associated receptor kinase-like 22 isoform X1 
[Camelina sativa]
Length=749

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 39/111 (35%), Positives = 62/111 (56%), Gaps = 17/111 (15%)
 Frame = +1

Query  226  CRDTCGNVSIYYPFGIGPSKDCYLNK--WFLINCTKSSSDGVEKPFLSSFSDGKNGVREI  399
            C+  CG ++I YPFGIG  KDCYLNK  W+ + C  +S + V  P L S +      RE+
Sbjct  36   CQSHCGGIAIPYPFGIG--KDCYLNKDEWYEVTCNGTSGNPV--PILKSIN------REL  85

Query  400  LSISNVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKL--SGTPFFYS  546
            ++IS   +     +SF  +      +++G +N+  + NT L  +G+PFF +
Sbjct  86   VNISLPDE--FSGDSFGLIRIKNPVTSLGCSNMEEL-NTPLNVTGSPFFLT  133



>ref|XP_002265153.1| PREDICTED: wall-associated receptor kinase 5-like [Vitis vinifera]
Length=747

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 35/95 (37%), Positives = 51/95 (54%), Gaps = 16/95 (17%)
 Frame = +1

Query  208  SMVPKGCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGKNG  387
            S+   GCR+TCGNV I YPFGIG  + CY ++ F ++C  SS+    +P L         
Sbjct  28   SIAKPGCRETCGNVRIVYPFGIG--RGCYHDRNFEVSCDNSSNP--PRPCLVVIET----  79

Query  388  VREIL--SISNVRQSIIMKESFSPLCHTTAGSAVG  486
              E+L  S+ NVR    + +  SP CH ++   +G
Sbjct  80   --EVLQTSLDNVR----IIDWVSPSCHISSTKGMG  108



>ref|XP_006306734.1| hypothetical protein CARUB_v10008263mg [Capsella rubella]
 gb|EOA39632.1| hypothetical protein CARUB_v10008263mg [Capsella rubella]
Length=894

 Score = 52.4 bits (124),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 27/63 (43%), Positives = 38/63 (60%), Gaps = 9/63 (14%)
 Frame = +1

Query  226  CRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDG-VEKPFLSSFSDGKNGVREIL  402
            C  TCG +SI +PFGIG  KDCYLN W+ + C  ++S      PFL+  +      RE++
Sbjct  37   CNRTCGGISIPFPFGIG--KDCYLNSWYEVVCNSTTSGSRTNVPFLTRIN------REVV  88

Query  403  SIS  411
            +IS
Sbjct  89   NIS  91



>ref|XP_010474237.1| PREDICTED: wall-associated receptor kinase-like 9 [Camelina sativa]
Length=791

 Score = 52.4 bits (124),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (55%), Gaps = 8/71 (11%)
 Frame = +1

Query  199  DGISMVPKGCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDG  378
            D  ++    C+  CG + I YPFGIG  K CY+ KW  I C  SS+ G   PFLS  +  
Sbjct  23   DSANLTVSSCQPDCGGIEIPYPFGIG--KGCYMEKWDEITCNASSTSGKLVPFLSVIN--  78

Query  379  KNGVREILSIS  411
                +E+++IS
Sbjct  79   ----KEVVNIS  85



>ref|XP_011078223.1| PREDICTED: wall-associated receptor kinase-like 8 [Sesamum indicum]
Length=714

 Score = 52.4 bits (124),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 22/45 (49%), Positives = 31/45 (69%), Gaps = 2/45 (4%)
 Frame = +1

Query  202  GISMVPKGCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSS  336
             +S+  +GC+DTCGNV+I YPFGIG   +CY N  F + C  S++
Sbjct  7    ALSLAKRGCQDTCGNVTIPYPFGIG--SECYANSSFAVVCDNSTN  49



>ref|NP_177131.1| wall-associated receptor kinase-like 9 [Arabidopsis thaliana]
 sp|Q9C9L5.1|WAKLH_ARATH RecName: Full=Wall-associated receptor kinase-like 9; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAG52551.1|AC013289_18 putative protein kinase; 39563-42199 [Arabidopsis thaliana]
 gb|AEE34968.1| wall-associated receptor kinase-like 9 [Arabidopsis thaliana]
Length=792

 Score = 52.4 bits (124),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 41/119 (34%), Positives = 58/119 (49%), Gaps = 27/119 (23%)
 Frame = +1

Query  226  CRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGKNGVREILS  405
            C+  CG + I YPFG+G  K CYL KW+ I C  S+S G   P+LS  +      +E++ 
Sbjct  31   CQPDCGGIKIPYPFGMG--KGCYLEKWYEITCNTSTS-GKLVPYLSVIN------KEVVG  81

Query  406  IS-----------NVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSGTPFFYSS  549
            IS           N  QS+ +K   +P+    A     SN   + S   L+GTPF+ S 
Sbjct  82   ISLPTEGRGSRYNNPYQSVNIK---NPI----ASKECSSNGEELGSLLNLTGTPFYVSQ  133



>gb|KJB28014.1| hypothetical protein B456_005G021800, partial [Gossypium raimondii]
Length=459

 Score = 52.4 bits (124),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 37/109 (34%), Positives = 56/109 (51%), Gaps = 11/109 (10%)
 Frame = +1

Query  223  GCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGKNGVREIL  402
            GC +TCG VSI YPFGI      Y N WF + C + ++DG  KPF++  +       E+L
Sbjct  29   GCSETCGTVSIPYPFGIKRGCYAYNNSWFRVTCNE-TADG-PKPFITRIN------LELL  80

Query  403  SISNVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSGTPFFYSS  549
                +   ++     +P+ +   G   G N+    S+  L GTPFF+S+
Sbjct  81   GKFWLDNKVVTIN--NPVTYLNCGDK-GDNSTISPSSVNLQGTPFFFSN  126



