BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001N11

Length=570
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

dbj|BAQ15377.1|  cryptochrome 1                                         340   9e-110   Ipomoea nil [qian niu]
gb|AJA72482.1|  cryptochrome 1                                          339   2e-109   Ipomoea purpurea
ref|XP_006833448.1|  hypothetical protein AMTR_s02137p00007130          304   7e-102   
ref|XP_009761809.1|  PREDICTED: cryptochrome-1-like isoform X1          313   2e-99    Nicotiana sylvestris
ref|NP_001234667.1|  cryptochrome 1                                     313   3e-99    Solanum lycopersicum
ref|XP_010089879.1|  hypothetical protein L484_003096                   311   2e-98    Morus notabilis
ref|XP_007141180.1|  hypothetical protein PHAVU_008G173700g             310   6e-98    Phaseolus vulgaris [French bean]
ref|XP_011074184.1|  PREDICTED: cryptochrome-1 isoform X1               309   7e-98    Sesamum indicum [beniseed]
ref|XP_002301054.1|  cryptochrome 1 family protein                      309   1e-97    Populus trichocarpa [western balsam poplar]
ref|XP_006364857.1|  PREDICTED: cryptochrome-1-like isoform X1          309   1e-97    Solanum tuberosum [potatoes]
gb|AEK26572.1|  cryptochrome 1.2                                        309   1e-97    Populus tremula [European aspen]
ref|XP_002307379.1|  cryptochrome 1 family protein                      308   3e-97    Populus trichocarpa [western balsam poplar]
gb|KHN44791.1|  Cryptochrome-1                                          307   5e-97    Glycine soja [wild soybean]
ref|NP_001242152.1|  cryptochrome-1-like                                307   5e-97    Glycine max [soybeans]
ref|XP_011004801.1|  PREDICTED: cryptochrome-1-like isoform X1          306   7e-97    Populus euphratica
gb|KDP41383.1|  hypothetical protein JCGZ_15790                         306   1e-96    Jatropha curcas
ref|XP_003615112.1|  Cryptochrome                                       305   3e-96    Medicago truncatula
ref|XP_007018772.1|  CRY1 isoform 1                                     305   3e-96    Theobroma cacao [chocolate]
gb|KHG11746.1|  Cryptochrome-1 -like protein                            305   3e-96    Gossypium arboreum [tree cotton]
gb|KJB59058.1|  hypothetical protein B456_009G236700                    305   4e-96    Gossypium raimondii
gb|KJB59057.1|  hypothetical protein B456_009G236700                    305   4e-96    Gossypium raimondii
gb|AEK26571.1|  cryptochrome 1.1                                        304   6e-96    Populus tremula [European aspen]
gb|EYU36499.1|  hypothetical protein MIMGU_mgv1a002293mg                305   6e-96    Erythranthe guttata [common monkey flower]
ref|XP_010538941.1|  PREDICTED: LOW QUALITY PROTEIN: cryptochrome...    301   6e-96    
ref|XP_010543979.1|  PREDICTED: cryptochrome-1                          304   9e-96    Tarenaya hassleriana [spider flower]
emb|CDP01060.1|  unnamed protein product                                303   2e-95    Coffea canephora [robusta coffee]
ref|NP_001240855.1|  cryptochrome-1-like                                303   3e-95    Glycine max [soybeans]
ref|XP_010060002.1|  PREDICTED: cryptochrome-1 isoform X1               302   3e-95    Eucalyptus grandis [rose gum]
gb|ACU44659.1|  cryptochrome 1                                          302   3e-95    Medicago sativa [alfalfa]
ref|XP_002285792.1|  PREDICTED: cryptochrome-1 isoform X1               301   6e-95    Vitis vinifera
ref|NP_001241002.1|  cryptochrome-1-like                                301   6e-95    Glycine max [soybeans]
emb|CBI19162.3|  unnamed protein product                                302   7e-95    Vitis vinifera
gb|ABX80391.1|  cryptochrome 1                                          301   7e-95    Vitis riparia [frost grape]
gb|AAR08429.1|  cryptochrome 1                                          301   9e-95    Orobanche minor
ref|XP_010676474.1|  PREDICTED: cryptochrome-1 isoform X1               301   9e-95    Beta vulgaris subsp. vulgaris [field beet]
gb|ABX79355.1|  cryptochrome 1                                          301   9e-95    Vitis vinifera
ref|XP_010676482.1|  PREDICTED: cryptochrome-1 isoform X2               301   9e-95    Beta vulgaris subsp. vulgaris [field beet]
ref|NP_001235205.1|  cryptochrome 1                                     300   2e-94    Glycine max [soybeans]
ref|XP_010269331.1|  PREDICTED: LOW QUALITY PROTEIN: cryptochrome...    295   3e-94    
ref|XP_006433985.1|  hypothetical protein CICLE_v10000591mg             298   4e-94    
gb|AAS79664.1|  mutant cryptochrome 1-1 protein                         299   6e-94    Pisum sativum [garden pea]
gb|AAO23970.1|  cryptochrome 1                                          299   6e-94    Pisum sativum [garden pea]
ref|XP_006433984.1|  hypothetical protein CICLE_v10000591mg             298   1e-93    Citrus clementina [clementine]
pdb|1U3C|A  Chain A, Crystal Structure Of The Phr Domain Of Crypt...    293   1e-93    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006472600.1|  PREDICTED: cryptochrome-1-like isoform X1          297   4e-93    Citrus sinensis [apfelsine]
gb|AAB28725.2|  flavin-type blue-light photoreceptor                    293   4e-93    Arabidopsis thaliana [mouse-ear cress]
gb|KFK32104.1|  hypothetical protein AALP_AA6G199300                    297   5e-93    Arabis alpina [alpine rockcress]
ref|XP_004490375.1|  PREDICTED: cryptochrome-1-like                     296   5e-93    Cicer arietinum [garbanzo]
ref|XP_010421806.1|  PREDICTED: LOW QUALITY PROTEIN: cryptochrome...    293   5e-93    
dbj|BAK61537.1|  cryptochrome1b                                         286   6e-93    Glycine soja [wild soybean]
dbj|BAJ15771.1|  cryptochrome1                                          296   1e-92    Cardamine nipponica
dbj|BAJ15777.1|  cryptochrome1                                          296   1e-92    Cardamine nipponica
dbj|BAJ15775.1|  cryptochrome1                                          296   1e-92    Cardamine nipponica
dbj|BAJ15776.1|  cryptochrome1                                          296   1e-92    Cardamine nipponica
dbj|BAJ15769.1|  cryptochrome1                                          296   1e-92    Cardamine nipponica
dbj|BAJ15781.1|  cryptochrome1                                          296   1e-92    Cardamine alpina
ref|NP_567341.1|  cryptochrome-1                                        295   1e-92    Arabidopsis thaliana [mouse-ear cress]
gb|AAB28724.1|  flavin-type blue-light photoreceptor                    295   1e-92    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008219437.1|  PREDICTED: cryptochrome-1 isoform X1               295   2e-92    Prunus mume [ume]
ref|XP_007225162.1|  hypothetical protein PRUPE_ppa002375mg             295   2e-92    Prunus persica
gb|ACX49996.1|  cryptochrome 1                                          295   2e-92    Capsella bursa-pastoris
ref|XP_002874505.1|  hypothetical protein ARALYDRAFT_327070             295   2e-92    
ref|XP_006360269.1|  PREDICTED: cryptochrome-1-like                     292   2e-92    Solanum tuberosum [potatoes]
gb|ACX49997.1|  cryptochrome 1                                          295   2e-92    Capsella bursa-pastoris
emb|CAB78016.1|  Arabidopsis thaliana flavin-type blue-light phot...    296   3e-92    Arabidopsis thaliana [mouse-ear cress]
gb|AAD17364.1|  Arabidopsis thaliana flavin-type blue-light photo...    295   3e-92    Arabidopsis thaliana [mouse-ear cress]
gb|AHZ89698.1|  cryptochrome 1                                          295   3e-92    Dimocarpus longan [longan]
prf||1924377A  blue light photoreceptor                                 294   4e-92 
gb|ACX49994.1|  cryptochrome 1                                          293   1e-91    Capsella bursa-pastoris
gb|AAK32756.1|AF361588_1  AT4g08920/hy4                                 293   1e-91    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007136253.1|  hypothetical protein PHAVU_009G031300g             292   3e-91    Phaseolus vulgaris [French bean]
gb|KJB59920.1|  hypothetical protein B456_009G280900                    292   3e-91    Gossypium raimondii
gb|KHG05452.1|  Cryptochrome-1 -like protein                            291   5e-91    Gossypium arboreum [tree cotton]
ref|XP_009113505.1|  PREDICTED: cryptochrome-1 isoform X2               291   6e-91    Brassica rapa
ref|XP_009113504.1|  PREDICTED: cryptochrome-1 isoform X1               291   7e-91    Brassica rapa
emb|CDX75131.1|  BnaC09g25510D                                          291   8e-91    
emb|CDY54706.1|  BnaAnng13370D                                          291   9e-91    Brassica napus [oilseed rape]
ref|XP_009348096.1|  PREDICTED: cryptochrome-1-like                     291   1e-90    Pyrus x bretschneideri [bai li]
ref|NP_001288891.1|  cryptochrome-1                                     291   1e-90    Brassica rapa
ref|NP_001266960.1|  uncharacterized protein LOC101311001               290   2e-90    Fragaria vesca [alpine strawberry]
dbj|BAM36552.1|  cryptochrome1                                          288   8e-90    Fragaria x ananassa
ref|XP_009599628.1|  PREDICTED: cryptochrome-1-like isoform X1          287   3e-89    Nicotiana tomentosiformis
ref|XP_008391090.1|  PREDICTED: cryptochrome-1 isoform X1               286   4e-89    
ref|XP_010939648.1|  PREDICTED: cryptochrome-1-like isoform X2          285   2e-88    
ref|NP_001234577.1|  cryptochrome 1b                                    282   3e-88    Solanum lycopersicum
ref|XP_010939647.1|  PREDICTED: cryptochrome-1-like isoform X1          284   4e-88    Elaeis guineensis
ref|XP_008790851.1|  PREDICTED: cryptochrome-1-like                     282   3e-87    Phoenix dactylifera
ref|XP_010937445.1|  PREDICTED: cryptochrome-1-like isoform X2          281   7e-87    
gb|AGU91427.1|  cryptochrome 1.2                                        280   7e-87    Chrysanthemum boreale
gb|ABR17701.1|  unknown                                                 280   9e-87    Picea sitchensis
ref|XP_010937444.1|  PREDICTED: cryptochrome-1-like isoform X1          281   1e-86    Elaeis guineensis
ref|XP_009403073.1|  PREDICTED: cryptochrome-1                          280   2e-86    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010267717.1|  PREDICTED: cryptochrome-1 isoform X3               279   3e-86    Nelumbo nucifera [Indian lotus]
ref|XP_010267691.1|  PREDICTED: cryptochrome-1 isoform X1               279   3e-86    Nelumbo nucifera [Indian lotus]
ref|XP_010267708.1|  PREDICTED: cryptochrome-1 isoform X2               279   3e-86    Nelumbo nucifera [Indian lotus]
ref|XP_008802203.1|  PREDICTED: cryptochrome-1-like isoform X3          278   8e-86    
ref|XP_010535517.1|  PREDICTED: cryptochrome-1-like                     278   8e-86    Tarenaya hassleriana [spider flower]
ref|XP_008802202.1|  PREDICTED: cryptochrome-1-like isoform X2          278   2e-85    
ref|XP_008802200.1|  PREDICTED: cryptochrome-1-like isoform X1          278   4e-85    
ref|XP_008466234.1|  PREDICTED: cryptochrome-1 isoform X3               273   1e-84    Cucumis melo [Oriental melon]
ref|XP_004136290.1|  PREDICTED: cryptochrome-1-like                     274   3e-84    Cucumis sativus [cucumbers]
ref|XP_008466232.1|  PREDICTED: cryptochrome-1 isoform X1               274   3e-84    Cucumis melo [Oriental melon]
ref|XP_011016468.1|  PREDICTED: cryptochrome-1 isoform X1               272   1e-83    Populus euphratica
dbj|BAP76061.1|  putative CRY1                                          271   4e-83    Cryptomeria japonica
dbj|BAL41964.1|  CRY1                                                   252   3e-82    Cardamine glauca
dbj|BAL41922.1|  CRY1                                                   252   4e-82    Cardamine nipponica
gb|AEK05699.1|  cryptochrome 1 protein 2                                267   5e-82    Populus balsamifera [balsam poplar]
gb|AEK05698.1|  cryptochrome 1 protein 2                                267   5e-82    Populus balsamifera [balsam poplar]
gb|AEK05709.1|  cryptochrome 1 protein 2                                267   5e-82    Populus balsamifera [balsam poplar]
dbj|BAL41939.1|  CRY1                                                   251   7e-82    Cardamine nipponica
dbj|BAL41953.1|  CRY1                                                   251   1e-81    Cardamine bellidifolia [alpine bittercress]
gb|AEK05708.1|  cryptochrome 1 protein 2                                265   2e-81    Populus balsamifera [balsam poplar]
gb|AEK05690.1|  cryptochrome 1 protein 1                                261   5e-80    Populus balsamifera [balsam poplar]
gb|AEK05692.1|  cryptochrome 1 protein 1                                261   8e-80    Populus balsamifera [balsam poplar]
gb|AEK05691.1|  cryptochrome 1 protein 1                                261   8e-80    Populus balsamifera [balsam poplar]
gb|AEK05695.1|  cryptochrome 1 protein 1                                260   2e-79    Populus balsamifera [balsam poplar]
gb|AEK05693.1|  cryptochrome 1 protein 1                                259   4e-79    Populus balsamifera [balsam poplar]
ref|XP_009599630.1|  PREDICTED: cryptochrome-1-like isoform X3          257   4e-78    Nicotiana tomentosiformis
ref|XP_009334353.1|  PREDICTED: cryptochrome-1-like                     248   6e-75    
ref|XP_002513922.1|  DNA photolyase, putative                           248   1e-74    
gb|AGI61039.1|  blue-light photoreceptor cryptochrome 4                 245   3e-73    Asplenium yunnanense
ref|XP_003579874.1|  PREDICTED: cryptochrome-1-like                     245   4e-73    Brachypodium distachyon [annual false brome]
dbj|BAE54523.1|  cryptochrome                                           244   9e-73    Marchantia paleacea subsp. diptera
emb|CAD40850.1|  OSJNBa0086B14.23                                       243   1e-72    Oryza sativa Japonica Group [Japonica rice]
dbj|BAB70688.2|  cryptochrome 1b                                        243   1e-72    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001052950.1|  Os04g0452100                                       243   1e-72    
ref|XP_008667261.1|  PREDICTED: uncharacterized protein LOC100194...    243   2e-72    
gb|EMT05360.1|  Cryptochrome-1                                          242   4e-72    
gb|ABB13328.1|  cryptochrome 1a                                         241   6e-72    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006652348.1|  PREDICTED: cryptochrome-1-like isoform X1          241   1e-71    Oryza brachyantha
gb|ABX58028.1|  cryptochrome 1a                                         240   2e-71    Triticum aestivum [Canadian hard winter wheat]
dbj|BAA32807.1|  blue-light photoreceptor                               239   2e-71    Adiantum capillus-veneris [maidenhair fern]
ref|XP_001751763.1|  cryptochrome 1a                                    239   5e-71    
gb|ABX58027.1|  cryptochrome 1a                                         239   5e-71    Triticum aestivum [Canadian hard winter wheat]
dbj|BAA32808.1|  blue-light photoreceptor                               238   8e-71    Adiantum capillus-veneris [maidenhair fern]
dbj|BAA88423.1|  blue light photoreceptor                               238   9e-71    Adiantum capillus-veneris [maidenhair fern]
dbj|BAB70665.1|  blue-light receptor cryptochrome                       239   1e-70    Physcomitrella patens
gb|AGI61037.1|  blue-light photoreceptor cryptochrome 1                 235   2e-70    Asplenium yunnanense
ref|XP_010235580.1|  PREDICTED: cryptochrome-1-like                     237   2e-70    
gb|ABB13331.1|  cryptochrome 1b                                         238   3e-70    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AFW62704.1|  hypothetical protein ZEAMMB73_163109                    223   4e-70    
gb|AGI61038.1|  blue-light photoreceptor cryptochrome 2                 235   1e-69    Asplenium yunnanense
gb|AEA50864.1|  cry2-2                                                  220   3e-69    Populus tremula [European aspen]
gb|EAZ30924.1|  hypothetical protein OsJ_15004                          233   1e-68    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010262313.1|  PREDICTED: cryptochrome-1-like isoform X2          231   3e-68    Nelumbo nucifera [Indian lotus]
ref|XP_010262312.1|  PREDICTED: cryptochrome-1-like isoform X1          231   3e-68    
ref|XP_007035109.1|  Cryptochrome 2 isoform 1                           230   4e-68    
ref|XP_007035110.1|  Cryptochrome 2 isoform 2                           230   5e-68    
ref|XP_007035111.1|  Cryptochrome 2 isoform 3                           230   6e-68    
gb|KJB38412.1|  hypothetical protein B456_006G253700                    224   1e-67    Gossypium raimondii
dbj|BAK61519.1|  cryptochrome1a                                         214   1e-67    Glycine soja [wild soybean]
gb|KJB38413.1|  hypothetical protein B456_006G253700                    224   1e-67    Gossypium raimondii
ref|XP_004952854.1|  PREDICTED: cryptochrome-1-like isoform X2          230   2e-67    Setaria italica
ref|XP_010104735.1|  hypothetical protein L484_021422                   229   2e-67    
ref|XP_004952853.1|  PREDICTED: cryptochrome-1-like isoform X1          229   2e-67    Setaria italica
dbj|BAA32809.1|  blue-light photoreceptor                               229   2e-67    Adiantum capillus-veneris [maidenhair fern]
gb|AAV97867.1|  cryptochrome 2                                          229   2e-67    Sorghum bicolor [broomcorn]
dbj|BAB70686.1|  cryptochrome 1a                                        229   2e-67    Oryza sativa Japonica Group [Japonica rice]
gb|AAN37909.1|  cryptochrome 2 apoprotein                               229   3e-67    Sorghum bicolor [broomcorn]
ref|NP_001047200.1|  Os02g0573200                                       229   3e-67    
gb|KJB38414.1|  hypothetical protein B456_006G253700                    226   6e-67    Gossypium raimondii
dbj|BAP76063.1|  putative CRY2                                          228   7e-67    Cryptomeria japonica
gb|AAO23971.1|  cryptochrome 2A                                         220   1e-66    Pisum sativum [garden pea]
gb|AGV77084.1|  CRY2                                                    226   2e-66    Picea abies
ref|XP_010556906.1|  PREDICTED: cryptochrome-1 isoform X2               225   2e-66    Tarenaya hassleriana [spider flower]
dbj|BAK61600.1|  cryptochrome2c                                         220   4e-66    Glycine soja [wild soybean]
gb|KJB38410.1|  hypothetical protein B456_006G253700                    225   4e-66    Gossypium raimondii
dbj|BAK61603.1|  cryptochrome2c                                         220   4e-66    Glycine soja [wild soybean]
ref|XP_010556905.1|  PREDICTED: cryptochrome-1 isoform X1               225   4e-66    Tarenaya hassleriana [spider flower]
ref|XP_010671035.1|  PREDICTED: cryptochrome-1                          225   4e-66    Beta vulgaris subsp. vulgaris [field beet]
dbj|BAK61601.1|  cryptochrome2c                                         219   4e-66    Glycine soja [wild soybean]
ref|XP_011030501.1|  PREDICTED: cryptochrome-1 isoform X2               224   6e-66    Populus euphratica
ref|XP_011030500.1|  PREDICTED: cryptochrome-1 isoform X1               224   6e-66    Populus euphratica
ref|XP_004975808.1|  PREDICTED: cryptochrome-1-like isoform X1          226   7e-66    
ref|XP_004975809.1|  PREDICTED: cryptochrome-1-like isoform X2          225   8e-66    Setaria italica
ref|NP_001183937.1|  cryptochrome 2                                     223   2e-65    Zea mays [maize]
gb|KHG08367.1|  Cryptochrome-2 -like protein                            223   3e-65    Gossypium arboreum [tree cotton]
ref|XP_010920468.1|  PREDICTED: cryptochrome-1 isoform X1               223   4e-65    Elaeis guineensis
ref|XP_008677764.1|  PREDICTED: cryptochrome 2 isoform X2               223   4e-65    Zea mays [maize]
ref|XP_010920471.1|  PREDICTED: cryptochrome-1 isoform X2               223   4e-65    Elaeis guineensis
ref|XP_008677763.1|  PREDICTED: cryptochrome 2 isoform X1               223   6e-65    Zea mays [maize]
ref|XP_006846831.1|  hypothetical protein AMTR_s00148p00098440          222   6e-65    
ref|XP_010483734.1|  PREDICTED: cryptochrome-2                          221   7e-65    Camelina sativa [gold-of-pleasure]
ref|XP_010457482.1|  PREDICTED: cryptochrome-2-like                     221   8e-65    Camelina sativa [gold-of-pleasure]
ref|XP_010475095.1|  PREDICTED: cryptochrome-2-like isoform X2          221   8e-65    Camelina sativa [gold-of-pleasure]
ref|XP_011091317.1|  PREDICTED: cryptochrome-1                          222   9e-65    Sesamum indicum [beniseed]
gb|KJB28459.1|  hypothetical protein B456_005G050000                    221   9e-65    Gossypium raimondii
gb|KJB28458.1|  hypothetical protein B456_005G050000                    221   9e-65    Gossypium raimondii
gb|AAS79665.1|  cryptochrome 2A apoprotein                              221   9e-65    Pisum sativum [garden pea]
ref|XP_010475092.1|  PREDICTED: cryptochrome-2-like isoform X1          221   1e-64    Camelina sativa [gold-of-pleasure]
gb|KHN05061.1|  Cryptochrome-2                                          221   1e-64    Glycine soja [wild soybean]
ref|XP_008791585.1|  PREDICTED: cryptochrome-1                          221   2e-64    
ref|NP_001276254.1|  cryptochrome-2-like                                221   2e-64    Glycine max [soybeans]
gb|AAO23972.1|  cryptochrome 2B                                         220   2e-64    Pisum sativum [garden pea]
gb|EEC73456.1|  hypothetical protein OsI_07758                          222   2e-64    Oryza sativa Indica Group [Indian rice]
gb|AAS79667.1|  cryptochrome 2B apoprotein                              219   3e-64    Pisum sativum [garden pea]
gb|KEH42771.1|  cryptochrome 2B apoprotein                              220   4e-64    Medicago truncatula
gb|KEH42772.1|  cryptochrome 2B apoprotein                              219   4e-64    Medicago truncatula
ref|XP_002892215.1|  hypothetical protein ARALYDRAFT_470417             219   4e-64    
gb|AFK29440.1|  cryptochrome 2                                          219   5e-64    Arabidopsis lyrata subsp. lyrata
ref|XP_002988890.1|  hypothetical protein SELMODRAFT_967                216   6e-64    
dbj|BAD23781.1|  putative cryptochrome 2                                211   7e-64    Oryza sativa Japonica Group [Japonica rice]
ref|XP_007143870.1|  hypothetical protein PHAVU_007G108900g             219   7e-64    Phaseolus vulgaris [French bean]
ref|XP_006420219.1|  hypothetical protein CICLE_v10004525mg             219   8e-64    Citrus clementina [clementine]
ref|XP_006420220.1|  hypothetical protein CICLE_v10004525mg             219   8e-64    
ref|XP_006307024.1|  hypothetical protein CARUB_v10008610mg             218   9e-64    
gb|AFK29439.1|  cryptochrome 2                                          218   2e-63    Arabidopsis kamchatica
emb|CDX89827.1|  BnaA10g02550D                                          213   2e-63    
emb|CDX86636.1|  BnaC08g00670D                                          217   2e-63    
gb|KDO57602.1|  hypothetical protein CISIN_1g006464mg                   217   4e-63    Citrus sinensis [apfelsine]
ref|XP_006489737.1|  PREDICTED: cryptochrome-2-like                     217   4e-63    Citrus sinensis [apfelsine]
gb|KDO57603.1|  hypothetical protein CISIN_1g006464mg                   217   4e-63    Citrus sinensis [apfelsine]
dbj|BAI47556.1|  cryptochrome2                                          217   4e-63    Glycine max [soybeans]
gb|AFK29441.1|  cryptochrome 2                                          216   4e-63    Arabidopsis halleri subsp. gemmifera
dbj|BAC67178.1|  cryptochrome 2                                         216   4e-63    Armoracia rusticana [horseradish]
dbj|BAC67177.1|  cryptochrome 2                                         216   5e-63    Armoracia rusticana [horseradish]
ref|XP_010274772.1|  PREDICTED: cryptochrome-1-like isoform X2          216   5e-63    Nelumbo nucifera [Indian lotus]
ref|XP_010274771.1|  PREDICTED: cryptochrome-1-like isoform X1          217   5e-63    Nelumbo nucifera [Indian lotus]
dbj|BAM36553.1|  cryptochrome 2                                         217   5e-63    Fragaria x ananassa
gb|AFK29442.1|  cryptochrome 2                                          216   6e-63    Arabidopsis halleri subsp. halleri
gb|ADU19845.1|  cryptochrome 2b                                         215   7e-63    Brassica napus [oilseed rape]
gb|KDP40329.1|  hypothetical protein JCGZ_02327                         216   7e-63    Jatropha curcas
ref|NP_001170477.1|  LOC100384475                                       217   9e-63    Zea mays [maize]
dbj|BAA88424.1|  blue light photoreceptor                               213   1e-62    Adiantum capillus-veneris [maidenhair fern]
gb|AAT80619.1|  cryptochrome 2                                          215   1e-62    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008644162.1|  PREDICTED: LOC100384475 isoform X1                 217   1e-62    Zea mays [maize]
gb|ABY77607.1|  At1g04400                                               215   1e-62    Arabidopsis thaliana [mouse-ear cress]
dbj|BAC67176.1|  cryptochrome 2                                         215   1e-62    Armoracia rusticana [horseradish]
ref|XP_008644161.1|  PREDICTED: LOC100384475 isoform X2                 217   1e-62    Zea mays [maize]
gb|AAL16377.1|  cryptochrome 2                                          215   1e-62    Arabidopsis thaliana [mouse-ear cress]
gb|AAT80618.1|  cryptochrome 2                                          215   1e-62    Arabidopsis thaliana [mouse-ear cress]
emb|CAA67508.1|  blue light receptor                                    215   1e-62    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006418132.1|  hypothetical protein EUTSA_v10007081mg             215   1e-62    
ref|NP_171935.1|  cryptochrome 2                                        215   1e-62    Arabidopsis thaliana [mouse-ear cress]
gb|AGC92990.1|  cryptochrome 2                                          216   1e-62    Coffea arabica [arabica coffee]
gb|AAB70435.1|  Match to Arabidopsis photolysase (PHH1) gene (gb|...    215   1e-62    Arabidopsis thaliana [mouse-ear cress]
dbj|BAK61591.1|  cryptochrome2a                                         215   2e-62    Glycine soja [wild soybean]
ref|XP_006588363.1|  PREDICTED: cryptochrome 2 isoform X1               215   2e-62    Glycine max [soybeans]
ref|NP_001235220.1|  cryptochrome 2                                     215   2e-62    Glycine max [soybeans]
ref|XP_009111108.1|  PREDICTED: cryptochrome-2 isoform X3               214   2e-62    Brassica rapa
ref|XP_009111107.1|  PREDICTED: cryptochrome-2 isoform X2               214   2e-62    Brassica rapa
emb|CAI63876.1|  cryptochrome 2                                         214   2e-62    Brassica napus [oilseed rape]
gb|ADN34696.1|  cryptochrome 2a                                         214   2e-62    Brassica napus [oilseed rape]
emb|CDO99229.1|  unnamed protein product                                215   3e-62    Coffea canephora [robusta coffee]
ref|XP_009111106.1|  PREDICTED: cryptochrome-2 isoform X1               215   3e-62    Brassica rapa
gb|AAT80598.1|  cryptochrome 2                                          214   3e-62    Arabidopsis thaliana [mouse-ear cress]
gb|ABY77602.1|  At1g04400                                               214   3e-62    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009119306.1|  PREDICTED: LOW QUALITY PROTEIN: cryptochrome-1     214   4e-62    
gb|AAL16379.1|  cryptochrome 2                                          214   4e-62    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002531529.1|  DNA photolyase, putative                           214   4e-62    Ricinus communis
gb|KFK42780.1|  cryptochrome 2                                          214   5e-62    Arabis alpina [alpine rockcress]
emb|CDY18229.1|  BnaC05g02520D                                          213   6e-62    Brassica napus [oilseed rape]
dbj|BAI47555.1|  cryptochrome2                                          213   1e-61    Glycine max [soybeans]
gb|AAB04997.1|  AT-PHH1                                                 212   1e-61    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006647540.1|  PREDICTED: cryptochrome-2-like                     213   1e-61    Oryza brachyantha
gb|AAB04996.1|  AT-PHH1                                                 212   1e-61    Arabidopsis thaliana [mouse-ear cress]
ref|NP_001234245.1|  cryptochrome 2                                     212   2e-61    Solanum lycopersicum
ref|XP_002285169.2|  PREDICTED: cryptochrome-1 isoform X3               212   3e-61    Vitis vinifera
ref|XP_004497844.1|  PREDICTED: cryptochrome-2-like isoform X2          212   3e-61    
ref|XP_009387297.1|  PREDICTED: cryptochrome-1-like                     213   3e-61    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004495382.1|  PREDICTED: cryptochrome-2-like isoform X1          212   3e-61    
ref|XP_004497843.1|  PREDICTED: cryptochrome-2-like isoform X1          212   3e-61    Cicer arietinum [garbanzo]
gb|AHZ89700.1|  cryptochrome 2 variant 1                                211   3e-61    Dimocarpus longan [longan]
ref|XP_004495383.1|  PREDICTED: cryptochrome-2-like isoform X2          212   3e-61    
gb|AHZ89699.1|  cryptochrome 2                                          212   4e-61    Dimocarpus longan [longan]
ref|XP_010650088.1|  PREDICTED: cryptochrome-1 isoform X2               212   4e-61    Vitis vinifera
ref|XP_008224359.1|  PREDICTED: cryptochrome-1                          212   4e-61    Prunus mume [ume]
ref|XP_010650087.1|  PREDICTED: cryptochrome-1 isoform X1               212   5e-61    
gb|ABB36797.1|  cryptochrome 2                                          211   1e-60    Nicotiana sylvestris
ref|XP_009765233.1|  PREDICTED: cryptochrome-1                          211   1e-60    Nicotiana sylvestris
dbj|BAC67179.1|  cryptochrome 2                                         210   1e-60    Armoracia rusticana [horseradish]
ref|XP_009378989.1|  PREDICTED: cryptochrome-1-like isoform X2          210   1e-60    Pyrus x bretschneideri [bai li]
ref|XP_009378988.1|  PREDICTED: cryptochrome-1-like isoform X1          210   2e-60    Pyrus x bretschneideri [bai li]
ref|XP_009378991.1|  PREDICTED: cryptochrome-1-like isoform X4          210   2e-60    Pyrus x bretschneideri [bai li]
ref|XP_009378990.1|  PREDICTED: cryptochrome-1-like isoform X3          210   2e-60    Pyrus x bretschneideri [bai li]
emb|CAN71971.1|  hypothetical protein VITISV_015253                     210   2e-60    Vitis vinifera
dbj|BAC56984.1|  cryptochrome 2                                         210   2e-60    Oryza sativa Japonica Group [Japonica rice]
gb|EYU18329.1|  hypothetical protein MIMGU_mgv1a002561mg                210   3e-60    Erythranthe guttata [common monkey flower]
gb|EEC73630.1|  hypothetical protein OsI_08136                          209   4e-60    Oryza sativa Indica Group [Indian rice]
ref|XP_009623394.1|  PREDICTED: cryptochrome-1                          209   5e-60    
gb|AIB52439.1|  cryptochrome 2                                          208   6e-60    
ref|XP_006403258.1|  hypothetical protein EUTSA_v10003169mg             208   6e-60    
ref|XP_009401947.1|  PREDICTED: cryptochrome-1-like                     209   6e-60    
emb|CAC82538.1|  Cryptochrome 2                                         208   7e-60    
emb|CAD35495.1|  cryptochrome 2                                         208   7e-60    
ref|XP_003590036.1|  Cryptochrome 2B                                    207   7e-60    
ref|XP_006354487.1|  PREDICTED: cryptochrome-2-like                     208   8e-60    
ref|NP_001266969.1|  cryptochrome 2 (photolyase-like)                   208   9e-60    
gb|EPS70987.1|  cryptochrome 2                                          207   1e-59    
ref|XP_007225114.1|  hypothetical protein PRUPE_ppa002669mg             207   1e-59    
ref|XP_008460640.1|  PREDICTED: cryptochrome-1                          207   2e-59    
ref|XP_008391216.1|  PREDICTED: cryptochrome-1-like isoform X4          207   2e-59    
ref|XP_008391195.1|  PREDICTED: cryptochrome-1-like isoform X3          207   3e-59    
ref|XP_008391215.1|  PREDICTED: cryptochrome-1-like isoform X3          207   3e-59    
ref|XP_008391196.1|  PREDICTED: cryptochrome-1-like isoform X4          207   3e-59    
ref|XP_008391213.1|  PREDICTED: cryptochrome-1-like isoform X1          207   3e-59    
ref|XP_008391194.1|  PREDICTED: cryptochrome-1-like isoform X2          207   3e-59    
gb|KCW57373.1|  hypothetical protein EUGRSUZ_H00159                     206   3e-59    
ref|XP_008391214.1|  PREDICTED: cryptochrome-1-like isoform X2          207   3e-59    
ref|XP_008391193.1|  PREDICTED: cryptochrome-1-like isoform X1          207   3e-59    
gb|ADM78912.1|  cryptochrome 1-like protein                             195   4e-59    
ref|XP_010069127.1|  PREDICTED: LOW QUALITY PROTEIN: cryptochrome-1     206   4e-59    
ref|XP_007145848.1|  hypothetical protein PHAVU_007G273300g             205   7e-59    
ref|XP_007145847.1|  hypothetical protein PHAVU_007G273300g             205   9e-59    
dbj|BAJ15782.1|  cryptochrome2                                          204   2e-58    
ref|XP_008362059.1|  PREDICTED: LOW QUALITY PROTEIN: cryptochrome...    204   3e-58    
dbj|BAJ15784.1|  cryptochrome2                                          202   5e-58    
dbj|BAJ15785.1|  cryptochrome2                                          202   5e-58    
ref|XP_004965416.1|  PREDICTED: cryptochrome-2-like isoform X3          202   6e-58    
ref|XP_004965414.1|  PREDICTED: cryptochrome-2-like isoform X1          202   1e-57    
ref|XP_004965415.1|  PREDICTED: cryptochrome-2-like isoform X2          202   1e-57    
ref|XP_002961252.1|  hypothetical protein SELMODRAFT_75166              199   1e-57    
ref|XP_002969486.1|  hypothetical protein SELMODRAFT_91442              199   1e-57    
ref|XP_003575393.1|  PREDICTED: cryptochrome-1                          201   5e-57    
dbj|BAJ15789.1|  cryptochrome2                                          200   5e-57    
gb|AEA50860.1|  cry1-2                                                  186   5e-57    
gb|AJA72483.1|  cryptochrome 2                                          200   8e-57    
ref|NP_001241551.1|  cryptochrome-2-like                                199   2e-56    
ref|XP_006574459.1|  PREDICTED: cryptochrome-2-like isoform X1          198   2e-56    
gb|KHN00259.1|  Cryptochrome-2                                          197   6e-56    
gb|AFW86543.1|  hypothetical protein ZEAMMB73_862701                    197   8e-56    
gb|AFW86542.1|  hypothetical protein ZEAMMB73_862701                    197   1e-55    
gb|AEA50857.1|  cry1-1                                                  182   2e-55    
gb|EMT22933.1|  Cryptochrome-2                                          196   3e-55    
dbj|BAK61577.1|  cryptochrome1d                                         179   4e-54    
gb|EMS59440.1|  Cryptochrome-2                                          192   9e-54    
gb|ABX58030.1|  cryptochrome 2                                          191   2e-53    
ref|XP_002436988.1|  hypothetical protein SORBIDRAFT_10g013750          191   3e-53    
dbj|BAJ85047.1|  predicted protein                                      190   4e-53    
dbj|BAK61551.1|  cryptochrome1c                                         176   5e-53    
gb|ABX58029.1|  cryptochrome 2                                          190   5e-53    
dbj|BAK61565.1|  cryptochrome1c                                         174   2e-52    
gb|EMS49329.1|  Cryptochrome-1                                          187   7e-52    
ref|XP_002312581.2|  hypothetical protein POPTR_0008s16650g             184   1e-51    
ref|XP_005646976.1|  hypothetical protein COCSUDRAFT_1729               179   3e-50    
gb|AGV77085.1|  CRY1                                                    180   8e-50    
ref|XP_002969914.1|  hypothetical protein SELMODRAFT_92414              177   8e-49    
sp|P40115.1|CRY1_SINAL  RecName: Full=Cryptochrome-1; AltName: Fu...    176   8e-49    
ref|XP_002981391.1|  hypothetical protein SELMODRAFT_114313             177   8e-49    
gb|AAC37438.2|  CPH1                                                    179   3e-48    
ref|XP_001701553.1|  cryptochrome photoreceptor                         179   4e-48    
ref|XP_002957272.1|  Deoxyribodipyrimidine photolyase, class 1          177   6e-48    
gb|ADM78818.1|  cryptochrome 1-like protein                             162   2e-47    
gb|ADM78819.1|  cryptochrome 1-like protein                             162   3e-47    
ref|XP_002964174.1|  hypothetical protein SELMODRAFT_142524             155   7e-41    
gb|ACU44658.1|  cryptochrome 2B                                         154   8e-41    
ref|WP_006340198.1|  deoxyribodipyrimidine photo-lyase                  152   3e-40    
gb|KIA77491.1|  hypothetical protein DB43_GF00330                       152   4e-40    
ref|WP_034424945.1|  deoxyribodipyrimidine photolyase                   146   2e-39    
gb|ETW94985.1|  hypothetical protein ETSY1_32520                        147   2e-39    
ref|WP_012637962.1|  deoxyribodipyrimidine photo-lyase                  146   9e-38    
ref|WP_025281278.1|  MULTISPECIES: deoxyribodipyrimidine photolyase     145   3e-37    
ref|WP_019593955.1|  deoxyribodipyrimidine photo-lyase                  144   4e-37    
ref|WP_018954605.1|  deoxyribodipyrimidine photo-lyase                  144   5e-37    
ref|WP_018938727.1|  MULTISPECIES: deoxyribodipyrimidine photo-lyase    144   5e-37    
ref|WP_042280092.1|  deoxyribodipyrimidine photolyase                   144   5e-37    
ref|WP_039357416.1|  deoxyribodipyrimidine photolyase                   143   7e-37    
ref|WP_017942400.1|  MULTISPECIES: deoxyribodipyrimidine photo-lyase    143   8e-37    
ref|WP_019568241.1|  deoxyribodipyrimidine photo-lyase                  143   8e-37    
ref|WP_018145997.1|  MULTISPECIES: deoxyribodipyrimidine photo-lyase    143   8e-37    
ref|WP_018951240.1|  deoxyribodipyrimidine photo-lyase                  143   9e-37    
ref|WP_019628374.1|  deoxyribodipyrimidine photo-lyase                  143   9e-37    
ref|WP_029247136.1|  deoxyribodipyrimidine photolyase                   143   1e-36    
ref|WP_019563144.1|  deoxyribodipyrimidine photo-lyase                  142   2e-36    
ref|WP_011175222.1|  deoxyribodipyrimidine photo-lyase                  142   2e-36    
ref|WP_019571398.1|  deoxyribodipyrimidine photo-lyase                  142   2e-36    
ref|WP_018169494.1|  deoxyribodipyrimidine photo-lyase                  142   2e-36    
ref|WP_032124268.1|  deoxyribodipyrimidine photolyase                   142   2e-36    
ref|WP_018176988.1|  deoxyribodipyrimidine photo-lyase                  142   2e-36    
ref|WP_028793926.1|  deoxyribodipyrimidine photolyase                   141   4e-36    
gb|KFA24700.1|  deoxyribodipyrimidine photolyase                        136   1e-35    
gb|AFK23499.1|  cryptochrome 1a-like protein                            132   1e-35    
dbj|BAP76062.1|  putative CRY2                                          141   1e-35    
ref|WP_032977962.1|  deoxyribodipyrimidine photolyase                   140   1e-35    
ref|WP_042840916.1|  deoxyribodipyrimidine photolyase                   139   2e-35    
ref|WP_039418088.1|  deoxyribodipyrimidine photolyase                   139   2e-35    
ref|WP_007194834.1|  deoxyribodipyrimidine photo-lyase                  140   2e-35    
ref|WP_014089790.1|  deoxyribodipyrimidine photo-lyase                  139   2e-35    
ref|WP_019583439.1|  deoxyribodipyrimidine photo-lyase                  139   2e-35    
ref|WP_041855040.1|  deoxyribodipyrimidine photolyase                   139   3e-35    
emb|CAJ23168.1|  putative photolyase                                    139   3e-35    
ref|WP_018880471.1|  deoxyribodipyrimidine photo-lyase                  139   3e-35    
ref|WP_029819067.1|  deoxyribodipyrimidine photolyase                   139   3e-35    
ref|WP_008577274.1|  deoxyribodipyrimidine photo-lyase                  139   3e-35    
ref|WP_025878837.1|  deoxyribodipyrimidine photolyase                   139   4e-35    
ref|WP_033832101.1|  deoxyribodipyrimidine photolyase                   138   8e-35    
ref|WP_024328121.1|  deoxyribodipyrimidine photolyase                   137   9e-35    
ref|WP_043754504.1|  deoxyribodipyrimidine photolyase                   137   9e-35    
ref|WP_032969657.1|  deoxyribodipyrimidine photolyase                   137   9e-35    
ref|WP_018940744.1|  deoxyribodipyrimidine photo-lyase                  137   9e-35    
ref|WP_031421908.1|  deoxyribodipyrimidine photolyase                   137   9e-35    
emb|CCP16069.1|  deoxyribodipyrimidine photo-lyase                      137   1e-34    
ref|WP_018875733.1|  deoxyribodipyrimidine photo-lyase                  137   1e-34    
ref|WP_019558191.1|  deoxyribodipyrimidine photo-lyase                  137   1e-34    
ref|WP_005223535.1|  deoxyribodipyrimidine photo-lyase                  137   1e-34    
ref|WP_012510723.1|  deoxyribodipyrimidine photo-lyase                  137   1e-34    
ref|WP_039384241.1|  deoxyribodipyrimidine photolyase                   137   2e-34    
ref|WP_017173307.1|  deoxyribodipyrimidine photo-lyase                  135   2e-34    
ref|WP_042821834.1|  deoxyribodipyrimidine photolyase                   136   3e-34    
ref|WP_005988359.1|  deoxyribodipyrimidine photo-lyase                  136   3e-34    
ref|WP_018948532.1|  deoxyribodipyrimidine photo-lyase                  136   3e-34    
ref|WP_037447075.1|  deoxyribodipyrimidine photolyase                   136   3e-34    
gb|KGP58375.1|  deoxyribodipyrimidine photolyase                        136   3e-34    
emb|CCP11079.1|  deoxyribodipyrimidine photo-lyase                      136   3e-34    
ref|WP_017118773.1|  deoxyribodipyrimidine photo-lyase                  136   3e-34    
ref|WP_039442569.1|  deoxyribodipyrimidine photolyase                   136   4e-34    
ref|WP_017155744.1|  deoxyribodipyrimidine photo-lyase                  135   4e-34    
ref|WP_028484112.1|  deoxyribodipyrimidine photolyase                   135   4e-34    
ref|WP_007042183.1|  deoxyribodipyrimidine photo-lyase                  135   4e-34    
ref|WP_042243615.1|  deoxyribodipyrimidine photolyase                   135   5e-34    
ref|WP_018878904.1|  deoxyribodipyrimidine photo-lyase                  135   5e-34    
ref|WP_022973478.1|  deoxyribodipyrimidine photo-lyase                  135   5e-34    
ref|WP_017113227.1|  deoxyribodipyrimidine photo-lyase                  135   5e-34    
ref|WP_018716461.1|  hypothetical protein                               135   5e-34    
ref|WP_019623531.1|  MULTISPECIES: deoxyribodipyrimidine photo-lyase    135   5e-34    
ref|WP_018882526.1|  MULTISPECIES: deoxyribodipyrimidine photo-lyase    135   6e-34    
ref|WP_018866835.1|  MULTISPECIES: deoxyribodipyrimidine photo-lyase    135   6e-34    
ref|WP_016902718.1|  deoxyribodipyrimidine photo-lyase                  135   6e-34    
ref|WP_039511652.1|  deoxyribodipyrimidine photolyase                   135   7e-34    
ref|WP_041019369.1|  deoxyribodipyrimidine photolyase                   135   7e-34    
ref|WP_043087377.1|  deoxyribodipyrimidine photolyase                   135   7e-34    
ref|WP_039809582.1|  deoxyribodipyrimidine photolyase                   135   7e-34    
gb|KGU42231.1|  deoxyribodipyrimidine photolyase                        135   7e-34    
ref|WP_039570427.1|  deoxyribodipyrimidine photolyase                   135   7e-34    
ref|WP_012375481.1|  deoxyribodipyrimidine photo-lyase                  135   8e-34    
ref|WP_018875040.1|  MULTISPECIES: deoxyribodipyrimidine photo-lyase    135   9e-34    
ref|WP_012982232.1|  deoxyribodipyrimidine photo-lyase                  135   9e-34    
ref|XP_011399532.1|  Cryptochrome-1                                     135   9e-34    
ref|WP_019183228.1|  deoxyribodipyrimidine photo-lyase                  135   1e-33    
ref|WP_015259152.1|  Deoxyribodipyrimidine photolyase                   135   1e-33    
ref|WP_019626798.1|  deoxyribodipyrimidine photo-lyase                  135   1e-33    
ref|WP_017115995.1|  deoxyribodipyrimidine photo-lyase                  135   1e-33    
ref|WP_017925902.1|  deoxyribodipyrimidine photo-lyase                  135   1e-33    
ref|WP_016352744.1|  Deoxyribodipyrimidine photo-lyase                  135   1e-33    
ref|WP_018868481.1|  MULTISPECIES: deoxyribodipyrimidine photo-lyase    134   1e-33    
ref|WP_018993642.1|  deoxyribodipyrimidine photo-lyase                  134   1e-33    
ref|WP_039403341.1|  deoxyribodipyrimidine photolyase                   134   1e-33    
ref|WP_006749103.1|  deoxyribodipyrimidine photo-lyase                  134   1e-33    
gb|EFF43285.1|  photolyase                                              134   1e-33    
ref|WP_016850353.1|  deoxyribodipyrimidine photo-lyase                  134   1e-33    
ref|WP_033481550.1|  MULTISPECIES: deoxyribodipyrimidine photolyase     134   1e-33    
gb|AAM36348.1|  photolyase                                              134   1e-33    
ref|WP_022559678.1|  putative deoxyribodipyrimidine photo-lyase         134   1e-33    
ref|WP_033484182.1|  deoxyribodipyrimidine photolyase                   134   1e-33    
ref|WP_005911822.1|  MULTISPECIES: photolyase                           134   1e-33    
ref|WP_042675906.1|  deoxyribodipyrimidine photolyase                   134   2e-33    
ref|WP_015463011.1|  MULTISPECIES: photolyase                           134   2e-33    
ref|WP_015472336.1|  Deoxyribodipyrimidine photolyase                   134   2e-33    
ref|WP_003483588.1|  MULTISPECIES: deoxyribodipyrimidine photo-lyase    134   2e-33    
ref|WP_018861780.1|  deoxyribodipyrimidine photo-lyase                  134   2e-33    
ref|WP_026988194.1|  deoxyribodipyrimidine photolyase                   134   2e-33    
ref|WP_042598751.1|  deoxyribodipyrimidine photolyase                   134   2e-33    
gb|KIC73273.1|  putative photolyase                                     134   2e-33    
ref|WP_018139986.1|  deoxyribodipyrimidine photo-lyase                  134   3e-33    
ref|WP_039565077.1|  deoxyribodipyrimidine photolyase                   133   3e-33    
ref|WP_029221036.1|  deoxyribodipyrimidine photolyase                   133   3e-33    
ref|WP_029550839.1|  deoxyribodipyrimidine photolyase                   133   4e-33    
ref|WP_039433607.1|  deoxyribodipyrimidine photolyase                   133   4e-33    
ref|WP_018231625.1|  hypothetical protein                               133   5e-33    
ref|WP_036286588.1|  deoxyribodipyrimidine photolyase                   133   5e-33    
ref|WP_039581609.1|  deoxyribodipyrimidine photolyase                   132   5e-33    
ref|WP_002810656.1|  photolyase                                         132   6e-33    
ref|WP_018174790.1|  MULTISPECIES: deoxyribodipyrimidine photo-lyase    132   6e-33    
ref|WP_018138736.1|  MULTISPECIES: deoxyribodipyrimidine photo-lyase    132   6e-33    
ref|WP_034210981.1|  deoxyribodipyrimidine photolyase                   132   6e-33    
emb|CAQ45346.1|  putative DNA photolyase                                132   7e-33    
ref|WP_033833088.1|  deoxyribodipyrimidine photolyase                   132   7e-33    
ref|WP_005412994.1|  Deoxyribodipyrimidine photolyase                   132   7e-33    
ref|WP_043399254.1|  deoxyribodipyrimidine photolyase                   132   7e-33    
ref|WP_018994709.1|  deoxyribodipyrimidine photo-lyase                  132   7e-33    
ref|WP_020146246.1|  deoxyribodipyrimidine photo-lyase                  132   7e-33    
ref|WP_018865067.1|  deoxyribodipyrimidine photo-lyase                  132   7e-33    
ref|WP_005409105.1|  deoxyribodipyrimidine photo-lyase                  132   7e-33    
ref|WP_042805600.1|  deoxyribodipyrimidine photolyase                   132   7e-33    
ref|WP_044569857.1|  deoxyribodipyrimidine photolyase                   132   7e-33    
gb|KGK59047.1|  deoxyribodipyrimidine photolyase                        132   7e-33    
gb|KEZ78790.1|  Deoxyribodipyrimidine photo-lyase                       131   8e-33    
gb|ADE13453.1|  Deoxyribodipyrimidine photo-lyase                       132   8e-33    
ref|WP_042612410.1|  deoxyribodipyrimidine photolyase                   132   8e-33    
ref|WP_024956425.1|  deoxyribodipyrimidine photolyase                   132   8e-33    
ref|WP_043035479.1|  deoxyribodipyrimidine photolyase                   132   8e-33    
ref|WP_041355281.1|  deoxyribodipyrimidine photolyase                   132   8e-33    
ref|WP_040276997.1|  deoxyribodipyrimidine photolyase                   132   8e-33    
ref|WP_037333706.1|  deoxyribodipyrimidine photolyase                   131   8e-33    
gb|EFF47938.1|  photolyase                                              132   8e-33    
ref|WP_044750155.1|  deoxyribodipyrimidine photolyase                   132   9e-33    
ref|WP_026070779.1|  deoxyribodipyrimidine photolyase                   132   9e-33    
ref|WP_024711429.1|  deoxyribodipyrimidine photolyase                   132   9e-33    
ref|WP_014503849.1|  deoxyribodipyrimidine photo-lyase                  132   1e-32    
gb|KFL38052.1|  hypothetical protein N788_02430                         132   1e-32    
ref|WP_029006797.1|  deoxyribodipyrimidine photolyase                   132   1e-32    
ref|WP_034220715.1|  deoxyribodipyrimidine photolyase                   132   1e-32    
gb|AAW74780.1|  photolyase                                              131   1e-32    
ref|WP_027704132.1|  deoxyribodipyrimidine photolyase                   131   1e-32    
ref|WP_012444398.1|  deoxyribodipyrimidine photo-lyase                  131   1e-32    
ref|WP_019024680.1|  MULTISPECIES: deoxyribodipyrimidine photo-lyase    131   1e-32    
ref|WP_019302076.1|  deoxyribodipyrimidine photo-lyase                  131   2e-32    
ref|WP_010366306.1|  deoxyribodipyrimidine photo-lyase                  131   2e-32    
ref|WP_038894246.1|  deoxyribodipyrimidine photolyase                   124   2e-32    
ref|WP_014036824.1|  deoxyribodipyrimidine photo-lyase                  131   2e-32    



>dbj|BAQ15377.1| cryptochrome 1 [Ipomoea nil]
Length=675

 Score =   340 bits (872),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 165/165 (100%), Positives = 165/165 (100%), Gaps = 0/165 (0%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL
Sbjct  8    IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  67

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR
Sbjct  68   RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  127

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP
Sbjct  128  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  172



>gb|AJA72482.1| cryptochrome 1, partial [Ipomoea purpurea]
Length=675

 Score =   339 bits (870),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 164/165 (99%), Positives = 165/165 (100%), Gaps = 0/165 (0%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLRVEDNPALAAGVRSGA+IALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL
Sbjct  8    IVWFRRDLRVEDNPALAAGVRSGAVIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  67

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR
Sbjct  68   RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  127

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP
Sbjct  128  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  172



>ref|XP_006833448.1| hypothetical protein AMTR_s02137p00007130, partial [Amborella 
trichopoda]
 gb|ERM98726.1| hypothetical protein AMTR_s02137p00007130, partial [Amborella 
trichopoda]
Length=190

 Score =   304 bits (778),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 139/165 (84%), Positives = 156/165 (95%), Gaps = 0/165 (0%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLRVEDNPAL+AGVR+G+++A+FIWAPEEEGHYYPGRVSRWWLKQSL HLDSSL
Sbjct  21   IVWFRRDLRVEDNPALSAGVRAGSVVAVFIWAPEEEGHYYPGRVSRWWLKQSLTHLDSSL  80

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            RSLGT LITKRS+DSVSSL+EV+KSTGA+ +FFNHLYDPLSLVRDHR+KE+LTAQG+ VR
Sbjct  81   RSLGTCLITKRSSDSVSSLLEVVKSTGATRVFFNHLYDPLSLVRDHRSKEVLTAQGIVVR  140

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            SFN+DLLYEPWE+ D  G PFTTF+AFWDRCLSMPYDP APLLPP
Sbjct  141  SFNADLLYEPWEIHDPNGQPFTTFAAFWDRCLSMPYDPSAPLLPP  185



>ref|XP_009761809.1| PREDICTED: cryptochrome-1-like isoform X1 [Nicotiana sylvestris]
 ref|XP_009761810.1| PREDICTED: cryptochrome-1-like isoform X2 [Nicotiana sylvestris]
 ref|XP_009761811.1| PREDICTED: cryptochrome-1-like isoform X3 [Nicotiana sylvestris]
 gb|ABB36796.1| cryptochrome 1 [Nicotiana sylvestris]
Length=681

 Score =   313 bits (803),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 143/165 (87%), Positives = 162/165 (98%), Gaps = 0/165 (0%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLRVEDNPALAAGVR+GA+IA+FIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL
Sbjct  8    IVWFRRDLRVEDNPALAAGVRAGAVIAVFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  67

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            +SLGT+L+TKRSTDS+SSL+E++KSTGA+ LFFNHLYDP+SLVRDHRAKE+LTAQG++VR
Sbjct  68   KSLGTSLVTKRSTDSISSLLEIVKSTGATQLFFNHLYDPISLVRDHRAKEVLTAQGISVR  127

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            SFN+DLLYEPWEV D+EG PFTTFSAFW++CLSMPYDPEAPLLPP
Sbjct  128  SFNADLLYEPWEVNDEEGRPFTTFSAFWEKCLSMPYDPEAPLLPP  172



>ref|NP_001234667.1| cryptochrome 1 [Solanum lycopersicum]
 ref|XP_010320060.1| PREDICTED: cryptochrome 1 isoform X1 [Solanum lycopersicum]
 gb|AAD44161.1|AF130423_1 cryptochrome 1 [Solanum lycopersicum]
 gb|AAF72555.1|AF130424_1 cryptochrome 1 [Solanum lycopersicum]
Length=679

 Score =   313 bits (801),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 145/165 (88%), Positives = 161/165 (98%), Gaps = 0/165 (0%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLRVEDNPALAAGVR+GA+IA+FI+APEEEGHYYPGRVSRWWLKQSLAHLDSSL
Sbjct  8    IVWFRRDLRVEDNPALAAGVRAGAVIAVFIYAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  67

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            +SLGT+LITKRSTDS+SSL+EV+KSTGA+ LFFNHLYDP+SLVRDHR KEILTAQG++VR
Sbjct  68   KSLGTSLITKRSTDSISSLLEVVKSTGATQLFFNHLYDPISLVRDHRTKEILTAQGISVR  127

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            SFN+DLLYEPWEV DDEG PFTTFSAFW++CLSMPYDPEAPLLPP
Sbjct  128  SFNADLLYEPWEVNDDEGRPFTTFSAFWEKCLSMPYDPEAPLLPP  172



>ref|XP_010089879.1| hypothetical protein L484_003096 [Morus notabilis]
 gb|EXB38520.1| hypothetical protein L484_003096 [Morus notabilis]
Length=683

 Score =   311 bits (796),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 145/165 (88%), Positives = 159/165 (96%), Gaps = 0/165 (0%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLRVEDNPALAAGVRSGA+IA+F+WAPEEEGHYYPGRVSRWWLKQSLAHLDSSL
Sbjct  8    IVWFRRDLRVEDNPALAAGVRSGAVIAVFVWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  67

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            RSLGT+LITKRSTDSVSSL+EV++STGA+ LFFNHLYDPLSLVRDHRAKE+LTAQG+ VR
Sbjct  68   RSLGTSLITKRSTDSVSSLLEVVESTGATQLFFNHLYDPLSLVRDHRAKEVLTAQGIAVR  127

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            SFN+DLLYEPW+V D  G PFTTF+AFW+RCLSMPYDPEAPLLPP
Sbjct  128  SFNADLLYEPWDVNDAHGRPFTTFAAFWERCLSMPYDPEAPLLPP  172



>ref|XP_007141180.1| hypothetical protein PHAVU_008G173700g [Phaseolus vulgaris]
 gb|ESW13174.1| hypothetical protein PHAVU_008G173700g [Phaseolus vulgaris]
Length=682

 Score =   310 bits (793),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 146/165 (88%), Positives = 157/165 (95%), Gaps = 0/165 (0%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLRVEDNPALAAGVR+GA+IA+FIWAPEEEG YYPGRVSRWWLKQSLAHLDSSL
Sbjct  8    IVWFRRDLRVEDNPALAAGVRAGAVIAVFIWAPEEEGQYYPGRVSRWWLKQSLAHLDSSL  67

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            RSLGT LITKRST+SVSSL+EVIKSTGA+ LFFNHLYDPLSLVRDHR KE+LTAQG+TVR
Sbjct  68   RSLGTPLITKRSTNSVSSLLEVIKSTGATQLFFNHLYDPLSLVRDHRTKEVLTAQGITVR  127

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            SFNSDLLYEPW+V D  G PFTTFSAFW+RCLSMPYDP+APLLPP
Sbjct  128  SFNSDLLYEPWDVNDAHGQPFTTFSAFWERCLSMPYDPQAPLLPP  172



>ref|XP_011074184.1| PREDICTED: cryptochrome-1 isoform X1 [Sesamum indicum]
 ref|XP_011074185.1| PREDICTED: cryptochrome-1 isoform X2 [Sesamum indicum]
Length=684

 Score =   309 bits (792),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 143/165 (87%), Positives = 159/165 (96%), Gaps = 0/165 (0%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLRVEDNPALAAGVRSGA++ALFIWAPEEEGHYYPGRVSRWW+KQSLAHLDSSL
Sbjct  10   IVWFRRDLRVEDNPALAAGVRSGAVVALFIWAPEEEGHYYPGRVSRWWVKQSLAHLDSSL  69

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            RSLGT+L+TKRSTDSVS L++VIKSTGA+ LFFNHLYDP+SLVRDHRAKE+LTA+GV VR
Sbjct  70   RSLGTSLVTKRSTDSVSCLLQVIKSTGATQLFFNHLYDPISLVRDHRAKEVLTAEGVAVR  129

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            SFN+DLLYEPWEV D+EG PFTTF+ FW++CLSMPYDPEAPLLPP
Sbjct  130  SFNADLLYEPWEVHDEEGRPFTTFTGFWEKCLSMPYDPEAPLLPP  174



>ref|XP_002301054.1| cryptochrome 1 family protein [Populus trichocarpa]
 gb|EEE80327.1| cryptochrome 1 family protein [Populus trichocarpa]
Length=681

 Score =   309 bits (791),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 142/165 (86%), Positives = 159/165 (96%), Gaps = 0/165 (0%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLRVEDNPALAAGVR+GA++A+F+WAPEEEGHYYPGRVSRWWLKQSLAHLDSSL
Sbjct  8    IVWFRRDLRVEDNPALAAGVRAGAVVAVFVWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  67

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            RSLGT+L+TKRSTDSVS+L+EVIKSTGA+ LFFNHLYDPLSLVRDHRAKE+LTAQG+ VR
Sbjct  68   RSLGTSLVTKRSTDSVSTLLEVIKSTGATQLFFNHLYDPLSLVRDHRAKEVLTAQGIAVR  127

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            SFN+DLLYEPW+V D +G PFTTF+ FWDRCLSMP+DPEAPLLPP
Sbjct  128  SFNADLLYEPWDVNDAQGRPFTTFATFWDRCLSMPFDPEAPLLPP  172



>ref|XP_006364857.1| PREDICTED: cryptochrome-1-like isoform X1 [Solanum tuberosum]
 ref|XP_006364858.1| PREDICTED: cryptochrome-1-like isoform X2 [Solanum tuberosum]
Length=679

 Score =   309 bits (791),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 143/165 (87%), Positives = 161/165 (98%), Gaps = 0/165 (0%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLRVEDNPALAAGVR+GA+IA+FI+APEEEGHYYPGRVSRWWLKQSLA+L+SSL
Sbjct  8    IVWFRRDLRVEDNPALAAGVRAGAVIAVFIYAPEEEGHYYPGRVSRWWLKQSLAYLNSSL  67

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            +SLGT+LITKRSTDS+SSL+EV+KSTGA+ LFFNHLYDP+SLVRDHR KEILTAQG++VR
Sbjct  68   KSLGTSLITKRSTDSISSLLEVVKSTGATQLFFNHLYDPISLVRDHRTKEILTAQGISVR  127

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            SFN+DLLYEPWEV DDEG PFTTFSAFW++CLSMPYDPEAPLLPP
Sbjct  128  SFNADLLYEPWEVNDDEGRPFTTFSAFWEKCLSMPYDPEAPLLPP  172



>gb|AEK26572.1| cryptochrome 1.2 [Populus tremula]
Length=681

 Score =   309 bits (791),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 142/165 (86%), Positives = 159/165 (96%), Gaps = 0/165 (0%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLRVEDNPALAAGVR+GA++A+F+WAPEEEGHYYPGRVSRWWLKQSLAHLDSSL
Sbjct  8    IVWFRRDLRVEDNPALAAGVRAGAVVAVFVWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  67

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            RSLGT+L+TKRSTDSVS+L+EVIKSTGA+ LFFNHLYDPLSLVRDHRAKE+LTAQG+ VR
Sbjct  68   RSLGTSLVTKRSTDSVSTLLEVIKSTGATQLFFNHLYDPLSLVRDHRAKEVLTAQGIAVR  127

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            SFN+DLLYEPW+V D +G PFTTF+ FWDRCLSMP+DPEAPLLPP
Sbjct  128  SFNADLLYEPWDVNDAQGRPFTTFATFWDRCLSMPFDPEAPLLPP  172



>ref|XP_002307379.1| cryptochrome 1 family protein [Populus trichocarpa]
 gb|EEE94375.1| cryptochrome 1 family protein [Populus trichocarpa]
Length=680

 Score =   308 bits (788),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 142/165 (86%), Positives = 158/165 (96%), Gaps = 0/165 (0%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLRVEDNPALAAGVR+GA++A+F+WAPEEEGHYYPGRVSRWWLKQSLAHLDSSL
Sbjct  8    IVWFRRDLRVEDNPALAAGVRAGAVVAVFVWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  67

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            RSLGT+L+TKRSTDSVSSL+EV+KSTGA+ L FNHLYDPLSLVRDHRAKEILTAQG+TVR
Sbjct  68   RSLGTSLVTKRSTDSVSSLLEVVKSTGATQLLFNHLYDPLSLVRDHRAKEILTAQGITVR  127

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            SFN+DLLYEPW+V D +G PFTTF  FW+RCLSMP+DPEAPLLPP
Sbjct  128  SFNADLLYEPWDVNDAQGRPFTTFDTFWERCLSMPFDPEAPLLPP  172



>gb|KHN44791.1| Cryptochrome-1 [Glycine soja]
Length=681

 Score =   307 bits (786),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 142/165 (86%), Positives = 158/165 (96%), Gaps = 0/165 (0%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLRVEDNPALAAGVR+GA+I++FIWAPEEEG YYPGRVSRWWLKQSLAHLDSSL
Sbjct  8    IVWFRRDLRVEDNPALAAGVRAGAVISVFIWAPEEEGQYYPGRVSRWWLKQSLAHLDSSL  67

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            R+LG+ LITKRST+S+SSL+EV+KSTGA+ LFFNHLYDPLSLVRDHRAKE+LTAQG+TVR
Sbjct  68   RNLGSPLITKRSTNSISSLLEVVKSTGATQLFFNHLYDPLSLVRDHRAKEVLTAQGITVR  127

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            SFNSDLLYEPW+V D  G PFTTFSAFW+RCLSMPYDP+APLLPP
Sbjct  128  SFNSDLLYEPWDVNDAHGQPFTTFSAFWERCLSMPYDPQAPLLPP  172



>ref|NP_001242152.1| cryptochrome-1-like [Glycine max]
 dbj|BAI47553.1| cryptochrome1 [Glycine max]
 dbj|BAI47554.1| cryptochrome1 [Glycine max]
Length=681

 Score =   307 bits (786),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 142/165 (86%), Positives = 158/165 (96%), Gaps = 0/165 (0%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLRVEDNPALAAGVR+GA+I++FIWAPEEEG YYPGRVSRWWLKQSLAHLDSSL
Sbjct  8    IVWFRRDLRVEDNPALAAGVRAGAVISVFIWAPEEEGQYYPGRVSRWWLKQSLAHLDSSL  67

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            R+LG+ LITKRST+S+SSL+EV+KSTGA+ LFFNHLYDPLSLVRDHRAKE+LTAQG+TVR
Sbjct  68   RNLGSPLITKRSTNSISSLLEVVKSTGATQLFFNHLYDPLSLVRDHRAKEVLTAQGITVR  127

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            SFNSDLLYEPW+V D  G PFTTFSAFW+RCLSMPYDP+APLLPP
Sbjct  128  SFNSDLLYEPWDVNDAHGQPFTTFSAFWERCLSMPYDPQAPLLPP  172



>ref|XP_011004801.1| PREDICTED: cryptochrome-1-like isoform X1 [Populus euphratica]
 ref|XP_011004802.1| PREDICTED: cryptochrome-1-like isoform X2 [Populus euphratica]
Length=681

 Score =   306 bits (785),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 141/165 (85%), Positives = 158/165 (96%), Gaps = 0/165 (0%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLRVEDNPALAAGVR+GA++A+F+WAPEEEGHYYPGRVSRWWLKQSLAHLDSSL
Sbjct  8    IVWFRRDLRVEDNPALAAGVRAGAVVAVFVWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  67

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            RSLGT+L+TKRSTDSVS+L+EV+KSTGA+ L FNHLYDPLSLVRDHRAKEILTAQG+TVR
Sbjct  68   RSLGTSLVTKRSTDSVSTLLEVVKSTGATQLLFNHLYDPLSLVRDHRAKEILTAQGITVR  127

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            SFN+DLLYEPWEV D +G PFTTF  FW+RCLSMP+DP+APLLPP
Sbjct  128  SFNADLLYEPWEVNDAQGRPFTTFDTFWERCLSMPFDPDAPLLPP  172



>gb|KDP41383.1| hypothetical protein JCGZ_15790 [Jatropha curcas]
Length=680

 Score =   306 bits (784),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 141/165 (85%), Positives = 158/165 (96%), Gaps = 0/165 (0%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLRVEDNPALAAGVR+GA++A+FIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL
Sbjct  7    IVWFRRDLRVEDNPALAAGVRAGAVVAVFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  66

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            RSLGTTL+TKRSTDSVS+L+EV+KSTGA+ +FFNHLYDPLSLVRDHRAK +LTA G+ VR
Sbjct  67   RSLGTTLVTKRSTDSVSTLLEVVKSTGATQIFFNHLYDPLSLVRDHRAKGVLTAHGIAVR  126

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            SFN+DLLYEPW+V D +G PFTTF+AFW+RCLSMPYDPEAPLLPP
Sbjct  127  SFNADLLYEPWDVNDAQGRPFTTFAAFWERCLSMPYDPEAPLLPP  171



>ref|XP_003615112.1| Cryptochrome [Medicago truncatula]
 ref|XP_003615113.1| Cryptochrome [Medicago truncatula]
 gb|ABN09162.1| Deoxyribodipyrimidine photolyase, class 1 [Medicago truncatula]
 gb|AES98070.1| cryptochrome protein [Medicago truncatula]
 gb|AES98071.1| cryptochrome protein [Medicago truncatula]
Length=679

 Score =   305 bits (781),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 140/165 (85%), Positives = 156/165 (95%), Gaps = 0/165 (0%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLRVEDNPALAAGVR+GA++ +FIWAPEEEG YYPGRVSRWWLK SLAHLDSSL
Sbjct  10   IVWFRRDLRVEDNPALAAGVRAGAVVGVFIWAPEEEGQYYPGRVSRWWLKNSLAHLDSSL  69

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            R+LGT L+TKRSTDSVSSL+EV+KSTGA+ +FFNHLYDPLSLVRDHRAKEILTAQG+TVR
Sbjct  70   RNLGTPLVTKRSTDSVSSLLEVVKSTGATQIFFNHLYDPLSLVRDHRAKEILTAQGITVR  129

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            SFNSDLLYEPW+V D+ G PFTTF +FW+RCLSMPYDP+APLLPP
Sbjct  130  SFNSDLLYEPWDVNDENGQPFTTFDSFWERCLSMPYDPQAPLLPP  174



>ref|XP_007018772.1| CRY1 isoform 1 [Theobroma cacao]
 ref|XP_007018773.1| CRY1 isoform 1 [Theobroma cacao]
 gb|EOY15997.1| CRY1 isoform 1 [Theobroma cacao]
 gb|EOY15998.1| CRY1 isoform 1 [Theobroma cacao]
Length=682

 Score =   305 bits (781),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 141/165 (85%), Positives = 158/165 (96%), Gaps = 0/165 (0%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLRVEDNPALAAGVR+GA++A+FIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL
Sbjct  8    IVWFRRDLRVEDNPALAAGVRAGAVVAVFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  67

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            RSLGT LI+KRST+SVSSL+EV+KSTGA+ LFFNHLYDP+SLVRDHRAKE+LTA GV VR
Sbjct  68   RSLGTCLISKRSTESVSSLLEVVKSTGATQLFFNHLYDPISLVRDHRAKEVLTAHGVAVR  127

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            SFN+DLLYEPW+V D +G PFTTF+AFW++CLSMPYDPEAPLLPP
Sbjct  128  SFNADLLYEPWDVNDAQGRPFTTFAAFWEKCLSMPYDPEAPLLPP  172



>gb|KHG11746.1| Cryptochrome-1 -like protein [Gossypium arboreum]
Length=682

 Score =   305 bits (781),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 141/165 (85%), Positives = 157/165 (95%), Gaps = 0/165 (0%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLRVEDNPALAAGVR+GA++A+F+WAPEEEGHYYPGRVSRWWLK SLAHLDSSL
Sbjct  8    IVWFRRDLRVEDNPALAAGVRAGAVVAVFVWAPEEEGHYYPGRVSRWWLKHSLAHLDSSL  67

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            RSLGT LITKRS+DSVSSL+EV+KSTGA+ L+FNHLYDP+SLVRDHRAKE+LTA GV VR
Sbjct  68   RSLGTCLITKRSSDSVSSLLEVVKSTGATQLYFNHLYDPISLVRDHRAKEVLTAHGVAVR  127

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            SFN+DLLYEPW+V D +G PFTTFSAFW+RCLSMPYDPEAPLLPP
Sbjct  128  SFNADLLYEPWDVNDAQGRPFTTFSAFWERCLSMPYDPEAPLLPP  172



>gb|KJB59058.1| hypothetical protein B456_009G236700 [Gossypium raimondii]
 gb|KJB59059.1| hypothetical protein B456_009G236700 [Gossypium raimondii]
Length=682

 Score =   305 bits (781),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 141/165 (85%), Positives = 157/165 (95%), Gaps = 0/165 (0%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLRVEDNPALAAGVR+GA++A+F+WAPEEEGHYYPGRVSRWWLK SLAHLDSSL
Sbjct  8    IVWFRRDLRVEDNPALAAGVRAGAVVAVFVWAPEEEGHYYPGRVSRWWLKHSLAHLDSSL  67

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            RSLGT LITKRS+DSVSSL+EV+KSTGA+ LFFNHLYDP+SLVRDHRAKE+LTA GV VR
Sbjct  68   RSLGTCLITKRSSDSVSSLLEVVKSTGATQLFFNHLYDPISLVRDHRAKEVLTAHGVAVR  127

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            SFN+DLLYEPW+V D +G PFTTFS+FW+RCLSMPYDPEAPLLPP
Sbjct  128  SFNADLLYEPWDVNDAQGRPFTTFSSFWERCLSMPYDPEAPLLPP  172



>gb|KJB59057.1| hypothetical protein B456_009G236700 [Gossypium raimondii]
Length=685

 Score =   305 bits (780),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 141/165 (85%), Positives = 157/165 (95%), Gaps = 0/165 (0%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLRVEDNPALAAGVR+GA++A+F+WAPEEEGHYYPGRVSRWWLK SLAHLDSSL
Sbjct  8    IVWFRRDLRVEDNPALAAGVRAGAVVAVFVWAPEEEGHYYPGRVSRWWLKHSLAHLDSSL  67

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            RSLGT LITKRS+DSVSSL+EV+KSTGA+ LFFNHLYDP+SLVRDHRAKE+LTA GV VR
Sbjct  68   RSLGTCLITKRSSDSVSSLLEVVKSTGATQLFFNHLYDPISLVRDHRAKEVLTAHGVAVR  127

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            SFN+DLLYEPW+V D +G PFTTFS+FW+RCLSMPYDPEAPLLPP
Sbjct  128  SFNADLLYEPWDVNDAQGRPFTTFSSFWERCLSMPYDPEAPLLPP  172



>gb|AEK26571.1| cryptochrome 1.1 [Populus tremula]
Length=681

 Score =   304 bits (779),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 140/165 (85%), Positives = 158/165 (96%), Gaps = 0/165 (0%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLRVEDNPALAAGVR+GA++A+F+WAPEEEGHYYPGRVSRWWLKQSLA+LDSSL
Sbjct  8    IVWFRRDLRVEDNPALAAGVRAGAVVAVFVWAPEEEGHYYPGRVSRWWLKQSLAYLDSSL  67

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            RSLGT+L+TKRSTDSVS+L+EV+KSTGA+ L FNHLYDPLSLVRDHRAKEILTAQG+TVR
Sbjct  68   RSLGTSLVTKRSTDSVSTLLEVVKSTGATQLLFNHLYDPLSLVRDHRAKEILTAQGITVR  127

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            SFN+DLLYEPW+V D +G PFTTF  FW+RCLSMP+DPEAPLLPP
Sbjct  128  SFNADLLYEPWDVNDAQGRPFTTFDTFWERCLSMPFDPEAPLLPP  172



>gb|EYU36499.1| hypothetical protein MIMGU_mgv1a002293mg [Erythranthe guttata]
Length=690

 Score =   305 bits (780),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 139/165 (84%), Positives = 157/165 (95%), Gaps = 0/165 (0%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLRVEDNPALAAGVRSGA+IA+FIWAPEEEGHYYPGRVSRWWLKQSL+HLD+SL
Sbjct  10   IVWFRRDLRVEDNPALAAGVRSGAVIAVFIWAPEEEGHYYPGRVSRWWLKQSLSHLDTSL  69

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            +SLGT+L+TKRS DS+S L++VIKSTGA  LFFNHLYDP+SLVRDHRAKE+L+A+GVTVR
Sbjct  70   KSLGTSLLTKRSADSISCLLQVIKSTGAKQLFFNHLYDPISLVRDHRAKEVLSAEGVTVR  129

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            SFN+DLLYEPWEV+D E  PFTTF+ FWDRCLSMPYDPE+PLLPP
Sbjct  130  SFNADLLYEPWEVLDHENRPFTTFAGFWDRCLSMPYDPESPLLPP  174



>ref|XP_010538941.1| PREDICTED: LOW QUALITY PROTEIN: cryptochrome-1-like [Tarenaya 
hassleriana]
Length=571

 Score =   301 bits (771),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 139/165 (84%), Positives = 156/165 (95%), Gaps = 0/165 (0%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            +VWFRRDLRVEDNPALAAGVR+G +IA+F+WAPEEEGHYYPGRVSRWWLK SLA LDSSL
Sbjct  21   VVWFRRDLRVEDNPALAAGVRAGPVIAVFVWAPEEEGHYYPGRVSRWWLKNSLAQLDSSL  80

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            RSLGT L+TKRSTDSV+SL+EV+K+TGAS +FFNHLYDPLSLVRDHRAKE+LTAQG+ VR
Sbjct  81   RSLGTRLVTKRSTDSVASLLEVVKATGASQIFFNHLYDPLSLVRDHRAKEVLTAQGIVVR  140

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            S+N+DLLYEPWEV D +G PFTTF+AFWDRCLSMPYDPEAPLLPP
Sbjct  141  SYNADLLYEPWEVNDSQGLPFTTFAAFWDRCLSMPYDPEAPLLPP  185



>ref|XP_010543979.1| PREDICTED: cryptochrome-1 [Tarenaya hassleriana]
Length=682

 Score =   304 bits (778),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 140/165 (85%), Positives = 155/165 (94%), Gaps = 0/165 (0%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLRVEDNPALAAGVR+G +IA+F+WAPEEEGHYYPGRVSRWWLK SLA LDSSL
Sbjct  11   IVWFRRDLRVEDNPALAAGVRAGPVIAVFVWAPEEEGHYYPGRVSRWWLKNSLAQLDSSL  70