>ref|XP_010245932.1| PREDICTED: uncharacterized protein LOC104589347 [Nelumbo nucifera]
Length=2108

 Score = 52.4 bits (124),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = +1

Query  205   ISMVPKGCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSS  333
             + +   GC+D CGN+SI YPFGIG + DC+LNK F   C+ +S
Sbjct  1102  LPLTKLGCQDKCGNLSIPYPFGIGDNPDCFLNKDFQFFCSGTS  1144



>ref|XP_006441107.1| hypothetical protein CICLE_v10023909mg, partial [Citrus clementina]
 gb|ESR54347.1| hypothetical protein CICLE_v10023909mg, partial [Citrus clementina]
Length=623

 Score = 52.4 bits (124),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 39/107 (36%), Positives = 54/107 (50%), Gaps = 16/107 (15%)
 Frame = +1

Query  226  CRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGKNGVREILS  405
            C+  CGNV+I YPFGIG  K CY +K F + C  SS  G  K FL+S ++ +     +  
Sbjct  27   CQYDCGNVTIRYPFGIG--KGCYFDKRFEVICDYSS--GSPKAFLASINNLQVLDNHVYG  82

Query  406  ISNVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSGTPFFYS  546
            +SN+R +I       P+      S   SN  S      LS +PF +S
Sbjct  83   VSNIRANI-------PVI-----SLKSSNLTSNAEGVSLSASPFTFS  117



>ref|XP_008365150.1| PREDICTED: wall-associated receptor kinase 2-like [Malus domestica]
Length=774

 Score = 52.4 bits (124),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 32/108 (30%), Positives = 52/108 (48%), Gaps = 9/108 (8%)
 Frame = +1

Query  49   MRAAGKEIVVATVLMMMSFTVMLTLAAEYEIPLddyddryyddEAENYKEDGISMVPKGC  228
            M  + +++++  +++++   V+L  A   +  L           +E         V  GC
Sbjct  1    MTMSKQKVLLQPIILLIVIEVLLAAATSAQTQLASPPLPSPPPPSE-------VEVKPGC  53

Query  229  RDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFS  372
            +D CGNVSI YPFG    K CYLN+ FLI C  +  +  +  F  S+S
Sbjct  54   QDKCGNVSIPYPFGT--KKGCYLNEDFLITCNSTHYEPPKPFFKKSYS  99



>gb|KFK43950.1| hypothetical protein AALP_AA1G195700 [Arabis alpina]
Length=695

 Score = 52.4 bits (124),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 41/119 (34%), Positives = 57/119 (48%), Gaps = 24/119 (20%)
 Frame = +1

Query  214  VPKGCRDTCGNVSIYYPFGIGPSKDCYLN--KWFLINCTKSSSDGVEKPFLSSFSDGKNG  387
            +   C+  CG + I YPFGIG  K CYLN  KW+ I C K+S   V  PFLSS +     
Sbjct  35   ISSSCQSHCGEIPIAYPFGIG--KGCYLNNDKWYEIICNKTSKSPV--PFLSSIN-----  85

Query  388  VREILSISNVRQSIIMKESFSPL-----CHTTAGSAVGSNNLSIISNTKLSGTPFFYSS  549
             +E+++IS       + + FS             S   SN   + S   + G+PFF +S
Sbjct  86   -KEVVNIS-------LPDDFSSAFGLIRIKNPVTSFGCSNKEQLSSALNVRGSPFFLTS  136



>gb|KJB29144.1| hypothetical protein B456_005G086700 [Gossypium raimondii]
Length=720

 Score = 52.4 bits (124),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 31/50 (62%), Gaps = 2/50 (4%)
 Frame = +1

Query  223  GCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFS  372
            GC+D CGN+SI YPFG+ P   CYLN+ FLI C  S S    +   S+F 
Sbjct  32   GCKDECGNMSIPYPFGMSPG--CYLNEGFLITCNTSVSPHRPQLLRSNFD  79



>ref|XP_011082236.1| PREDICTED: wall-associated receptor kinase-like 2 [Sesamum indicum]
Length=735

 Score = 52.0 bits (123),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 38/117 (32%), Positives = 56/117 (48%), Gaps = 17/117 (15%)
 Frame = +1

Query  199  DGISMVPKGCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDG  378
            DG  +   GC   CG++++ YPFGIG + +C +N +F INC  S +    K FL      
Sbjct  53   DGPYIAKPGCPSKCGDLTVPYPFGIGINANCSINPFFDINCNPSFNP--PKAFL------  104

Query  379  KNGVREILSISNVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSGTPFFYSS  549
              G  E+L IS  +  I  + + + LC        G+          LSGTPF +S+
Sbjct  105  --GNLEVLGISETKVHI--RNNLTSLCAVPGYILQGAKFY-----MDLSGTPFSFSN  152



>ref|XP_010459150.1| PREDICTED: wall-associated receptor kinase-like 1 [Camelina sativa]
Length=734

 Score = 52.0 bits (123),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 27/63 (43%), Positives = 40/63 (63%), Gaps = 8/63 (13%)
 Frame = +1

Query  226  CRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEK-PFLSSFSDGKNGVREIL  402
            C  TCG +SI +PFGIG  K+CY+N W+ + C  ++SD  +  PFLS  +      RE++
Sbjct  39   CNRTCGGISIPFPFGIG-EKNCYVNGWYEVICNPTTSDSNKTVPFLSMIN------REVV  91

Query  403  SIS  411
            +IS
Sbjct  92   NIS  94



>ref|XP_007034131.1| Wall associated kinase-like 6 [Theobroma cacao]
 gb|EOY05057.1| Wall associated kinase-like 6 [Theobroma cacao]
Length=759