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            RSLGT L+TKRSTDSV+SL+EV+K+TGAS LFFNHLYDPLSLVRDHRAKE+LTAQG+ VR
Sbjct  71   RSLGTCLVTKRSTDSVASLLEVVKATGASQLFFNHLYDPLSLVRDHRAKEVLTAQGIIVR  130

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            S+N+DLLYEPWEV D +G PF+ FSAFWDRCLSMPYDPEAPLLPP
Sbjct  131  SYNADLLYEPWEVNDAQGRPFSKFSAFWDRCLSMPYDPEAPLLPP  175



>emb|CDP01060.1| unnamed protein product [Coffea canephora]
Length=682

 Score =   303 bits (775),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 137/165 (83%), Positives = 158/165 (96%), Gaps = 0/165 (0%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLRVEDNPALAAGVR+GA++A+FIW+PEEEGHYYPGRVSRWWLKQSLAHLDSSL
Sbjct  8    IVWFRRDLRVEDNPALAAGVRAGAVVAVFIWSPEEEGHYYPGRVSRWWLKQSLAHLDSSL  67

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            RSLGT LITKRS+D++S+L+EVIKSTGA+ LFFNHLYDPLSLVRDHRAKE+LTAQGV VR
Sbjct  68   RSLGTALITKRSSDTISTLLEVIKSTGATQLFFNHLYDPLSLVRDHRAKEVLTAQGVAVR  127

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            +FN+DL YEPWE+ D+EG PF TF++FW+RCLSMPYDP++PLLPP
Sbjct  128  TFNADLFYEPWEIHDEEGRPFRTFASFWERCLSMPYDPDSPLLPP  172



>ref|NP_001240855.1| cryptochrome-1-like [Glycine max]
 dbj|BAI47551.1| cryptochrome1 [Glycine max]
 dbj|BAI47552.1| cryptochrome1 [Glycine max]
 gb|KHN27000.1| Cryptochrome-1 [Glycine soja]
Length=681

 Score =   303 bits (775),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 139/165 (84%), Positives = 156/165 (95%), Gaps = 0/165 (0%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLRVEDNPALAAGVR+GA++ +FIWAPEEEG YYPGRVSRWWLKQSLAHLDS L
Sbjct  8    IVWFRRDLRVEDNPALAAGVRAGAVVCVFIWAPEEEGQYYPGRVSRWWLKQSLAHLDSYL  67

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            R+LG+ LITKRST+S+SSL+EV+KSTGA+ LFFNHLYDPLSLVRDH+AKE+LTAQG+TVR
Sbjct  68   RNLGSPLITKRSTNSISSLLEVVKSTGATQLFFNHLYDPLSLVRDHKAKEVLTAQGITVR  127

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            SFNSDLLYEPW+V D  G PFTTFSAFW+RCLSMPYDP+APLLPP
Sbjct  128  SFNSDLLYEPWDVNDAHGQPFTTFSAFWERCLSMPYDPQAPLLPP  172



>ref|XP_010060002.1| PREDICTED: cryptochrome-1 isoform X1 [Eucalyptus grandis]
 ref|XP_010060003.1| PREDICTED: cryptochrome-1 isoform X2 [Eucalyptus grandis]
 gb|KCW66522.1| hypothetical protein EUGRSUZ_F00326 [Eucalyptus grandis]
Length=679

 Score =   302 bits (774),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 138/165 (84%), Positives = 156/165 (95%), Gaps = 0/165 (0%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLRVEDNPALAAGVRSG+++A+FIWAPEEEG YYPGRVSRWWLK SLAHLDSSL
Sbjct  6    IVWFRRDLRVEDNPALAAGVRSGSVLAVFIWAPEEEGAYYPGRVSRWWLKHSLAHLDSSL  65

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            RSLGT LIT+RSTDSVSSL+E++KSTGA+ LFFNHLYDP+SLVRDHRAKE+L AQG+ V 
Sbjct  66   RSLGTCLITRRSTDSVSSLLELVKSTGATQLFFNHLYDPISLVRDHRAKEVLNAQGINVH  125

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            SFN+DLLYEPWEV DD+GHPFTTF+ FW++CLSMPYDPE+PLLPP
Sbjct  126  SFNADLLYEPWEVNDDQGHPFTTFAGFWEKCLSMPYDPESPLLPP  170



>gb|ACU44659.1| cryptochrome 1 [Medicago sativa]
Length=676

 Score =   302 bits (774),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 139/165 (84%), Positives = 155/165 (94%), Gaps = 0/165 (0%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLRVEDNPALAAGVR+GA++ +FIWAPEEEG YYPGRVSRWWLK SLAHLDSSL
Sbjct  10   IVWFRRDLRVEDNPALAAGVRAGAVVGVFIWAPEEEGQYYPGRVSRWWLKNSLAHLDSSL  69

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            R+LGT L+TKRSTDSVSSL+EV+KSTGA+ +FFNHLYDPLSLVRDHRAKEILTAQG+TVR
Sbjct  70   RNLGTPLVTKRSTDSVSSLLEVVKSTGATQIFFNHLYDPLSLVRDHRAKEILTAQGITVR  129

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            SFNSDLLYEPW+V D+ G PFTTF +FW+RCLSMPYDP+AP LPP
Sbjct  130  SFNSDLLYEPWDVNDENGQPFTTFDSFWERCLSMPYDPQAPPLPP  174



>ref|XP_002285792.1| PREDICTED: cryptochrome-1 isoform X1 [Vitis vinifera]
 ref|XP_010664331.1| PREDICTED: cryptochrome-1 isoform X2 [Vitis vinifera]
Length=681

 Score =   301 bits (772),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 143/165 (87%), Positives = 154/165 (93%), Gaps = 0/165 (0%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLRVEDNPALAAGVR+GA+I +FIWAPEEEG YYPGRVSRWWLKQSLAHLDSSL
Sbjct  8    IVWFRRDLRVEDNPALAAGVRAGAVIPVFIWAPEEEGPYYPGRVSRWWLKQSLAHLDSSL  67

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            RSLGT LITKRSTD VSSL+E++KSTGA+ LFFNHLYDPLSLVRDHRAKE LTAQG+ V 
Sbjct  68   RSLGTPLITKRSTDCVSSLLEIVKSTGATLLFFNHLYDPLSLVRDHRAKEALTAQGIAVH  127

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            SFN+DLLYEPW+V D +GH FTTFSAFWDRCLSMPYDPEAPLLPP
Sbjct  128  SFNADLLYEPWDVNDAQGHSFTTFSAFWDRCLSMPYDPEAPLLPP  172



>ref|NP_001241002.1| cryptochrome-1-like [Glycine max]
 ref|XP_006581011.1| PREDICTED: cryptochrome-1-like isoform X1 [Glycine max]
 ref|XP_006581012.1| PREDICTED: cryptochrome-1-like isoform X2 [Glycine max]
 ref|XP_006581013.1| PREDICTED: cryptochrome-1-like isoform X3 [Glycine max]
 dbj|BAI47549.1| cryptochrome1 [Glycine max]
 dbj|BAI47550.1| cryptochrome1 [Glycine max]
 gb|KHN03902.1| Cryptochrome-1 [Glycine soja]
Length=682

 Score =   301 bits (772),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 138/165 (84%), Positives = 155/165 (94%), Gaps = 0/165 (0%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLR+EDNPAL AGVR+GA++A+FIWAPEEEG YYPGRVSRWWLK SLAHLDSSL
Sbjct  9    IVWFRRDLRIEDNPALTAGVRAGAVVAVFIWAPEEEGQYYPGRVSRWWLKNSLAHLDSSL  68

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            R+LGT LITKRSTD++SSL EV+KSTGA+ LFFNHLYDPLSLVRDHRAKE+LTAQG+TVR
Sbjct  69   RNLGTPLITKRSTDTLSSLFEVVKSTGATQLFFNHLYDPLSLVRDHRAKEVLTAQGITVR  128

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            SFN+DLLYEPW+V D  G PFTTF+AFW+RCLSMPYDPE+PLLPP
Sbjct  129  SFNADLLYEPWDVNDAHGRPFTTFAAFWERCLSMPYDPESPLLPP  173



>emb|CBI19162.3| unnamed protein product [Vitis vinifera]
Length=691

 Score =   302 bits (773),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 143/165 (87%), Positives = 154/165 (93%), Gaps = 0/165 (0%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLRVEDNPALAAGVR+GA+I +FIWAPEEEG YYPGRVSRWWLKQSLAHLDSSL
Sbjct  8    IVWFRRDLRVEDNPALAAGVRAGAVIPVFIWAPEEEGPYYPGRVSRWWLKQSLAHLDSSL  67

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            RSLGT LITKRSTD VSSL+E++KSTGA+ LFFNHLYDPLSLVRDHRAKE LTAQG+ V 
Sbjct  68   RSLGTPLITKRSTDCVSSLLEIVKSTGATLLFFNHLYDPLSLVRDHRAKEALTAQGIAVH  127

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            SFN+DLLYEPW+V D +GH FTTFSAFWDRCLSMPYDPEAPLLPP
Sbjct  128  SFNADLLYEPWDVNDAQGHSFTTFSAFWDRCLSMPYDPEAPLLPP  172



>gb|ABX80391.1| cryptochrome 1 [Vitis riparia]
Length=681

 Score =   301 bits (772),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 143/165 (87%), Positives = 154/165 (93%), Gaps = 0/165 (0%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLRVEDNPALAAGVR+GA+I +FIWAPEEEG YYPGRVSRWWLKQSLAHLDSSL
Sbjct  8    IVWFRRDLRVEDNPALAAGVRAGAVIPVFIWAPEEEGPYYPGRVSRWWLKQSLAHLDSSL  67

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            RSLGT LITKRSTD VSSL+E++KSTGA+ LFFNHLYDPLSLVRDHRAKE LTAQG+ V 
Sbjct  68   RSLGTPLITKRSTDCVSSLLEIVKSTGATLLFFNHLYDPLSLVRDHRAKEALTAQGIAVH  127

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            SFN+DLLYEPW+V D +GH FTTFSAFWDRCLSMPYDPEAPLLPP
Sbjct  128  SFNADLLYEPWDVNDAQGHSFTTFSAFWDRCLSMPYDPEAPLLPP  172



>gb|AAR08429.1| cryptochrome 1 [Orobanche minor]
Length=679

 Score =   301 bits (771),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 140/165 (85%), Positives = 155/165 (94%), Gaps = 0/165 (0%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLRVEDNPALAAGVR+GA++ LFIWAPEEEGHYYPGRVSRWWLKQSL+HLD SL
Sbjct  10   IVWFRRDLRVEDNPALAAGVRAGAVLPLFIWAPEEEGHYYPGRVSRWWLKQSLSHLDISL  69

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            RSLGT+L+T+RSTDSVSSL+EVIK TGA  +FFNHLYDP+SLVRDHRAKE+LTA+GV VR
Sbjct  70   RSLGTSLVTRRSTDSVSSLLEVIKLTGAKQIFFNHLYDPISLVRDHRAKEVLTAEGVAVR  129

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            SFN+DLLYEPWEV D EG PFTTF+ FW+RCLSMPYDPEAPLLPP
Sbjct  130  SFNADLLYEPWEVHDQEGQPFTTFAGFWERCLSMPYDPEAPLLPP  174



>ref|XP_010676474.1| PREDICTED: cryptochrome-1 isoform X1 [Beta vulgaris subsp. vulgaris]
Length=695

 Score =   301 bits (772),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 139/165 (84%), Positives = 155/165 (94%), Gaps = 0/165 (0%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLRVEDNPALAAGVR+GA+I +FIWAPEEEGHYYPGRVSRWWLK SLA LDSSL
Sbjct  8    IVWFRRDLRVEDNPALAAGVRAGAVICVFIWAPEEEGHYYPGRVSRWWLKNSLAQLDSSL  67

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            RSLGT LITKRSTDSVSSL+EV+KSTGAS + FNHLYDPLSLVRDHRAKE+LTA GV+VR
Sbjct  68   RSLGTCLITKRSTDSVSSLLEVVKSTGASQILFNHLYDPLSLVRDHRAKEVLTANGVSVR  127

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            SFN+DLLYEPWEVVD+ G PFTTF++FW++CL MP+DP+APLLPP
Sbjct  128  SFNADLLYEPWEVVDERGQPFTTFTSFWEKCLGMPFDPDAPLLPP  172



>gb|ABX79355.1| cryptochrome 1 [Vitis vinifera]
Length=681

 Score =   301 bits (771),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 142/165 (86%), Positives = 154/165 (93%), Gaps = 0/165 (0%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLRVEDNPALAAGVR+GA+I +FIWAPEEEG YYPGRVSRWWLKQSLAHLDSSL
Sbjct  8    IVWFRRDLRVEDNPALAAGVRAGAVIPVFIWAPEEEGPYYPGRVSRWWLKQSLAHLDSSL  67

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            RSLGT LITKRSTD +SSL+E++KSTGA+ LFFNHLYDPLSLVRDHRAKE LTAQG+ V 
Sbjct  68   RSLGTPLITKRSTDCISSLLEIVKSTGATLLFFNHLYDPLSLVRDHRAKEALTAQGIAVH  127

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            SFN+DLLYEPW+V D +GH FTTFSAFWDRCLSMPYDPEAPLLPP
Sbjct  128  SFNADLLYEPWDVNDAQGHSFTTFSAFWDRCLSMPYDPEAPLLPP  172



>ref|XP_010676482.1| PREDICTED: cryptochrome-1 isoform X2 [Beta vulgaris subsp. vulgaris]
 ref|XP_010676490.1| PREDICTED: cryptochrome-1 isoform X3 [Beta vulgaris subsp. vulgaris]
Length=685

 Score =   301 bits (771),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 139/165 (84%), Positives = 155/165 (94%), Gaps = 0/165 (0%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLRVEDNPALAAGVR+GA+I +FIWAPEEEGHYYPGRVSRWWLK SLA LDSSL
Sbjct  8    IVWFRRDLRVEDNPALAAGVRAGAVICVFIWAPEEEGHYYPGRVSRWWLKNSLAQLDSSL  67

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            RSLGT LITKRSTDSVSSL+EV+KSTGAS + FNHLYDPLSLVRDHRAKE+LTA GV+VR
Sbjct  68   RSLGTCLITKRSTDSVSSLLEVVKSTGASQILFNHLYDPLSLVRDHRAKEVLTANGVSVR  127

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            SFN+DLLYEPWEVVD+ G PFTTF++FW++CL MP+DP+APLLPP
Sbjct  128  SFNADLLYEPWEVVDERGQPFTTFTSFWEKCLGMPFDPDAPLLPP  172



>ref|NP_001235205.1| cryptochrome 1 [Glycine max]
 gb|ABD63261.1| cryptochrome 1 [Glycine max]
 dbj|BAI47548.1| cryptochrome1 [Glycine max]
 gb|KHN19765.1| Cryptochrome-1 [Glycine soja]
Length=681

 Score =   300 bits (769),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 137/165 (83%), Positives = 155/165 (94%), Gaps = 0/165 (0%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLR+EDNPAL AGVR+GA++A+F+WAPEEEG YYPGRVSRWWLK SLAHL SSL
Sbjct  8    IVWFRRDLRIEDNPALTAGVRAGAVVAVFVWAPEEEGQYYPGRVSRWWLKNSLAHLHSSL  67

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            R+LGT LITKRSTD++SSL+EV+KSTGA+ LFFNHLYDPLSLVRDHRAKE+LTAQG+TVR
Sbjct  68   RNLGTPLITKRSTDTLSSLLEVVKSTGATQLFFNHLYDPLSLVRDHRAKEVLTAQGITVR  127

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            SFN+DLLYEPWEV D  G PFTTF+AFW+RCLSMPYDPE+PLLPP
Sbjct  128  SFNADLLYEPWEVNDAHGRPFTTFAAFWERCLSMPYDPESPLLPP  172



>ref|XP_010269331.1| PREDICTED: LOW QUALITY PROTEIN: cryptochrome-1-like [Nelumbo 
nucifera]
Length=524

 Score =   295 bits (756),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 135/165 (82%), Positives = 155/165 (94%), Gaps = 0/165 (0%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLR+EDNPALAAGVR+GA+IA+FIWAPEEEGHYYPGRVSRWWLKQ+LAHLD +L
Sbjct  8    IVWFRRDLRIEDNPALAAGVRAGAVIAVFIWAPEEEGHYYPGRVSRWWLKQTLAHLDITL  67

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            RSLGT+L+TKRST+SVSSLIEV+KSTGA+ LFFN LYDPLSLVRDH+AKE+L+AQG+TVR
Sbjct  68   RSLGTSLVTKRSTNSVSSLIEVVKSTGATQLFFNDLYDPLSLVRDHQAKEVLSAQGITVR  127

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            SFN+DLLYEPWE+ D +G PF TF  FW++CLSMPYDP APLLPP
Sbjct  128  SFNADLLYEPWEITDVDGRPFATFVDFWNKCLSMPYDPAAPLLPP  172



>ref|XP_006433985.1| hypothetical protein CICLE_v10000591mg [Citrus clementina]
 gb|ESR47225.1| hypothetical protein CICLE_v10000591mg [Citrus clementina]
Length=626

 Score =   298 bits (763),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 137/165 (83%), Positives = 156/165 (95%), Gaps = 0/165 (0%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLRVEDNPALAAGVR+GA+IA+FIWAPEEEG YYPGRVSRWWLK SL+HLDSSL
Sbjct  8    IVWFRRDLRVEDNPALAAGVRAGAVIAVFIWAPEEEGPYYPGRVSRWWLKHSLSHLDSSL  67

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            RSLGT+L+TKRSTDSVSSL+EV+K+TGA+ LFFNHLYDPLSLVRDHRAKE LTAQG+ VR
Sbjct  68   RSLGTSLVTKRSTDSVSSLLEVVKATGATQLFFNHLYDPLSLVRDHRAKEALTAQGIAVR  127

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            SFN+DLLYEPW+V D +G PF TF+AFW++CLSMP+DP+APLLPP
Sbjct  128  SFNADLLYEPWDVNDAQGQPFATFAAFWEKCLSMPFDPDAPLLPP  172



>gb|AAS79664.1| mutant cryptochrome 1-1 protein [Pisum sativum]
Length=682

 Score =   299 bits (766),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 136/165 (82%), Positives = 155/165 (94%), Gaps = 0/165 (0%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLRVEDNPALAAGVR+GA++ +FIWAPEEEG YYPGRVSRWWLK SL+ LDSSL
Sbjct  8    IVWFRRDLRVEDNPALAAGVRAGAVVGVFIWAPEEEGQYYPGRVSRWWLKNSLSQLDSSL  67

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            R+LGT L+TKRSTDS+SSL+EV+KSTGA+ +FFNHLYDPLSLVRDHRAKEILTAQG+TVR
Sbjct  68   RNLGTPLVTKRSTDSISSLLEVVKSTGATQIFFNHLYDPLSLVRDHRAKEILTAQGITVR  127

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            S+NSDLLYEPW+V D+ G PFTTF +FW+RCLSMPYDP+APLLPP
Sbjct  128  SYNSDLLYEPWDVNDEHGQPFTTFDSFWERCLSMPYDPQAPLLPP  172



>gb|AAO23970.1| cryptochrome 1 [Pisum sativum]
 gb|AAS79662.1| cryptochrome 1 apoprotein [Pisum sativum]
 gb|AAS79663.1| cryptochrome 1 apoprotein [Pisum sativum]
Length=682

 Score =   299 bits (766),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 136/165 (82%), Positives = 155/165 (94%), Gaps = 0/165 (0%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLRVEDNPALAAGVR+GA++ +FIWAPEEEG YYPGRVSRWWLK SL+ LDSSL
Sbjct  8    IVWFRRDLRVEDNPALAAGVRAGAVVGVFIWAPEEEGQYYPGRVSRWWLKNSLSQLDSSL  67

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            R+LGT L+TKRSTDS+SSL+EV+KSTGA+ +FFNHLYDPLSLVRDHRAKEILTAQG+TVR
Sbjct  68   RNLGTPLVTKRSTDSISSLLEVVKSTGATQIFFNHLYDPLSLVRDHRAKEILTAQGITVR  127

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            S+NSDLLYEPW+V D+ G PFTTF +FW+RCLSMPYDP+APLLPP
Sbjct  128  SYNSDLLYEPWDVNDEHGQPFTTFDSFWERCLSMPYDPQAPLLPP  172



>ref|XP_006433984.1| hypothetical protein CICLE_v10000591mg [Citrus clementina]
 ref|XP_006433986.1| hypothetical protein CICLE_v10000591mg [Citrus clementina]
 gb|ESR47224.1| hypothetical protein CICLE_v10000591mg [Citrus clementina]
 gb|ESR47226.1| hypothetical protein CICLE_v10000591mg [Citrus clementina]
 gb|KDO80965.1| hypothetical protein CISIN_1g005723mg [Citrus sinensis]
 gb|KDO80966.1| hypothetical protein CISIN_1g005723mg [Citrus sinensis]
 gb|KDO80967.1| hypothetical protein CISIN_1g005723mg [Citrus sinensis]
Length=681

 Score =   298 bits (764),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 137/165 (83%), Positives = 156/165 (95%), Gaps = 0/165 (0%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLRVEDNPALAAGVR+GA+IA+FIWAPEEEG YYPGRVSRWWLK SL+HLDSSL
Sbjct  8    IVWFRRDLRVEDNPALAAGVRAGAVIAVFIWAPEEEGPYYPGRVSRWWLKHSLSHLDSSL  67

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            RSLGT+L+TKRSTDSVSSL+EV+K+TGA+ LFFNHLYDPLSLVRDHRAKE LTAQG+ VR
Sbjct  68   RSLGTSLVTKRSTDSVSSLLEVVKATGATQLFFNHLYDPLSLVRDHRAKEALTAQGIAVR  127

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            SFN+DLLYEPW+V D +G PF TF+AFW++CLSMP+DP+APLLPP
Sbjct  128  SFNADLLYEPWDVNDAQGQPFATFAAFWEKCLSMPFDPDAPLLPP  172



>pdb|1U3C|A Chain A, Crystal Structure Of The Phr Domain Of Cryptochrome 
1 From Arabidopsis Thaliana
 pdb|1U3D|A Chain A, Crystal Structure Of The Phr Domain Of Cryptochrome 
1 From Arabidopsis Thaliana With Amppnp Bound
Length=509

 Score =   293 bits (751),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 136/165 (82%), Positives = 154/165 (93%), Gaps = 0/165 (0%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLRVEDNPALAA VR+G +IALF+WAPEEEGHY+PGRVSRWWLK SLA LDSSL
Sbjct  15   IVWFRRDLRVEDNPALAAAVRAGPVIALFVWAPEEEGHYHPGRVSRWWLKNSLAQLDSSL  74

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            RSLGT LITKRSTDSV+SL++V+KSTGAS +FFNHLYDPLSLVRDHRAK++LTAQG+ VR
Sbjct  75   RSLGTCLITKRSTDSVASLLDVVKSTGASQIFFNHLYDPLSLVRDHRAKDVLTAQGIAVR  134

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            SFN+DLLYEPWEV D+ G PF+ F+AFW+RCLSMPYDPE+PLLPP
Sbjct  135  SFNADLLYEPWEVTDELGRPFSMFAAFWERCLSMPYDPESPLLPP  179



>ref|XP_006472600.1| PREDICTED: cryptochrome-1-like isoform X1 [Citrus sinensis]
 ref|XP_006472601.1| PREDICTED: cryptochrome-1-like isoform X2 [Citrus sinensis]
Length=681

 Score =   297 bits (760),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 136/165 (82%), Positives = 156/165 (95%), Gaps = 0/165 (0%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLRVEDNPALAAGVR+GA+IA+FIWAPEEEG YYPGRVSRWWLK SL+HLDSSL
Sbjct  8    IVWFRRDLRVEDNPALAAGVRAGAVIAVFIWAPEEEGPYYPGRVSRWWLKHSLSHLDSSL  67

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            RSLGT+L+TKRSTDSVSSL+EV+K+TGA+ LFFNHLYDPLSLVRDH+AKE LTAQG+ VR
Sbjct  68   RSLGTSLVTKRSTDSVSSLLEVVKATGATQLFFNHLYDPLSLVRDHQAKEALTAQGIAVR  127

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            SFN+DLLYEPW+V D +G PF TF+AFW++CLSMP+DP+APLLPP
Sbjct  128  SFNADLLYEPWDVNDAQGQPFATFAAFWEKCLSMPFDPDAPLLPP  172



>gb|AAB28725.2| flavin-type blue-light photoreceptor [Arabidopsis thaliana]
Length=556

 Score =   293 bits (751),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 136/165 (82%), Positives = 154/165 (93%), Gaps = 0/165 (0%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLRVEDNPALAA VR+G +IALF+WAPEEEGHY+PGRVSRWWLK SLA LDSSL
Sbjct  15   IVWFRRDLRVEDNPALAAAVRAGPVIALFVWAPEEEGHYHPGRVSRWWLKNSLAQLDSSL  74

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            RSLGT LITKRSTDSV+SL++V+KSTGAS +FFNHLYDPLSLVRDHRAK++LTAQG+ VR
Sbjct  75   RSLGTCLITKRSTDSVASLLDVVKSTGASQIFFNHLYDPLSLVRDHRAKDVLTAQGIAVR  134

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            SFN+DLLYEPWEV D+ G PF+ F+AFW+RCLSMPYDPE+PLLPP
Sbjct  135  SFNADLLYEPWEVTDELGRPFSMFAAFWERCLSMPYDPESPLLPP  179



>gb|KFK32104.1| hypothetical protein AALP_AA6G199300 [Arabis alpina]
Length=690

 Score =   297 bits (760),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 136/165 (82%), Positives = 154/165 (93%), Gaps = 0/165 (0%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLRVEDNPALAA VR+G +IA+F+WAPEEEGHY+PGRVSRWWLK SL+ LDSSL
Sbjct  15   IVWFRRDLRVEDNPALAAAVRAGPVIAVFVWAPEEEGHYHPGRVSRWWLKNSLSQLDSSL  74

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            RSLGT LITKRSTDSV+SL+EV+KSTGAS +FFNHLYDPLSLVRDHRAK++LTAQG+ VR
Sbjct  75   RSLGTCLITKRSTDSVASLLEVVKSTGASQIFFNHLYDPLSLVRDHRAKDVLTAQGIAVR  134

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            SFN+DLLYEPWEV D+ G PF+ F+AFWDRCLSMPYDPE+PLLPP
Sbjct  135  SFNADLLYEPWEVTDELGRPFSMFAAFWDRCLSMPYDPESPLLPP  179



>ref|XP_004490375.1| PREDICTED: cryptochrome-1-like [Cicer arietinum]
Length=681

 Score =   296 bits (759),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 136/165 (82%), Positives = 154/165 (93%), Gaps = 0/165 (0%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLRVEDNPALAAGVR+GA++A+FIWAPEEEG YYPGRVSRWWLK SL+ LDSSL
Sbjct  8    IVWFRRDLRVEDNPALAAGVRAGAVVAVFIWAPEEEGQYYPGRVSRWWLKNSLSQLDSSL  67

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            RSLGT LITKRSTDSVSSL+EV+K+TGA+ +FFNHLYDPLSLVRDH+AKE+LT QG+TVR
Sbjct  68   RSLGTPLITKRSTDSVSSLLEVVKNTGATQIFFNHLYDPLSLVRDHKAKEVLTTQGITVR  127

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            SFNSDLLYEPW+V D+   PFTTF +FW+RCLSMPYDP+APLLPP
Sbjct  128  SFNSDLLYEPWDVNDEHDQPFTTFDSFWERCLSMPYDPQAPLLPP  172



>ref|XP_010421806.1| PREDICTED: LOW QUALITY PROTEIN: cryptochrome-1-like [Camelina 
sativa]
Length=562

 Score =   293 bits (751),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 136/165 (82%), Positives = 153/165 (93%), Gaps = 0/165 (0%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLRVEDNPALAA VR+G +IA+F+WAPEEEGHY+PGRVSRWWLK SLA LDSSL
Sbjct  20   IVWFRRDLRVEDNPALAAAVRAGPVIAVFVWAPEEEGHYHPGRVSRWWLKNSLAQLDSSL  79

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            RSLGT LITKRSTDSV+SL+EV+KSTGAS +FFNHLYDPLSLVRDHRAK++LTAQG+ VR
Sbjct  80   RSLGTCLITKRSTDSVASLLEVVKSTGASQIFFNHLYDPLSLVRDHRAKDVLTAQGIAVR  139

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            SFN+DLLYEPWEV D+ G PF+ F AFW+RCLSMPYDPE+PLLPP
Sbjct  140  SFNADLLYEPWEVTDELGRPFSMFDAFWERCLSMPYDPESPLLPP  184



>dbj|BAK61537.1| cryptochrome1b [Glycine soja]
 dbj|BAK61539.1| cryptochrome1b [Glycine soja]
 dbj|BAK61541.1| cryptochrome1b [Glycine soja]
 dbj|BAK61543.1| cryptochrome1b [Glycine soja]
 dbj|BAK61545.1| cryptochrome1b [Glycine soja]
 dbj|BAK61547.1| cryptochrome1b [Glycine soja]
 dbj|BAK61549.1| cryptochrome1b [Glycine soja]
Length=345

 Score =   286 bits (733),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 132/159 (83%), Positives = 149/159 (94%), Gaps = 0/159 (0%)
 Frame = +3

Query  93   DLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSLRSLGTT  272
            DLR+EDNPAL AGVR+GA++A+FIWAPEEEG YYPGRVSRWWLK SLAHLDSSLR+LGT 
Sbjct  1    DLRIEDNPALTAGVRAGAVVAVFIWAPEEEGQYYPGRVSRWWLKNSLAHLDSSLRNLGTP  60

Query  273  LITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVRSFNSDL  452
            LITKRSTD++SSL EV+KSTGA+ LFFNHLYDPLSLVRDHRAKE+LTAQG+TVRSFN+DL
Sbjct  61   LITKRSTDTLSSLFEVVKSTGATQLFFNHLYDPLSLVRDHRAKEVLTAQGITVRSFNADL  120

Query  453  LYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            LYEPW+V D  G PFTTF+AFW+RCLSMPYDPE+PLLPP
Sbjct  121  LYEPWDVNDAHGRPFTTFAAFWERCLSMPYDPESPLLPP  159



>dbj|BAJ15771.1| cryptochrome1, partial [Cardamine nipponica]
Length=693

 Score =   296 bits (758),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 136/165 (82%), Positives = 154/165 (93%), Gaps = 0/165 (0%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLRVEDNPALAA VR+G +IALF+WAPEEEGHY+PGRVSRWWLK SLA LDSSL
Sbjct  3    IVWFRRDLRVEDNPALAAAVRAGPVIALFVWAPEEEGHYHPGRVSRWWLKNSLAQLDSSL  62

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            RSLGT LITKRSTDSV+SL++V+KSTGAS +FFNHLYDPLSLVRDHRAK++LTAQG+ VR
Sbjct  63   RSLGTCLITKRSTDSVASLLDVVKSTGASQIFFNHLYDPLSLVRDHRAKDVLTAQGIAVR  122

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            SFN+DLLYEPWEV D+ G PF+ F+AFW+RCLSMPYDPE+PLLPP
Sbjct  123  SFNADLLYEPWEVTDELGRPFSMFAAFWERCLSMPYDPESPLLPP  167



>dbj|BAJ15777.1| cryptochrome1, partial [Cardamine nipponica]
 dbj|BAJ15778.1| cryptochrome1, partial [Cardamine nipponica]
Length=693

 Score =   296 bits (758),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 136/165 (82%), Positives = 154/165 (93%), Gaps = 0/165 (0%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLRVEDNPALAA VR+G +IALF+WAPEEEGHY+PGRVSRWWLK SLA LDSSL
Sbjct  3    IVWFRRDLRVEDNPALAAAVRAGPVIALFVWAPEEEGHYHPGRVSRWWLKNSLAQLDSSL  62

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            RSLGT LITKRSTDSV+SL++V+KSTGAS +FFNHLYDPLSLVRDHRAK++LTAQG+ VR
Sbjct  63   RSLGTCLITKRSTDSVASLLDVVKSTGASQIFFNHLYDPLSLVRDHRAKDVLTAQGIAVR  122

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            SFN+DLLYEPWEV D+ G PF+ F+AFW+RCLSMPYDPE+PLLPP
Sbjct  123  SFNADLLYEPWEVTDELGRPFSMFAAFWERCLSMPYDPESPLLPP  167



>dbj|BAJ15775.1| cryptochrome1, partial [Cardamine nipponica]
Length=693

 Score =   296 bits (758),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 136/165 (82%), Positives = 154/165 (93%), Gaps = 0/165 (0%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLRVEDNPALAA VR+G +IALF+WAPEEEGHY+PGRVSRWWLK SLA LDSSL
Sbjct  3    IVWFRRDLRVEDNPALAAAVRAGPVIALFVWAPEEEGHYHPGRVSRWWLKNSLAQLDSSL  62

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            RSLGT LITKRSTDSV+SL++V+KSTGAS +FFNHLYDPLSLVRDHRAK++LTAQG+ VR
Sbjct  63   RSLGTCLITKRSTDSVASLLDVVKSTGASQIFFNHLYDPLSLVRDHRAKDVLTAQGIAVR  122

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            SFN+DLLYEPWEV D+ G PF+ F+AFW+RCLSMPYDPE+PLLPP
Sbjct  123  SFNADLLYEPWEVTDELGRPFSMFAAFWERCLSMPYDPESPLLPP  167



>dbj|BAJ15776.1| cryptochrome1, partial [Cardamine nipponica]
Length=693

 Score =   296 bits (758),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 136/165 (82%), Positives = 154/165 (93%), Gaps = 0/165 (0%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLRVEDNPALAA VR+G +IALF+WAPEEEGHY+PGRVSRWWLK SLA LDSSL
Sbjct  3    IVWFRRDLRVEDNPALAAAVRAGPVIALFVWAPEEEGHYHPGRVSRWWLKNSLAQLDSSL  62

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            RSLGT LITKRSTDSV+SL++V+KSTGAS +FFNHLYDPLSLVRDHRAK++LTAQG+ VR
Sbjct  63   RSLGTCLITKRSTDSVASLLDVVKSTGASQIFFNHLYDPLSLVRDHRAKDVLTAQGIAVR  122

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            SFN+DLLYEPWEV D+ G PF+ F+AFW+RCLSMPYDPE+PLLPP
Sbjct  123  SFNADLLYEPWEVTDELGRPFSMFAAFWERCLSMPYDPESPLLPP  167



>dbj|BAJ15769.1| cryptochrome1, partial [Cardamine nipponica]
 dbj|BAJ15770.1| cryptochrome1, partial [Cardamine nipponica]
 dbj|BAJ15772.1| cryptochrome1, partial [Cardamine nipponica]
 dbj|BAJ15773.1| cryptochrome1, partial [Cardamine nipponica]
 dbj|BAJ15774.1| cryptochrome1, partial [Cardamine nipponica]
 dbj|BAJ15779.1| cryptochrome1, partial [Cardamine nipponica]
 dbj|BAJ15780.1| cryptochrome1, partial [Cardamine nipponica]
Length=693

 Score =   296 bits (758),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 136/165 (82%), Positives = 154/165 (93%), Gaps = 0/165 (0%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLRVEDNPALAA VR+G +IALF+WAPEEEGHY+PGRVSRWWLK SLA LDSSL
Sbjct  3    IVWFRRDLRVEDNPALAAAVRAGPVIALFVWAPEEEGHYHPGRVSRWWLKNSLAQLDSSL  62

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            RSLGT LITKRSTDSV+SL++V+KSTGAS +FFNHLYDPLSLVRDHRAK++LTAQG+ VR
Sbjct  63   RSLGTCLITKRSTDSVASLLDVVKSTGASQIFFNHLYDPLSLVRDHRAKDVLTAQGIAVR  122

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            SFN+DLLYEPWEV D+ G PF+ F+AFW+RCLSMPYDPE+PLLPP
Sbjct  123  SFNADLLYEPWEVTDELGRPFSMFAAFWERCLSMPYDPESPLLPP  167



>dbj|BAJ15781.1| cryptochrome1, partial [Cardamine bellidifolia subsp. alpina]
Length=681

 Score =   296 bits (757),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 136/165 (82%), Positives = 154/165 (93%), Gaps = 0/165 (0%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLRVEDNPALAA VR+G +IALF+WAPEEEGHY+PGRVSRWWLK SLA LDSSL
Sbjct  3    IVWFRRDLRVEDNPALAAAVRAGPVIALFVWAPEEEGHYHPGRVSRWWLKNSLAQLDSSL  62

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            RSLGT LITKRSTDSV+SL++V+KSTGAS +FFNHLYDPLSLVRDHRAK++LTAQG+ VR
Sbjct  63   RSLGTCLITKRSTDSVASLLDVVKSTGASQIFFNHLYDPLSLVRDHRAKDVLTAQGIAVR  122

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            SFN+DLLYEPWEV D+ G PF+ F+AFW+RCLSMPYDPE+PLLPP
Sbjct  123  SFNADLLYEPWEVTDELGRPFSMFAAFWERCLSMPYDPESPLLPP  167



>ref|NP_567341.1| cryptochrome-1 [Arabidopsis thaliana]
 sp|Q43125.2|CRY1_ARATH RecName: Full=Cryptochrome-1; AltName: Full=Blue light photoreceptor; 
AltName: Full=Protein BLUE LIGHT UNINHIBITED 1; AltName: 
Full=Protein ELONGATED HYPOCOTYL 4; AltName: Full=Protein 
OUT OF PHASE 2; Short=OOP2 [Arabidopsis thaliana]
 gb|AAM70572.1| AT4g08920/hy4 [Arabidopsis thaliana]
 gb|AEE82696.1| cryptochrome-1 [Arabidopsis thaliana]
Length=681

 Score =   295 bits (756),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 136/165 (82%), Positives = 154/165 (93%), Gaps = 0/165 (0%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLRVEDNPALAA VR+G +IALF+WAPEEEGHY+PGRVSRWWLK SLA LDSSL
Sbjct  15   IVWFRRDLRVEDNPALAAAVRAGPVIALFVWAPEEEGHYHPGRVSRWWLKNSLAQLDSSL  74

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            RSLGT LITKRSTDSV+SL++V+KSTGAS +FFNHLYDPLSLVRDHRAK++LTAQG+ VR
Sbjct  75   RSLGTCLITKRSTDSVASLLDVVKSTGASQIFFNHLYDPLSLVRDHRAKDVLTAQGIAVR  134

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            SFN+DLLYEPWEV D+ G PF+ F+AFW+RCLSMPYDPE+PLLPP
Sbjct  135  SFNADLLYEPWEVTDELGRPFSMFAAFWERCLSMPYDPESPLLPP  179



>gb|AAB28724.1| flavin-type blue-light photoreceptor [Arabidopsis thaliana]
Length=681

 Score =   295 bits (756),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 136/165 (82%), Positives = 154/165 (93%), Gaps = 0/165 (0%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLRVEDNPALAA VR+G +IALF+WAPEEEGHY+PGRVSRWWLK SLA LDSSL
Sbjct  15   IVWFRRDLRVEDNPALAAAVRAGPVIALFVWAPEEEGHYHPGRVSRWWLKNSLAQLDSSL  74

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            RSLGT LITKRSTDSV+SL++V+KSTGAS +FFNHLYDPLSLVRDHRAK++LTAQG+ VR
Sbjct  75   RSLGTCLITKRSTDSVASLLDVVKSTGASQIFFNHLYDPLSLVRDHRAKDVLTAQGIAVR  134

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            SFN+DLLYEPWEV D+ G PF+ F+AFW+RCLSMPYDPE+PLLPP
Sbjct  135  SFNADLLYEPWEVTDELGRPFSMFAAFWERCLSMPYDPESPLLPP  179



>ref|XP_008219437.1| PREDICTED: cryptochrome-1 isoform X1 [Prunus mume]
 ref|XP_008219438.1| PREDICTED: cryptochrome-1 isoform X2 [Prunus mume]
Length=679

 Score =   295 bits (756),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 137/165 (83%), Positives = 153/165 (93%), Gaps = 0/165 (0%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            +VWFRRDLRVEDNPALAAGVR+G+++ +FIWAPEEEG YYPGRVSRWWLK SLAHLDSSL
Sbjct  8    VVWFRRDLRVEDNPALAAGVRAGSVVCVFIWAPEEEGPYYPGRVSRWWLKHSLAHLDSSL  67

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            RSLGT+LITKRSTDSVSSL+EV+ STGA+ LFFNHLYDP+SLVRDHRAKE+LTAQG+ VR
Sbjct  68   RSLGTSLITKRSTDSVSSLLEVVISTGATQLFFNHLYDPISLVRDHRAKEVLTAQGIAVR  127

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            SFN+DLLYEPW+V D  G PFTTF AFW RCLSMPYDP+APLLPP
Sbjct  128  SFNADLLYEPWDVNDVNGRPFTTFDAFWGRCLSMPYDPDAPLLPP  172



>ref|XP_007225162.1| hypothetical protein PRUPE_ppa002375mg [Prunus persica]
 gb|EMJ26361.1| hypothetical protein PRUPE_ppa002375mg [Prunus persica]
Length=679

 Score =   295 bits (756),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 137/165 (83%), Positives = 153/165 (93%), Gaps = 0/165 (0%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            +VWFRRDLRVEDNPALAAGVR+G+++ +FIWAPEEEG YYPGRVSRWWLK SLAHLDSSL
Sbjct  8    VVWFRRDLRVEDNPALAAGVRAGSVVCVFIWAPEEEGPYYPGRVSRWWLKHSLAHLDSSL  67

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            RSLGT+LITKRSTDSVSSL+EV+ STGA+ LFFNHLYDP+SLVRDHRAKE+LTAQG+ VR
Sbjct  68   RSLGTSLITKRSTDSVSSLLEVVISTGATQLFFNHLYDPISLVRDHRAKEVLTAQGIAVR  127

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            SFN+DLLYEPW+V D  G PFTTF AFW RCLSMPYDP+APLLPP
Sbjct  128  SFNADLLYEPWDVNDVNGRPFTTFDAFWGRCLSMPYDPDAPLLPP  172



>gb|ACX49996.1| cryptochrome 1, partial [Capsella bursa-pastoris]
Length=660

 Score =   295 bits (754),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 136/165 (82%), Positives = 152/165 (92%), Gaps = 0/165 (0%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLRVEDNPALAA VR+G +IA+F+WAPEEEGHY+PGRVSRWWLK SLA LDSSL
Sbjct  18   IVWFRRDLRVEDNPALAAAVRAGPVIAVFVWAPEEEGHYHPGRVSRWWLKNSLAQLDSSL  77

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            RSLGT LITKRSTDSV+SL+EV+KSTGAS +FFNHLYDPLSLVRDHRAK +LTAQG+ VR
Sbjct  78   RSLGTCLITKRSTDSVTSLLEVVKSTGASQIFFNHLYDPLSLVRDHRAKXVLTAQGIAVR  137

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            SFN+DLLYEPWEV D+ G PF+ F AFW+RCLSMPYDPE+PLLPP
Sbjct  138  SFNADLLYEPWEVTDELGRPFSMFGAFWERCLSMPYDPESPLLPP  182



>ref|XP_002874505.1| hypothetical protein ARALYDRAFT_327070 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50764.1| hypothetical protein ARALYDRAFT_327070 [Arabidopsis lyrata subsp. 
lyrata]
Length=690

 Score =   295 bits (756),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 136/165 (82%), Positives = 154/165 (93%), Gaps = 0/165 (0%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLRVEDNPALAA VR+G +IALF+WAPEEEGHY+PGRVSRWWLK SLA LDSSL
Sbjct  15   IVWFRRDLRVEDNPALAAAVRAGPVIALFVWAPEEEGHYHPGRVSRWWLKNSLAQLDSSL  74

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            RSLGT LITKRSTDSV+SL++V+KSTGAS +FFNHLYDPLSLVRDHRAK++LTAQG+ VR
Sbjct  75   RSLGTCLITKRSTDSVASLLDVVKSTGASQIFFNHLYDPLSLVRDHRAKDVLTAQGIAVR  134

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            SFN+DLLYEPWEV D+ G PF+ F+AFW+RCLSMPYDPE+PLLPP
Sbjct  135  SFNADLLYEPWEVTDELGRPFSMFAAFWERCLSMPYDPESPLLPP  179



>ref|XP_006360269.1| PREDICTED: cryptochrome-1-like [Solanum tuberosum]
Length=583

 Score =   292 bits (748),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 133/165 (81%), Positives = 158/165 (96%), Gaps = 0/165 (0%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLR+EDNPALAAGVR+G++IA+FIWAPEEEG+Y PGRVSRWW+K+SLAHLDSSL
Sbjct  8    IVWFRRDLRLEDNPALAAGVRAGSVIAVFIWAPEEEGYYCPGRVSRWWIKKSLAHLDSSL  67

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            + LGT+LITKRS DSVSSL++V+KSTGA+ +FFNHLYDP+SLVRD+RAKE L+A+GV+V 
Sbjct  68   KKLGTSLITKRSNDSVSSLLQVVKSTGATRVFFNHLYDPISLVRDNRAKETLSAEGVSVC  127

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            SFN+DLLYEPWEVVDDEGHPF+TFS FW++CL+MPYDPEAPLLPP
Sbjct  128  SFNADLLYEPWEVVDDEGHPFSTFSDFWEKCLTMPYDPEAPLLPP  172



>gb|ACX49997.1| cryptochrome 1, partial [Capsella bursa-pastoris]
Length=674

 Score =   295 bits (755),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 136/165 (82%), Positives = 152/165 (92%), Gaps = 0/165 (0%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLRVEDNPALAA VR+G +IA+F+WAPEEEGHY+PGRVSRWWLK SLA LDSSL
Sbjct  18   IVWFRRDLRVEDNPALAAAVRAGPVIAVFVWAPEEEGHYHPGRVSRWWLKNSLAQLDSSL  77

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            RSLGT LITKRSTDSV+SL+EV+KSTGAS +FFNHLYDPLSLVRDHRAK +LTAQG+ VR
Sbjct  78   RSLGTCLITKRSTDSVTSLLEVVKSTGASQIFFNHLYDPLSLVRDHRAKXVLTAQGIAVR  137

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            SFN+DLLYEPWEV D+ G PF+ F AFW+RCLSMPYDPE+PLLPP
Sbjct  138  SFNADLLYEPWEVTDELGRPFSMFGAFWERCLSMPYDPESPLLPP  182



>emb|CAB78016.1| Arabidopsis thaliana flavin-type blue-light photoreceptor (SW:Q43125) 
(Pfam: PF00875, Score=765.2, E=2.6e-226, N=1)
Length=716

 Score =   296 bits (757),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 136/165 (82%), Positives = 154/165 (93%), Gaps = 0/165 (0%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLRVEDNPALAA VR+G +IALF+WAPEEEGHY+PGRVSRWWLK SLA LDSSL
Sbjct  15   IVWFRRDLRVEDNPALAAAVRAGPVIALFVWAPEEEGHYHPGRVSRWWLKNSLAQLDSSL  74

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            RSLGT LITKRSTDSV+SL++V+KSTGAS +FFNHLYDPLSLVRDHRAK++LTAQG+ VR
Sbjct  75   RSLGTCLITKRSTDSVASLLDVVKSTGASQIFFNHLYDPLSLVRDHRAKDVLTAQGIAVR  134

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            SFN+DLLYEPWEV D+ G PF+ F+AFW+RCLSMPYDPE+PLLPP
Sbjct  135  SFNADLLYEPWEVTDELGRPFSMFAAFWERCLSMPYDPESPLLPP  179



>gb|AAD17364.1| Arabidopsis thaliana flavin-type blue-light photoreceptor (SW:Q43125) 
(Pfam: PF00875, Score=765.2, E=2.6e-226, N=1) [Arabidopsis 
thaliana]
Length=702

 Score =   295 bits (755),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 136/165 (82%), Positives = 154/165 (93%), Gaps = 0/165 (0%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLRVEDNPALAA VR+G +IALF+WAPEEEGHY+PGRVSRWWLK SLA LDSSL
Sbjct  15   IVWFRRDLRVEDNPALAAAVRAGPVIALFVWAPEEEGHYHPGRVSRWWLKNSLAQLDSSL  74

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            RSLGT LITKRSTDSV+SL++V+KSTGAS +FFNHLYDPLSLVRDHRAK++LTAQG+ VR
Sbjct  75   RSLGTCLITKRSTDSVASLLDVVKSTGASQIFFNHLYDPLSLVRDHRAKDVLTAQGIAVR  134

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            SFN+DLLYEPWEV D+ G PF+ F+AFW+RCLSMPYDPE+PLLPP
Sbjct  135  SFNADLLYEPWEVTDELGRPFSMFAAFWERCLSMPYDPESPLLPP  179



>gb|AHZ89698.1| cryptochrome 1 [Dimocarpus longan]
Length=682

 Score =   295 bits (754),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 137/165 (83%), Positives = 155/165 (94%), Gaps = 0/165 (0%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLRVEDNPALAAGVR+GA++A+FIWAPEEEG +YPGRVSRWWLK SLAHLDSSL
Sbjct  8    IVWFRRDLRVEDNPALAAGVRAGAVVAVFIWAPEEEGLFYPGRVSRWWLKHSLAHLDSSL  67

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            RSLGT LITKRSTDS+SSL++V+K+TGA+ LFFNHLYDPLSLVRDHRAKE+LTAQGV V 
Sbjct  68   RSLGTCLITKRSTDSLSSLLQVVKATGATQLFFNHLYDPLSLVRDHRAKEVLTAQGVAVH  127

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            SFN+DLLYEPW+V D +G PFTTF+AFW+RCLSM YDP+APLLPP
Sbjct  128  SFNADLLYEPWDVNDAQGRPFTTFAAFWERCLSMSYDPDAPLLPP  172



>prf||1924377A blue light photoreceptor
Length=681

 Score =   294 bits (753),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 135/165 (82%), Positives = 154/165 (93%), Gaps = 0/165 (0%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLRVEDNPALAA VR+G +IALF+WAPEEEGHY+PGRVSRWWLK SLA LDSSL
Sbjct  15   IVWFRRDLRVEDNPALAAAVRAGPVIALFVWAPEEEGHYHPGRVSRWWLKNSLAQLDSSL  74

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            RSLGT LITKRSTDSV+SL++V+KSTGAS +FFNHLYDPLSLVRDHRAK++LTAQG+ VR
Sbjct  75   RSLGTCLITKRSTDSVASLLDVVKSTGASQIFFNHLYDPLSLVRDHRAKDVLTAQGIAVR  134

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            SFN+DLLY+PWEV D+ G PF+ F+AFW+RCLSMPYDPE+PLLPP
Sbjct  135  SFNADLLYQPWEVTDELGRPFSMFAAFWERCLSMPYDPESPLLPP  179



>gb|ACX49994.1| cryptochrome 1 [Capsella bursa-pastoris]
 gb|ACX49995.1| cryptochrome 1 [Capsella bursa-pastoris]
Length=684

 Score =   293 bits (750),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 135/165 (82%), Positives = 152/165 (92%), Gaps = 0/165 (0%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLRVEDNPALAA VR+G +IA+F+WAPEEEGHY+PGRVSRWWLK SLA LDSSL
Sbjct  18   IVWFRRDLRVEDNPALAAAVRAGPVIAVFVWAPEEEGHYHPGRVSRWWLKNSLAQLDSSL  77

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            RSLGT LITKRSTDSV+SL+ V+KSTGAS +FFNHLYDPLSLVRDHRAK++LTAQG+ VR
Sbjct  78   RSLGTCLITKRSTDSVASLLXVVKSTGASQIFFNHLYDPLSLVRDHRAKDVLTAQGIAVR  137

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            SFN+DLLYEPWEV D+ G PF+ F AFW+RCLSMPYDPE+PLLPP
Sbjct  138  SFNADLLYEPWEVTDELGRPFSMFGAFWERCLSMPYDPESPLLPP  182



>gb|AAK32756.1|AF361588_1 AT4g08920/hy4 [Arabidopsis thaliana]
Length=681

 Score =   293 bits (750),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 135/165 (82%), Positives = 153/165 (93%), Gaps = 0/165 (0%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLRVEDNPALAA VR+G + ALF+WAPEEEGHY+PGRVSRWWLK SLA LDSSL
Sbjct  15   IVWFRRDLRVEDNPALAAAVRAGPVNALFVWAPEEEGHYHPGRVSRWWLKNSLAQLDSSL  74

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            RSLGT LITKRSTDSV+SL++V+KSTGAS +FFNHLYDPLSLVRDHRAK++LTAQG+ VR
Sbjct  75   RSLGTCLITKRSTDSVASLLDVVKSTGASQIFFNHLYDPLSLVRDHRAKDVLTAQGIAVR  134

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            SFN+DLLYEPWEV D+ G PF+ F+AFW+RCLSMPYDPE+PLLPP
Sbjct  135  SFNADLLYEPWEVTDELGRPFSMFAAFWERCLSMPYDPESPLLPP  179



>ref|XP_007136253.1| hypothetical protein PHAVU_009G031300g [Phaseolus vulgaris]
 gb|ESW08247.1| hypothetical protein PHAVU_009G031300g [Phaseolus vulgaris]
Length=674

 Score =   292 bits (747),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 133/165 (81%), Positives = 153/165 (93%), Gaps = 0/165 (0%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLRVEDNPAL AGVR+GA++A+FIWAPEEEG YYPGRVSRWWLKQSLAHLDSSL
Sbjct  9    IVWFRRDLRVEDNPALTAGVRAGAVVAVFIWAPEEEGQYYPGRVSRWWLKQSLAHLDSSL  68

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            R+LGT LITKRSTD+VSSL+EV+K TGA+ L+FNHLYDPLSLV+DHR KE+L A+G+TVR
Sbjct  69   RNLGTRLITKRSTDTVSSLLEVLKFTGATQLYFNHLYDPLSLVKDHRVKEVLNAKGITVR  128

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            SFN+DLLYEPW+V D    PFTTF+AFWDRCL+MPYDP++PLLPP
Sbjct  129  SFNADLLYEPWDVNDVHARPFTTFAAFWDRCLNMPYDPDSPLLPP  173



>gb|KJB59920.1| hypothetical protein B456_009G280900 [Gossypium raimondii]
 gb|KJB59921.1| hypothetical protein B456_009G280900 [Gossypium raimondii]
Length=673

 Score =   292 bits (747),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 135/165 (82%), Positives = 152/165 (92%), Gaps = 0/165 (0%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLRVEDNPAL AGVR+G + A+FIWAPEEEGHY PGRVSRWWLK SLA LDSSL
Sbjct  4    IVWFRRDLRVEDNPALLAGVRAGPVFAVFIWAPEEEGHYQPGRVSRWWLKHSLALLDSSL  63

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            RSLGT LITKRSTDSVSSL++++KSTGA+ LFFNHLYDP+SLVRDHRAKE+LTA GV VR
Sbjct  64   RSLGTCLITKRSTDSVSSLLQIVKSTGATQLFFNHLYDPISLVRDHRAKEVLTAHGVAVR  123

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            SFN+DLLYEPW+V DD G PFTTF+AFW++CL+MP+DPEAPLLPP
Sbjct  124  SFNADLLYEPWDVNDDNGRPFTTFTAFWEKCLNMPFDPEAPLLPP  168



>gb|KHG05452.1| Cryptochrome-1 -like protein [Gossypium arboreum]
Length=690

 Score =   291 bits (746),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 135/165 (82%), Positives = 152/165 (92%), Gaps = 0/165 (0%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLRVEDNPAL AGVR+G + A+FIWAPEEEGHY PGRVSRWWLK SLA LDSSL
Sbjct  4    IVWFRRDLRVEDNPALLAGVRAGPVFAVFIWAPEEEGHYQPGRVSRWWLKHSLALLDSSL  63

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            RSLGT LITKRSTDSVSSL++++KSTGA+ LFFNHLYDP+SLVRDHRAKE+LTA GV VR
Sbjct  64   RSLGTCLITKRSTDSVSSLLQIVKSTGATQLFFNHLYDPISLVRDHRAKEVLTAHGVAVR  123

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            SFN+DLLYEPW+V DD G PFTTF+AFW++CL+MP+DPEAPLLPP
Sbjct  124  SFNADLLYEPWDVNDDNGRPFTTFNAFWEKCLNMPFDPEAPLLPP  168



>ref|XP_009113505.1| PREDICTED: cryptochrome-1 isoform X2 [Brassica rapa]
 emb|CAG28805.1| cryptochrome1 [Brassica napus]
 emb|CAC87903.2| cryptochrome 1 [Brassica napus]
Length=680

 Score =   291 bits (745),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 134/165 (81%), Positives = 152/165 (92%), Gaps = 0/165 (0%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLRVEDNPALAA VR+G +IA+F+WAPEEEGHY PGRVSRWWLK SLA LDSSL
Sbjct  13   IVWFRRDLRVEDNPALAAAVRAGPVIAVFVWAPEEEGHYQPGRVSRWWLKNSLAQLDSSL  72

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            RSLGT LITKRSTDSV+SL+EV+KSTGAS +FFNHLYDPLSLVRDHRAK+ LTA+G+ V+
Sbjct  73   RSLGTCLITKRSTDSVASLLEVVKSTGASQIFFNHLYDPLSLVRDHRAKDALTAEGIAVK  132

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            SFN+DLLYEPWEV D+ G PF+ F+AFW+RCLSMPYDPE+PLLPP
Sbjct  133  SFNADLLYEPWEVTDELGRPFSMFAAFWERCLSMPYDPESPLLPP  177



>ref|XP_009113504.1| PREDICTED: cryptochrome-1 isoform X1 [Brassica rapa]
Length=688

 Score =   291 bits (745),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 134/165 (81%), Positives = 152/165 (92%), Gaps = 0/165 (0%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLRVEDNPALAA VR+G +IA+F+WAPEEEGHY PGRVSRWWLK SLA LDSSL
Sbjct  13   IVWFRRDLRVEDNPALAAAVRAGPVIAVFVWAPEEEGHYQPGRVSRWWLKNSLAQLDSSL  72

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            RSLGT LITKRSTDSV+SL+EV+KSTGAS +FFNHLYDPLSLVRDHRAK+ LTA+G+ V+
Sbjct  73   RSLGTCLITKRSTDSVASLLEVVKSTGASQIFFNHLYDPLSLVRDHRAKDALTAEGIAVK  132

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            SFN+DLLYEPWEV D+ G PF+ F+AFW+RCLSMPYDPE+PLLPP
Sbjct  133  SFNADLLYEPWEVTDELGRPFSMFAAFWERCLSMPYDPESPLLPP  177



>emb|CDX75131.1| BnaC09g25510D [Brassica napus]
Length=713

 Score =   291 bits (746),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 134/165 (81%), Positives = 152/165 (92%), Gaps = 0/165 (0%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLRVEDNPALAA VR+G +IA+F+WAPEEEGHY PGRVSRWWLK SLA LDSSL
Sbjct  13   IVWFRRDLRVEDNPALAAAVRAGPVIAVFVWAPEEEGHYQPGRVSRWWLKNSLAQLDSSL  72

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            RSLGT LITKRSTDSV+SL+EV+KSTGAS +FFNHLYDPLSLVRDHRAK+ LTA+G+ V+
Sbjct  73   RSLGTCLITKRSTDSVASLLEVVKSTGASQIFFNHLYDPLSLVRDHRAKDALTAEGIAVK  132

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            SFN+DLLYEPWEV D+ G PF+ F+AFW+RCLSMPYDPE+PLLPP
Sbjct  133  SFNADLLYEPWEVTDELGRPFSMFAAFWERCLSMPYDPESPLLPP  177



>emb|CDY54706.1| BnaAnng13370D [Brassica napus]
Length=713

 Score =   291 bits (746),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 134/165 (81%), Positives = 152/165 (92%), Gaps = 0/165 (0%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLRVEDNPALAA VR+G +IA+F+WAPEEEGHY PGRVSRWWLK SLA LDSSL
Sbjct  13   IVWFRRDLRVEDNPALAAAVRAGPVIAVFVWAPEEEGHYQPGRVSRWWLKNSLAQLDSSL  72

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            RSLGT LITKRSTDSV+SL+EV+KSTGAS +FFNHLYDPLSLVRDHRAK+ LTA+G+ V+
Sbjct  73   RSLGTCLITKRSTDSVASLLEVVKSTGASQIFFNHLYDPLSLVRDHRAKDALTAEGIAVK  132

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            SFN+DLLYEPWEV D+ G PF+ F+AFW+RCLSMPYDPE+PLLPP
Sbjct  133  SFNADLLYEPWEVTDELGRPFSMFAAFWERCLSMPYDPESPLLPP  177



>ref|XP_009348096.1| PREDICTED: cryptochrome-1-like [Pyrus x bretschneideri]
Length=679

 Score =   291 bits (744),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 132/165 (80%), Positives = 151/165 (92%), Gaps = 0/165 (0%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            +VWFRRDLRVEDNPALAA VR+G ++ +FIWAP+EEG YYPGRVSRWWLK SLAHLDSSL
Sbjct  8    VVWFRRDLRVEDNPALAAAVRAGGVVCVFIWAPDEEGPYYPGRVSRWWLKHSLAHLDSSL  67

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            +S+G +LITKRSTDSVSSL+EV+ STGA+ LFFNHLYDP+SLVRDHRAKE+LTAQG+ VR
Sbjct  68   KSMGASLITKRSTDSVSSLLEVVVSTGATQLFFNHLYDPMSLVRDHRAKEVLTAQGIAVR  127

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            SFN+DLLYEPW+V+D  G PFTTF AFW RCLSMPYDP+APLLPP
Sbjct  128  SFNADLLYEPWDVIDVHGRPFTTFDAFWGRCLSMPYDPDAPLLPP  172



>ref|NP_001288891.1| cryptochrome-1 [Brassica rapa]
 gb|ABI31780.1| cryptochrome 1 protein [Brassica rapa]
Length=704

 Score =   291 bits (745),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 134/165 (81%), Positives = 152/165 (92%), Gaps = 0/165 (0%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLRVEDNPALAA VR+G +IA+F+WAPEEEGHY PGRVSRWWLK SLA LDSSL
Sbjct  13   IVWFRRDLRVEDNPALAAAVRAGPVIAVFVWAPEEEGHYQPGRVSRWWLKNSLAQLDSSL  72

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            RSLGT LITKRSTDSV+SL+EV+KSTGAS +FFNHLYDPLSLVRDHRAK+ LTA+G+ V+
Sbjct  73   RSLGTCLITKRSTDSVASLLEVVKSTGASQIFFNHLYDPLSLVRDHRAKDALTAEGIAVK  132

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            SFN+DLLYEPWEV D+ G PF+ F+AFW+RCLSMPYDPE+PLLPP
Sbjct  133  SFNADLLYEPWEVTDELGRPFSMFAAFWERCLSMPYDPESPLLPP  177



>ref|NP_001266960.1| uncharacterized protein LOC101311001 [Fragaria vesca]
 ref|XP_011463728.1| PREDICTED: uncharacterized protein LOC101311001 isoform X1 [Fragaria 
vesca subsp. vesca]
 gb|ACV89993.1| CRY1 [Fragaria vesca]
Length=673

 Score =   290 bits (741),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 135/165 (82%), Positives = 151/165 (92%), Gaps = 0/165 (0%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            +VWFRRDLRVEDNPAL AGVR+G ++ALFIWAPEEEG YYPGRVSRWWLK SLAHLDSSL
Sbjct  9    VVWFRRDLRVEDNPALLAGVRAGGVVALFIWAPEEEGPYYPGRVSRWWLKHSLAHLDSSL  68

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            RSLGT LITK+STDSVSSL+EV  +TGA+ LFFNHLYDP+SLVRDHRAKE+L+A G+TVR
Sbjct  69   RSLGTPLITKKSTDSVSSLLEVCLATGATQLFFNHLYDPISLVRDHRAKEVLSANGITVR  128

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            SFN+DLLYEPW+V D  G PFTTF AFW+RCLSMP+DPEAPLLPP
Sbjct  129  SFNADLLYEPWDVNDVHGRPFTTFDAFWERCLSMPFDPEAPLLPP  173



>dbj|BAM36552.1| cryptochrome1 [Fragaria x ananassa]
Length=673

 Score =   288 bits (737),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 134/165 (81%), Positives = 151/165 (92%), Gaps = 0/165 (0%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            +VWFRRDLRVEDNPAL AGVR+G ++ALFIWAPEEEG +YPGRVSRWWLK SLAHLDSSL
Sbjct  9    VVWFRRDLRVEDNPALLAGVRAGGVVALFIWAPEEEGPFYPGRVSRWWLKHSLAHLDSSL  68

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            RSLGT LITK+STDSVSSL+EV  +TGA+ LFFNHLYDP+SLVRDHRAKE+L+A G+TVR
Sbjct  69   RSLGTPLITKKSTDSVSSLLEVCLATGATQLFFNHLYDPISLVRDHRAKEVLSANGITVR  128

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            SFN+DLLYEPW+V D  G PFTTF AFW+RCLSMP+DPEAPLLPP
Sbjct  129  SFNADLLYEPWDVNDVHGRPFTTFDAFWERCLSMPFDPEAPLLPP  173



>ref|XP_009599628.1| PREDICTED: cryptochrome-1-like isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009599629.1| PREDICTED: cryptochrome-1-like isoform X2 [Nicotiana tomentosiformis]
Length=676

 Score =   287 bits (734),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 145/167 (87%), Positives = 161/167 (96%), Gaps = 2/167 (1%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAI--IALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDS  248
            IVWFRRDLRVEDNPALAAGVR+GA   IA+FIWAPEEEGHYYPGRVSRWWLKQSLAHLDS
Sbjct  8    IVWFRRDLRVEDNPALAAGVRAGAGAVIAVFIWAPEEEGHYYPGRVSRWWLKQSLAHLDS  67

Query  249  SLRSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVT  428
            SL+SLGT+L+TKRSTDS+SSL+EVIKSTGA+ LFFNHLYDP+SLVRDHRAKE+LTAQG++
Sbjct  68   SLKSLGTSLVTKRSTDSISSLLEVIKSTGATQLFFNHLYDPISLVRDHRAKEVLTAQGIS  127

Query  429  VRSFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            VRSFN+DLLYEPWEV D+EG PFTTFSAFW++CLSMPYDPEAPLLPP
Sbjct  128  VRSFNADLLYEPWEVNDEEGCPFTTFSAFWEKCLSMPYDPEAPLLPP  174



>ref|XP_008391090.1| PREDICTED: cryptochrome-1 isoform X1 [Malus domestica]
 ref|XP_008391091.1| PREDICTED: cryptochrome-1 isoform X2 [Malus domestica]
Length=679

 Score =   286 bits (733),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 133/165 (81%), Positives = 149/165 (90%), Gaps = 0/165 (0%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            +VWFRRDLRVEDNPALAA VR+G ++ +FIWAPEEEG YYPGRVSRWWLK SLAHLD SL
Sbjct  8    VVWFRRDLRVEDNPALAAAVRAGGVVCVFIWAPEEEGPYYPGRVSRWWLKHSLAHLDCSL  67

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            +SLGT+LITKRSTDSVSSL+EV+ STGA+ LFFNHLYDP+SLVRDHRAKE+LTAQG+ VR
Sbjct  68   KSLGTSLITKRSTDSVSSLLEVVVSTGATQLFFNHLYDPISLVRDHRAKEVLTAQGIAVR  127

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            SFN+DLLYEPW+V D    PFTTF AFW RCLSMPYDP+APLLPP
Sbjct  128  SFNADLLYEPWDVNDVHDCPFTTFDAFWGRCLSMPYDPDAPLLPP  172



>ref|XP_010939648.1| PREDICTED: cryptochrome-1-like isoform X2 [Elaeis guineensis]
Length=688

 Score =   285 bits (729),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 131/165 (79%), Positives = 151/165 (92%), Gaps = 0/165 (0%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLRVEDNPALAAGVR G ++A+FIWAPEEEG Y+PGRVSRWWL QSL HLDSSL
Sbjct  16   IVWFRRDLRVEDNPALAAGVRFGEVVAVFIWAPEEEGPYFPGRVSRWWLSQSLLHLDSSL  75

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            R+LGT+LITKRS D+ S+L+E++ STGA++LFFNHLYDPLSLVRDHR KE+LTA+G+TVR
Sbjct  76   RNLGTSLITKRSFDTASTLLEIVHSTGATNLFFNHLYDPLSLVRDHRLKELLTARGITVR  135

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            SFN+DLLYEPWEV DD G PFTTF+ FW++CLSMPYDP APLLPP
Sbjct  136  SFNADLLYEPWEVYDDNGRPFTTFAPFWNKCLSMPYDPAAPLLPP  180



>ref|NP_001234577.1| cryptochrome 1b [Solanum lycopersicum]
 gb|AAL02092.1|AF348461_1 cryptochrome 1b [Solanum lycopersicum]
 gb|AAL02093.1|AF348462_1 Cryptochrome 1b [Solanum lycopersicum]
Length=583

 Score =   282 bits (721),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 129/165 (78%), Positives = 154/165 (93%), Gaps = 0/165 (0%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLR+EDNPALAA VR+G++IA+FIWAPEEEG+Y PGRVSRWW+K+SLAHLDSSL
Sbjct  8    IVWFRRDLRLEDNPALAAAVRAGSVIAVFIWAPEEEGYYCPGRVSRWWIKKSLAHLDSSL  67

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            + LGT+LITKRS DSVSSL++V+KSTGA+ +FFNHLYDP+SLVRD+ AKE L+A+GV+V 
Sbjct  68   KKLGTSLITKRSNDSVSSLLQVVKSTGATRVFFNHLYDPISLVRDNCAKETLSAEGVSVC  127

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            SFN+DLLYEPWEVVDDE  PF+TFS FW++CL+MPYDPEAPLLPP
Sbjct  128  SFNADLLYEPWEVVDDESRPFSTFSDFWEKCLTMPYDPEAPLLPP  172



>ref|XP_010939647.1| PREDICTED: cryptochrome-1-like isoform X1 [Elaeis guineensis]
Length=707

 Score =   284 bits (727),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 131/165 (79%), Positives = 151/165 (92%), Gaps = 0/165 (0%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLRVEDNPALAAGVR G ++A+FIWAPEEEG Y+PGRVSRWWL QSL HLDSSL
Sbjct  16   IVWFRRDLRVEDNPALAAGVRFGEVVAVFIWAPEEEGPYFPGRVSRWWLSQSLLHLDSSL  75

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            R+LGT+LITKRS D+ S+L+E++ STGA++LFFNHLYDPLSLVRDHR KE+LTA+G+TVR
Sbjct  76   RNLGTSLITKRSFDTASTLLEIVHSTGATNLFFNHLYDPLSLVRDHRLKELLTARGITVR  135

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            SFN+DLLYEPWEV DD G PFTTF+ FW++CLSMPYDP APLLPP
Sbjct  136  SFNADLLYEPWEVYDDNGRPFTTFAPFWNKCLSMPYDPAAPLLPP  180



>ref|XP_008790851.1| PREDICTED: cryptochrome-1-like [Phoenix dactylifera]
Length=706

 Score =   282 bits (721),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 130/165 (79%), Positives = 149/165 (90%), Gaps = 0/165 (0%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLRVEDNPALAAGVR G ++ +FIWAPEEEG YYPGRVSRWWL QSL HLDSSL
Sbjct  18   IVWFRRDLRVEDNPALAAGVRLGEVVPVFIWAPEEEGTYYPGRVSRWWLSQSLLHLDSSL  77

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            RSLGT+LITKRS D+ S+L+E++ STGA++LFFNHLYDP+SLVRDHR KE+LTA+G+TVR
Sbjct  78   RSLGTSLITKRSFDTASTLLEIVHSTGATNLFFNHLYDPVSLVRDHRLKELLTARGITVR  137

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            SFN+DLLYEPWEV D+ G PFTTF+ FW +CLSMPYDP APLLPP
Sbjct  138  SFNADLLYEPWEVYDENGQPFTTFAPFWSKCLSMPYDPAAPLLPP  182



>ref|XP_010937445.1| PREDICTED: cryptochrome-1-like isoform X2 [Elaeis guineensis]
Length=689

 Score =   281 bits (718),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 129/165 (78%), Positives = 150/165 (91%), Gaps = 0/165 (0%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLRVEDNPALAAGVR G ++ +FIW+PEEEG YYPGRVSRWWL QSL HLDSSL
Sbjct  17   IVWFRRDLRVEDNPALAAGVRLGEVVPVFIWSPEEEGPYYPGRVSRWWLSQSLLHLDSSL  76

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            RSLGT+LITKRS D+ S+L+E++ STGA++LFFNHLYDPLSLVRDHR KE+L+A+G+TVR
Sbjct  77   RSLGTSLITKRSLDTASTLLEIVHSTGATNLFFNHLYDPLSLVRDHRLKELLSARGITVR  136

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            SFN+DLLYEPWEV D+ G PFTTF+ FW++CLSMPYDP APLLPP
Sbjct  137  SFNADLLYEPWEVHDENGRPFTTFAPFWNKCLSMPYDPAAPLLPP  181



>gb|AGU91427.1| cryptochrome 1.2 [Chrysanthemum boreale]
Length=674

 Score =   280 bits (717),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 137/165 (83%), Positives = 152/165 (92%), Gaps = 0/165 (0%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLRVEDNPALAAGVRSG +IALFIWAPEEEGHYYPGRVSRWWLKQSL+ LDSSL
Sbjct  7    IVWFRRDLRVEDNPALAAGVRSGKVIALFIWAPEEEGHYYPGRVSRWWLKQSLSLLDSSL  66

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            ++LGT+LITKRS+DSV SL++VIKSTGA+ LFFNHLYDP+SLVRDHR KEILT  G+ VR
Sbjct  67   KNLGTSLITKRSSDSVLSLLDVIKSTGATQLFFNHLYDPISLVRDHRVKEILTENGIAVR  126

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            SFN+DLL EPWEV+DDEG PF TF++FWDRCLSMPYDPE P LPP
Sbjct  127  SFNADLLCEPWEVLDDEGRPFITFTSFWDRCLSMPYDPEPPQLPP  171



>gb|ABR17701.1| unknown [Picea sitchensis]
Length=655

 Score =   280 bits (715),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 124/165 (75%), Positives = 152/165 (92%), Gaps = 0/165 (0%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLRVEDNPALAAGVR+GA+I L+IW+PEEEG YYPGRVSRWWLKQSLAHLDSSL
Sbjct  7    IVWFRRDLRVEDNPALAAGVRAGAVIVLYIWSPEEEGQYYPGRVSRWWLKQSLAHLDSSL  66

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            R+LG  LITKRST+S+S++++V+++TGA+ LF+NHLYDPLSLVRDH+ K+ L+++G+ VR
Sbjct  67   RNLGARLITKRSTNSISAILQVVQATGATQLFYNHLYDPLSLVRDHKLKQDLSSRGILVR  126

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            SFNSDLLYEPWEV D+EGH F+TF  +W++CL+MPYDP APLLPP
Sbjct  127  SFNSDLLYEPWEVNDEEGHAFSTFQDYWNKCLNMPYDPLAPLLPP  171



>ref|XP_010937444.1| PREDICTED: cryptochrome-1-like isoform X1 [Elaeis guineensis]
Length=705

 Score =   281 bits (718),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 129/165 (78%), Positives = 150/165 (91%), Gaps = 0/165 (0%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLRVEDNPALAAGVR G ++ +FIW+PEEEG YYPGRVSRWWL QSL HLDSSL
Sbjct  17   IVWFRRDLRVEDNPALAAGVRLGEVVPVFIWSPEEEGPYYPGRVSRWWLSQSLLHLDSSL  76

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            RSLGT+LITKRS D+ S+L+E++ STGA++LFFNHLYDPLSLVRDHR KE+L+A+G+TVR
Sbjct  77   RSLGTSLITKRSLDTASTLLEIVHSTGATNLFFNHLYDPLSLVRDHRLKELLSARGITVR  136

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            SFN+DLLYEPWEV D+ G PFTTF+ FW++CLSMPYDP APLLPP
Sbjct  137  SFNADLLYEPWEVHDENGRPFTTFAPFWNKCLSMPYDPAAPLLPP  181



>ref|XP_009403073.1| PREDICTED: cryptochrome-1 [Musa acuminata subsp. malaccensis]
Length=698

 Score =   280 bits (716),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 130/165 (79%), Positives = 148/165 (90%), Gaps = 0/165 (0%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            +VWFRRDLRVEDNPALAAGVR+GA++AL+IWAPEEEG +YPGRVSRWWL QSL HLDSSL
Sbjct  20   VVWFRRDLRVEDNPALAAGVRAGAVVALYIWAPEEEGSFYPGRVSRWWLSQSLHHLDSSL  79

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            RSLGT LITKRS D+ S+L+EV++ST A+ LFFNHLYDPLSLVRDH  KE+LTAQG+ V 
Sbjct  80   RSLGTPLITKRSLDTASTLLEVVRSTAATSLFFNHLYDPLSLVRDHGLKELLTAQGIRVC  139

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            SFN+DLLYEPWEV D+ G PFTTF+ FW+RCLSMPYDP APLLPP
Sbjct  140  SFNADLLYEPWEVNDENGQPFTTFAPFWNRCLSMPYDPAAPLLPP  184



>ref|XP_010267717.1| PREDICTED: cryptochrome-1 isoform X3 [Nelumbo nucifera]
Length=683

 Score =   279 bits (714),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 140/165 (85%), Positives = 157/165 (95%), Gaps = 0/165 (0%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLRVEDNPALAA VR+GA++A+FIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL
Sbjct  8    IVWFRRDLRVEDNPALAAAVRAGAVVAVFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  67

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            +SLGT+L+TKRSTDSVSSL++++KSTGA+ LFFNHLYDPLSLVRDHRAKE+LTAQG+ V 
Sbjct  68   KSLGTSLVTKRSTDSVSSLLDIVKSTGATQLFFNHLYDPLSLVRDHRAKEVLTAQGIAVL  127

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            SFN+DLLYEPWEV D +G PFTTF AFW+RCLSMPYDPEAPLLPP
Sbjct  128  SFNADLLYEPWEVNDVDGRPFTTFMAFWNRCLSMPYDPEAPLLPP  172



>ref|XP_010267691.1| PREDICTED: cryptochrome-1 isoform X1 [Nelumbo nucifera]
 ref|XP_010267700.1| PREDICTED: cryptochrome-1 isoform X1 [Nelumbo nucifera]
Length=687

 Score =   279 bits (714),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 140/165 (85%), Positives = 157/165 (95%), Gaps = 0/165 (0%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLRVEDNPALAA VR+GA++A+FIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL
Sbjct  8    IVWFRRDLRVEDNPALAAAVRAGAVVAVFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  67

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            +SLGT+L+TKRSTDSVSSL++++KSTGA+ LFFNHLYDPLSLVRDHRAKE+LTAQG+ V 
Sbjct  68   KSLGTSLVTKRSTDSVSSLLDIVKSTGATQLFFNHLYDPLSLVRDHRAKEVLTAQGIAVL  127