 Score = 52.0 bits (123),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 38/109 (35%), Positives = 58/109 (53%), Gaps = 18/109 (17%)
 Frame = +1

Query  220  KGCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGKNGVREI  399
            K C  +CG V I YPFGI     CY+N WF + C   ++DG +KPFLSS +       E+
Sbjct  318  KSCTVSCGKVDIAYPFGI--EVGCYMNDWFKVTCN-DTADG-KKPFLSSIN------LEL  367

Query  400  LSISNVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSGTPFFYS  546
             S S    S+ +    +P+ +      + +N +S+     L+G+PFF+S
Sbjct  368  FSSSFTLGSVQVN---NPVTYIQC-QDIHNNEVSV----NLTGSPFFFS  408



>ref|XP_006349531.1| PREDICTED: wall-associated receptor kinase-like 6-like [Solanum 
tuberosum]
Length=191

 Score = 50.8 bits (120),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 32/90 (36%), Positives = 46/90 (51%), Gaps = 13/90 (14%)
 Frame = +1

Query  223  GCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGKNGVREIL  402
            GCR  CGNV++ YPFGIG   DC +N  F + C   S+DG +KP + S         E+ 
Sbjct  50   GCRKRCGNVTVPYPFGIG--SDCAINSGFEVIC-NVSTDGTQKPLIGSI--------EVY  98

Query  403  SISNVRQSIIMKESFSPLCHTTAGSAVGSN  492
             IS+    + +K + +  C+   GS    N
Sbjct  99   DISDAE--LRVKNAIAWRCYNENGSMYSEN  126



>ref|XP_004486489.1| PREDICTED: wall-associated receptor kinase-like 8-like [Cicer 
arietinum]
Length=725

 Score = 52.0 bits (123),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 31/113 (27%), Positives = 53/113 (47%), Gaps = 11/113 (10%)
 Frame = +1

Query  211  MVPKGCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGKNGV  390
            +  + C  TCG +SI +PFG+     CY +KWF + C   ++  +EKP+L S +      
Sbjct  33   IAQRDCASTCGTISIPFPFGMNEPH-CYAHKWFEVECKLDNTSHIEKPYLKSLN------  85

Query  391  REILSISNVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSGTPFFYSS  549
               L ++    +  + E  +P+ H+       +NN   +    L  +PF YS 
Sbjct  86   ---LEVTLFDVNSALVEIMNPIYHSNCKKNNNNNNNKTVV-INLKDSPFIYSQ  134



>ref|XP_010525668.1| PREDICTED: putative wall-associated receptor kinase-like 16 [Tarenaya 
hassleriana]
Length=741

 Score = 52.0 bits (123),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 25/49 (51%), Positives = 31/49 (63%), Gaps = 7/49 (14%)
 Frame = +1

Query  217  PK-GCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFL  360
            PK GCR  CGN++I+YPFG    + CYLN  FLI C + S    +KPF 
Sbjct  27   PKDGCRGNCGNLTIHYPFGT--EQGCYLNDGFLITCDRDS----DKPFF  69



>emb|CAN75091.1| hypothetical protein VITISV_032867 [Vitis vinifera]
Length=747

 Score = 52.0 bits (123),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 35/95 (37%), Positives = 51/95 (54%), Gaps = 16/95 (17%)
 Frame = +1

Query  208  SMVPKGCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGKNG  387
            S+   GCR+TCGNV I YPFGIG  + CY ++ F ++C  SS+    +P L         
Sbjct  28   SIAKPGCRETCGNVRIVYPFGIG--RGCYHDRNFEVSCDYSSNP--PRPCLVVIET----  79

Query  388  VREIL--SISNVRQSIIMKESFSPLCHTTAGSAVG  486
              E+L  S+ NVR    + +  SP CH ++   +G
Sbjct  80   --EVLQTSLDNVR----IIDWVSPSCHISSTKGMG  108



>gb|AFW85650.1| hypothetical protein ZEAMMB73_166927 [Zea mays]
Length=405

 Score = 51.6 bits (122),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 36/104 (35%), Positives = 49/104 (47%), Gaps = 13/104 (13%)
 Frame = +1

Query  226  CRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGKNGVREILS  405
            C   CG+VSI YPFGIGP   C + K F ++C +S S    +   + FSDG   V  +  
Sbjct  51   CPSKCGDVSIEYPFGIGPG--CAMEKGFELHCNESQSQDGRRSSTAYFSDGDLPV--LAD  106

Query  406  ISNVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSGTPF  537
            I  +   + +  S + +C          NN S      LSGTPF
Sbjct  107  ILLLHGQVRVMSSVASMC---------PNNRSTTYLLNLSGTPF  141



>ref|XP_011078212.1| PREDICTED: wall-associated receptor kinase-like 10 [Sesamum indicum]
Length=731

 Score = 52.0 bits (123),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 33/83 (40%), Positives = 46/83 (55%), Gaps = 10/83 (12%)
 Frame = +1

Query  208  SMVPKGCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGKNG  387
            S+   GC++TCGNV+I YPFGIG    CY N  F + C  S++    + +LSS       
Sbjct  24   SLAKPGCQETCGNVTIPYPFGIG--SQCYANSSFAVICDNSTNPA--RLYLSSIQ-----  74

Query  388  VREILSISNVRQSIIMKESFSPL  456
              EIL+IS V   + + +  SPL
Sbjct  75   -LEILNISLVDGIVRIVQPVSPL  96



>emb|CDX86600.1| BnaC08g01030D [Brassica napus]
Length=743

 Score = 52.0 bits (123),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 37/62 (60%), Gaps = 9/62 (15%)
 Frame = +1