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            SFN+DLLYEPWEV D +G PFTTF AFW+RCLSMPYDPEAPLLPP
Sbjct  128  SFNADLLYEPWEVNDVDGRPFTTFMAFWNRCLSMPYDPEAPLLPP  172



>ref|XP_010267708.1| PREDICTED: cryptochrome-1 isoform X2 [Nelumbo nucifera]
Length=686

 Score =   279 bits (714),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 140/165 (85%), Positives = 157/165 (95%), Gaps = 0/165 (0%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLRVEDNPALAA VR+GA++A+FIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL
Sbjct  8    IVWFRRDLRVEDNPALAAAVRAGAVVAVFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  67

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            +SLGT+L+TKRSTDSVSSL++++KSTGA+ LFFNHLYDPLSLVRDHRAKE+LTAQG+ V 
Sbjct  68   KSLGTSLVTKRSTDSVSSLLDIVKSTGATQLFFNHLYDPLSLVRDHRAKEVLTAQGIAVL  127

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            SFN+DLLYEPWEV D +G PFTTF AFW+RCLSMPYDPEAPLLPP
Sbjct  128  SFNADLLYEPWEVNDVDGRPFTTFMAFWNRCLSMPYDPEAPLLPP  172



>ref|XP_008802203.1| PREDICTED: cryptochrome-1-like isoform X3 [Phoenix dactylifera]
Length=707

 Score =   278 bits (712),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 128/165 (78%), Positives = 150/165 (91%), Gaps = 0/165 (0%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWF+RDLRVEDNPALAAGVRSG ++A+FIW+PEE+G +YPGRVSRWWL QSL HLDSSL
Sbjct  15   IVWFQRDLRVEDNPALAAGVRSGEVVAVFIWSPEEDGPFYPGRVSRWWLSQSLLHLDSSL  74

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            RSLGT+LITKRS D+ S+L+E++ STGA++LFFNHLYDPLSLVR H  KE+LTAQG+TVR
Sbjct  75   RSLGTSLITKRSFDTASTLLEIVHSTGATNLFFNHLYDPLSLVRGHHLKELLTAQGITVR  134

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            SFN+DLLYEPWEV D+ G PFTTF+ FW++CLSMPYDP APLLPP
Sbjct  135  SFNADLLYEPWEVNDENGSPFTTFAPFWNKCLSMPYDPAAPLLPP  179



>ref|XP_010535517.1| PREDICTED: cryptochrome-1-like [Tarenaya hassleriana]
Length=676

 Score =   278 bits (710),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 128/166 (77%), Positives = 148/166 (89%), Gaps = 1/166 (1%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGA-IIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSS  251
            +VWFRRDLRVEDNPAL A VR+G   +A+F+W+PEEEGHY+PGRVSRWWLKQSLAHLDSS
Sbjct  13   VVWFRRDLRVEDNPALTAAVRTGGGTVAVFVWSPEEEGHYHPGRVSRWWLKQSLAHLDSS  72

Query  252  LRSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTV  431
            LRSLGT LIT+RSTD VSSL++V+KSTG++ LFFNHLYD LSLVRDHR KE+LT  G+ V
Sbjct  73   LRSLGTCLITRRSTDCVSSLLDVVKSTGSTRLFFNHLYDQLSLVRDHRVKEVLTKHGIHV  132

Query  432  RSFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            +S+N+DLLYEPWEV D+EG PFTTF  FW+RCLSMPYDPE PLLPP
Sbjct  133  QSYNADLLYEPWEVNDNEGRPFTTFVPFWERCLSMPYDPEPPLLPP  178



>ref|XP_008802202.1| PREDICTED: cryptochrome-1-like isoform X2 [Phoenix dactylifera]
Length=732

 Score =   278 bits (711),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 128/165 (78%), Positives = 150/165 (91%), Gaps = 0/165 (0%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWF+RDLRVEDNPALAAGVRSG ++A+FIW+PEE+G +YPGRVSRWWL QSL HLDSSL
Sbjct  15   IVWFQRDLRVEDNPALAAGVRSGEVVAVFIWSPEEDGPFYPGRVSRWWLSQSLLHLDSSL  74

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            RSLGT+LITKRS D+ S+L+E++ STGA++LFFNHLYDPLSLVR H  KE+LTAQG+TVR
Sbjct  75   RSLGTSLITKRSFDTASTLLEIVHSTGATNLFFNHLYDPLSLVRGHHLKELLTAQGITVR  134

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            SFN+DLLYEPWEV D+ G PFTTF+ FW++CLSMPYDP APLLPP
Sbjct  135  SFNADLLYEPWEVNDENGSPFTTFAPFWNKCLSMPYDPAAPLLPP  179



>ref|XP_008802200.1| PREDICTED: cryptochrome-1-like isoform X1 [Phoenix dactylifera]
Length=794

 Score =   278 bits (712),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 128/165 (78%), Positives = 150/165 (91%), Gaps = 0/165 (0%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWF+RDLRVEDNPALAAGVRSG ++A+FIW+PEE+G +YPGRVSRWWL QSL HLDSSL
Sbjct  15   IVWFQRDLRVEDNPALAAGVRSGEVVAVFIWSPEEDGPFYPGRVSRWWLSQSLLHLDSSL  74

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            RSLGT+LITKRS D+ S+L+E++ STGA++LFFNHLYDPLSLVR H  KE+LTAQG+TVR
Sbjct  75   RSLGTSLITKRSFDTASTLLEIVHSTGATNLFFNHLYDPLSLVRGHHLKELLTAQGITVR  134

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            SFN+DLLYEPWEV D+ G PFTTF+ FW++CLSMPYDP APLLPP
Sbjct  135  SFNADLLYEPWEVNDENGSPFTTFAPFWNKCLSMPYDPAAPLLPP  179



>ref|XP_008466234.1| PREDICTED: cryptochrome-1 isoform X3 [Cucumis melo]
Length=612

 Score =   273 bits (698),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 131/165 (79%), Positives = 154/165 (93%), Gaps = 0/165 (0%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLR+EDNPAL A VR+GA++A+FIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL
Sbjct  8    IVWFRRDLRIEDNPALTAAVRAGAVVAVFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  67

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            RSLGT L+TKRST+++S+L++V K+TGASHLFFNHLYDPLSL+RDHR KE+L+AQG+ VR
Sbjct  68   RSLGTFLLTKRSTNTISALLDVFKATGASHLFFNHLYDPLSLIRDHRVKEVLSAQGIRVR  127

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            S+N+DLLYEPW+V D  G+PFTTF+ FW+RCLSMP DPEAPLLPP
Sbjct  128  SYNADLLYEPWDVKDANGNPFTTFAGFWERCLSMPCDPEAPLLPP  172



>ref|XP_004136290.1| PREDICTED: cryptochrome-1-like [Cucumis sativus]
 ref|XP_004160278.1| PREDICTED: cryptochrome-1-like [Cucumis sativus]
 gb|KGN60210.1| hypothetical protein Csa_3G889670 [Cucumis sativus]
Length=681

 Score =   274 bits (700),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 130/165 (79%), Positives = 153/165 (93%), Gaps = 0/165 (0%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLR+EDNPAL A VR+GA++ +FIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL
Sbjct  8    IVWFRRDLRIEDNPALTAAVRAGAVVVVFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  67

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            RSLGT L+TKRST+++S+L++V K+TGASHLFFNHLYDPLSL+RDHR KE+L+AQG+ VR
Sbjct  68   RSLGTYLLTKRSTNTISALLDVFKATGASHLFFNHLYDPLSLIRDHRVKEVLSAQGIRVR  127

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            S+N+DLLYEPW+V D  G+PFTTF+ FW+RCLSMP DPEAPLLPP
Sbjct  128  SYNADLLYEPWDVKDANGNPFTTFAGFWERCLSMPCDPEAPLLPP  172



>ref|XP_008466232.1| PREDICTED: cryptochrome-1 isoform X1 [Cucumis melo]
 ref|XP_008466233.1| PREDICTED: cryptochrome-1 isoform X2 [Cucumis melo]
Length=681

 Score =   274 bits (700),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 131/165 (79%), Positives = 154/165 (93%), Gaps = 0/165 (0%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLR+EDNPAL A VR+GA++A+FIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL
Sbjct  8    IVWFRRDLRIEDNPALTAAVRAGAVVAVFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  67

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            RSLGT L+TKRST+++S+L++V K+TGASHLFFNHLYDPLSL+RDHR KE+L+AQG+ VR
Sbjct  68   RSLGTFLLTKRSTNTISALLDVFKATGASHLFFNHLYDPLSLIRDHRVKEVLSAQGIRVR  127

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            S+N+DLLYEPW+V D  G+PFTTF+ FW+RCLSMP DPEAPLLPP
Sbjct  128  SYNADLLYEPWDVKDANGNPFTTFAGFWERCLSMPCDPEAPLLPP  172



>ref|XP_011016468.1| PREDICTED: cryptochrome-1 isoform X1 [Populus euphratica]
 ref|XP_011016473.1| PREDICTED: cryptochrome-1 isoform X2 [Populus euphratica]
Length=681

 Score =   272 bits (696),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 141/165 (85%), Positives = 157/165 (95%), Gaps = 0/165 (0%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLRVEDNPALAAGVR+GA+ A+F+WAPEEEGHYYPGRVSRWWLKQSLAHLDSSL
Sbjct  8    IVWFRRDLRVEDNPALAAGVRAGAVAAVFVWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  67

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            RSLGT+L+TKRSTDSVS+L+EVIKST A+ LFFNHLYDPLSLVRDHRAKE+LTAQG+ VR
Sbjct  68   RSLGTSLVTKRSTDSVSTLLEVIKSTRATQLFFNHLYDPLSLVRDHRAKEVLTAQGIAVR  127

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            SFN+DLLYEPW+V D +G PFTTF+ FWDRCLSMP+DPEAPLLPP
Sbjct  128  SFNADLLYEPWDVNDAQGRPFTTFATFWDRCLSMPFDPEAPLLPP  172



>dbj|BAP76061.1| putative CRY1 [Cryptomeria japonica]
Length=702

 Score =   271 bits (694),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 121/165 (73%), Positives = 148/165 (90%), Gaps = 0/165 (0%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLR+EDNP LAAGVR+G +IALF+W+PEEE HY PGRVSRWWLKQSLAHLDSSL
Sbjct  8    IVWFRRDLRIEDNPGLAAGVRAGTVIALFVWSPEEESHYIPGRVSRWWLKQSLAHLDSSL  67

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            R LG  LITKRS DS+S++++VI++TGA+ LF+NHLYDPLSLVRDH+ K+ L+++G+ VR
Sbjct  68   RRLGAPLITKRSPDSLSAILQVIEATGATQLFYNHLYDPLSLVRDHKVKQDLSSRGILVR  127

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            SFN+DLLYEPWEV DDEG  F+TF ++W++CL+MPYDP APLLPP
Sbjct  128  SFNADLLYEPWEVNDDEGRAFSTFLSYWNKCLNMPYDPAAPLLPP  172



>dbj|BAL41964.1| CRY1, partial [Cardamine glauca]
Length=145

 Score =   252 bits (644),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 118/145 (81%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = +3

Query  90   RDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSLRSLGT  269
            RDLRVEDNPALAA VR+G +IALF+WAPEEEGHY+PGRVSRWWLK SLA LDSSLRSLGT
Sbjct  1    RDLRVEDNPALAAAVRAGPVIALFVWAPEEEGHYHPGRVSRWWLKNSLAQLDSSLRSLGT  60

Query  270  TLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVRSFNSD  449
             LITKRSTDSVSSL++V+KSTGAS +FFNHLYDPLSLVRDHRAK++LTAQG+ VRSFN+D
Sbjct  61   YLITKRSTDSVSSLLDVVKSTGASQIFFNHLYDPLSLVRDHRAKDVLTAQGIAVRSFNAD  120

Query  450  LLYEPWEVVDDEGHPFTTFSAFWDR  524
            LLYEPWEV D+ G PF+ F+AFW+R
Sbjct  121  LLYEPWEVTDELGRPFSMFAAFWER  145



>dbj|BAL41922.1| CRY1, partial [Cardamine nipponica]
 dbj|BAL41923.1| CRY1, partial [Cardamine nipponica]
 dbj|BAL41924.1| CRY1, partial [Cardamine nipponica]
 dbj|BAL41925.1| CRY1, partial [Cardamine nipponica]
 dbj|BAL41926.1| CRY1, partial [Cardamine nipponica]
 dbj|BAL41927.1| CRY1, partial [Cardamine nipponica]
 dbj|BAL41928.1| CRY1, partial [Cardamine nipponica]
 dbj|BAL41929.1| CRY1, partial [Cardamine nipponica]
 dbj|BAL41930.1| CRY1, partial [Cardamine nipponica]
 dbj|BAL41931.1| CRY1, partial [Cardamine nipponica]
 dbj|BAL41932.1| CRY1, partial [Cardamine nipponica]
 dbj|BAL41933.1| CRY1, partial [Cardamine nipponica]
 dbj|BAL41934.1| CRY1, partial [Cardamine nipponica]
 dbj|BAL41935.1| CRY1, partial [Cardamine nipponica]
 dbj|BAL41936.1| CRY1, partial [Cardamine nipponica]
 dbj|BAL41937.1| CRY1, partial [Cardamine nipponica]
 dbj|BAL41938.1| CRY1, partial [Cardamine nipponica]
 dbj|BAL41940.1| CRY1, partial [Cardamine bellidifolia]
 dbj|BAL41941.1| CRY1, partial [Cardamine bellidifolia]
 dbj|BAL41942.1| CRY1, partial [Cardamine bellidifolia]
 dbj|BAL41943.1| CRY1, partial [Cardamine bellidifolia]
 dbj|BAL41944.1| CRY1, partial [Cardamine bellidifolia]
 dbj|BAL41945.1| CRY1, partial [Cardamine bellidifolia]
 dbj|BAL41946.1| CRY1, partial [Cardamine bellidifolia]
 dbj|BAL41947.1| CRY1, partial [Cardamine bellidifolia]
 dbj|BAL41948.1| CRY1, partial [Cardamine bellidifolia]
 dbj|BAL41949.1| CRY1, partial [Cardamine bellidifolia]
 dbj|BAL41950.1| CRY1, partial [Cardamine bellidifolia]
 dbj|BAL41951.1| CRY1, partial [Cardamine bellidifolia]
 dbj|BAL41952.1| CRY1, partial [Cardamine bellidifolia]
 dbj|BAL41954.1| CRY1, partial [Cardamine bellidifolia]
 dbj|BAL41955.1| CRY1, partial [Cardamine bellidifolia]
 dbj|BAL41956.1| CRY1, partial [Cardamine bellidifolia]
 dbj|BAL41957.1| CRY1, partial [Cardamine bellidifolia subsp. alpina]
 dbj|BAL41958.1| CRY1, partial [Cardamine bellidifolia subsp. alpina]
 dbj|BAL41959.1| CRY1, partial [Cardamine bellidifolia subsp. alpina]
Length=145

 Score =   252 bits (643),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 117/145 (81%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = +3

Query  90   RDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSLRSLGT  269
            RDLRVEDNPALAA VR+G +IALF+WAPEEEGHY+PGRVSRWWLK SLA LDSSLRSLGT
Sbjct  1    RDLRVEDNPALAAAVRAGPVIALFVWAPEEEGHYHPGRVSRWWLKNSLAQLDSSLRSLGT  60

Query  270  TLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVRSFNSD  449
             LITKRSTDSV+SL++V+KSTGAS +FFNHLYDPLSLVRDHRAK++LTAQG+ VRSFN+D
Sbjct  61   CLITKRSTDSVASLLDVVKSTGASQIFFNHLYDPLSLVRDHRAKDVLTAQGIAVRSFNAD  120

Query  450  LLYEPWEVVDDEGHPFTTFSAFWDR  524
            LLYEPWEV D+ G PF+ F+AFW+R
Sbjct  121  LLYEPWEVTDELGRPFSMFAAFWER  145



>gb|AEK05699.1| cryptochrome 1 protein 2, partial [Populus balsamifera]
 gb|AEK05700.1| cryptochrome 1 protein 2, partial [Populus balsamifera]
 gb|AEK05716.1| cryptochrome 1 protein 2, partial [Populus balsamifera]
Length=633

 Score =   267 bits (682),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 121/144 (84%), Positives = 138/144 (96%), Gaps = 0/144 (0%)
 Frame = +3

Query  138  SGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSLRSLGTTLITKRSTDSVSSLIE  317
            +GA++A+F+WAPEEEGHYYPGRVSRWWLKQSLAHLDSSLRSLGT+L+TKRSTDSVS+L+E
Sbjct  1    AGAVVAVFVWAPEEEGHYYPGRVSRWWLKQSLAHLDSSLRSLGTSLVTKRSTDSVSTLLE  60

Query  318  VIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVRSFNSDLLYEPWEVVDDEGHPF  497
            VIKSTGA+ LFFNHLYDPLSLVRDHRAKE+LTAQG+ VRSFN+DLLYEPW+V D +G PF
Sbjct  61   VIKSTGATQLFFNHLYDPLSLVRDHRAKEVLTAQGIAVRSFNADLLYEPWDVNDAQGRPF  120

Query  498  TTFSAFWDRCLSMPYDPEAPLLPP  569
            TTF+ FWDRCLSMP+DPEAPLLPP
Sbjct  121  TTFATFWDRCLSMPFDPEAPLLPP  144



>gb|AEK05698.1| cryptochrome 1 protein 2, partial [Populus balsamifera]
 gb|AEK05701.1| cryptochrome 1 protein 2, partial [Populus balsamifera]
 gb|AEK05702.1| cryptochrome 1 protein 2, partial [Populus balsamifera]
 gb|AEK05703.1| cryptochrome 1 protein 2, partial [Populus balsamifera]
 gb|AEK05704.1| cryptochrome 1 protein 2, partial [Populus balsamifera]
 gb|AEK05705.1| cryptochrome 1 protein 2, partial [Populus balsamifera]
 gb|AEK05706.1| cryptochrome 1 protein 2, partial [Populus balsamifera]
 gb|AEK05707.1| cryptochrome 1 protein 2, partial [Populus balsamifera]
 gb|AEK05710.1| cryptochrome 1 protein 2, partial [Populus balsamifera]
 gb|AEK05711.1| cryptochrome 1 protein 2, partial [Populus balsamifera]
 gb|AEK05712.1| cryptochrome 1 protein 2, partial [Populus balsamifera]
 gb|AEK05713.1| cryptochrome 1 protein 2, partial [Populus balsamifera]
 gb|AEK05714.1| cryptochrome 1 protein 2, partial [Populus balsamifera]
 gb|AEK05715.1| cryptochrome 1 protein 2, partial [Populus balsamifera]
 gb|AEK05717.1| cryptochrome 1 protein 2, partial [Populus balsamifera]
 gb|AEK05718.1| cryptochrome 1 protein 2, partial [Populus balsamifera]
 gb|AEK05719.1| cryptochrome 1 protein 2, partial [Populus balsamifera]
 gb|AEK05720.1| cryptochrome 1 protein 2, partial [Populus balsamifera]
Length=633

 Score =   267 bits (682),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 121/144 (84%), Positives = 138/144 (96%), Gaps = 0/144 (0%)
 Frame = +3

Query  138  SGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSLRSLGTTLITKRSTDSVSSLIE  317
            +GA++A+F+WAPEEEGHYYPGRVSRWWLKQSLAHLDSSLRSLGT+L+TKRSTDSVS+L+E
Sbjct  1    AGAVVAVFVWAPEEEGHYYPGRVSRWWLKQSLAHLDSSLRSLGTSLVTKRSTDSVSTLLE  60

Query  318  VIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVRSFNSDLLYEPWEVVDDEGHPF  497
            VIKSTGA+ LFFNHLYDPLSLVRDHRAKE+LTAQG+ VRSFN+DLLYEPW+V D +G PF
Sbjct  61   VIKSTGATQLFFNHLYDPLSLVRDHRAKEVLTAQGIAVRSFNADLLYEPWDVNDAQGRPF  120

Query  498  TTFSAFWDRCLSMPYDPEAPLLPP  569
            TTF+ FWDRCLSMP+DPEAPLLPP
Sbjct  121  TTFATFWDRCLSMPFDPEAPLLPP  144



>gb|AEK05709.1| cryptochrome 1 protein 2, partial [Populus balsamifera]
Length=633

 Score =   267 bits (682),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 121/144 (84%), Positives = 138/144 (96%), Gaps = 0/144 (0%)
 Frame = +3

Query  138  SGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSLRSLGTTLITKRSTDSVSSLIE  317
            +GA++A+F+WAPEEEGHYYPGRVSRWWLKQSLAHLDSSLRSLGT+L+TKRSTDSVS+L+E
Sbjct  1    AGAVVAVFVWAPEEEGHYYPGRVSRWWLKQSLAHLDSSLRSLGTSLVTKRSTDSVSTLLE  60

Query  318  VIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVRSFNSDLLYEPWEVVDDEGHPF  497
            VIKSTGA+ LFFNHLYDPLSLVRDHRAKE+LTAQG+ VRSFN+DLLYEPW+V D +G PF
Sbjct  61   VIKSTGATQLFFNHLYDPLSLVRDHRAKEVLTAQGIAVRSFNADLLYEPWDVNDAQGRPF  120

Query  498  TTFSAFWDRCLSMPYDPEAPLLPP  569
            TTF+ FWDRCLSMP+DPEAPLLPP
Sbjct  121  TTFATFWDRCLSMPFDPEAPLLPP  144



>dbj|BAL41939.1| CRY1, partial [Cardamine nipponica]
Length=145

 Score =   251 bits (641),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 117/145 (81%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = +3

Query  90   RDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSLRSLGT  269
            RDLRVEDNPALAA VR+G +IALF+WAPEEEGHY+PGRVSRWWLK SLA LDSSLRSLGT
Sbjct  1    RDLRVEDNPALAAAVRAGPVIALFVWAPEEEGHYHPGRVSRWWLKNSLAQLDSSLRSLGT  60

Query  270  TLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVRSFNSD  449
             LITKRSTDSV+SL++V+KSTGAS +FFNHLYDPLSLVRDHRAK++LTAQG+ VRSFN+D
Sbjct  61   YLITKRSTDSVASLLDVVKSTGASQIFFNHLYDPLSLVRDHRAKDVLTAQGIAVRSFNAD  120

Query  450  LLYEPWEVVDDEGHPFTTFSAFWDR  524
            LLYEPWEV D+ G PF+ F+AFW+R
Sbjct  121  LLYEPWEVTDELGRPFSMFAAFWER  145



>dbj|BAL41953.1| CRY1, partial [Cardamine bellidifolia]
 dbj|BAL41960.1| CRY1, partial [Cardamine resedifolia]
 dbj|BAL41961.1| CRY1, partial [Cardamine resedifolia]
 dbj|BAL41962.1| CRY1, partial [Cardamine resedifolia]
 dbj|BAL41963.1| CRY1, partial [Cardamine resedifolia]
Length=145

 Score =   251 bits (640),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 116/145 (80%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = +3

Query  90   RDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSLRSLGT  269
            RDLRVEDNPALAA VR+G +IALF+WAPEEEGHY+PGRVSRWWLK SLA LDSSLRSLGT
Sbjct  1    RDLRVEDNPALAAAVRAGPVIALFVWAPEEEGHYHPGRVSRWWLKNSLAQLDSSLRSLGT  60

Query  270  TLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVRSFNSD  449
             LITKRSTDSV+SL++V+KSTGAS +FFNHLYDPLSLVRDHRAK++L+AQG+ VRSFN+D
Sbjct  61   CLITKRSTDSVASLLDVVKSTGASQIFFNHLYDPLSLVRDHRAKDVLSAQGIAVRSFNAD  120

Query  450  LLYEPWEVVDDEGHPFTTFSAFWDR  524
            LLYEPWEV D+ G PF+ F+AFW+R
Sbjct  121  LLYEPWEVTDELGRPFSMFAAFWER  145



>gb|AEK05708.1| cryptochrome 1 protein 2, partial [Populus balsamifera]
Length=633

 Score =   265 bits (677),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 120/144 (83%), Positives = 137/144 (95%), Gaps = 0/144 (0%)
 Frame = +3

Query  138  SGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSLRSLGTTLITKRSTDSVSSLIE  317
            +GA++A+F+WAPEEEGHYYPGRVSRWWLKQSLAHLDSSLRSLGT+L+TKRSTDSVS+L+E
Sbjct  1    AGAVVAVFVWAPEEEGHYYPGRVSRWWLKQSLAHLDSSLRSLGTSLVTKRSTDSVSTLLE  60

Query  318  VIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVRSFNSDLLYEPWEVVDDEGHPF  497
            VIKSTGA+ LFFNHLYDPLSLVRDHRAKE+LTAQG+ VRSFN+DLLYEPW+V D +G PF
Sbjct  61   VIKSTGATQLFFNHLYDPLSLVRDHRAKEVLTAQGIAVRSFNADLLYEPWDVNDAQGRPF  120

Query  498  TTFSAFWDRCLSMPYDPEAPLLPP  569
            TTF+ FWDRCL MP+DPEAPLLPP
Sbjct  121  TTFATFWDRCLXMPFDPEAPLLPP  144



>gb|AEK05690.1| cryptochrome 1 protein 1 [Populus balsamifera]
Length=639

 Score =   261 bits (668),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 121/152 (80%), Positives = 136/152 (89%), Gaps = 0/152 (0%)
 Frame = +3

Query  114  PALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSLRSLGTTLITKRST  293
            PALAAGVR+GA++A+F+WAPEEEGHYYPGRVSRWWLKQSLAHLDSSLRSLGT+L+TKRST
Sbjct  1    PALAAGVRAGAVVAVFVWAPEEEGHYYPGRVSRWWLKQSLAHLDSSLRSLGTSLVTKRST  60

Query  294  DSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVRSFNSDLLYEPWEV  473
            DSVSSL+EV+KSTGA+ L FNHLYDPLSLVRDHRAKE         RSFN+DLLYEPW+V
Sbjct  61   DSVSSLLEVVKSTGATQLLFNHLYDPLSLVRDHRAKEXXXXXXXXXRSFNADLLYEPWDV  120

Query  474  VDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
             D +G PFTTF  FW+RCLSMP+DPEAPLLPP
Sbjct  121  NDAQGRPFTTFDTFWERCLSMPFDPEAPLLPP  152



>gb|AEK05692.1| cryptochrome 1 protein 1 [Populus balsamifera]
 gb|AEK05696.1| cryptochrome 1 protein 1 [Populus balsamifera]
 gb|AEK05697.1| cryptochrome 1 protein 1 [Populus balsamifera]
Length=639

 Score =   261 bits (667),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 121/152 (80%), Positives = 136/152 (89%), Gaps = 0/152 (0%)
 Frame = +3

Query  114  PALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSLRSLGTTLITKRST  293
            PALAAGVR+GA++A+F+WAPEEEGHYYPGRVSRWWLKQSLAHLDSSLRSLGT+L+TKRST
Sbjct  1    PALAAGVRAGAVVAVFVWAPEEEGHYYPGRVSRWWLKQSLAHLDSSLRSLGTSLVTKRST  60

Query  294  DSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVRSFNSDLLYEPWEV  473
            DSVSSL+EV+KSTGA+ L FNHLYDPLSLVRDHRAKE         RSFN+DLLYEPW+V
Sbjct  61   DSVSSLLEVVKSTGATQLLFNHLYDPLSLVRDHRAKEXXXXXXXXXRSFNADLLYEPWDV  120

Query  474  VDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
             D +G PFTTF  FW+RCLSMP+DPEAPLLPP
Sbjct  121  NDAQGRPFTTFDTFWERCLSMPFDPEAPLLPP  152



>gb|AEK05691.1| cryptochrome 1 protein 1 [Populus balsamifera]
Length=639

 Score =   261 bits (667),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 121/152 (80%), Positives = 136/152 (89%), Gaps = 0/152 (0%)
 Frame = +3

Query  114  PALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSLRSLGTTLITKRST  293
            PALAAGVR+GA++A+F+WAPEEEGHYYPGRVSRWWLKQSLAHLDSSLRSLGT+L+TKRST
Sbjct  1    PALAAGVRAGAVVAVFVWAPEEEGHYYPGRVSRWWLKQSLAHLDSSLRSLGTSLVTKRST  60

Query  294  DSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVRSFNSDLLYEPWEV  473
            DSVSSL+EV+KSTGA+ L FNHLYDPLSLVRDHRAKE         RSFN+DLLYEPW+V
Sbjct  61   DSVSSLLEVVKSTGATQLLFNHLYDPLSLVRDHRAKEXXXXXXXXXRSFNADLLYEPWDV  120

Query  474  VDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
             D +G PFTTF  FW+RCLSMP+DPEAPLLPP
Sbjct  121  NDAQGRPFTTFDTFWERCLSMPFDPEAPLLPP  152



>gb|AEK05695.1| cryptochrome 1 protein 1 [Populus balsamifera]
Length=639

 Score =   260 bits (664),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 120/152 (79%), Positives = 136/152 (89%), Gaps = 0/152 (0%)
 Frame = +3

Query  114  PALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSLRSLGTTLITKRST  293
            PALAAGVR+GA++A+F+WAPEEEGHYYPGRVSRWWLKQSLAHLDSSLRSLGT+L+TKRST
Sbjct  1    PALAAGVRAGAVVAVFVWAPEEEGHYYPGRVSRWWLKQSLAHLDSSLRSLGTSLVTKRST  60

Query  294  DSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVRSFNSDLLYEPWEV  473
            DSVSSL+EV+KSTG++ L FNHLYDPLSLVRDHRAKE         RSFN+DLLYEPW+V
Sbjct  61   DSVSSLLEVVKSTGSTQLLFNHLYDPLSLVRDHRAKEXXXXXXXXXRSFNADLLYEPWDV  120

Query  474  VDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
             D +G PFTTF  FW+RCLSMP+DPEAPLLPP
Sbjct  121  NDAQGRPFTTFDTFWERCLSMPFDPEAPLLPP  152



>gb|AEK05693.1| cryptochrome 1 protein 1 [Populus balsamifera]
 gb|AEK05694.1| cryptochrome 1 protein 1 [Populus balsamifera]
Length=639

 Score =   259 bits (662),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 120/152 (79%), Positives = 135/152 (89%), Gaps = 0/152 (0%)
 Frame = +3

Query  114  PALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSLRSLGTTLITKRST  293
            PALAAGVR+GA++A+F+WAPEEEGHYYPGRVSRWWLKQSLAHLDSSLRSLGT+L+TKRST
Sbjct  1    PALAAGVRAGAVVAVFVWAPEEEGHYYPGRVSRWWLKQSLAHLDSSLRSLGTSLVTKRST  60

Query  294  DSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVRSFNSDLLYEPWEV  473
            DSVSSL+EV+KSTG + L FNHLYDPLSLVRDHRAKE         RSFN+DLLYEPW+V
Sbjct  61   DSVSSLLEVVKSTGXTQLLFNHLYDPLSLVRDHRAKEXXXXXXXXXRSFNADLLYEPWDV  120

Query  474  VDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
             D +G PFTTF  FW+RCLSMP+DPEAPLLPP
Sbjct  121  NDAQGRPFTTFDTFWERCLSMPFDPEAPLLPP  152



>ref|XP_009599630.1| PREDICTED: cryptochrome-1-like isoform X3 [Nicotiana tomentosiformis]
Length=665

 Score =   257 bits (657),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 136/167 (81%), Positives = 151/167 (90%), Gaps = 13/167 (8%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAI--IALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDS  248
            IVWFRRDLRVEDNPALAAGVR+GA   IA+FIWAPEEEGHYYPGRVSRWWLKQSLAHLDS
Sbjct  8    IVWFRRDLRVEDNPALAAGVRAGAGAVIAVFIWAPEEEGHYYPGRVSRWWLKQSLAHLDS  67

Query  249  SLRSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVT  428
            SL+SLGT+L+TKRSTDS+SSL+EVIKST           DP+SLVRDHRAKE+LTAQG++
Sbjct  68   SLKSLGTSLVTKRSTDSISSLLEVIKST-----------DPISLVRDHRAKEVLTAQGIS  116

Query  429  VRSFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            VRSFN+DLLYEPWEV D+EG PFTTFSAFW++CLSMPYDPEAPLLPP
Sbjct  117  VRSFNADLLYEPWEVNDEEGCPFTTFSAFWEKCLSMPYDPEAPLLPP  163



>ref|XP_009334353.1| PREDICTED: cryptochrome-1-like, partial [Pyrus x bretschneideri]
Length=654

 Score =   248 bits (634),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 114/147 (78%), Positives = 131/147 (89%), Gaps = 0/147 (0%)
 Frame = +3

Query  129  GVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSLRSLGTTLITKRSTDSVSS  308
             VR+G ++ +FIWAPEEEG +YPGRVSRWWLK SLAHLDSSL++LGT+LITKRS DSVSS
Sbjct  1    AVRAGGVVCVFIWAPEEEGPFYPGRVSRWWLKHSLAHLDSSLKNLGTSLITKRSNDSVSS  60

Query  309  LIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVRSFNSDLLYEPWEVVDDEG  488
            L+EV+ STGA+ LFFNHLYDP+SLVRDHRAKE+LTAQG+ VRSFN+DLLYEPW+V D   
Sbjct  61   LLEVVVSTGATQLFFNHLYDPISLVRDHRAKEVLTAQGIAVRSFNADLLYEPWDVNDVHD  120

Query  489  HPFTTFSAFWDRCLSMPYDPEAPLLPP  569
             PFTTF AFW RCLSMPYDP+APLLPP
Sbjct  121  RPFTTFDAFWGRCLSMPYDPDAPLLPP  147



>ref|XP_002513922.1| DNA photolyase, putative [Ricinus communis]
 gb|EEF48505.1| DNA photolyase, putative [Ricinus communis]
Length=660

 Score =   248 bits (633),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 121/165 (73%), Positives = 134/165 (81%), Gaps = 17/165 (10%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLRVEDNPALAAGVR+GA++A+F+WAPEEEGHYYPGRVSRWWLKQSLAHLDSSL
Sbjct  8    IVWFRRDLRVEDNPALAAGVRAGAVVAVFVWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  67

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            RSLGT L++KRSTDSVSSL+EV+KSTGA+ LFFNHLYDP+SLVRDHRAKE+LTAQG+ VR
Sbjct  68   RSLGTVLVSKRSTDSVSSLLEVVKSTGATQLFFNHLYDPISLVRDHRAKEVLTAQGIAVR  127

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            S        P                    CLSMPYDPEAPLLPP
Sbjct  128  SLTRICYMNPGXX-----------------CLSMPYDPEAPLLPP  155



>gb|AGI61039.1| blue-light photoreceptor cryptochrome 4, partial [Asplenium yunnanense]
Length=697

 Score =   245 bits (625),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 105/165 (64%), Positives = 140/165 (85%), Gaps = 0/165 (0%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLR+EDNPAL+   R+GA++ +FIW+PEEEG ++PGRVSRWWLK+SL  LD SL
Sbjct  8    IVWFRRDLRLEDNPALSVAARAGAVVPVFIWSPEEEGQFHPGRVSRWWLKESLIQLDISL  67

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            RSLG  L+ +++ D++S+L+E++K+TGA+ + +NHLYDP+SLVRDHR K+ LT  GV V+
Sbjct  68   RSLGAFLVLRKTHDTLSTLLEIVKTTGATQVVYNHLYDPISLVRDHRVKQGLTENGVQVQ  127

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            SFN DLLYEPWEV+DD G PFT F ++W +CLSMP++P++PLLPP
Sbjct  128  SFNGDLLYEPWEVLDDHGKPFTFFDSYWTKCLSMPFEPDSPLLPP  172



>ref|XP_003579874.1| PREDICTED: cryptochrome-1-like [Brachypodium distachyon]
Length=712

 Score =   245 bits (625),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 115/167 (69%), Positives = 145/167 (87%), Gaps = 2/167 (1%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRS-GAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSS  251
            +VWFRRDLRVEDNPALAA  R+ G ++  ++W+PEE+G Y+PGRVSRWWL QSL HL++S
Sbjct  18   VVWFRRDLRVEDNPALAAAARTAGEVVPAYVWSPEEDGPYFPGRVSRWWLSQSLKHLEAS  77

Query  252  LRSLGT-TLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVT  428
            L+ LG   L+T+RS D+V +L+++++ TGA+HLFFNHLYDP+SLVRDHR KE+LTA+G+ 
Sbjct  78   LQRLGAGKLVTRRSADAVVALLQLVRDTGATHLFFNHLYDPISLVRDHRLKEMLTAEGII  137

Query  429  VRSFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            V+SFN+DLLY+PWEVVDDEGHPFT F  FW+RCLSMPYDP APLLPP
Sbjct  138  VQSFNADLLYDPWEVVDDEGHPFTMFMPFWNRCLSMPYDPPAPLLPP  184



>dbj|BAE54523.1| cryptochrome [Marchantia paleacea subsp. diptera]
 dbj|BAE54524.1| cryptochrome [Marchantia paleacea subsp. diptera]
Length=696

 Score =   244 bits (622),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 105/165 (64%), Positives = 137/165 (83%), Gaps = 0/165 (0%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLRVEDNPAL A  R+G +I +FIW+PEE+G ++PGRVSRWWLKQSL HLDSSL
Sbjct  6    IVWFRRDLRVEDNPALVAAARAGIVIPVFIWSPEEDGQFHPGRVSRWWLKQSLIHLDSSL  65

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            +SLG+ LI ++S D+++ L+++++  GA+ +F+NHLYDP+SLVRDHR K+ L+   + V 
Sbjct  66   KSLGSPLIMRKSPDTLTVLLDIVQQVGATQVFYNHLYDPVSLVRDHRVKQGLSIHNIPVH  125

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            +FN DLLYEPWEV DDEG  FTTF  FWD+C++MP++PEAPLL P
Sbjct  126  TFNGDLLYEPWEVYDDEGQAFTTFDDFWDKCMNMPFEPEAPLLSP  170



>emb|CAD40850.1| OSJNBa0086B14.23 [Oryza sativa Japonica Group]
 emb|CAH67187.1| H0815C01.8 [Oryza sativa Indica Group]
Length=693

 Score =   243 bits (621),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 115/167 (69%), Positives = 142/167 (85%), Gaps = 2/167 (1%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGA-IIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSS  251
            +VWFRRDLRVEDNPALAA  R+G  ++  ++WAPEE+G YYPGRVSRWWL QSL HLD+S
Sbjct  14   VVWFRRDLRVEDNPALAAAARAGGEVVPAYVWAPEEDGPYYPGRVSRWWLSQSLKHLDAS  73

Query  252  LRSLGT-TLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVT  428
            LR LG   L+T+RS D+V +L+++++ TGA+ LFFNHLYDP+SLVRDHR KE++ A+G+ 
Sbjct  74   LRRLGAGKLVTRRSADAVVALLQLVRDTGATRLFFNHLYDPISLVRDHRLKEMMAAEGII  133

Query  429  VRSFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            V+SFN+DLLYEPWEVVDDEG  FT F+ FW+RCLSMPYDP APLLPP
Sbjct  134  VQSFNADLLYEPWEVVDDEGQSFTMFAPFWNRCLSMPYDPAAPLLPP  180



>dbj|BAB70688.2| cryptochrome 1b [Oryza sativa Japonica Group]
Length=700

 Score =   243 bits (621),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 115/167 (69%), Positives = 142/167 (85%), Gaps = 2/167 (1%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGA-IIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSS  251
            +VWFRRDLRVEDNPALAA  R+G  ++  ++WAPEE+G YYPGRVSRWWL QSL HLD+S
Sbjct  21   VVWFRRDLRVEDNPALAAAARAGGEVVPAYVWAPEEDGPYYPGRVSRWWLSQSLKHLDAS  80