Query  226  CRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGKNGVREILS  405
            C   CG++SI YPFGIG   DCYLN+WF I C  S+S G   P+L   +      +E++ 
Sbjct  31   CPSHCGSISIPYPFGIG--SDCYLNEWFAIQCNNSTS-GDLVPYLPKIN------KEVVK  81

Query  406  IS  411
            IS
Sbjct  82   IS  83



>ref|XP_010476713.1| PREDICTED: wall-associated receptor kinase-like 6 [Camelina sativa]
Length=715

 Score = 52.0 bits (123),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 38/65 (58%), Gaps = 11/65 (17%)
 Frame = +1

Query  226  CRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEK---PFLSSFSDGKNGVRE  396
            C   CG +SI +PFGIG  KDCYLN W+ + C  + S G+     PFLS  +      RE
Sbjct  29   CNRACGGISIPFPFGIG--KDCYLNGWYEVVCDTNISSGLSTTNVPFLSRIN------RE  80

Query  397  ILSIS  411
            +++IS
Sbjct  81   VVNIS  85



>ref|XP_006349532.1| PREDICTED: uncharacterized protein LOC102582197 [Solanum tuberosum]
Length=1726

 Score = 52.0 bits (123),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 37/117 (32%), Positives = 58/117 (50%), Gaps = 15/117 (13%)
 Frame = +1

Query  199   DGISMVPKGCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDG  378
             +G  +   GC   CGNV++ YPFGIG   DC  N  F +NC  +S DG +K  L     G
Sbjct  1016  EGAIVTKPGCAKQCGNVTVPYPFGIG--SDCVFNVRFELNC-NTSDDGSQKLIL-----G  1067

Query  379   KNGVREILSISNVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSGTPFFYSS  549
             +N V   +S +  R    +  SF   C+ ++G+ +     S+   T +   P+ +S+
Sbjct  1068  RNIVVYDISDAEFR----ISNSFGWRCYNSSGAVIDE---SLAWTTLIESGPYSFSA  1117



>ref|XP_010655763.1| PREDICTED: putative wall-associated receptor kinase-like 11 isoform 
X2 [Vitis vinifera]
Length=673

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 23/47 (49%), Positives = 31/47 (66%), Gaps = 2/47 (4%)
 Frame = +1

Query  193  KEDGISMVPKGCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSS  333
            +E G S+   GC + CGN++I YPFG+G  K CYL++ F I C  SS
Sbjct  25   QEAGASLTKPGCPEKCGNITIPYPFGMG--KGCYLHRDFKITCNMSS  69



>ref|XP_008352005.1| PREDICTED: putative wall-associated receptor kinase-like 16 [Malus 
domestica]
Length=760

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/88 (38%), Positives = 45/88 (51%), Gaps = 11/88 (13%)
 Frame = +1

Query  214  VPKGCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFS-------  372
            V  GC+  CGNVSI YPFG  P  DCY N+ FLI C  +  +   KPFL   +       
Sbjct  39   VKPGCQAKCGNVSIPYPFGTTP--DCYYNEDFLITCNDTHYN-PPKPFLGDSNIDVTNIS  95

Query  373  -DGKNGVREILSISNVRQSIIMKESFSP  453
             DGK  + + ++     +S +  ES +P
Sbjct  96   VDGKLHILQYIAKDCYNESGVSTESNTP  123



>gb|EMT18053.1| Wall-associated receptor kinase-like protein 8 [Aegilops tauschii]
Length=690

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 39/67 (58%), Gaps = 11/67 (16%)
 Frame = +1

Query  220  KGCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGKNGVREI  399
            +GCR  CG+  I YPFGIG    C + + F INC++ S DG +KPFL          REI
Sbjct  100  RGCRTHCGDFEIPYPFGIGIG--CAMGQGFEINCSR-SVDGNDKPFLLG--------REI  148

Query  400  LSISNVR  420
            +SIS  R
Sbjct  149  VSISLSR  155



>ref|XP_006384702.1| hypothetical protein POPTR_0004s20330g [Populus trichocarpa]
 gb|ERP62499.1| hypothetical protein POPTR_0004s20330g [Populus trichocarpa]
Length=727

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 39/113 (35%), Positives = 54/113 (48%), Gaps = 17/113 (15%)
 Frame = +1

Query  214  VPKGCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGKNGVR  393
            V  GC+D CGNVS+ YPFGIG  + C +N  F +NC   S +G  K +      G    R
Sbjct  29   VKPGCQDKCGNVSVPYPFGIGEPR-CAMNDDFFLNC---SDEGHPKLWFG----GNIPAR  80

Query  394  EILSISNVRQSIIMKESFSPL-CHTTAGSAVGSNNLSIISNTKLSGTPFFYSS  549
             I    +V +  I   S++P  C+   GS+    +  +I    L   PF YS 
Sbjct  81   NI----SVLEGTITASSYTPFNCYDRTGSSTEYYSPPVI----LGPGPFMYSD  125



>ref|XP_010497656.1| PREDICTED: wall-associated receptor kinase-like 1 [Camelina sativa]
Length=731

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 35/111 (32%), Positives = 54/111 (49%), Gaps = 14/111 (13%)
 Frame = +1

Query  226  CRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKS-SSDGVEKPFLSSFSDGKNGVREIL  402
            C  TCG +SI +PFGIG  KDCYLN W+ + C  + S      PFL+  +      RE++
Sbjct  38   CNRTCGGISIPFPFGIG--KDCYLNSWYEVVCNSTISGSRTTVPFLTRIN------REVV  89

Query  403  SIS-----NVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSGTPFF  540
            +IS     +    + +K   + L  ++   + GS       N    G+P+F
Sbjct  90   NISLPEIYDQHGVVYIKTHVTSLGCSSNNISQGSQKSLTGLNVTGKGSPYF  140