Query  252  LRSLGT-TLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVT  428
            LR LG   L+T+RS D+V +L+++++ TGA+ LFFNHLYDP+SLVRDHR KE++ A+G+ 
Sbjct  81   LRRLGAGKLVTRRSADAVVALLQLVRDTGATRLFFNHLYDPISLVRDHRLKEMMAAEGII  140

Query  429  VRSFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            V+SFN+DLLYEPWEVVDDEG  FT F+ FW+RCLSMPYDP APLLPP
Sbjct  141  VQSFNADLLYEPWEVVDDEGQSFTMFAPFWNRCLSMPYDPAAPLLPP  187



>ref|NP_001052950.1| Os04g0452100 [Oryza sativa Japonica Group]
 dbj|BAF14864.1| Os04g0452100 [Oryza sativa Japonica Group]
 gb|EEC77377.1| hypothetical protein OsI_16111 [Oryza sativa Indica Group]
Length=700

 Score =   243 bits (621),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 115/167 (69%), Positives = 142/167 (85%), Gaps = 2/167 (1%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGA-IIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSS  251
            +VWFRRDLRVEDNPALAA  R+G  ++  ++WAPEE+G YYPGRVSRWWL QSL HLD+S
Sbjct  21   VVWFRRDLRVEDNPALAAAARAGGEVVPAYVWAPEEDGPYYPGRVSRWWLSQSLKHLDAS  80

Query  252  LRSLGT-TLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVT  428
            LR LG   L+T+RS D+V +L+++++ TGA+ LFFNHLYDP+SLVRDHR KE++ A+G+ 
Sbjct  81   LRRLGAGKLVTRRSADAVVALLQLVRDTGATRLFFNHLYDPISLVRDHRLKEMMAAEGII  140

Query  429  VRSFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            V+SFN+DLLYEPWEVVDDEG  FT F+ FW+RCLSMPYDP APLLPP
Sbjct  141  VQSFNADLLYEPWEVVDDEGQSFTMFAPFWNRCLSMPYDPAAPLLPP  187



>ref|XP_008667261.1| PREDICTED: uncharacterized protein LOC100194126 isoform X1 [Zea 
mays]
 ref|XP_008667262.1| PREDICTED: uncharacterized protein LOC100194126 isoform X1 [Zea 
mays]
 gb|ACL54414.1| unknown [Zea mays]
 tpg|DAA37521.1| TPA: hypothetical protein ZEAMMB73_248176 [Zea mays]
 tpg|DAA37522.1| TPA: hypothetical protein ZEAMMB73_248176 [Zea mays]
Length=688

 Score =   243 bits (619),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 114/167 (68%), Positives = 141/167 (84%), Gaps = 2/167 (1%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGA-IIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSS  251
            +VWFRRDLRVEDNPALAA  R+G  ++  ++W+PEEEG YYPGRVSRWW+ QSL HLD+S
Sbjct  4    VVWFRRDLRVEDNPALAAAARAGGEVVPAYVWSPEEEGPYYPGRVSRWWISQSLNHLDAS  63

Query  252  LRSLGT-TLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVT  428
            LR LG   L+T+RS D+  +L+++++ TGA+H++FNHLYDP+SLVRD R KE+L A+G+ 
Sbjct  64   LRRLGAGKLVTRRSADAAVALLQLVRDTGATHVYFNHLYDPISLVRDRRLKEMLAAEGIV  123

Query  429  VRSFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            V+SFNSDLLYEPWEVVDDEG PFT F  FW+RCLSMPYDP APLLPP
Sbjct  124  VQSFNSDLLYEPWEVVDDEGQPFTMFDPFWNRCLSMPYDPPAPLLPP  170



>gb|EMT05360.1| Cryptochrome-1 [Aegilops tauschii]
Length=698

 Score =   242 bits (617),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 117/167 (70%), Positives = 145/167 (87%), Gaps = 3/167 (2%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRS-GAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSS  251
            +VWFRRDLRVEDNPALAA  R+ G ++  ++WAPEE+G YYPGRVSRWWL QSL HLD+S
Sbjct  18   VVWFRRDLRVEDNPALAAAARTAGEVVPAYVWAPEEDGPYYPGRVSRWWLSQSLKHLDAS  77

Query  252  LRSLGTT-LITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVT  428
            LR LG T L+T+RSTD+V++L+E+++STGA+HLFFNHLYDPLSLVRDHR K++L A+G+T
Sbjct  78   LRRLGATRLVTRRSTDTVAALLELVRSTGATHLFFNHLYDPLSLVRDHRVKQVLGAEGIT  137

Query  429  VRSFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            V+SFNSDLLYEPWEV+DD G PFT F+ FW++CL M  DP AP+LPP
Sbjct  138  VQSFNSDLLYEPWEVLDDHGCPFTMFTPFWNKCLCM-VDPPAPMLPP  183



>gb|ABB13328.1| cryptochrome 1a [Hordeum vulgare subsp. vulgare]
 gb|ABB13329.1| cryptochrome 1a [Hordeum vulgare subsp. vulgare]
 gb|ABB13330.1| cryptochrome 1a [Hordeum vulgare subsp. vulgare]
Length=694

 Score =   241 bits (616),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 115/167 (69%), Positives = 146/167 (87%), Gaps = 3/167 (2%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRS-GAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSS  251
            +VWFRRDLRVEDNPALAA  R+ G ++  ++WAPEE+G YYPGRVSRWWL QSL HLD+S
Sbjct  19   VVWFRRDLRVEDNPALAAAARTAGEVVPAYVWAPEEDGPYYPGRVSRWWLSQSLKHLDAS  78

Query  252  LRSLGTT-LITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVT  428
            LR LG + L+T+RSTD+V++L+E+++STGA+HLFFNHLYDPLSLVRDHR K++L A+G++
Sbjct  79   LRRLGASRLVTRRSTDTVAALLELVRSTGATHLFFNHLYDPLSLVRDHRVKQVLAAEGIS  138

Query  429  VRSFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            V+SFNSDLLYEPWEV+DD G PFT F++FW++CL M  DP AP+LPP
Sbjct  139  VQSFNSDLLYEPWEVLDDHGSPFTMFTSFWNKCLCM-VDPPAPMLPP  184



>ref|XP_006652348.1| PREDICTED: cryptochrome-1-like isoform X1 [Oryza brachyantha]
 ref|XP_006652349.1| PREDICTED: cryptochrome-1-like isoform X2 [Oryza brachyantha]
Length=702

 Score =   241 bits (614),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 113/167 (68%), Positives = 141/167 (84%), Gaps = 2/167 (1%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGA-IIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSS  251
            +VWFRRDLRVEDNPALAA  R+G  ++  ++WAPEE+G YYPGRVSRWWL QSL HLD+S
Sbjct  23   VVWFRRDLRVEDNPALAAAARAGGEVVPAYVWAPEEDGAYYPGRVSRWWLSQSLKHLDAS  82

Query  252  LRSLGTT-LITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVT  428
            LR LG   L+T+RS D+V +L+++++ TGA+ LFFNHLYDP+SLVRDHR K+++  +G+ 
Sbjct  83   LRRLGAGRLVTRRSADAVIALLQLVRDTGATQLFFNHLYDPISLVRDHRLKQMMAVEGII  142

Query  429  VRSFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            V+SFN+DLLYEPWEVVDDEG  FT F+ FW+RCLSMPYDP APLLPP
Sbjct  143  VQSFNADLLYEPWEVVDDEGQSFTMFAPFWNRCLSMPYDPAAPLLPP  189



>gb|ABX58028.1| cryptochrome 1a [Triticum aestivum]
Length=698

 Score =   240 bits (613),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 117/167 (70%), Positives = 144/167 (86%), Gaps = 3/167 (2%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRS-GAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSS  251
            +VWFRRDLRVEDNPALAA  R+ G ++  ++WAPEE+G YYPGRVSRWWL QSL HLD+S
Sbjct  18   VVWFRRDLRVEDNPALAAAARTAGEVVPAYVWAPEEDGPYYPGRVSRWWLSQSLKHLDAS  77

Query  252  LRSLGTT-LITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVT  428
            LR LG T L+T+RSTD+V++L+E+++STGA+HLFFNHLYDPLSLVRDHR K++L A+G+T
Sbjct  78   LRRLGATRLVTRRSTDTVAALLELVRSTGATHLFFNHLYDPLSLVRDHRVKQVLGAEGIT  137

Query  429  VRSFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            V+SFNSDLLYEPWEV+DD G PFT F+ FW+ CL M  DP AP+LPP
Sbjct  138  VQSFNSDLLYEPWEVLDDHGCPFTMFTPFWNTCLCM-VDPPAPMLPP  183



>dbj|BAA32807.1| blue-light photoreceptor [Adiantum capillus-veneris]
 dbj|BAA32810.1| blue-light photoreceptor [Adiantum capillus-veneris]
Length=637

 Score =   239 bits (609),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 107/165 (65%), Positives = 131/165 (79%), Gaps = 0/165 (0%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLRVEDNPAL A VR+G ++ LFIW PEEEG + PGRVSRWWLKQSL  L  SL
Sbjct  5    IVWFRRDLRVEDNPALVAAVRAGTVVPLFIWTPEEEGQFLPGRVSRWWLKQSLIQLHQSL  64

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
             SLG+ LI +R+  ++S L ++IK TGA+ +FFNHLYDP+SLVRDH+ K+ L   GVTV 
Sbjct  65   TSLGSPLIMRRAQSAISVLSQIIKQTGATQVFFNHLYDPVSLVRDHKVKQELLQAGVTVT  124

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            +FN+DLLYEPWE+ D++G PFTTF+ FW  C+ M  +PEAPLLPP
Sbjct  125  TFNADLLYEPWEINDEQGRPFTTFAGFWSLCMDMAIEPEAPLLPP  169



>ref|XP_001751763.1| cryptochrome 1a [Physcomitrella patens]
 dbj|BAA83338.1| blue light photoreceptor cryptochrome [Physcomitrella patens]
 gb|EDQ83198.1| cryptochrome 1a [Physcomitrella patens]
Length=727

 Score =   239 bits (611),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 101/165 (61%), Positives = 137/165 (83%), Gaps = 0/165 (0%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLR+EDNPAL A  R+G ++ +F+W+P E+G ++PGRVSRWWLKQSL HL+ SL
Sbjct  6    IVWFRRDLRLEDNPALIAAARAGTVVPVFVWSPAEDGQFHPGRVSRWWLKQSLTHLELSL  65

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            + LG+ LI ++S D++S L+E+ ++TGA+ +F+NHLYDP+SLVRDHR K+ L+ +G+ V 
Sbjct  66   KKLGSPLILRKSPDTLSVLLEIAEATGATQVFYNHLYDPVSLVRDHRVKQGLSQRGIVVH  125

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            +FN DLLYEPWEV D+EG  FT + AFW +C+SMP++PEAPLLPP
Sbjct  126  TFNGDLLYEPWEVYDEEGQAFTVYEAFWKKCMSMPFEPEAPLLPP  170



>gb|ABX58027.1| cryptochrome 1a [Triticum aestivum]
Length=700

 Score =   239 bits (610),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 116/167 (69%), Positives = 144/167 (86%), Gaps = 3/167 (2%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRS-GAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSS  251
            +VWFRRDLRVEDNPALAA  R+ G ++  ++WAP+E+G YYPGRVSRWWL QSL HLD+S
Sbjct  20   VVWFRRDLRVEDNPALAAAARTAGEVVPAYVWAPKEDGPYYPGRVSRWWLSQSLKHLDAS  79

Query  252  LRSLGTT-LITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVT  428
            LR LG T L+T+RSTD+V++L+E+++STGA+HLFFNHLYDPLSLVRDHR K++L A+G+T
Sbjct  80   LRRLGATRLVTRRSTDTVAALLELVRSTGATHLFFNHLYDPLSLVRDHRVKQVLGAEGIT  139

Query  429  VRSFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            V+SFNSDLLYEPWEV+DD G PFT F+ FW+ CL M  DP AP+LPP
Sbjct  140  VQSFNSDLLYEPWEVLDDHGCPFTMFTPFWNTCLCM-VDPPAPMLPP  185



>dbj|BAA32808.1| blue-light photoreceptor [Adiantum capillus-veneris]
 dbj|BAA32811.1| blue-light photoreceptor [Adiantum capillus-veneris]
Length=679

 Score =   238 bits (608),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 103/165 (62%), Positives = 134/165 (81%), Gaps = 0/165 (0%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLR+EDNPAL A VR+G ++ +FIW+PEEEG + PGRVSRWWLKQSL HL+ SL
Sbjct  11   IVWFRRDLRIEDNPALVAAVRAGPVLPVFIWSPEEEGQFLPGRVSRWWLKQSLVHLNESL  70

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
              LG  L+ +R+++ +++L+E+ K+TGA+ +F+NHLYDP+SLVRDHR K+ L+  G+ V 
Sbjct  71   TILGAPLVMRRASNVLAALLEIKKATGATQVFYNHLYDPVSLVRDHRVKQGLSQAGIIVN  130

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            SFN+DLLYEPWEV DD G  FTTFS FW +C+ MP +PEA +LPP
Sbjct  131  SFNADLLYEPWEVNDDNGQAFTTFSGFWAKCMDMPAEPEAQILPP  175



>dbj|BAA88423.1| blue light photoreceptor [Adiantum capillus-veneris]
 dbj|BAA88425.1| blue light photoreceptor [Adiantum capillus-veneris]
Length=699

 Score =   238 bits (608),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 102/165 (62%), Positives = 136/165 (82%), Gaps = 0/165 (0%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVW RRDLR+EDNPAL A  R G ++ +FIW+PEEE  ++PGRVSRWWLKQSL  LD SL
Sbjct  7    IVWLRRDLRLEDNPALCAAGRIGNVVPVFIWSPEEERQFHPGRVSRWWLKQSLIQLDVSL  66

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            RS G  L+ ++STD++ +L E+IK+TGA+ +F+NHLYDP+SLVRDH  K+ LT  G+ V+
Sbjct  67   RSFGVPLVMRKSTDTLGTLQELIKATGATQVFYNHLYDPISLVRDHHVKQGLTQSGIQVQ  126

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            SFN DLLYEPWEV++D+G PFT+F ++W +CL+MP++P++PLLPP
Sbjct  127  SFNGDLLYEPWEVLNDDGKPFTSFESYWQKCLNMPFEPDSPLLPP  171



>dbj|BAB70665.1| blue-light receptor cryptochrome [Physcomitrella patens]
Length=727

 Score =   239 bits (609),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 101/165 (61%), Positives = 136/165 (82%), Gaps = 0/165 (0%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLR+EDNPAL A  R+G ++ +F+W+P E+G ++PGRVSRWWLKQSL HL+ SL
Sbjct  6    IVWFRRDLRLEDNPALIAAARAGTVVPVFVWSPAEDGQFHPGRVSRWWLKQSLTHLELSL  65

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            + LG+ LI ++S D +S L+E+ ++TGA+ +F+NHLYDP+SLVRDHR K+ L+ +G+ V 
Sbjct  66   KKLGSPLILRKSPDMLSVLLEIAEATGATQVFYNHLYDPVSLVRDHRVKQGLSQRGIVVH  125

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            +FN DLLYEPWEV D+EG  FT + AFW +C+SMP++PEAPLLPP
Sbjct  126  TFNGDLLYEPWEVYDEEGQAFTVYEAFWKKCMSMPFEPEAPLLPP  170



>gb|AGI61037.1| blue-light photoreceptor cryptochrome 1, partial [Asplenium yunnanense]
Length=575

 Score =   235 bits (599),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 104/165 (63%), Positives = 134/165 (81%), Gaps = 0/165 (0%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            +VWFRRDLRVEDNPAL A VR+G ++ +FIW PEEEG + PGRVSRWWLKQSL  L  SL
Sbjct  5    VVWFRRDLRVEDNPALVAAVRAGNVVPVFIWTPEEEGQFLPGRVSRWWLKQSLIQLHESL  64

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
             +LG+ LI +RS +++S L+++IK TGA+ +FFNHLYDP+SLVRDH+ K+ L   GV+V 
Sbjct  65   TNLGSPLIMRRSRNALSFLLDLIKETGATQVFFNHLYDPVSLVRDHKLKQELVQAGVSVT  124

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            +FN+DLLYEPWEV +++G PFTTF+ FW +C+ M  +PEAPLLPP
Sbjct  125  TFNADLLYEPWEVNNEQGRPFTTFAGFWTQCMGMAIEPEAPLLPP  169



>ref|XP_010235580.1| PREDICTED: cryptochrome-1-like [Brachypodium distachyon]
 ref|XP_010235581.1| PREDICTED: cryptochrome-1-like [Brachypodium distachyon]
Length=700

 Score =   237 bits (605),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 115/167 (69%), Positives = 144/167 (86%), Gaps = 3/167 (2%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRS-GAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSS  251
            +VWFRRDLRVEDNPALAA  R+ G ++  ++WAPEE+G YYPGRVSRWWL QSL HLD+S
Sbjct  21   VVWFRRDLRVEDNPALAAAARTAGEVVPAYVWAPEEDGPYYPGRVSRWWLSQSLKHLDAS  80

Query  252  LRSLGTT-LITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVT  428
            LR LG + L+T+RSTD+V++L+++++STGA+HLFFNHLYDPLSLVRDHR KE+L  +G+T
Sbjct  81   LRRLGASRLVTRRSTDTVAALLDLVRSTGATHLFFNHLYDPLSLVRDHRVKELLAGEGIT  140

Query  429  VRSFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            V+SFNSDLLYEPWEV+DD+  PFT F+ FW++CL M  DP APLLPP
Sbjct  141  VQSFNSDLLYEPWEVLDDDCCPFTMFTPFWEKCLCMA-DPAAPLLPP  186



>gb|ABB13331.1| cryptochrome 1b [Hordeum vulgare subsp. vulgare]
 gb|ABB13332.1| cryptochrome 1b [Hordeum vulgare subsp. vulgare]
 gb|ABB13333.1| cryptochrome 1b [Hordeum vulgare subsp. vulgare]
Length=712

 Score =   238 bits (606),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 111/167 (66%), Positives = 142/167 (85%), Gaps = 2/167 (1%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRS-GAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSS  251
            +VWFRRDLRVEDNPALAA  R+ G ++  ++W+PEE+G Y+PGRVSRWWL QSL HL++S
Sbjct  18   VVWFRRDLRVEDNPALAAAARTAGEVVPAYVWSPEEDGPYFPGRVSRWWLSQSLKHLEAS  77

Query  252  LRSLGT-TLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVT  428
            L  LG   L+T+RS DSV++L+++++ TGA+HLFFNHLYDP+SLVRDHR KE+LT++G+ 
Sbjct  78   LHRLGAGKLVTRRSADSVAALLQLVRDTGATHLFFNHLYDPISLVRDHRLKEMLTSEGIV  137

Query  429  VRSFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            V+SFN+DLLY+PWEV DD+G PF  F  FW+RCLSMPYDP APLLPP
Sbjct  138  VQSFNADLLYDPWEVNDDDGQPFNMFMPFWNRCLSMPYDPPAPLLPP  184



>gb|AFW62704.1| hypothetical protein ZEAMMB73_163109 [Zea mays]
Length=199

 Score =   223 bits (569),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 107/156 (69%), Positives = 135/156 (87%), Gaps = 2/156 (1%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRS-GAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSS  251
            +VWFRRDLRVEDNPALAA  R+ G ++  ++W+PEE+G YYPGRVSRWWL QSL HLD+S
Sbjct  19   VVWFRRDLRVEDNPALAAAARTAGEVVPAYVWSPEEDGPYYPGRVSRWWLSQSLKHLDAS  78

Query  252  LRSLGTT-LITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVT  428
            LR LG   L+T+RS+D+V +LI++++STGA+HLFFN LYDPLSLVRDHR KE L+A+G+T
Sbjct  79   LRRLGACRLVTRRSSDAVVALIDLVRSTGATHLFFNRLYDPLSLVRDHRVKEQLSAEGIT  138

Query  429  VRSFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSM  536
            V+SFN+DLLYEPWEV+DD+G PFT F+ FW+RCL M
Sbjct  139  VQSFNADLLYEPWEVLDDDGFPFTMFAPFWNRCLCM  174



>gb|AGI61038.1| blue-light photoreceptor cryptochrome 2 [Asplenium yunnanense]
Length=665

 Score =   235 bits (599),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 102/165 (62%), Positives = 133/165 (81%), Gaps = 0/165 (0%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            +VWFRRDLRVEDNPAL + VR G +I +FIW+PEEEG + PGRVSRWWLKQSL  L+ SL
Sbjct  6    VVWFRRDLRVEDNPALVSAVRVGTVIPVFIWSPEEEGQFLPGRVSRWWLKQSLIRLNESL  65

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
             SLG  L+ +R+ + +SS++E+++++GA+ +F+NHLYDP+SLVRDH  K+ L   G+TV 
Sbjct  66   TSLGAPLVMRRARNVLSSILEIVEASGATQVFYNHLYDPVSLVRDHTVKQGLLQAGITVN  125

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            SFN+DLLYEPWEV D +G  FTTFS FW +C+ MP +PEAP+LPP
Sbjct  126  SFNADLLYEPWEVNDHQGQAFTTFSGFWTKCMDMPAEPEAPILPP  170



>gb|AEA50864.1| cry2-2 [Populus tremula]
Length=177

 Score =   220 bits (560),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 97/164 (59%), Positives = 126/164 (77%), Gaps = 0/164 (0%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLR+EDNPALAA  R G +  +FIW P+EEG +YPGRVSRWWLKQSLAHL  SL
Sbjct  7    IVWFRRDLRIEDNPALAAAARDGCVFPVFIWCPKEEGQFYPGRVSRWWLKQSLAHLGQSL  66

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            +SLG  L+  ++  +V +L++ I++ GA+ + FNHLYDP+SLVRDH  KE L   G++V+
Sbjct  67   KSLGAELVLIKTHSTVVALLDCIETIGATRVVFNHLYDPVSLVRDHNIKEKLVELGISVQ  126

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLP  566
            S+N DLLYEPWE+ D+ G+ FTTF A+WD+CL M  +P + L P
Sbjct  127  SYNGDLLYEPWEIYDERGYAFTTFEAYWDKCLHMQMEPVSHLPP  170



>gb|EAZ30924.1| hypothetical protein OsJ_15004 [Oryza sativa Japonica Group]
Length=697

 Score =   233 bits (594),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 111/162 (69%), Positives = 137/162 (85%), Gaps = 2/162 (1%)
 Frame = +3

Query  90   RDLRVEDNPALAAGVRSGA-IIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSLRSLG  266
            RDLRVEDNPALAA  R+G  ++  ++WAPEE+G YYPGRVSRWWL QSL HLD+SLR LG
Sbjct  23   RDLRVEDNPALAAAARAGGEVVPAYVWAPEEDGPYYPGRVSRWWLSQSLKHLDASLRRLG  82

Query  267  T-TLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVRSFN  443
               L+T+RS D+V +L+++++ TGA+ LFFNHLYDP+SLVRDHR KE++ A+G+ V+SFN
Sbjct  83   AGKLVTRRSADAVVALLQLVRDTGATRLFFNHLYDPISLVRDHRLKEMMAAEGIIVQSFN  142

Query  444  SDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            +DLLYEPWEVVDDEG  FT F+ FW+RCLSMPYDP APLLPP
Sbjct  143  ADLLYEPWEVVDDEGQSFTMFAPFWNRCLSMPYDPAAPLLPP  184



>ref|XP_010262313.1| PREDICTED: cryptochrome-1-like isoform X2 [Nelumbo nucifera]
Length=646

 Score =   231 bits (588),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 104/165 (63%), Positives = 134/165 (81%), Gaps = 1/165 (1%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLR+EDNPALA+  R G+++ ++IW P+EEG +YPGRVSRWWLKQSLAHLD SL
Sbjct  8    IVWFRRDLRIEDNPALASAAREGSVLPVYIWCPKEEGQFYPGRVSRWWLKQSLAHLDQSL  67

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            RSLG  L+  ++ +++++L+  I++ GA+ + +NHLYDP+SL RDH  KE LT  G++V+
Sbjct  68   RSLGAPLVLIKAENTLAALLRCIEAVGATKVVYNHLYDPVSLARDHSIKEKLTNFGISVQ  127

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            SFN DLLYEPWEV DD+GHPFTTF+AFW RCL  P +P A LLPP
Sbjct  128  SFNGDLLYEPWEVNDDKGHPFTTFNAFWSRCLLEPTEP-ALLLPP  171



>ref|XP_010262312.1| PREDICTED: cryptochrome-1-like isoform X1 [Nelumbo nucifera]
Length=647

 Score =   231 bits (588),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 104/165 (63%), Positives = 134/165 (81%), Gaps = 1/165 (1%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLR+EDNPALA+  R G+++ ++IW P+EEG +YPGRVSRWWLKQSLAHLD SL
Sbjct  8    IVWFRRDLRIEDNPALASAAREGSVLPVYIWCPKEEGQFYPGRVSRWWLKQSLAHLDQSL  67

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            RSLG  L+  ++ +++++L+  I++ GA+ + +NHLYDP+SL RDH  KE LT  G++V+
Sbjct  68   RSLGAPLVLIKAENTLAALLRCIEAVGATKVVYNHLYDPVSLARDHSIKEKLTNFGISVQ  127

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            SFN DLLYEPWEV DD+GHPFTTF+AFW RCL  P +P A LLPP
Sbjct  128  SFNGDLLYEPWEVNDDKGHPFTTFNAFWSRCLLEPTEP-ALLLPP  171



>ref|XP_007035109.1| Cryptochrome 2 isoform 1 [Theobroma cacao]
 gb|EOY06035.1| Cryptochrome 2 isoform 1 [Theobroma cacao]
Length=643

 Score =   230 bits (587),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 101/165 (61%), Positives = 133/165 (81%), Gaps = 1/165 (1%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLR++DNPALAA  R+G++  +FIW P+EEG +YPGRVSRWWLKQSLAHL+ SL
Sbjct  7    IVWFRRDLRIDDNPALAAAARNGSVFPVFIWCPKEEGQFYPGRVSRWWLKQSLAHLEQSL  66

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            RSLG  L+  ++  ++S+L++ I +TGA+ + FNHLYDP+SLVRDH  KE L   G++V+
Sbjct  67   RSLGAELVLIKTQSTLSALLDCINATGATKVVFNHLYDPVSLVRDHGIKEKLAEIGISVQ  126

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            S+N DLLYEPWE+ D++G  FTTF A+WD+CL+M  +P  PLLPP
Sbjct  127  SYNGDLLYEPWEIYDEKGQAFTTFDAYWDKCLNMQTEP-IPLLPP  170



>ref|XP_007035110.1| Cryptochrome 2 isoform 2 [Theobroma cacao]
 gb|EOY06036.1| Cryptochrome 2 isoform 2 [Theobroma cacao]
Length=645

 Score =   230 bits (587),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 101/165 (61%), Positives = 133/165 (81%), Gaps = 1/165 (1%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLR++DNPALAA  R+G++  +FIW P+EEG +YPGRVSRWWLKQSLAHL+ SL
Sbjct  7    IVWFRRDLRIDDNPALAAAARNGSVFPVFIWCPKEEGQFYPGRVSRWWLKQSLAHLEQSL  66

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            RSLG  L+  ++  ++S+L++ I +TGA+ + FNHLYDP+SLVRDH  KE L   G++V+
Sbjct  67   RSLGAELVLIKTQSTLSALLDCINATGATKVVFNHLYDPVSLVRDHGIKEKLAEIGISVQ  126

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            S+N DLLYEPWE+ D++G  FTTF A+WD+CL+M  +P  PLLPP
Sbjct  127  SYNGDLLYEPWEIYDEKGQAFTTFDAYWDKCLNMQTEP-IPLLPP  170



>ref|XP_007035111.1| Cryptochrome 2 isoform 3 [Theobroma cacao]
 gb|EOY06037.1| Cryptochrome 2 isoform 3 [Theobroma cacao]
Length=658

 Score =   230 bits (587),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 101/165 (61%), Positives = 133/165 (81%), Gaps = 1/165 (1%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLR++DNPALAA  R+G++  +FIW P+EEG +YPGRVSRWWLKQSLAHL+ SL
Sbjct  7    IVWFRRDLRIDDNPALAAAARNGSVFPVFIWCPKEEGQFYPGRVSRWWLKQSLAHLEQSL  66

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            RSLG  L+  ++  ++S+L++ I +TGA+ + FNHLYDP+SLVRDH  KE L   G++V+
Sbjct  67   RSLGAELVLIKTQSTLSALLDCINATGATKVVFNHLYDPVSLVRDHGIKEKLAEIGISVQ  126

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            S+N DLLYEPWE+ D++G  FTTF A+WD+CL+M  +P  PLLPP
Sbjct  127  SYNGDLLYEPWEIYDEKGQAFTTFDAYWDKCLNMQTEP-IPLLPP  170



>gb|KJB38412.1| hypothetical protein B456_006G253700 [Gossypium raimondii]
Length=434

 Score =   224 bits (572),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 99/165 (60%), Positives = 130/165 (79%), Gaps = 1/165 (1%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLR++DNPALAA  R G++  ++IW P+EE  +YPGRVSRWWLKQSLAHL+ SL
Sbjct  19   IVWFRRDLRIDDNPALAAAARDGSVFPVYIWCPKEEEQFYPGRVSRWWLKQSLAHLEQSL  78

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            +SLG  L+  ++  ++S+L++ IK+TGA+ L FNHLYDP+SLVRDH  KE L   G++VR
Sbjct  79   KSLGAELVLIKTHSTLSALLDCIKATGATKLVFNHLYDPVSLVRDHNIKEKLAEAGISVR  138

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            S+N DLLYEPWE+ D++G  FTTF A+WD+CL+M  +P    LPP
Sbjct  139  SYNGDLLYEPWEIYDEKGQAFTTFDAYWDKCLNMQMEP-ISFLPP  182



>dbj|BAK61519.1| cryptochrome1a [Glycine soja]
 dbj|BAK61521.1| cryptochrome1a [Glycine soja]
 dbj|BAK61523.1| cryptochrome1a [Glycine soja]
 dbj|BAK61525.1| cryptochrome1a [Glycine soja]
 dbj|BAK61527.1| cryptochrome1a [Glycine soja]
 dbj|BAK61529.1| cryptochrome1a [Glycine soja]
 dbj|BAK61531.1| cryptochrome1a [Glycine soja]
 dbj|BAK61533.1| cryptochrome1a [Glycine soja]
 dbj|BAK61535.1| cryptochrome1a [Glycine soja]
Length=119

 Score =   214 bits (545),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 99/119 (83%), Positives = 113/119 (95%), Gaps = 0/119 (0%)
 Frame = +3

Query  87   RRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSLRSLG  266
            RRDLR+EDNPAL AGVR+GA++A+F+WAPEEEG YYPGRVSRWWLK SLAHL SSLR+LG
Sbjct  1    RRDLRIEDNPALTAGVRAGAVVAVFVWAPEEEGQYYPGRVSRWWLKNSLAHLHSSLRNLG  60

Query  267  TTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVRSFN  443
            T LITKRSTD++SSL+EV+KSTGA+ LFFNHLYDPLSLVRDHRAKE+LTAQG+TVRSFN
Sbjct  61   TPLITKRSTDTLSSLLEVVKSTGATQLFFNHLYDPLSLVRDHRAKEVLTAQGITVRSFN  119



>gb|KJB38413.1| hypothetical protein B456_006G253700 [Gossypium raimondii]
Length=440

 Score =   224 bits (572),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 99/165 (60%), Positives = 130/165 (79%), Gaps = 1/165 (1%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLR++DNPALAA  R G++  ++IW P+EE  +YPGRVSRWWLKQSLAHL+ SL
Sbjct  19   IVWFRRDLRIDDNPALAAAARDGSVFPVYIWCPKEEEQFYPGRVSRWWLKQSLAHLEQSL  78

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            +SLG  L+  ++  ++S+L++ IK+TGA+ L FNHLYDP+SLVRDH  KE L   G++VR
Sbjct  79   KSLGAELVLIKTHSTLSALLDCIKATGATKLVFNHLYDPVSLVRDHNIKEKLAEAGISVR  138

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            S+N DLLYEPWE+ D++G  FTTF A+WD+CL+M  +P    LPP
Sbjct  139  SYNGDLLYEPWEIYDEKGQAFTTFDAYWDKCLNMQMEP-ISFLPP  182



>ref|XP_004952854.1| PREDICTED: cryptochrome-1-like isoform X2 [Setaria italica]
Length=698

 Score =   230 bits (586),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 110/156 (71%), Positives = 136/156 (87%), Gaps = 2/156 (1%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRS-GAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSS  251
            +VWFRRDLRVEDNPALAA  R  G ++  ++WAPEE+G YYPGRVSRWWL QSL HLD+S
Sbjct  19   LVWFRRDLRVEDNPALAAAARKAGEVVPAYVWAPEEDGAYYPGRVSRWWLSQSLKHLDAS  78

Query  252  LRSLGTT-LITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVT  428
            LR LG + L+T+RS D+V +L+++++STGA+HLFFNHLYDPLSLVRDHR KE+LTA+G+T
Sbjct  79   LRRLGASRLVTRRSDDAVVALLDLVRSTGATHLFFNHLYDPLSLVRDHRVKELLTAEGIT  138

Query  429  VRSFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSM  536
            V+SFNSDLLYEPWEV+DD+G PFT F+ FW+RCL M
Sbjct  139  VQSFNSDLLYEPWEVLDDDGCPFTMFAPFWNRCLCM  174



>ref|XP_010104735.1| hypothetical protein L484_021422 [Morus notabilis]
 gb|EXC01785.1| hypothetical protein L484_021422 [Morus notabilis]
Length=649

 Score =   229 bits (583),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 100/165 (61%), Positives = 131/165 (79%), Gaps = 1/165 (1%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLR+EDNPALAA  + G+I+ ++IW P+EEG +YPGRVSRWWLKQSLAHL+ SL
Sbjct  8    IVWFRRDLRIEDNPALAAAAKEGSILPVYIWCPKEEGQFYPGRVSRWWLKQSLAHLEQSL  67

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            +SLG  L+  ++  ++ +L+E IK+TGA+ + FNHLYDP+SLVRDH  KE L   G++V+
Sbjct  68   KSLGAELVLIKTQSTLEALLECIKATGATKVVFNHLYDPVSLVRDHNVKEKLVELGISVQ  127

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            S+N DLL+EPWEV DD+G  FTTF A+W++C  MP +P   LLPP
Sbjct  128  SYNGDLLFEPWEVYDDKGLAFTTFEAYWEKCFQMPMEP-VSLLPP  171



>ref|XP_004952853.1| PREDICTED: cryptochrome-1-like isoform X1 [Setaria italica]
Length=706

 Score =   229 bits (585),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 110/156 (71%), Positives = 136/156 (87%), Gaps = 2/156 (1%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRS-GAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSS  251
            +VWFRRDLRVEDNPALAA  R  G ++  ++WAPEE+G YYPGRVSRWWL QSL HLD+S
Sbjct  19   LVWFRRDLRVEDNPALAAAARKAGEVVPAYVWAPEEDGAYYPGRVSRWWLSQSLKHLDAS  78

Query  252  LRSLGTT-LITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVT  428
            LR LG + L+T+RS D+V +L+++++STGA+HLFFNHLYDPLSLVRDHR KE+LTA+G+T
Sbjct  79   LRRLGASRLVTRRSDDAVVALLDLVRSTGATHLFFNHLYDPLSLVRDHRVKELLTAEGIT  138

Query  429  VRSFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSM  536
            V+SFNSDLLYEPWEV+DD+G PFT F+ FW+RCL M
Sbjct  139  VQSFNSDLLYEPWEVLDDDGCPFTMFAPFWNRCLCM  174



>dbj|BAA32809.1| blue-light photoreceptor [Adiantum capillus-veneris]
 dbj|BAA32812.1| blue-light photoreceptor [Adiantum capillus-veneris]
Length=718

 Score =   229 bits (585),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 106/165 (64%), Positives = 138/165 (84%), Gaps = 0/165 (0%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            +VWFRRDLR+EDNPALAA  R+GA++ +FIW+P+EEG + PGRVSRWWLKQSL  LD SL
Sbjct  7    VVWFRRDLRLEDNPALAAAARAGAVVPVFIWSPDEEGQFRPGRVSRWWLKQSLIQLDISL  66

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            RSLG +L+   + D+VS+L+E++K+TGAS + +NHLYDP+SLVRDHR K+ L   G+ V+
Sbjct  67   RSLGVSLVMINANDTVSALLELVKTTGASQVVYNHLYDPVSLVRDHRVKQSLVQNGIQVQ  126

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            SFN DLLYEPWEV+DD G PFT F ++W +CL+MP++PE+PLLPP
Sbjct  127  SFNGDLLYEPWEVLDDHGKPFTYFESYWAKCLTMPFEPESPLLPP  171



>gb|AAV97867.1| cryptochrome 2 [Sorghum bicolor]
Length=690

 Score =   229 bits (584),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 107/159 (67%), Positives = 136/159 (86%), Gaps = 2/159 (1%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGA-IIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSS  251
            +VWFRRDLRVEDNPALAA  R+G  ++  ++W+PEEEG YYPGRVSRWW+ QSL  LD+S
Sbjct  18   VVWFRRDLRVEDNPALAAAARAGGEVVPAYVWSPEEEGPYYPGRVSRWWISQSLKRLDAS  77

Query  252  LRSLGT-TLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVT  428
            LR LG   L+T+RS D+V +L+++++ TGA+H++FNHLYDP+SLVRDHR KE+L A+G+ 
Sbjct  78   LRRLGAGKLVTRRSADAVVALLQLVRDTGATHVYFNHLYDPISLVRDHRLKEMLAAEGIV  137

Query  429  VRSFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYD  545
            V+SFN+DLLYEPWEVVDDEG PFT F+AFW+RCLSM YD
Sbjct  138  VQSFNADLLYEPWEVVDDEGQPFTMFTAFWNRCLSMQYD  176



>dbj|BAB70686.1| cryptochrome 1a [Oryza sativa Japonica Group]
Length=710

 Score =   229 bits (585),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 110/156 (71%), Positives = 135/156 (87%), Gaps = 2/156 (1%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRS-GAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSS  251
            +VWFRRDLRVEDNPALAA  R+ G ++ +++WAPEE+G YYPGRVSRWWL QSL HLD+S
Sbjct  21   VVWFRRDLRVEDNPALAAAARAAGEVVPVYVWAPEEDGPYYPGRVSRWWLSQSLKHLDAS  80

Query  252  LRSLGTT-LITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVT  428
            LR LG + L+T+RS D+V +LIE+++S GA+HLFFNHLYDPLSLVRDHR K +LTA+G+ 
Sbjct  81   LRRLGASRLVTRRSADAVVALIELVRSIGATHLFFNHLYDPLSLVRDHRVKALLTAEGIA  140

Query  429  VRSFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSM  536
            V+SFN+DLLYEPWEVVDD+G PFT F+ FWDRCL M
Sbjct  141  VQSFNADLLYEPWEVVDDDGCPFTMFAPFWDRCLCM  176



>gb|AAN37909.1| cryptochrome 2 apoprotein [Sorghum bicolor]
Length=691

 Score =   229 bits (583),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 107/159 (67%), Positives = 136/159 (86%), Gaps = 2/159 (1%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGA-IIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSS  251
            +VWFRRDLRVEDNPALAA  R+G  ++  ++W+PEEEG YYPGRVSRWW+ QSL HLD+S
Sbjct  19   VVWFRRDLRVEDNPALAAAARAGGEVVPAYVWSPEEEGPYYPGRVSRWWISQSLKHLDAS  78

Query  252  LRSLGT-TLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVT  428
            LR LG   L+T+RS D+V +L+++++ TGA+H++FNHLYDP+SLVRDHR KE+L A+G+ 
Sbjct  79   LRRLGAGKLVTRRSADAVVALLQLVRDTGATHVYFNHLYDPISLVRDHRLKEMLAAEGIV  138

Query  429  VRSFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYD  545
            V+SFN+DLLYEPWEVVDDE  PFT F+AFW+RCLSM YD
Sbjct  139  VQSFNADLLYEPWEVVDDERQPFTMFTAFWNRCLSMQYD  177



>ref|NP_001047200.1| Os02g0573200 [Oryza sativa Japonica Group]
 dbj|BAD17529.1| cryptochrome 1a [Oryza sativa Japonica Group]
 dbj|BAF09114.1| Os02g0573200 [Oryza sativa Japonica Group]
Length=718

 Score =   229 bits (584),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 110/156 (71%), Positives = 135/156 (87%), Gaps = 2/156 (1%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRS-GAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSS  251
            +VWFRRDLRVEDNPALAA  R+ G ++ +++WAPEE+G YYPGRVSRWWL QSL HLD+S
Sbjct  21   VVWFRRDLRVEDNPALAAAARAAGEVVPVYVWAPEEDGPYYPGRVSRWWLSQSLKHLDAS  80

Query  252  LRSLGTT-LITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVT  428
            LR LG + L+T+RS D+V +LIE+++S GA+HLFFNHLYDPLSLVRDHR K +LTA+G+ 
Sbjct  81   LRRLGASRLVTRRSADAVVALIELVRSIGATHLFFNHLYDPLSLVRDHRVKALLTAEGIA  140

Query  429  VRSFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSM  536
            V+SFN+DLLYEPWEVVDD+G PFT F+ FWDRCL M
Sbjct  141  VQSFNADLLYEPWEVVDDDGCPFTMFAPFWDRCLCM  176



>gb|KJB38414.1| hypothetical protein B456_006G253700 [Gossypium raimondii]
Length=559

 Score =   226 bits (575),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 99/165 (60%), Positives = 130/165 (79%), Gaps = 1/165 (1%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLR++DNPALAA  R G++  ++IW P+EE  +YPGRVSRWWLKQSLAHL+ SL
Sbjct  19   IVWFRRDLRIDDNPALAAAARDGSVFPVYIWCPKEEEQFYPGRVSRWWLKQSLAHLEQSL  78

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            +SLG  L+  ++  ++S+L++ IK+TGA+ L FNHLYDP+SLVRDH  KE L   G++VR
Sbjct  79   KSLGAELVLIKTHSTLSALLDCIKATGATKLVFNHLYDPVSLVRDHNIKEKLAEAGISVR  138

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            S+N DLLYEPWE+ D++G  FTTF A+WD+CL+M  +P    LPP
Sbjct  139  SYNGDLLYEPWEIYDEKGQAFTTFDAYWDKCLNMQMEP-ISFLPP  182



>dbj|BAP76063.1| putative CRY2 [Cryptomeria japonica]
Length=696

 Score =   228 bits (581),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 101/166 (61%), Positives = 133/166 (80%), Gaps = 1/166 (1%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSG-AIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSS  251
            IVWFRRDLR+EDNPAL A  R G +++ ++IW P EE  ++PGRVSRWWLK SL HLD S
Sbjct  5    IVWFRRDLRLEDNPALVAAARGGGSVVPVYIWCPNEEAQFHPGRVSRWWLKMSLMHLDQS  64

Query  252  LRSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTV  431
            LR+LG  L+  R+TD++S+L+ +I+STGA+ LF+N LYDP+SLVRDH+ K+ L  +G  V
Sbjct  65   LRALGVPLLILRTTDTLSALLNLIQSTGATQLFYNRLYDPISLVRDHKLKQQLIEKGYFV  124

Query  432  RSFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
             +FN DLLYE W+V D+ G+ FT F+AFW++CL+MP+DPEAPLLPP
Sbjct  125  FNFNGDLLYESWQVYDENGNAFTRFNAFWEKCLNMPFDPEAPLLPP  170



>gb|AAO23971.1| cryptochrome 2A [Pisum sativum]
Length=375

 Score =   220 bits (561),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 97/165 (59%), Positives = 127/165 (77%), Gaps = 1/165 (1%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLR+EDNPALAA  R G++  +FIW P+EEG +YPGRVSRWWLKQSLAHLD SL
Sbjct  7    IVWFRRDLRIEDNPALAAAARDGSVFPVFIWCPKEEGQFYPGRVSRWWLKQSLAHLDQSL  66

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            +SLG  L+  ++  ++++L+E + +  A+ + FNHLYDP+SLVRDH  KE L   G++V+
Sbjct  67   KSLGAKLVLIKTDSTLNALLECVNAIQATKVVFNHLYDPVSLVRDHNIKEKLVELGISVK  126

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            S+N DLLYEPWE+ D++GH FTTF  FW+RCL    +P   L+PP
Sbjct  127  SYNGDLLYEPWELYDEKGHAFTTFDPFWERCLHKQMEP-VSLIPP  170



>gb|AGV77084.1| CRY2 [Picea abies]
Length=687

 Score =   226 bits (577),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 103/167 (62%), Positives = 131/167 (78%), Gaps = 2/167 (1%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRS-GAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSS  251
            IVWFRRDLRVEDNPAL    R  G +I L+IW P+EEG +YPGRVSRWWLKQSL HL  S
Sbjct  11   IVWFRRDLRVEDNPALTNAARGDGTVIPLYIWCPKEEGEFYPGRVSRWWLKQSLIHLHHS  70

Query  252  LRSLGTTLIT-KRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVT  428
            L++LG+ L+  K    ++S+L++  +STGA+ +F+NHLYDP+SLVRDH+ K+ L   G T
Sbjct  71   LQALGSPLVMIKAQQTTLSALLDCCRSTGATRIFYNHLYDPVSLVRDHKLKQKLLELGFT  130

Query  429  VRSFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            V+SFN+DLLYEPWE+ DD+G  FTTF  +W +CL MP++PEAPLLPP
Sbjct  131  VQSFNADLLYEPWEIYDDKGQAFTTFDPYWRKCLKMPFEPEAPLLPP  177



>ref|XP_010556906.1| PREDICTED: cryptochrome-1 isoform X2 [Tarenaya hassleriana]
Length=622

 Score =   225 bits (574),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 98/165 (59%), Positives = 129/165 (78%), Gaps = 1/165 (1%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLR+EDNPALAA  + G +  +FIW PEEEG +YPGR SRWWLKQSL+HL  SL
Sbjct  8    IVWFRRDLRIEDNPALAAAAQEGRVFPVFIWCPEEEGQFYPGRASRWWLKQSLSHLGHSL  67

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            +SLG  L+  +S +++SS+++ +++TGA+ + FNHLYDP+SLVRDH  KE L   G++V+
Sbjct  68   KSLGAELVLIKSHNTISSILDCVRATGATKVVFNHLYDPISLVRDHTVKEKLGEHGISVQ  127

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            S+N DLLYEPWE+ D+ G PFTTFS +W +CL+MP +   PL PP
Sbjct  128  SYNGDLLYEPWEIYDERGQPFTTFSFYWKKCLNMPME-SVPLPPP  171



>dbj|BAK61600.1| cryptochrome2c [Glycine soja]
 dbj|BAK61602.1| cryptochrome2c [Glycine soja]
 dbj|BAK61604.1| cryptochrome2c [Glycine soja]
Length=413

 Score =   220 bits (560),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 97/165 (59%), Positives = 129/165 (78%), Gaps = 1/165 (1%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLR+EDNPALAA  + G+++ ++IW P+EEG +YPGRVSRWWLKQSLAHLD SL
Sbjct  7    IVWFRRDLRIEDNPALAAAAKEGSVLPVYIWCPKEEGQFYPGRVSRWWLKQSLAHLDQSL  66

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            +SLG+ L+  ++  +V++L+E +K+  A+ + FNHLYDP+SLVRDH  KE L  QG++V+
Sbjct  67   KSLGSRLVLIKTHSTVTALVECVKAIQATKVVFNHLYDPVSLVRDHNIKEKLVEQGISVQ  126

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            S+N DLLYEPWEV  + G  FTTF+AFW +CL M  D    ++PP
Sbjct  127  SYNGDLLYEPWEVYSESGRAFTTFNAFWKKCLHMQMDI-VSVVPP  170



>gb|KJB38410.1| hypothetical protein B456_006G253700 [Gossypium raimondii]
 gb|KJB38411.1| hypothetical protein B456_006G253700 [Gossypium raimondii]
Length=655

 Score =   225 bits (574),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 99/165 (60%), Positives = 130/165 (79%), Gaps = 1/165 (1%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLR++DNPALAA  R G++  ++IW P+EE  +YPGRVSRWWLKQSLAHL+ SL
Sbjct  19   IVWFRRDLRIDDNPALAAAARDGSVFPVYIWCPKEEEQFYPGRVSRWWLKQSLAHLEQSL  78

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            +SLG  L+  ++  ++S+L++ IK+TGA+ L FNHLYDP+SLVRDH  KE L   G++VR
Sbjct  79   KSLGAELVLIKTHSTLSALLDCIKATGATKLVFNHLYDPVSLVRDHNIKEKLAEAGISVR  138

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            S+N DLLYEPWE+ D++G  FTTF A+WD+CL+M  +P    LPP
Sbjct  139  SYNGDLLYEPWEIYDEKGQAFTTFDAYWDKCLNMQMEP-ISFLPP  182



>dbj|BAK61603.1| cryptochrome2c [Glycine soja]
Length=413

 Score =   220 bits (560),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 97/165 (59%), Positives = 129/165 (78%), Gaps = 1/165 (1%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLR+EDNPALAA  + G+++ ++IW P+EEG +YPGRVSRWWLKQSLAHLD SL
Sbjct  7    IVWFRRDLRIEDNPALAAAAKEGSVLPVYIWCPKEEGQFYPGRVSRWWLKQSLAHLDQSL  66

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            +SLG+ L+  ++  +V++L+E +K+  A+ + FNHLYDP+SLVRDH  KE L  QG++V+
Sbjct  67   KSLGSRLVLIKTHSTVTALVECVKAIQATKVVFNHLYDPVSLVRDHNIKEKLVEQGISVQ  126

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            S+N DLLYEPWEV  + G  FTTF+AFW +CL M  D    ++PP
Sbjct  127  SYNGDLLYEPWEVYSESGRAFTTFNAFWKKCLHMQMDI-VSVVPP  170



>ref|XP_010556905.1| PREDICTED: cryptochrome-1 isoform X1 [Tarenaya hassleriana]
Length=624

 Score =   225 bits (573),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 98/165 (59%), Positives = 129/165 (78%), Gaps = 1/165 (1%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLR+EDNPALAA  + G +  +FIW PEEEG +YPGR SRWWLKQSL+HL  SL
Sbjct  8    IVWFRRDLRIEDNPALAAAAQEGRVFPVFIWCPEEEGQFYPGRASRWWLKQSLSHLGHSL  67

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            +SLG  L+  +S +++SS+++ +++TGA+ + FNHLYDP+SLVRDH  KE L   G++V+
Sbjct  68   KSLGAELVLIKSHNTISSILDCVRATGATKVVFNHLYDPISLVRDHTVKEKLGEHGISVQ  127

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            S+N DLLYEPWE+ D+ G PFTTFS +W +CL+MP +   PL PP
Sbjct  128  SYNGDLLYEPWEIYDERGQPFTTFSFYWKKCLNMPME-SVPLPPP  171



>ref|XP_010671035.1| PREDICTED: cryptochrome-1 [Beta vulgaris subsp. vulgaris]
Length=632

 Score =   225 bits (573),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 98/158 (62%), Positives = 123/158 (78%), Gaps = 0/158 (0%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLR+EDNPALAA  R G+I  +FIW P+EEG +YPGRVSRWWLK+SL HLD SL
Sbjct  8    IVWFRRDLRIEDNPALAAAARDGSIFPVFIWCPKEEGQFYPGRVSRWWLKESLVHLDQSL  67

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            RSLG  L+  ++ +++ ++ E I +TGA+ + FN LYDP+SLVRDH  K+ L  Q + V 
Sbjct  68   RSLGVELVLIKAENTLDAMFECINATGATKVVFNRLYDPVSLVRDHNIKQKLGEQNIAVH  127

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDP  548
            S+N DLLYEPWEV D++GH FTTF+ FWD+CLSM  DP
Sbjct  128  SYNGDLLYEPWEVYDEKGHAFTTFAPFWDKCLSMQLDP  165



>dbj|BAK61601.1| cryptochrome2c [Glycine soja]
Length=413

 Score =   219 bits (559),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 97/165 (59%), Positives = 129/165 (78%), Gaps = 1/165 (1%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLR+EDNPALAA  + G+++ ++IW P+EEG +YPGRVSRWWLKQSLAHLD SL
Sbjct  7    IVWFRRDLRIEDNPALAAAAKEGSVLPVYIWCPKEEGQFYPGRVSRWWLKQSLAHLDQSL  66

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            +SLG+ L+  ++  +V++L+E +K+  A+ + FNHLYDP+SLVRDH  KE L  QG++V+
Sbjct  67   KSLGSRLVLIKTHSTVTALVECVKAIQATKVVFNHLYDPVSLVRDHNIKEKLVEQGISVQ  126

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            S+N DLLYEPWEV  + G  FTTF+AFW +CL M  D    ++PP
Sbjct  127  SYNGDLLYEPWEVYSESGRAFTTFNAFWKKCLHMQMDI-VSVVPP  170



>ref|XP_011030501.1| PREDICTED: cryptochrome-1 isoform X2 [Populus euphratica]
Length=644

 Score =   224 bits (572),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 98/164 (60%), Positives = 127/164 (77%), Gaps = 0/164 (0%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLR+EDNPALAA  R G +  +FIW P+EEG +YPGRVSRWWLKQSLAHL  SL
Sbjct  7    IVWFRRDLRIEDNPALAAAARDGCVFPVFIWCPKEEGQFYPGRVSRWWLKQSLAHLGQSL  66

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            +SLG  L+  ++  +V++L++ I++ GA+ + FNHLYDP+SLVRDH  KE L   G++V+
Sbjct  67   KSLGAELVLIKTHSTVAALLDCIETIGATRVVFNHLYDPVSLVRDHNIKEKLVELGISVQ  126

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLP  566
            S+N DLLYEPWE+ D+ GH FTTF A+WD+CL M  +P + L P
Sbjct  127  SYNGDLLYEPWEIYDERGHAFTTFEAYWDKCLHMQMEPVSHLPP  170



>ref|XP_011030500.1| PREDICTED: cryptochrome-1 isoform X1 [Populus euphratica]
Length=646

 Score =   224 bits (572),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 98/164 (60%), Positives = 127/164 (77%), Gaps = 0/164 (0%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLR+EDNPALAA  R G +  +FIW P+EEG +YPGRVSRWWLKQSLAHL  SL
Sbjct  7    IVWFRRDLRIEDNPALAAAARDGCVFPVFIWCPKEEGQFYPGRVSRWWLKQSLAHLGQSL  66

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            +SLG  L+  ++  +V++L++ I++ GA+ + FNHLYDP+SLVRDH  KE L   G++V+
Sbjct  67   KSLGAELVLIKTHSTVAALLDCIETIGATRVVFNHLYDPVSLVRDHNIKEKLVELGISVQ  126

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLP  566
            S+N DLLYEPWE+ D+ GH FTTF A+WD+CL M  +P + L P
Sbjct  127  SYNGDLLYEPWEIYDERGHAFTTFEAYWDKCLHMQMEPVSHLPP  170



>ref|XP_004975808.1| PREDICTED: cryptochrome-1-like isoform X1 [Setaria italica]
Length=716

 Score =   226 bits (575),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 105/156 (67%), Positives = 135/156 (87%), Gaps = 2/156 (1%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGA-IIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSS  251
            +VWFRRDLRVEDNPALAA  R+G  ++  ++W+PEE+G YYPGRVSRWW+ QSL HLD+S
Sbjct  19   VVWFRRDLRVEDNPALAAAARAGGEVVPAYVWSPEEDGPYYPGRVSRWWISQSLQHLDAS  78

Query  252  LRSLGT-TLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVT  428
            LR LG   L+T+RS D+V +L+++++ TGA+H++FNHLYDP+SLVRDHR KE+LTA+G+ 
Sbjct  79   LRRLGAGKLVTRRSDDAVVALLQLVRDTGATHVYFNHLYDPISLVRDHRLKEMLTAEGIV  138

Query  429  VRSFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSM  536
            V+SFN+DLLYEPWEVVDDEG PFT F+ FW+RCLSM
Sbjct  139  VQSFNADLLYEPWEVVDDEGQPFTMFAPFWNRCLSM  174



>ref|XP_004975809.1| PREDICTED: cryptochrome-1-like isoform X2 [Setaria italica]
Length=689

 Score =   225 bits (574),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 105/156 (67%), Positives = 135/156 (87%), Gaps = 2/156 (1%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGA-IIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSS  251
            +VWFRRDLRVEDNPALAA  R+G  ++  ++W+PEE+G YYPGRVSRWW+ QSL HLD+S
Sbjct  19   VVWFRRDLRVEDNPALAAAARAGGEVVPAYVWSPEEDGPYYPGRVSRWWISQSLQHLDAS  78

Query  252  LRSLGT-TLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVT  428
            LR LG   L+T+RS D+V +L+++++ TGA+H++FNHLYDP+SLVRDHR KE+LTA+G+ 
Sbjct  79   LRRLGAGKLVTRRSDDAVVALLQLVRDTGATHVYFNHLYDPISLVRDHRLKEMLTAEGIV  138

Query  429  VRSFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSM  536
            V+SFN+DLLYEPWEVVDDEG PFT F+ FW+RCLSM
Sbjct  139  VQSFNADLLYEPWEVVDDEGQPFTMFAPFWNRCLSM  174



>ref|NP_001183937.1| cryptochrome 2 [Zea mays]
 gb|ACV66337.1| cryptochrome 2 [Zea mays]
Length=643

 Score =   223 bits (568),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 107/156 (69%), Positives = 135/156 (87%), Gaps = 2/156 (1%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRS-GAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSS  251
            +VWFRRDLRVEDNPALAA  R+ G ++  ++W+PEE+G YYPGRVSRWWL QSL HLD+S
Sbjct  19   VVWFRRDLRVEDNPALAAAARTAGEVVPAYVWSPEEDGPYYPGRVSRWWLSQSLKHLDAS  78

Query  252  LRSLGTT-LITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVT  428
            LR LG   L+T+RS+D+V +LI++++STGA+HLFFN LYDPLSLVRDHR KE L+A+G+T
Sbjct  79   LRRLGACRLVTRRSSDAVVALIDLVRSTGATHLFFNRLYDPLSLVRDHRVKEQLSAEGIT  138

Query  429  VRSFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSM  536
            V+SFN+DLLYEPWEV+DD+G PFT F+ FW+RCL M
Sbjct  139  VQSFNADLLYEPWEVLDDDGFPFTMFAPFWNRCLCM  174



>gb|KHG08367.1| Cryptochrome-2 -like protein [Gossypium arboreum]
 gb|KHG11572.1| Cryptochrome-2 -like protein [Gossypium arboreum]
Length=644

 Score =   223 bits (567),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 98/165 (59%), Positives = 131/165 (79%), Gaps = 1/165 (1%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLR++DNPALAA  R G++  ++IW P+EE  +YPGRVSRWWLKQSLAHL+ SL
Sbjct  8    IVWFRRDLRIDDNPALAAAARDGSVFPVYIWCPKEEEQFYPGRVSRWWLKQSLAHLEQSL  67

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            + LG+ L+  ++  ++S+L++ IK+TGA+ L FNHLYDP+SLVRDH  KE L   G++V+
Sbjct  68   KFLGSELVLIKTHSTLSALLDCIKATGATKLVFNHLYDPVSLVRDHNIKEKLAEAGISVQ  127

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            S+N DLLYEPWE+ D++G  FTTF A+WD+CL+M  +P   LLPP
Sbjct  128  SYNGDLLYEPWEIYDEKGQAFTTFDAYWDKCLNMQMEP-ISLLPP  171



>ref|XP_010920468.1| PREDICTED: cryptochrome-1 isoform X1 [Elaeis guineensis]
 ref|XP_010920469.1| PREDICTED: cryptochrome-1 isoform X1 [Elaeis guineensis]
 ref|XP_010920470.1| PREDICTED: cryptochrome-1 isoform X1 [Elaeis guineensis]
Length=669

 Score =   223 bits (568),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 97/164 (59%), Positives = 127/164 (77%), Gaps = 0/164 (0%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLR+EDNPALAA  +   ++ +FIW P EE  +YPGRVSRWWLKQ+LAHLD SL
Sbjct  10   IVWFRRDLRIEDNPALAAASKDACVLPVFIWCPSEEEQFYPGRVSRWWLKQTLAHLDQSL  69

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            RSLG  L+  R+  +++SL++ + S GA+ + +NHLYDP+SL+RDH+ K  L   G++V+
Sbjct  70   RSLGAPLVLIRAESTLASLLQCVGSIGATRVVYNHLYDPVSLIRDHKIKNQLVDLGISVQ  129

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLP  566
            SFN DLLYEPWEV D+ GH FTTF+A+WD+C+S+P D   PL P
Sbjct  130  SFNGDLLYEPWEVYDENGHAFTTFNAYWDKCMSLPIDLTLPLPP  173



>ref|XP_008677764.1| PREDICTED: cryptochrome 2 isoform X2 [Zea mays]
Length=699

 Score =   223 bits (569),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 107/156 (69%), Positives = 135/156 (87%), Gaps = 2/156 (1%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRS-GAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSS  251
            +VWFRRDLRVEDNPALAA  R+ G ++  ++W+PEE+G YYPGRVSRWWL QSL HLD+S
Sbjct  19   VVWFRRDLRVEDNPALAAAARTAGEVVPAYVWSPEEDGPYYPGRVSRWWLSQSLKHLDAS  78

Query  252  LRSLGTT-LITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVT  428
            LR LG   L+T+RS+D+V +LI++++STGA+HLFFN LYDPLSLVRDHR KE L+A+G+T
Sbjct  79   LRRLGACRLVTRRSSDAVVALIDLVRSTGATHLFFNRLYDPLSLVRDHRVKEQLSAEGIT  138

Query  429  VRSFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSM  536
            V+SFN+DLLYEPWEV+DD+G PFT F+ FW+RCL M
Sbjct  139  VQSFNADLLYEPWEVLDDDGFPFTMFAPFWNRCLCM  174



>ref|XP_010920471.1| PREDICTED: cryptochrome-1 isoform X2 [Elaeis guineensis]
Length=667

 Score =   223 bits (568),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 97/164 (59%), Positives = 127/164 (77%), Gaps = 0/164 (0%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLR+EDNPALAA  +   ++ +FIW P EE  +YPGRVSRWWLKQ+LAHLD SL
Sbjct  10   IVWFRRDLRIEDNPALAAASKDACVLPVFIWCPSEEEQFYPGRVSRWWLKQTLAHLDQSL  69

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            RSLG  L+  R+  +++SL++ + S GA+ + +NHLYDP+SL+RDH+ K  L   G++V+
Sbjct  70   RSLGAPLVLIRAESTLASLLQCVGSIGATRVVYNHLYDPVSLIRDHKIKNQLVDLGISVQ  129

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLP  566
            SFN DLLYEPWEV D+ GH FTTF+A+WD+C+S+P D   PL P
Sbjct  130  SFNGDLLYEPWEVYDENGHAFTTFNAYWDKCMSLPIDLTLPLPP  173



>ref|XP_008677763.1| PREDICTED: cryptochrome 2 isoform X1 [Zea mays]
 gb|AFW62703.1| cryptochrome 2 [Zea mays]
Length=707

 Score =   223 bits (568),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 107/156 (69%), Positives = 135/156 (87%), Gaps = 2/156 (1%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRS-GAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSS  251
            +VWFRRDLRVEDNPALAA  R+ G ++  ++W+PEE+G YYPGRVSRWWL QSL HLD+S
Sbjct  19   VVWFRRDLRVEDNPALAAAARTAGEVVPAYVWSPEEDGPYYPGRVSRWWLSQSLKHLDAS  78

Query  252  LRSLGTT-LITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVT  428
            LR LG   L+T+RS+D+V +LI++++STGA+HLFFN LYDPLSLVRDHR KE L+A+G+T
Sbjct  79   LRRLGACRLVTRRSSDAVVALIDLVRSTGATHLFFNRLYDPLSLVRDHRVKEQLSAEGIT  138

Query  429  VRSFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSM  536
            V+SFN+DLLYEPWEV+DD+G PFT F+ FW+RCL M
Sbjct  139  VQSFNADLLYEPWEVLDDDGFPFTMFAPFWNRCLCM  174



>ref|XP_006846831.1| hypothetical protein AMTR_s00148p00098440 [Amborella trichopoda]
 gb|ERN08412.1| hypothetical protein AMTR_s00148p00098440 [Amborella trichopoda]
Length=650

 Score =   222 bits (566),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 99/165 (60%), Positives = 126/165 (76%), Gaps = 1/165 (1%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLR+EDNPALA   R G ++ ++IW P+EEG +YPGRVSRWWLKQSL HLD SL
Sbjct  8    IVWFRRDLRIEDNPALAQAARVGCVLPVYIWCPKEEGQFYPGRVSRWWLKQSLVHLDQSL  67

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            RSLG  L+  ++ D++S+L+  I + GA+ + +NHLYDP+SLVRDH  K+ L  QG+ V+
Sbjct  68   RSLGAPLLLIKTEDTLSALLRCISAIGATQVVYNHLYDPVSLVRDHCVKQKLVEQGIIVQ  127

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            S N DLLYEPWEV DDEG  FTTF  +W++C+SM  +P   LLPP
Sbjct  128  SLNGDLLYEPWEVYDDEGLAFTTFDEYWNKCISMSVEP-VCLLPP  171



>ref|XP_010483734.1| PREDICTED: cryptochrome-2 [Camelina sativa]
 ref|XP_010483742.1| PREDICTED: cryptochrome-2 [Camelina sativa]
Length=614

 Score =   221 bits (563),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 96/165 (58%), Positives = 130/165 (79%), Gaps = 2/165 (1%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLR+EDNPALAA    G++  +FIW PEEEG +YPGR SRWW+KQSLAHL  SL
Sbjct  8    IVWFRRDLRIEDNPALAAAAHEGSVFPVFIWCPEEEGQFYPGRASRWWMKQSLAHLSQSL  67

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            ++LG+ L   ++ ++VS++++ I+ TGA+ + FNHLYDP+SLVRDH  KE L  +G++V+
Sbjct  68   KALGSDLTLIKTHNTVSAILDCIRVTGATKVVFNHLYDPVSLVRDHTVKEKLVERGISVQ  127

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            S+N DLLYEPWE+  D+G PFT+FS++W +CL MP   E+ +LPP
Sbjct  128  SYNGDLLYEPWEIYCDKGKPFTSFSSYWKKCLDMPI--ESVMLPP  170



>ref|XP_010457482.1| PREDICTED: cryptochrome-2-like [Camelina sativa]
 ref|XP_010457483.1| PREDICTED: cryptochrome-2-like [Camelina sativa]
Length=613

 Score =   221 bits (563),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 96/165 (58%), Positives = 130/165 (79%), Gaps = 2/165 (1%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLR+EDNPALAA    G++  +FIW PEEEG +YPGR SRWW+KQSLAHL  SL
Sbjct  8    IVWFRRDLRIEDNPALAAAAHEGSVFPVFIWCPEEEGQFYPGRASRWWMKQSLAHLSQSL  67

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            ++LG+ L   ++ ++VS++++ I+ TGA+ + FNHLYDP+SLVRDH  KE L  +G++V+
Sbjct  68   KALGSDLTLIKTHNTVSAILDCIRVTGATKVVFNHLYDPVSLVRDHTVKEKLVERGISVQ  127

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            S+N DLLYEPWE+  D+G PFT+FS++W +CL MP   E+ +LPP
Sbjct  128  SYNGDLLYEPWEIYCDKGKPFTSFSSYWKKCLDMPI--ESVMLPP  170



>ref|XP_010475095.1| PREDICTED: cryptochrome-2-like isoform X2 [Camelina sativa]
Length=613

 Score =   221 bits (563),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 96/165 (58%), Positives = 130/165 (79%), Gaps = 2/165 (1%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLR+EDNPALAA    G++  +FIW PEEEG +YPGR SRWW+KQSLAHL  SL
Sbjct  8    IVWFRRDLRIEDNPALAAAAHEGSVFPVFIWCPEEEGQFYPGRASRWWMKQSLAHLSQSL  67

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            ++LG+ L   ++ ++VS++++ I+ TGA+ + FNHLYDP+SLVRDH  KE L  +G++V+
Sbjct  68   KALGSDLTLIKTHNTVSAILDCIRVTGATKVVFNHLYDPVSLVRDHTVKEKLVERGISVQ  127

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            S+N DLLYEPWE+  D+G PFT+FS++W +CL MP   E+ +LPP
Sbjct  128  SYNGDLLYEPWEIYCDKGKPFTSFSSYWKKCLDMPI--ESVMLPP  170



>ref|XP_011091317.1| PREDICTED: cryptochrome-1 [Sesamum indicum]
Length=658

 Score =   222 bits (565),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 96/164 (59%), Positives = 128/164 (78%), Gaps = 0/164 (0%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLR+EDNPALAA  R G+++ +FIW P+EEG Y+PGRVSRWWLK SL HL  SL
Sbjct  8    IVWFRRDLRIEDNPALAAAARDGSLLPVFIWCPKEEGQYFPGRVSRWWLKHSLKHLQQSL  67

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            +SLG  LI  ++ D++S+L++ + + GA+ + +NHLYDP+SLVRDH  K+ L   G+ V+
Sbjct  68   KSLGAELILIKAEDTLSALLDCLNAVGATKVLYNHLYDPISLVRDHNIKQKLVELGIKVQ  127

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLP  566
            S+N DLL+EPWEV DD GH FTTF+A+W++CLSM  +P + L P
Sbjct  128  SYNGDLLFEPWEVYDDNGHAFTTFNAYWEKCLSMQREPVSHLPP  171



>gb|KJB28459.1| hypothetical protein B456_005G050000 [Gossypium raimondii]
 gb|KJB28461.1| hypothetical protein B456_005G050000 [Gossypium raimondii]
 gb|KJB28463.1| hypothetical protein B456_005G050000 [Gossypium raimondii]
Length=635

 Score =   221 bits (564),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 98/165 (59%), Positives = 129/165 (78%), Gaps = 1/165 (1%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLR+EDNPALAA  R G++  ++IW PEEEG +YPGRVSRWWLKQSLAHL+ SL
Sbjct  7    IVWFRRDLRIEDNPALAAAARDGSVFPVYIWCPEEEGQFYPGRVSRWWLKQSLAHLEQSL  66

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            +SLG  L+  ++  ++S+L++ IK+T A+ +  N LYDP+SLVRDH  +E L   G++V+
Sbjct  67   KSLGAELVMIKTQSTLSALLDCIKATEATKVVVNRLYDPVSLVRDHSIEEKLAEVGISVQ  126

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            S+N DLLYEPWE+ DDEG  F+TF A+WD+CL+M  +P   LLPP
Sbjct  127  SYNGDLLYEPWEIYDDEGRAFSTFDAYWDKCLNMQMEP-VSLLPP  170



>gb|KJB28458.1| hypothetical protein B456_005G050000 [Gossypium raimondii]
 gb|KJB28460.1| hypothetical protein B456_005G050000 [Gossypium raimondii]
 gb|KJB28462.1| hypothetical protein B456_005G050000 [Gossypium raimondii]
 gb|KJB28464.1| hypothetical protein B456_005G050000 [Gossypium raimondii]
Length=637

 Score =   221 bits (564),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 98/165 (59%), Positives = 129/165 (78%), Gaps = 1/165 (1%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLR+EDNPALAA  R G++  ++IW PEEEG +YPGRVSRWWLKQSLAHL+ SL
Sbjct  7    IVWFRRDLRIEDNPALAAAARDGSVFPVYIWCPEEEGQFYPGRVSRWWLKQSLAHLEQSL  66

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            +SLG  L+  ++  ++S+L++ IK+T A+ +  N LYDP+SLVRDH  +E L   G++V+
Sbjct  67   KSLGAELVMIKTQSTLSALLDCIKATEATKVVVNRLYDPVSLVRDHSIEEKLAEVGISVQ  126

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            S+N DLLYEPWE+ DDEG  F+TF A+WD+CL+M  +P   LLPP
Sbjct  127  SYNGDLLYEPWEIYDDEGRAFSTFDAYWDKCLNMQMEP-VSLLPP  170



>gb|AAS79665.1| cryptochrome 2A apoprotein [Pisum sativum]
 gb|AAS79666.1| cryptochrome 2A apoprotein [Pisum sativum]
Length=629

 Score =   221 bits (563),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 97/165 (59%), Positives = 127/165 (77%), Gaps = 1/165 (1%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLR+EDNPALAA  R G++  +FIW P+EEG +YPGRVSRWWLKQSLAHLD SL
Sbjct  7    IVWFRRDLRIEDNPALAAAARDGSVFPVFIWCPKEEGQFYPGRVSRWWLKQSLAHLDQSL  66

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            +SLG  L+  ++  ++++L+E + +  A+ + FNHLYDP+SLVRDH  KE L   G++V+
Sbjct  67   KSLGAKLVLIKTDSTLNALLECVNAIQATKVVFNHLYDPVSLVRDHNIKEKLVELGISVK  126

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            S+N DLLYEPWE+ D++GH FTTF  FW+RCL    +P   L+PP
Sbjct  127  SYNGDLLYEPWELYDEKGHAFTTFDPFWERCLHKQMEP-VSLIPP  170



>ref|XP_010475092.1| PREDICTED: cryptochrome-2-like isoform X1 [Camelina sativa]
 ref|XP_010475093.1| PREDICTED: cryptochrome-2-like isoform X1 [Camelina sativa]
 ref|XP_010475094.1| PREDICTED: cryptochrome-2-like isoform X1 [Camelina sativa]
Length=643

 Score =   221 bits (563),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 96/165 (58%), Positives = 130/165 (79%), Gaps = 2/165 (1%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLR+EDNPALAA    G++  +FIW PEEEG +YPGR SRWW+KQSLAHL  SL
Sbjct  8    IVWFRRDLRIEDNPALAAAAHEGSVFPVFIWCPEEEGQFYPGRASRWWMKQSLAHLSQSL  67

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            ++LG+ L   ++ ++VS++++ I+ TGA+ + FNHLYDP+SLVRDH  KE L  +G++V+
Sbjct  68   KALGSDLTLIKTHNTVSAILDCIRVTGATKVVFNHLYDPVSLVRDHTVKEKLVERGISVQ  127

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            S+N DLLYEPWE+  D+G PFT+FS++W +CL MP   E+ +LPP
Sbjct  128  SYNGDLLYEPWEIYCDKGKPFTSFSSYWKKCLDMPI--ESVMLPP  170



>gb|KHN05061.1| Cryptochrome-2 [Glycine soja]
Length=634

 Score =   221 bits (562),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 95/157 (61%), Positives = 125/157 (80%), Gaps = 0/157 (0%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLR+EDNPALAA  + G+++ ++IW P+EEG +YPGRVSRWWLKQSLAHLD SL
Sbjct  7    IVWFRRDLRIEDNPALAAAAKEGSVLPVYIWCPKEEGQFYPGRVSRWWLKQSLAHLDQSL  66

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            +SLG+ L+  ++  +V++L+E +K+  A+ + FNHLYDP+SLVRDH  KE L  QG++V+
Sbjct  67   KSLGSRLVLIKTHSTVTALVECVKAIQATKVVFNHLYDPVSLVRDHNIKEKLVEQGISVQ  126

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYD  545
            S+N DLLYEPWEV  + G  FTTF+AFW +CL M  D
Sbjct  127  SYNGDLLYEPWEVYSESGRAFTTFNAFWKKCLHMQMD  163



>ref|XP_008791585.1| PREDICTED: cryptochrome-1 [Phoenix dactylifera]
 ref|XP_008791587.1| PREDICTED: cryptochrome-1 [Phoenix dactylifera]
 ref|XP_008791588.1| PREDICTED: cryptochrome-1 [Phoenix dactylifera]
 ref|XP_008791589.1| PREDICTED: cryptochrome-1 [Phoenix dactylifera]
 ref|XP_008791590.1| PREDICTED: cryptochrome-1 [Phoenix dactylifera]
Length=667

 Score =   221 bits (564),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 96/164 (59%), Positives = 127/164 (77%), Gaps = 0/164 (0%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            +VWFRRDLR+EDNPALAA  +   ++ +FIW P EEG +YPGRVSRWWLKQSLAHLD SL
Sbjct  8    VVWFRRDLRIEDNPALAAASKDACVLPVFIWCPGEEGQFYPGRVSRWWLKQSLAHLDRSL  67

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            RSLG  L+  R+  +++SL++ I + GA+ + +NHLYDP+SL+RDH+ K  L   G++V+
Sbjct  68   RSLGAPLVLIRAESTLASLLQCIGAIGATRVVYNHLYDPVSLIRDHKIKNELADLGISVQ  127

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLP  566
            SFN DLLYEPWEV D+ G  FT F+A+WD+C+S+P +P  PL P
Sbjct  128  SFNGDLLYEPWEVYDENGLAFTAFNAYWDKCMSLPIEPTLPLPP  171



>ref|NP_001276254.1| cryptochrome-2-like [Glycine max]
 dbj|BAI47558.1| cryptochrome2 [Glycine max]
Length=634

 Score =   221 bits (562),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 95/157 (61%), Positives = 125/157 (80%), Gaps = 0/157 (0%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLR+EDNPALAA  + G+++ ++IW P+EEG +YPGRVSRWWLKQSLAHLD SL
Sbjct  7    IVWFRRDLRIEDNPALAAAAKEGSVLPVYIWCPKEEGQFYPGRVSRWWLKQSLAHLDQSL  66

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            +SLG+ L+  ++  +V++L+E +K+  A+ + FNHLYDP+SLVRDH  KE L  QG++V+
Sbjct  67   KSLGSRLVLIKTHSTVTALVECVKAIQATKVVFNHLYDPVSLVRDHNIKEKLVEQGISVQ  126

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYD  545
            S+N DLLYEPWEV  + G  FTTF+AFW +CL M  D
Sbjct  127  SYNGDLLYEPWEVYSESGRAFTTFNAFWKKCLHMQMD  163



>gb|AAO23972.1| cryptochrome 2B [Pisum sativum]
Length=597

 Score =   220 bits (560),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 95/164 (58%), Positives = 123/164 (75%), Gaps = 0/164 (0%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLR+EDNPALAA  R G++  +FIW P+EEG +YPGRVSRWW+KQSL HLD SL
Sbjct  7    IVWFRRDLRIEDNPALAAAARDGSVFPVFIWCPKEEGQFYPGRVSRWWMKQSLVHLDQSL  66

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            +SLG  L+  ++  ++ +L+E + +  A+ + FNHLYDP+SLVRDH  KE L  QGV+V+
Sbjct  67   KSLGAGLVIIKTDSTLKALLECVNAVQATKVVFNHLYDPVSLVRDHNIKEKLVEQGVSVQ  126