>gb|EMS57976.1| Wall-associated receptor kinase 3 [Triticum urartu]
Length=701

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 38/77 (49%), Gaps = 12/77 (16%)
 Frame = +1

Query  181  AENYKEDGISMVPKGCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFL  360
            A  Y   G ++    CR  CGNV I YPFGI P   C L   F ++C     DG+E+PF 
Sbjct  15   AAQYAPAGSAVPSSHCRRQCGNVEIPYPFGIDPG--CSLGDGFHLDC--KVHDGIERPFR  70

Query  361  SSFSDGKNGVREILSIS  411
            S F        E+L IS
Sbjct  71   SVF--------EVLDIS  79



>ref|XP_010664899.1| PREDICTED: putative wall-associated receptor kinase-like 16 [Vitis 
vinifera]
Length=743

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 33/47 (70%), Gaps = 4/47 (9%)
 Frame = +1

Query  223  GCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLS  363
            GC D+CG+VSI YPFG    +DCYLN+ FLI C  S+S  + K FL+
Sbjct  31   GCPDSCGDVSIPYPFGT--REDCYLNEEFLITCDNSTS--LPKAFLT  73



>ref|XP_006384710.1| hypothetical protein POPTR_0004s20410g [Populus trichocarpa]
 gb|ERP62507.1| hypothetical protein POPTR_0004s20410g [Populus trichocarpa]
Length=710

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 31/43 (72%), Gaps = 2/43 (5%)
 Frame = +1

Query  214  VPKGCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDG  342
            V  GC+D CG+VS+ YPFGIG  + C +NK F +NCT S +DG
Sbjct  24   VKPGCQDKCGDVSVPYPFGIG-EQSCAMNKPFFLNCT-SGADG  64



>gb|EMS61208.1| Wall-associated receptor kinase 3 [Triticum urartu]
Length=701

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 38/77 (49%), Gaps = 12/77 (16%)
 Frame = +1

Query  181  AENYKEDGISMVPKGCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFL  360
            A  Y   G ++    CR  CGNV I YPFGI P   C L   F ++C     DG+E+PF 
Sbjct  15   ATQYAPAGSAVPSSHCRRQCGNVEIPYPFGIDPG--CSLGDGFHLDC--KVHDGIERPFR  70

Query  361  SSFSDGKNGVREILSIS  411
            S F        E+L IS
Sbjct  71   SVF--------EVLDIS  79



>emb|CDY33355.1| BnaC05g12280D [Brassica napus]
Length=333

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 38/65 (58%), Gaps = 10/65 (15%)
 Frame = +1

Query  226  CRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDG---VEKPFLSSFSDGKNGVRE  396
            C  TCG VSI +PFGIG  K+CYLN WF + C   ++ G      PFLS  +      RE
Sbjct  41   CNTTCGRVSIPFPFGIG-RKECYLNSWFEVVCKTINTSGSSVTTVPFLSRLN------RE  93

Query  397  ILSIS  411
            +++IS
Sbjct  94   VVNIS  98



>ref|XP_010648089.1| PREDICTED: wall-associated receptor kinase-like 10 [Vitis vinifera]
Length=677

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/46 (50%), Positives = 30/46 (65%), Gaps = 3/46 (7%)
 Frame = +1

Query  223  GCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFL  360
            GC++ CG+V I YPFGIG S  CY ++WF + C  S+     KPFL
Sbjct  28   GCQERCGDVDIPYPFGIG-SAGCYFDEWFEVTCNNSTDP--PKPFL  70



>ref|XP_011006010.1| PREDICTED: wall-associated receptor kinase 2-like isoform X1 
[Populus euphratica]
Length=742

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 35/111 (32%), Positives = 53/111 (48%), Gaps = 13/111 (12%)
 Frame = +1

Query  214  VPKGCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGKNGVR  393
            V   C+D CGNVS+ YPFGIG  + C +NK F +NC+ +     E  F      G+N   
Sbjct  42   VKPDCQDKCGNVSVPYPFGIG-ERSCAMNKHFFLNCSSNDEGHPELWF------GRN--M  92

Query  394  EILSISNVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSGTPFFYS  546
             + +IS +  ++ +    +  C+  AG    S   S+     L   PF +S
Sbjct  93   PVHNISQLEGTVTLGIDAAFKCYNKAGMQTESFRQSMT----LGSGPFMFS  139



>emb|CDX72291.1| BnaC07g43130D [Brassica napus]
Length=708

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 30/48 (63%), Gaps = 2/48 (4%)
 Frame = +1

Query  226  CRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSF  369
            C   CG+V I YPFGIG  K CYL K + I C  ++S G + PFLS+ 
Sbjct  29   CESHCGDVEILYPFGIG--KGCYLEKSYEIQCPNTTSSGRQIPFLSAI  74



>ref|XP_010680098.1| PREDICTED: wall-associated receptor kinase 2-like [Beta vulgaris 
subsp. vulgaris]
Length=745

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 39/109 (36%), Positives = 55/109 (50%), Gaps = 10/109 (9%)
 Frame = +1

Query  223  GCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGKNGVREIL  402
            GC   CGNV+I YPFG G  ++C +  W+ I C  +++    KPFL   S+ +N   EIL
Sbjct  8    GCATRCGNVTIPYPFGFGLDEECSMGYWYNIRC--NTTFNPPKPFL---SESRN--LEIL  60

Query  403  SISNVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSGTPFFYSS  549
             IS     I      +  C+ +   AV SN L       L+ +PF +SS
Sbjct  61   EISETH--IRTNNFIAKRCYGSE-EAVKSNKLINTVMMYLTTSPFMFSS  106



>gb|KFK28618.1| hypothetical protein AALP_AA7G022800 [Arabis alpina]
Length=687

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 36/62 (58%), Gaps = 11/62 (18%)
 Frame = +1

Query  226  CRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGKNGVREILS  405
            C   CG +SI YPFGIG  KDCYLN W+ + C  ++S     PFL   +      RE+++
Sbjct  37   CNRVCGGISIPYPFGIG-GKDCYLNPWYEVVCNSTTS----VPFLPRIN------RELVN  85

Query  406  IS  411
            IS
Sbjct  86   IS  87



>emb|CBI31034.3| unnamed protein product [Vitis vinifera]
Length=321

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 47/92 (51%), Gaps = 10/92 (11%)
 Frame = +1

Query  193  KEDGISMVPKGCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFS  372
            KE   S    GC +TCGN++I YPFGIG  + CYL+K F I C  SS+     P L    
Sbjct  25   KETKASTAKPGCPETCGNLAIVYPFGIG--EGCYLDKRFEITCNNSSN---PHPVL-RLD  78

Query  373  DGKNGVREILSISNVRQSIIMKESFSPLCHTT  468
              K      +S+ +VR    + +  SPLC+  
Sbjct  79   QKKEAEVLDMSLEHVR----ITDWTSPLCYAN  106



>ref|XP_008225633.1| PREDICTED: putative wall-associated receptor kinase-like 16 [Prunus 
mume]
Length=762

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 26/38 (68%), Gaps = 2/38 (5%)
 Frame = +1

Query  223  GCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSS  336
            GC+D CGN+SI YPFGIGP   CYL   F I C +SS 
Sbjct  33   GCQDHCGNLSIPYPFGIGPG--CYLQPQFNITCNQSSQ  68



>ref|XP_003534784.1| PREDICTED: wall-associated receptor kinase-like 8-like [Glycine 
max]
Length=705

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 36/111 (32%), Positives = 52/111 (47%), Gaps = 19/111 (17%)
 Frame = +1

Query  223  GCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGKNGVREIL  402
            GC  TCG VSI YPFG+    +CY + WF I C K +S G +KP+L S +     + + L
Sbjct  30   GCNSTCGEVSIPYPFGM-KDPECYADGWFEIEC-KDTSQG-QKPYLKSLNLQVTSISDFL  86

Query  403  SISNVRQSI-------------IMKESFSPLCHTTAGS---AVGSNNLSII  507
             +  +   I             I     SP  ++   +   AVG NNL+ +
Sbjct  87   GLVTIMNPIYRWNCPSKRAMPAIKDLRGSPFVYSQESNKFVAVGCNNLAFL  137



>ref|XP_006385946.1| hypothetical protein POPTR_0003s18480g, partial [Populus trichocarpa]
 gb|ERP63743.1| hypothetical protein POPTR_0003s18480g, partial [Populus trichocarpa]
Length=572

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/38 (53%), Positives = 28/38 (74%), Gaps = 2/38 (5%)
 Frame = +1

Query  223  GCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSS  336
            GC D CG+++I YPFG G  KDCY ++WF I C K+++
Sbjct  32   GCPDRCGDITIPYPFGTG--KDCYKDEWFAIECNKTTN  67



>ref|XP_008353664.1| PREDICTED: wall-associated receptor kinase-like 8 [Malus domestica]
Length=327

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 34/47 (72%), Gaps = 4/47 (9%)
 Frame = +1

Query  226  CRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSS  366
            C+  CG+V+I YPFGIGP  +CYL++WF I+C  + +    KPFL+S
Sbjct  20   CQAQCGSVTIPYPFGIGP--NCYLDEWFSISCNDTYNP--SKPFLNS  62



>emb|CDX83955.1| BnaC08g16900D [Brassica napus]
Length=603

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 39/115 (34%), Positives = 59/115 (51%), Gaps = 19/115 (17%)
 Frame = +1

Query  211  MVPKGCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKS-SSDGVEKPFLSSFSDGKNG  387
            +  + C+  CG VS+ YPFGIG  + CY NKWF I C  S SSD     FL S       
Sbjct  29   LAKRNCKGHCGAVSVPYPFGIG--QGCYENKWFEIVCRNSNSSDQQPILFLPSIK-----  81

Query  388  VREI--LSISNVRQSIIMKESF--SPLCHTTAGSAVGSNNLSIISNTKLSGTPFF  540
             R++   ++      +++   +  SPL H+  G ++G  + S+     L+G+PFF
Sbjct  82   -RQVTNFNLGYFFPLLVLTNFYIQSPLKHS--GCSIGDADSSL----NLTGSPFF  129



>ref|XP_011095218.1| PREDICTED: wall-associated receptor kinase 2-like [Sesamum indicum]
Length=767

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/76 (32%), Positives = 42/76 (55%), Gaps = 8/76 (11%)
 Frame = +1

Query  202  GISMVPKGCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGK  381
            G+++   GC+  CGN+++ YPFG+G    C ++ WF INC  + +    KPF +      
Sbjct  39   GVNITKPGCQRKCGNLTVPYPFGVGIGSGCSIDPWFDINCNATFNP--PKPFTAK-----  91

Query  382  NGVREILSISNVRQSI  429
             G  E++ IS+ +  +
Sbjct  92   -GSLEVIEISDSQMRV  106



>ref|XP_009793166.1| PREDICTED: wall-associated receptor kinase 2-like isoform X2 
[Nicotiana sylvestris]
Length=566

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 29/39 (74%), Gaps = 2/39 (5%)
 Frame = +1

Query  223  GCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSD  339
            GC+D CGN++I YPFGIG  KDCY +K F INC   +++
Sbjct  43   GCKDKCGNLTIPYPFGIG--KDCYFDKAFEINCFDDNTN  79



>ref|XP_010277680.1| PREDICTED: wall-associated receptor kinase 2-like [Nelumbo nucifera]
Length=1088

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 34/56 (61%), Gaps = 3/56 (5%)
 Frame = +1

Query  205  ISMVPKGCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFS  372
            +S    GC+  CGN+SI YPFGIG   DC+++  F + C  +S+D    PFL ++ 
Sbjct  36   LSQTKPGCQFKCGNLSIPYPFGIGDDPDCFMDADFRLICNTTSTD---TPFLQTYD  88



>emb|CAN70207.1| hypothetical protein VITISV_007744 [Vitis vinifera]
Length=679

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/46 (50%), Positives = 30/46 (65%), Gaps = 3/46 (7%)
 Frame = +1

Query  223  GCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFL  360
            GC++ CG+V I YPFGIG S  CY ++WF + C  S+     KPFL
Sbjct  29   GCQEWCGDVDIPYPFGIG-SSGCYFDEWFEVTCNNSTDP--PKPFL  71



>ref|XP_002513974.1| kinase, putative [Ricinus communis]
 gb|EEF48557.1| kinase, putative [Ricinus communis]
Length=694

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 38/108 (35%), Positives = 57/108 (53%), Gaps = 19/108 (18%)
 Frame = +1

Query  226  CRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDGKNGVREILS  405
            C   CGNV I +PFGIG  K CY+++ F + C  SS     KPFL+S +     + E+LS
Sbjct  32   CESYCGNVPIEFPFGIG--KGCYMDESFEVTCNSSSEP--PKPFLTSIN---MELLEVLS  84

Query  406  ISNVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSGTPFFYSS  549
             + V+ +       +P+ ++       S+  S  S   LSGTPF +S+
Sbjct  85   PNQVQVN-------NPVIYSNC-----SHKTSTASRVSLSGTPFTFSN  120



>ref|XP_011082237.1| PREDICTED: wall-associated receptor kinase-like 2 [Sesamum indicum]
Length=728

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 38/117 (32%), Positives = 61/117 (52%), Gaps = 20/117 (17%)
 Frame = +1

Query  199  DGISMVPKGCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDG  378
            +G ++   GC   CG++++ YPFGIG   +C +N  F INC  +SS    K FL      
Sbjct  37   EGPNIAKPGCPSKCGDLNVPYPFGIGIKANCSINPSFDINC--NSSFDPPKAFL------  88

Query  379  KNGVREILSISNVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSGTPFFYSS  549
              G  E++ IS  +  I +K   + +C+ +       N++S++    LSGTPF  S+
Sbjct  89   --GNLEVVGISETQ--IRIKNHLASICNNSI-----DNSMSVLD---LSGTPFSLSN  133



>ref|XP_002265985.1| PREDICTED: wall-associated receptor kinase 5-like [Vitis vinifera]
Length=768

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 28/41 (68%), Gaps = 2/41 (5%)
 Frame = +1

Query  208  SMVPKGCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKS  330
            SMV  GC+DTCGN++I YPFGIG    CYL+  F I C  S
Sbjct  32   SMVKSGCQDTCGNITIPYPFGIG--SRCYLDPRFEITCDVS  70



>ref|XP_007035468.1| Wall associated kinase-like 6, putative [Theobroma cacao]
 gb|EOY06394.1| Wall associated kinase-like 6, putative [Theobroma cacao]
Length=719

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 29/43 (67%), Gaps = 2/43 (5%)
 Frame = +1

Query  208  SMVPKGCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSS  336
            S+    C D CGNVSI Y FGIG   DC+LN WF ++C ++SS
Sbjct  24   SIAKSKCPDLCGNVSIPYSFGIGA--DCFLNPWFEVSCNETSS  64



>gb|KEH35370.1| wall-associated receptor kinase-like protein [Medicago truncatula]
Length=751

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/45 (53%), Positives = 30/45 (67%), Gaps = 2/45 (4%)
 Frame = +1

Query  226  CRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFL  360
            C   CGNV+I +PFG   +KDC L+  FLI+C K+SS   E PFL
Sbjct  27   CPTKCGNVTIPFPFGT--TKDCSLDNTFLIDCNKTSSTSTEVPFL  69



>ref|XP_010691609.1| PREDICTED: wall-associated receptor kinase-like 6 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010691610.1| PREDICTED: wall-associated receptor kinase-like 6 [Beta vulgaris 
subsp. vulgaris]
Length=763

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 56/117 (48%), Gaps = 15/117 (13%)
 Frame = +1

Query  22   KEYVKVRIIMRAAGKEIVVATVLMMMSFTVMLTLAAEYEIPLddyddryyddEAENYKED  201
            K ++ + +I++   + I++   +++  F +M+ LA    +P            A+   E 
Sbjct  3    KSFIFISLILK---EHIMICLSVVLCRFVLMMCLAGAV-LP----------ASADPEPEG  48

Query  202  GISMVPKGCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFS  372
             I +   GC ++C N ++  PF  G   +CY + W+ I C  S S G E P LSSF 
Sbjct  49   SIPIAKPGCMESCQNSTVKVPFPFGIGDNCYSDPWYEIVCNTSLS-GAETPILSSFD  104



>ref|XP_006388728.1| hypothetical protein POPTR_0112s00230g [Populus trichocarpa]
 gb|ERP47642.1| hypothetical protein POPTR_0112s00230g [Populus trichocarpa]
Length=693

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 28/38 (74%), Gaps = 2/38 (5%)
 Frame = +1

Query  223  GCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSS  336
            GC D CG+++I YPFG G  KDCY ++WF + C K+++
Sbjct  32   GCPDRCGDITIPYPFGTG--KDCYKDEWFAVECNKTTN  67



>ref|XP_010269758.1| PREDICTED: wall-associated receptor kinase-like 8 [Nelumbo nucifera]
Length=690

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 40/117 (34%), Positives = 55/117 (47%), Gaps = 19/117 (16%)
 Frame = +1

Query  199  DGISMVPKGCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFSDG  378
            +   +   GC+D CG+VSI +PFGIG    C   K F I C +SSS     PFL S S G
Sbjct  28   EATPLAKPGCQDRCGDVSIPFPFGIGDR--CSKRKQFEITCDRSSSHPT--PFL-SLSTG  82

Query  379  KNGVREILSISNVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSGTPFFYSS  549
            +    ++L+IS   +  I   +FS             N   +     L G+PFF+S 
Sbjct  83   R---FQVLNISMNGELRINVPTFS-----------SPNETEVHGRISLEGSPFFFSQ  125



>ref|XP_007147592.1| hypothetical protein PHAVU_006G137600g [Phaseolus vulgaris]
 gb|ESW19586.1| hypothetical protein PHAVU_006G137600g [Phaseolus vulgaris]
Length=359

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 41/116 (35%), Positives = 60/116 (52%), Gaps = 16/116 (14%)
 Frame = +1

Query  202  GISMVPKGCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSS-SDGVEKPFLSSFSDG  378
            G+S+   GC   CGNV I +PFG+  S +CY  KWF I C  S+ ++    P+L S    
Sbjct  22   GLSVGKPGCDWRCGNVPIPFPFGM-KSFECYAGKWFEIECRNSTYTNYTHTPYLKSI---  77

Query  379  KNGVREILSISNVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSGTPFFYS  546
              GV E++SI+    ++ +K   +P+  +  GS       S   N  L G+PF YS
Sbjct  78   --GV-EVISINLQLGTVNIK---NPIYRSNCGSKD-----SPPVNKSLEGSPFVYS  122



>ref|XP_010655830.1| PREDICTED: wall-associated receptor kinase 2-like [Vitis vinifera]
Length=319

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 47/90 (52%), Gaps = 10/90 (11%)
 Frame = +1

Query  193  KEDGISMVPKGCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSFS  372
            KE   S    GC +TCGN++I YPFGIG  + CYL+K F I C  SS+     P L    
Sbjct  25   KETKASTAKPGCPETCGNLAIVYPFGIG--EGCYLDKRFEITCNNSSN---PHPVL-RLD  78

Query  373  DGKNGVREILSISNVRQSIIMKESFSPLCH  462
              K      +S+ +VR    + +  SPLC+
Sbjct  79   QKKEAEVLDMSLEHVR----ITDWTSPLCY  104



>ref|XP_009106689.1| PREDICTED: wall-associated receptor kinase-like 22 [Brassica 
rapa]
Length=752

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 42/69 (61%), Gaps = 9/69 (13%)
 Frame = +1

Query  226  CRDTCGNVSIYYPFGIGPSKDCYLNKWFLINC-TKSSSDGVEKPFLSSFSDGKNGVREIL  402
            C   CG +SI +PFGIG  K CYLN W+ + C T ++S  +  PFLS  +      RE++
Sbjct  39   CNRICGGISIPFPFGIG-QKHCYLNDWYKVVCNTTTTSGNLLAPFLSKIN------RELV  91

Query  403  SISNVRQSI  429
            +I+ +R SI
Sbjct  92   TIT-LRNSI  99



>ref|XP_004979730.1| PREDICTED: wall-associated receptor kinase 5-like [Setaria italica]
Length=737

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 39/119 (33%), Positives = 55/119 (46%), Gaps = 17/119 (14%)
 Frame = +1

Query  193  KEDGISMVPKG-CRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFLSSF  369
            K D    VP   C+  CG V I YPFGIG   +C L+  F ++C     DGV KPFL   
Sbjct  19   KHDPALAVPSSQCQTQCGGVEIPYPFGIG--DNCSLSSSFNVSC--QIHDGVYKPFL---  71

Query  370  SDGKNGVREILSISNVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSGTPFFYS  546
                 G  E+L+IS  + +I +    S  C+  +   +  N   +     + G PF +S
Sbjct  72   -----GFVEVLNISLAQGTIRVLNQISTYCYNNSSGQMEDNRWWL----DIRGGPFRFS  121



>gb|AGT16313.1| wall-associated kinase [Saccharum hybrid cultivar R570]
Length=665

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 31/46 (67%), Gaps = 3/46 (7%)
 Frame = +1

Query  223  GCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFL  360
            GCR  CG+V I YPFGIG    C + K F INC K++  G+EKPF+
Sbjct  26   GCRTRCGDVEIPYPFGIGIG--CAIEKGFEINCNKTAG-GIEKPFI  68



>ref|XP_006385943.1| hypothetical protein POPTR_0003s18440g, partial [Populus trichocarpa]
 gb|ERP63740.1| hypothetical protein POPTR_0003s18440g, partial [Populus trichocarpa]
Length=645

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 28/38 (74%), Gaps = 2/38 (5%)
 Frame = +1

Query  223  GCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSS  336
            GC D CG+++I YPFG G  KDCY ++WF + C K+++
Sbjct  21   GCPDRCGDITIPYPFGTG--KDCYKDEWFAVECNKTTN  56



>ref|XP_010648101.1| PREDICTED: wall-associated receptor kinase-like 1 [Vitis vinifera]
Length=325

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/46 (50%), Positives = 30/46 (65%), Gaps = 3/46 (7%)
 Frame = +1

Query  223  GCRDTCGNVSIYYPFGIGPSKDCYLNKWFLINCTKSSSDGVEKPFL  360
            GC++ CG+V I YPFGIG S  CY ++WF + C  S+     KPFL
Sbjct  28   GCQEWCGDVDIPYPFGIG-SSGCYFDEWFEVTCNNSTDP--PKPFL  70



Lambda      K        H        a         alpha
   0.318    0.133    0.387    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 590079713720