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLP  566
            S+N DLLYEPWE+ D+ GH FTTF  FW+ CL M     +P+ P
Sbjct  127  SYNGDLLYEPWEIFDESGHAFTTFDPFWNTCLHMQMKTYSPIPP  170



>gb|EEC73456.1| hypothetical protein OsI_07758 [Oryza sativa Indica Group]
 gb|EEE57234.1| hypothetical protein OsJ_07222 [Oryza sativa Japonica Group]
Length=719

 Score =   222 bits (565),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 110/165 (67%), Positives = 135/165 (82%), Gaps = 11/165 (7%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRS-GAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSS  251
            +VWFRRDLRVEDNPALAA  R+ G ++ +++WAPEE+G YYPGRVSRWWL QSL HLD+S
Sbjct  21   VVWFRRDLRVEDNPALAAAARAAGEVVPVYVWAPEEDGPYYPGRVSRWWLSQSLKHLDAS  80

Query  252  LRSLGTT-LITKRSTDSVSSLIEVIKSTGASHLFFNHLY---------DPLSLVRDHRAK  401
            LR LG + L+T+RS D+V +LIE+++S GA+HLFFNHLY         DPLSLVRDHR K
Sbjct  81   LRRLGASRLVTRRSADAVVALIELVRSIGATHLFFNHLYGSIDPEFQIDPLSLVRDHRVK  140

Query  402  EILTAQGVTVRSFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSM  536
             +LTA+G+ V+SFN+DLLYEPWEVVDD+G PFT F+ FWDRCL M
Sbjct  141  ALLTAEGIAVQSFNADLLYEPWEVVDDDGCPFTMFAPFWDRCLCM  185



>gb|AAS79667.1| cryptochrome 2B apoprotein [Pisum sativum]
 gb|AAS79668.1| cryptochrome 2B apoprotein [Pisum sativum]
Length=598

 Score =   219 bits (558),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 95/164 (58%), Positives = 123/164 (75%), Gaps = 0/164 (0%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLR+EDNPALAA  R G++  +FIW P+EEG +YPGRVSRWW+KQSL HLD SL
Sbjct  7    IVWFRRDLRIEDNPALAAAARDGSVFPVFIWCPKEEGQFYPGRVSRWWMKQSLVHLDQSL  66

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            +SLG  L+  ++  ++ +L+E + +  A+ + FNHLYDP+SLVRDH  KE L  QGV+V+
Sbjct  67   KSLGAGLVIIKTDSTLKALLECVNAVQATKVVFNHLYDPVSLVRDHNIKEKLVEQGVSVQ  126

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLP  566
            S+N DLLYEPWE+ D+ GH FTTF  FW+ CL M     +P+ P
Sbjct  127  SYNGDLLYEPWEIFDESGHAFTTFDPFWNTCLHMQMKTYSPIPP  170



>gb|KEH42771.1| cryptochrome 2B apoprotein [Medicago truncatula]
Length=639

 Score =   220 bits (560),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 98/165 (59%), Positives = 126/165 (76%), Gaps = 1/165 (1%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLR+EDNPALAA  R G++  +FIW P+EEG +YPGRVSRWWLKQSL HLD SL
Sbjct  7    IVWFRRDLRIEDNPALAAAARDGSVFPVFIWCPKEEGQFYPGRVSRWWLKQSLVHLDQSL  66

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            +SLG+ L+  R+  ++++L++ I +  A+ + FNHLYDP+SLVRDH  KE L   G++V+
Sbjct  67   KSLGSRLVLIRTESTLNALLDCINAIQATKVVFNHLYDPVSLVRDHNIKEKLVELGLSVK  126

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            S+N DLLYEPWEV D++GH FTTF  FW RCL    +P   L+PP
Sbjct  127  SYNGDLLYEPWEVYDEKGHAFTTFDPFWQRCLHKQMEP-VSLIPP  170



>gb|KEH42772.1| cryptochrome 2B apoprotein [Medicago truncatula]
Length=630

 Score =   219 bits (559),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 98/165 (59%), Positives = 126/165 (76%), Gaps = 1/165 (1%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLR+EDNPALAA  R G++  +FIW P+EEG +YPGRVSRWWLKQSL HLD SL
Sbjct  7    IVWFRRDLRIEDNPALAAAARDGSVFPVFIWCPKEEGQFYPGRVSRWWLKQSLVHLDQSL  66

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            +SLG+ L+  R+  ++++L++ I +  A+ + FNHLYDP+SLVRDH  KE L   G++V+
Sbjct  67   KSLGSRLVLIRTESTLNALLDCINAIQATKVVFNHLYDPVSLVRDHNIKEKLVELGLSVK  126

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            S+N DLLYEPWEV D++GH FTTF  FW RCL    +P   L+PP
Sbjct  127  SYNGDLLYEPWEVYDEKGHAFTTFDPFWQRCLHKQMEP-VSLIPP  170



>ref|XP_002892215.1| hypothetical protein ARALYDRAFT_470417 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68474.1| hypothetical protein ARALYDRAFT_470417 [Arabidopsis lyrata subsp. 
lyrata]
Length=612

 Score =   219 bits (558),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 95/165 (58%), Positives = 130/165 (79%), Gaps = 2/165 (1%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLR+EDNPALAA    G++  +FIW PEEEG +YPGR SRWW+KQSLAHL  SL
Sbjct  8    IVWFRRDLRIEDNPALAAAAHEGSVFPVFIWCPEEEGQFYPGRASRWWMKQSLAHLSQSL  67

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            ++LG+ L   ++ ++VS++++ I+ TGA+ + FNHLYDP+SLVRDH  KE L  +G++V+
Sbjct  68   KALGSDLTFIKTHNTVSAILDCIRVTGATKVVFNHLYDPVSLVRDHTVKEKLVERGISVQ  127

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            S+N DLLYEPWE+  ++G PFT+FS++W +CL MP   E+ +LPP
Sbjct  128  SYNGDLLYEPWEIYCEKGKPFTSFSSYWKKCLDMPI--ESVMLPP  170



>gb|AFK29440.1| cryptochrome 2 [Arabidopsis lyrata subsp. lyrata]
Length=610

 Score =   219 bits (557),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 95/165 (58%), Positives = 130/165 (79%), Gaps = 2/165 (1%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLR+EDNPALAA    G++  +FIW PEEEG +YPGR SRWW+KQSLAHL  SL
Sbjct  6    IVWFRRDLRIEDNPALAAAAHEGSVFPVFIWCPEEEGQFYPGRASRWWMKQSLAHLSQSL  65

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            ++LG+ L   ++ ++VS++++ I+ TGA+ + FNHLYDP+SLVRDH  KE L  +G++V+
Sbjct  66   KALGSDLTFIKTHNTVSAILDCIRVTGATKVVFNHLYDPVSLVRDHTVKEKLVERGISVQ  125

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            S+N DLLYEPWE+  ++G PFT+FS++W +CL MP   E+ +LPP
Sbjct  126  SYNGDLLYEPWEIYCEKGKPFTSFSSYWKKCLDMPI--ESVMLPP  168



>ref|XP_002988890.1| hypothetical protein SELMODRAFT_967, partial [Selaginella moellendorffii]
 gb|EFJ10152.1| hypothetical protein SELMODRAFT_967, partial [Selaginella moellendorffii]
Length=489

 Score =   216 bits (550),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 100/167 (60%), Positives = 129/167 (77%), Gaps = 3/167 (2%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGV-RSGAIIA-LFIWAPEEEGHYYPGRVSRWWLKQSLAHLDS  248
            +VWFRRDLR++DNPALAA V R G+I+  +F+W PEEEG + PGRVSRWWLKQSL  L S
Sbjct  5    LVWFRRDLRLDDNPALAAAVARKGSIVVPVFVWCPEEEGQFQPGRVSRWWLKQSLIQLSS  64

Query  249  SLRSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVT  428
            SL  LG  L+ +R+  ++ +L+++   TGAS +F+NHLYDP+SL+RDHR K+ L   G++
Sbjct  65   SLERLGAPLLVRRTAGTLDALLQIAHDTGASQVFYNHLYDPVSLIRDHRVKQGLADHGIS  124

Query  429  VRSFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            V++F  DLLYEPWE+ DD+G  FTTF AFW + LSM  DPEAPLLPP
Sbjct  125  VKTFRGDLLYEPWEIYDDQGQVFTTFQAFWSKSLSM-RDPEAPLLPP  170



>dbj|BAD23781.1| putative cryptochrome 2 [Oryza sativa Japonica Group]
Length=298

 Score =   211 bits (536),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 90/164 (55%), Positives = 122/164 (74%), Gaps = 0/164 (0%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            +VWFRRDLR++DNPALA+  R GA++ +FIW P +EG +YPGR SRWWLKQSL HL  SL
Sbjct  8    VVWFRRDLRIDDNPALASAARDGAVLPVFIWCPADEGQFYPGRCSRWWLKQSLPHLSQSL  67

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
             SLG  L+  R+  ++ +L+  I S GA+ L +NHLYDP+SLVRD + K+ L+A G++++
Sbjct  68   ESLGCPLVLIRAESTLEALLRCIDSVGATRLVYNHLYDPVSLVRDDKIKKELSALGISIQ  127

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLP  566
            SFN DLLYEPWE+ DD G  FTTF+ +W++C+ +P D    L P
Sbjct  128  SFNGDLLYEPWEIYDDSGLAFTTFNMYWEKCMELPIDASPSLAP  171



>ref|XP_007143870.1| hypothetical protein PHAVU_007G108900g [Phaseolus vulgaris]
 ref|XP_007143871.1| hypothetical protein PHAVU_007G108900g [Phaseolus vulgaris]
 gb|ESW15864.1| hypothetical protein PHAVU_007G108900g [Phaseolus vulgaris]
 gb|ESW15865.1| hypothetical protein PHAVU_007G108900g [Phaseolus vulgaris]
Length=635

 Score =   219 bits (557),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 99/165 (60%), Positives = 128/165 (78%), Gaps = 1/165 (1%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLR+EDNPALAA  R G+++ ++IW P+EEG +YPGRVSRWWLKQSLAHLD SL
Sbjct  7    IVWFRRDLRIEDNPALAAAAREGSVLPVYIWCPKEEGQFYPGRVSRWWLKQSLAHLDRSL  66

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            +SLGT L+  ++  +V++L+E IK+  A+ + FNHLYDP+SLVRDH  KE L  QG++V+
Sbjct  67   KSLGTRLVLIKTHSTVTALLECIKAIQATKVVFNHLYDPVSLVRDHNIKEKLVEQGISVQ  126

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            S+N DLLYEPWE+  + G  FTTF+AFW +CL    D    L+PP
Sbjct  127  SYNGDLLYEPWELYTESGRAFTTFNAFWTKCLHKQMDI-VSLVPP  170



>ref|XP_006420219.1| hypothetical protein CICLE_v10004525mg [Citrus clementina]
 gb|ESR33459.1| hypothetical protein CICLE_v10004525mg [Citrus clementina]
Length=644

 Score =   219 bits (558),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 96/165 (58%), Positives = 128/165 (78%), Gaps = 1/165 (1%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLR+EDNPALAA  R G++  ++IW P+EEG +YPGRVSRWWLKQSL++L  SL
Sbjct  7    IVWFRRDLRIEDNPALAAAARDGSVFPVYIWCPKEEGQFYPGRVSRWWLKQSLSYLGQSL  66

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            +SLG  L+  ++  ++++L+E I +  A+ + FNHLYDP+SLVRDH  KE L   G++V+
Sbjct  67   KSLGAELVLFKTESTLAALLECISAIKATKVVFNHLYDPVSLVRDHSIKEKLVELGISVQ  126

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            S+N DLLYEPWE+ D+ GH FTTF A+WD+CL M  +P A +LPP
Sbjct  127  SYNGDLLYEPWEIYDERGHAFTTFDAYWDKCLQMQMEP-ASILPP  170



>ref|XP_006420220.1| hypothetical protein CICLE_v10004525mg [Citrus clementina]
 gb|ESR33460.1| hypothetical protein CICLE_v10004525mg [Citrus clementina]
Length=641

 Score =   219 bits (557),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 96/165 (58%), Positives = 128/165 (78%), Gaps = 1/165 (1%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLR+EDNPALAA  R G++  ++IW P+EEG +YPGRVSRWWLKQSL++L  SL
Sbjct  7    IVWFRRDLRIEDNPALAAAARDGSVFPVYIWCPKEEGQFYPGRVSRWWLKQSLSYLGQSL  66

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            +SLG  L+  ++  ++++L+E I +  A+ + FNHLYDP+SLVRDH  KE L   G++V+
Sbjct  67   KSLGAELVLFKTESTLAALLECISAIKATKVVFNHLYDPVSLVRDHSIKEKLVELGISVQ  126

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            S+N DLLYEPWE+ D+ GH FTTF A+WD+CL M  +P A +LPP
Sbjct  127  SYNGDLLYEPWEIYDERGHAFTTFDAYWDKCLQMQMEP-ASILPP  170



>ref|XP_006307024.1| hypothetical protein CARUB_v10008610mg [Capsella rubella]
 gb|EOA39922.1| hypothetical protein CARUB_v10008610mg [Capsella rubella]
Length=612

 Score =   218 bits (556),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 95/165 (58%), Positives = 129/165 (78%), Gaps = 2/165 (1%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLR+EDNPALAA    G++  +FIW PEEEG +YPGR SRWW+KQSLAHL  SL
Sbjct  8    IVWFRRDLRIEDNPALAAAAHEGSVFPVFIWCPEEEGQFYPGRASRWWMKQSLAHLSQSL  67

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            ++LG+ L   ++ ++VS++++ I+ TGA+ + FNHLYDP+SLVRDH  KE L  +G++V+
Sbjct  68   KALGSELTLIKTHNTVSAILDCIRVTGATKVVFNHLYDPVSLVRDHTVKEKLVERGISVQ  127

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            S+N DLLYEPWE+  D+G PFT+FS++W +CL M    E+ +LPP
Sbjct  128  SYNGDLLYEPWEIYCDKGKPFTSFSSYWKKCLDMSI--ESVMLPP  170



>gb|AFK29439.1| cryptochrome 2 [Arabidopsis kamchatica]
Length=610

 Score =   218 bits (554),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 95/165 (58%), Positives = 129/165 (78%), Gaps = 2/165 (1%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLR+EDNPALAA    G++  +FIW PEEEG +YPGR SRWW+KQSLAHL  SL
Sbjct  6    IVWFRRDLRIEDNPALAAAAHEGSVFPVFIWCPEEEGQFYPGRASRWWMKQSLAHLSQSL  65

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            + LG+ L   ++ ++VS++++ I+ TGA+ + FNHLYDP+SLVRDH  KE L  +G++V+
Sbjct  66   KVLGSDLTFIKTHNTVSAILDCIRVTGATKVVFNHLYDPVSLVRDHTIKEKLVERGISVQ  125

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            S+N DLLYEPWE+  ++G PFT+FS++W +CL MP   E+ +LPP
Sbjct  126  SYNGDLLYEPWEIYCEKGKPFTSFSSYWKKCLDMPI--ESVMLPP  168



>emb|CDX89827.1| BnaA10g02550D [Brassica napus]
Length=434

 Score =   213 bits (542),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 92/165 (56%), Positives = 128/165 (78%), Gaps = 2/165 (1%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLR+EDNPALAA  R G++  +FIW PEEEG ++PGR SRWW+KQSLAHL+ SL
Sbjct  8    IVWFRRDLRIEDNPALAAAAREGSVFPVFIWCPEEEGQFHPGRASRWWMKQSLAHLNQSL  67

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            +SLG+ L   ++  +VS++++ +++TGA+ + FNHLYDP+SLVRDH  KE L  +G++V+
Sbjct  68   KSLGSHLTFIKTHSTVSAILDCVRATGATKVVFNHLYDPVSLVRDHNVKEKLMERGISVQ  127

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
             +N DLLYEPWE+  + G PFT+F+ +W +CL M    E+ +LPP
Sbjct  128  GYNGDLLYEPWEINSENGKPFTSFAPYWKKCLDMSV--ESVMLPP  170



>emb|CDX86636.1| BnaC08g00670D [Brassica napus]
Length=619

 Score =   217 bits (553),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 92/165 (56%), Positives = 130/165 (79%), Gaps = 2/165 (1%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLR+EDNPALAA    G++  +FIW PEEEG +YPGR SRWW+KQSLAHL  SL
Sbjct  8    IVWFRRDLRIEDNPALAAAAHEGSVFPVFIWCPEEEGQFYPGRASRWWMKQSLAHLTQSL  67

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            ++LG+ L   ++ ++VS++++ +++TGA+ + FNHLYDP+SLVRDH  KE L  +G++V+
Sbjct  68   KALGSELTLIKTHNTVSAILDCVRATGATKVVFNHLYDPVSLVRDHTVKEKLVERGISVQ  127

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            S+N DLLYEPWE+  ++G PFT F+++W +CL MP   E+ ++PP
Sbjct  128  SYNGDLLYEPWEIYCEKGKPFTNFNSYWKKCLDMPV--ESVVIPP  170



>gb|KDO57602.1| hypothetical protein CISIN_1g006464mg [Citrus sinensis]
Length=644

 Score =   217 bits (553),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 95/165 (58%), Positives = 127/165 (77%), Gaps = 1/165 (1%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLR+EDNPALAA  R G++  ++ W P+EEG +YPGRVSRWWLKQSL++L  SL
Sbjct  7    IVWFRRDLRIEDNPALAAAARDGSVFPVYTWCPKEEGQFYPGRVSRWWLKQSLSYLGQSL  66

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            +SLG  L+  ++  ++++L+E I +  A+ + FNHLYDP+SLVRDH  KE L   G++V+
Sbjct  67   KSLGAELVLFKTESTLAALLECISAIKATKVVFNHLYDPVSLVRDHSIKEKLVELGISVQ  126

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            S+N DLLYEPWE+ D+ GH FTTF A+WD+CL M  +P A +LPP
Sbjct  127  SYNGDLLYEPWEIYDERGHAFTTFDAYWDKCLQMQMEP-ASILPP  170



>ref|XP_006489737.1| PREDICTED: cryptochrome-2-like [Citrus sinensis]
Length=644

 Score =   217 bits (553),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 95/165 (58%), Positives = 127/165 (77%), Gaps = 1/165 (1%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLR+EDNPALAA  R G++  ++ W P+EEG +YPGRVSRWWLKQSL++L  SL
Sbjct  7    IVWFRRDLRIEDNPALAAAARDGSVFPVYTWCPKEEGQFYPGRVSRWWLKQSLSYLGQSL  66

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            +SLG  L+  ++  ++++L+E I +  A+ + FNHLYDP+SLVRDH  KE L   G++V+
Sbjct  67   KSLGAELVLFKTESTLAALLECISAIKATKVVFNHLYDPVSLVRDHSIKEKLVELGISVQ  126

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            S+N DLLYEPWE+ D+ GH FTTF A+WD+CL M  +P A +LPP
Sbjct  127  SYNGDLLYEPWEIYDERGHAFTTFDAYWDKCLQMQMEP-ASILPP  170



>gb|KDO57603.1| hypothetical protein CISIN_1g006464mg [Citrus sinensis]
Length=642

 Score =   217 bits (553),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 95/165 (58%), Positives = 127/165 (77%), Gaps = 1/165 (1%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLR+EDNPALAA  R G++  ++ W P+EEG +YPGRVSRWWLKQSL++L  SL
Sbjct  7    IVWFRRDLRIEDNPALAAAARDGSVFPVYTWCPKEEGQFYPGRVSRWWLKQSLSYLGQSL  66

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            +SLG  L+  ++  ++++L+E I +  A+ + FNHLYDP+SLVRDH  KE L   G++V+
Sbjct  67   KSLGAELVLFKTESTLAALLECISAIKATKVVFNHLYDPVSLVRDHSIKEKLVELGISVQ  126

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            S+N DLLYEPWE+ D+ GH FTTF A+WD+CL M  +P A +LPP
Sbjct  127  SYNGDLLYEPWEIYDERGHAFTTFDAYWDKCLQMQMEP-ASILPP  170



>dbj|BAI47556.1| cryptochrome2 [Glycine max]
Length=634

 Score =   217 bits (552),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 93/157 (59%), Positives = 123/157 (78%), Gaps = 0/157 (0%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLR+EDNPALAA  + G+++ +++W P+EEG +YPGRVSRWWLKQSLAHLD SL
Sbjct  7    IVWFRRDLRIEDNPALAAAAKEGSVLPVYVWCPKEEGQFYPGRVSRWWLKQSLAHLDQSL  66

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            +SLG+ L+  ++  +  +L+E +K+  A+ + FNHLYDP+SLVRDH  KE L  QG++V+
Sbjct  67   KSLGSRLVLIKTHSTAVALVECVKAIQATKVVFNHLYDPVSLVRDHNIKEKLVEQGISVQ  126

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYD  545
            S+N DLLYEPWEV  + G  FTTF+AFW +CL M  D
Sbjct  127  SYNGDLLYEPWEVNSESGRAFTTFNAFWKKCLHMQMD  163



>gb|AFK29441.1| cryptochrome 2 [Arabidopsis halleri subsp. gemmifera]
Length=610

 Score =   216 bits (551),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 94/165 (57%), Positives = 129/165 (78%), Gaps = 2/165 (1%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLR+EDNPALAA    G++  +FIW PEEEG +YPGR SRWW+KQSLAHL  SL
Sbjct  6    IVWFRRDLRIEDNPALAAAAHEGSVFPVFIWCPEEEGQFYPGRASRWWMKQSLAHLSQSL  65

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            ++LG+ L   ++ ++VS++++ I+ TGA+ + FNHLYDP+SLVRDH  KE L  +G++V+
Sbjct  66   KALGSDLTLIKTHNTVSAILDCIRVTGATKVVFNHLYDPVSLVRDHTVKEKLVERGISVQ  125

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            S+N DLLYEPWE+  ++G PFT+FS++W +CL M    E+ +LPP
Sbjct  126  SYNGDLLYEPWEIYCEKGKPFTSFSSYWKKCLDMSI--ESVMLPP  168



>dbj|BAC67178.1| cryptochrome 2 [Armoracia rusticana]
Length=617

 Score =   216 bits (551),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 95/165 (58%), Positives = 128/165 (78%), Gaps = 2/165 (1%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLR+EDNPALAA    G++  +FIW PEEEG +YPGR SRWW+KQSLAHL  SL
Sbjct  8    IVWFRRDLRIEDNPALAAAAHQGSVFPVFIWCPEEEGQFYPGRASRWWMKQSLAHLSQSL  67

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            ++LG+ L   ++ ++VS++++ I+ TGA+ + FNHLYDP+SLVRDH  KE L   G++V+
Sbjct  68   KALGSELTLIKTHNTVSAILDCIRVTGATKVVFNHLYDPVSLVRDHTVKEKLVELGISVQ  127

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            SFN DLLYEPWE+  ++G PFT+FS++W +CL M    E+ +LPP
Sbjct  128  SFNGDLLYEPWEIYCEKGKPFTSFSSYWKKCLDMSI--ESVMLPP  170



>dbj|BAC67177.1| cryptochrome 2 [Armoracia rusticana]
Length=617

 Score =   216 bits (551),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 95/165 (58%), Positives = 127/165 (77%), Gaps = 2/165 (1%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLR+EDNPALAA    G++  +FIW PEEEG +YPGR SRWW+KQSLAHL  SL
Sbjct  8    IVWFRRDLRIEDNPALAAAAHEGSVFPVFIWCPEEEGQFYPGRASRWWMKQSLAHLSQSL  67

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            ++LG+ L   ++ ++VS++++ I+ TGA+ + FNHLYDP+SLVRDH  KE L   G++V+
Sbjct  68   KALGSELTLIKTHNTVSAILDCIRITGATKVVFNHLYDPVSLVRDHTVKEKLVELGISVQ  127

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            SFN DLLYEPWE+  ++G PFT FS++W +CL M    E+ +LPP
Sbjct  128  SFNGDLLYEPWEIYFEKGKPFTNFSSYWKKCLDMSI--ESVMLPP  170



>ref|XP_010274772.1| PREDICTED: cryptochrome-1-like isoform X2 [Nelumbo nucifera]
Length=620

 Score =   216 bits (551),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 98/165 (59%), Positives = 129/165 (78%), Gaps = 1/165 (1%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLR+EDNPA+A   R G+++ +FIW P EEG +YPGRVSRWWLKQSLAHLD SL
Sbjct  8    IVWFRRDLRIEDNPAVATAAREGSVLPVFIWCPREEGQFYPGRVSRWWLKQSLAHLDQSL  67

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            +SLG  L+  ++  ++++L+  I++ GA+ + +NHLYDP+SL RD+  K+ L   G++V+
Sbjct  68   KSLGAPLVLVKAESTLAALLRCIEAVGATKVVYNHLYDPVSLSRDNSVKQNLVDLGISVQ  127

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            SFN DLLYEPWEV DD+ H FTTF+AFW+RCL  P +P A LLPP
Sbjct  128  SFNGDLLYEPWEVHDDKRHAFTTFNAFWNRCLLGPTEP-ALLLPP  171



>ref|XP_010274771.1| PREDICTED: cryptochrome-1-like isoform X1 [Nelumbo nucifera]
Length=641

 Score =   217 bits (552),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 98/165 (59%), Positives = 129/165 (78%), Gaps = 1/165 (1%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLR+EDNPA+A   R G+++ +FIW P EEG +YPGRVSRWWLKQSLAHLD SL
Sbjct  8    IVWFRRDLRIEDNPAVATAAREGSVLPVFIWCPREEGQFYPGRVSRWWLKQSLAHLDQSL  67

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            +SLG  L+  ++  ++++L+  I++ GA+ + +NHLYDP+SL RD+  K+ L   G++V+
Sbjct  68   KSLGAPLVLVKAESTLAALLRCIEAVGATKVVYNHLYDPVSLSRDNSVKQNLVDLGISVQ  127

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            SFN DLLYEPWEV DD+ H FTTF+AFW+RCL  P +P A LLPP
Sbjct  128  SFNGDLLYEPWEVHDDKRHAFTTFNAFWNRCLLGPTEP-ALLLPP  171



>dbj|BAM36553.1| cryptochrome 2 [Fragaria x ananassa]
Length=646

 Score =   217 bits (552),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 96/165 (58%), Positives = 128/165 (78%), Gaps = 1/165 (1%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLR+EDNPALAA VR GA+  ++IW P++EGH+YPGRVSRWWLKQSLAHLD SL
Sbjct  8    IVWFRRDLRIEDNPALAAAVRDGAVFPVYIWCPKDEGHFYPGRVSRWWLKQSLAHLDQSL  67

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            +SLG  L   ++  +VS++++ I++ GA+ + FNHLYDP+SLVRDH  K  L   G++V+
Sbjct  68   KSLGAQLALIKTDSTVSAILDCIQAIGATKVVFNHLYDPVSLVRDHNIKGKLVELGISVQ  127

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            S+N+DLL+EPWE+ D +G  FTTF  +WD+CL+M  +     LPP
Sbjct  128  SYNADLLHEPWEIYDAKGQTFTTFKEYWDKCLNMEREL-VTFLPP  171



>gb|AFK29442.1| cryptochrome 2 [Arabidopsis halleri subsp. halleri]
Length=610

 Score =   216 bits (550),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 93/165 (56%), Positives = 129/165 (78%), Gaps = 2/165 (1%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLR+EDNPALAA    G++  +FIW PEEEG +YPGR SRWW+KQSLAHL  SL
Sbjct  6    IVWFRRDLRIEDNPALAAAAHEGSVFPVFIWCPEEEGQFYPGRASRWWMKQSLAHLSQSL  65

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            ++LG+ L   ++ +++S++++ I+ TGA+ + FNHLYDP+SLVRDH  KE L  +G++V+
Sbjct  66   KALGSDLTLIKTHNTISAILDCIRVTGATKVVFNHLYDPVSLVRDHTVKEKLVERGISVQ  125

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            S+N DLLYEPWE+  ++G PFT+FS++W +CL M    E+ +LPP
Sbjct  126  SYNGDLLYEPWEIYCEKGKPFTSFSSYWKKCLDMSI--ESVMLPP  168



>gb|ADU19845.1| cryptochrome 2b [Brassica napus]
 gb|AEA29691.1| cryptochrome 2b [Brassica napus]
Length=575

 Score =   215 bits (548),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 93/165 (56%), Positives = 128/165 (78%), Gaps = 2/165 (1%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLR+EDNPALAA  R G++  +FIW PEEEG ++PGR SRWW+KQSLAHL+ SL
Sbjct  8    IVWFRRDLRIEDNPALAAAAREGSVFPVFIWCPEEEGQFHPGRASRWWMKQSLAHLNQSL  67

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            +SLG+ L   ++  +VS++++ ++STGA+ + FNHLYDP+SLVRDH  KE L  +G++V+
Sbjct  68   KSLGSHLTFIKTHSTVSAILDCVRSTGATKVVFNHLYDPVSLVRDHNVKEKLVERGISVQ  127

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
             +N DLLYEPWE+  + G PFT+F+ +W +CL M    E+ +LPP
Sbjct  128  GYNGDLLYEPWEINSENGKPFTSFAPYWKKCLDMSV--ESVMLPP  170



>gb|KDP40329.1| hypothetical protein JCGZ_02327 [Jatropha curcas]
Length=647

 Score =   216 bits (551),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 95/164 (58%), Positives = 123/164 (75%), Gaps = 0/164 (0%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLR+EDNPALA+  R G +  +FIW P+EEG +YPGRVSRWWLKQSLAHL  SL
Sbjct  7    IVWFRRDLRIEDNPALASAARDGCVFPVFIWCPQEEGQFYPGRVSRWWLKQSLAHLGHSL  66

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
             SLG  L+  ++  ++++L++ I + GA+ + FNHLYDP+SLVRDH  KE L   G++V+
Sbjct  67   NSLGAELVVIKTHSTLAALLDCINAIGATRVVFNHLYDPVSLVRDHNIKEKLVEVGISVQ  126

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLP  566
            S+N DLL EPWEV D+ GH F TF A+WD+CL M  +P + L P
Sbjct  127  SYNGDLLLEPWEVYDESGHAFVTFDAYWDKCLHMQMEPVSHLPP  170



>ref|NP_001170477.1| LOC100384475 [Zea mays]
 gb|ACO59248.1| cryptochrome 1 [Zea mays]
Length=699

 Score =   217 bits (553),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 106/156 (68%), Positives = 133/156 (85%), Gaps = 2/156 (1%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRS-GAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSS  251
            +VWFRRDLRVEDNPALAA  R+ G ++  ++WAPEE+G YYPGRVSRWWL QSL HLD+S
Sbjct  19   VVWFRRDLRVEDNPALAAAPRAAGEVVPAYVWAPEEDGPYYPGRVSRWWLSQSLKHLDAS  78

Query  252  LRSLGTT-LITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVT  428
            LR LG   L+T+RS+D+V +LI++++STGA+HLFFNHLYDPLSLVRDHR KE L A+G+ 
Sbjct  79   LRRLGACRLVTRRSSDAVVALIDLVRSTGATHLFFNHLYDPLSLVRDHRVKEQLAAEGID  138

Query  429  VRSFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSM  536
            V+SFN+DLLYEPWEV+D++  PFT F+ FW+RCL M
Sbjct  139  VQSFNADLLYEPWEVLDEDRRPFTMFAPFWNRCLCM  174



>dbj|BAA88424.1| blue light photoreceptor [Adiantum capillus-veneris]
 dbj|BAA88426.1| blue light photoreceptor [Adiantum capillus-veneris]
Length=487

 Score =   213 bits (541),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 98/166 (59%), Positives = 126/166 (76%), Gaps = 1/166 (1%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSG-AIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSS  251
            IVW RRDLR++DNPAL    + G A++ +F+W PEEEG +  GR+SRWWLKQSL  L  S
Sbjct  7    IVWLRRDLRLDDNPALKEASKIGNAVVPVFVWVPEEEGQFQQGRMSRWWLKQSLKQLAQS  66

Query  252  LRSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTV  431
            L SLG+ LI +RS+ S+ +L++++  T AS +FFNHLYDP+SLVRD R KE L   G+ V
Sbjct  67   LDSLGSPLIIRRSSSSLQALMDLVIHTQASQVFFNHLYDPISLVRDQRVKEGLLQTGIHV  126

Query  432  RSFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            R+FN+DLLYEPW+V D  G  FTTF+ FWD+CL+MP +P APLLPP
Sbjct  127  RTFNADLLYEPWQVNDPSGKAFTTFNEFWDKCLNMPEEPHAPLLPP  172



>gb|AAT80619.1| cryptochrome 2 [Arabidopsis thaliana]
 gb|AAT80620.1| cryptochrome 2 [Arabidopsis thaliana]
 gb|AAT80621.1| cryptochrome 2 [Arabidopsis thaliana]
 gb|AAT80622.1| cryptochrome 2 [Arabidopsis thaliana]
 gb|AAT80623.1| cryptochrome 2 [Arabidopsis thaliana]
Length=610

 Score =   215 bits (548),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 93/165 (56%), Positives = 129/165 (78%), Gaps = 2/165 (1%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLR+EDNPALAA    G++  +FIW PEEEG +YPGR SRWW+KQSLAHL  SL
Sbjct  6    IVWFRRDLRIEDNPALAAAAHEGSVFPVFIWCPEEEGQFYPGRASRWWMKQSLAHLSQSL  65

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            ++LG+ L   ++ ++VS++++ I+ TGA+ + FNHLYDP+SLVRDH  KE L  +G++V+
Sbjct  66   KALGSDLTLIKTHNTVSAILDCIRVTGATKVVFNHLYDPVSLVRDHTVKEKLVERGISVQ  125

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            S+N DLLYEPWE+  ++G PFT+F+++W +CL M    E+ +LPP
Sbjct  126  SYNGDLLYEPWEIYCEKGKPFTSFNSYWKKCLDMSI--ESVMLPP  168



>ref|XP_008644162.1| PREDICTED: LOC100384475 isoform X1 [Zea mays]
Length=699

 Score =   217 bits (552),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 103/156 (66%), Positives = 132/156 (85%), Gaps = 2/156 (1%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRS-GAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSS  251
            +VWFRRDLRVEDNPALAA  R+ G ++  ++WAPEE+G YYPGRVSRWWL QSL HLD+S
Sbjct  19   VVWFRRDLRVEDNPALAAAARAAGEVVPAYVWAPEEDGAYYPGRVSRWWLSQSLKHLDAS  78

Query  252  LRSLGTT-LITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVT  428
            LR LG   L+T+RS D+V++L+++++ TGA+HLFFNHLYDPLSLVRD+R KE L A+G+ 
Sbjct  79   LRRLGAARLVTRRSNDAVAALLDLVRCTGATHLFFNHLYDPLSLVRDYRVKEQLAAEGID  138

Query  429  VRSFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSM  536
            V+SFN+DLLYEPWEV+D++  PFT F+ FW+RCL M
Sbjct  139  VQSFNADLLYEPWEVLDEDRRPFTMFAPFWNRCLCM  174



>gb|ABY77607.1| At1g04400 [Arabidopsis thaliana]
 gb|ABY77609.1| At1g04400 [Arabidopsis thaliana]
 gb|ABY77611.1| At1g04400 [Arabidopsis thaliana]
 gb|ABY77612.1| At1g04400 [Arabidopsis thaliana]
 gb|ABY77617.1| At1g04400 [Arabidopsis thaliana]
 gb|AEM06545.1| cryptochrome 2 [Arabidopsis thaliana]
 gb|AEM06563.1| cryptochrome 2 [Arabidopsis thaliana]
 gb|AEM06582.1| cryptochrome 2 [Arabidopsis thaliana]
 gb|AEM06639.1| cryptochrome 2 [Arabidopsis thaliana]
 gb|AEM06717.1| cryptochrome 2 [Arabidopsis thaliana]
Length=612

 Score =   215 bits (548),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 93/165 (56%), Positives = 129/165 (78%), Gaps = 2/165 (1%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLR+EDNPALAA    G++  +FIW PEEEG +YPGR SRWW+KQSLAHL  SL
Sbjct  8    IVWFRRDLRIEDNPALAAAAHEGSVFPVFIWCPEEEGQFYPGRASRWWMKQSLAHLSQSL  67

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            ++LG+ L   ++ ++VS++++ I+ TGA+ + FNHLYDP+SLVRDH  KE L  +G++V+
Sbjct  68   KALGSDLTLIKTHNTVSAILDCIRVTGATKVVFNHLYDPVSLVRDHTVKEKLVERGISVQ  127

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            S+N DLLYEPWE+  ++G PFT+F+++W +CL M    E+ +LPP
Sbjct  128  SYNGDLLYEPWEIYCEKGKPFTSFNSYWKKCLDMSI--ESVMLPP  170



>dbj|BAC67176.1| cryptochrome 2 [Armoracia rusticana]
Length=617

 Score =   215 bits (548),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 95/165 (58%), Positives = 127/165 (77%), Gaps = 2/165 (1%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLR+EDNPALAA    G++  +FIW PEEEG +YPGR SRWW+KQSLAHL  SL
Sbjct  8    IVWFRRDLRIEDNPALAAAAHEGSVFPVFIWCPEEEGQFYPGRASRWWMKQSLAHLSQSL  67

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            ++LG+ L   ++ ++VS++++ I+ TGA+ + FNHLYDP+SLVRDH  KE L   G++V+
Sbjct  68   KALGSELTLIKTHNTVSAILDCIRITGATKVVFNHLYDPVSLVRDHTVKEKLVELGISVQ  127

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            SFN DLLYEPWE+  ++G PFT FS++W +CL M    E+ +LPP
Sbjct  128  SFNGDLLYEPWEIYFEKGKPFTNFSSYWKKCLDMSI--ESVMLPP  170



>ref|XP_008644161.1| PREDICTED: LOC100384475 isoform X2 [Zea mays]
 gb|AFW71952.1| cryptochrome 1 [Zea mays]
Length=707

 Score =   217 bits (552),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 103/156 (66%), Positives = 132/156 (85%), Gaps = 2/156 (1%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRS-GAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSS  251
            +VWFRRDLRVEDNPALAA  R+ G ++  ++WAPEE+G YYPGRVSRWWL QSL HLD+S
Sbjct  19   VVWFRRDLRVEDNPALAAAARAAGEVVPAYVWAPEEDGAYYPGRVSRWWLSQSLKHLDAS  78

Query  252  LRSLGTT-LITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVT  428
            LR LG   L+T+RS D+V++L+++++ TGA+HLFFNHLYDPLSLVRD+R KE L A+G+ 
Sbjct  79   LRRLGAARLVTRRSNDAVAALLDLVRCTGATHLFFNHLYDPLSLVRDYRVKEQLAAEGID  138

Query  429  VRSFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSM  536
            V+SFN+DLLYEPWEV+D++  PFT F+ FW+RCL M
Sbjct  139  VQSFNADLLYEPWEVLDEDRRPFTMFAPFWNRCLCM  174



>gb|AAL16377.1| cryptochrome 2 [Arabidopsis thaliana]
 gb|AAL16378.1| cryptochrome 2 [Arabidopsis thaliana]
 gb|ABY77603.1| At1g04400 [Arabidopsis thaliana]
Length=612

 Score =   215 bits (548),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 92/165 (56%), Positives = 129/165 (78%), Gaps = 2/165 (1%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLR+EDNPALAA    G++  +FIW PEEEG +YPGR SRWW+KQSLAHL  SL
Sbjct  8    IVWFRRDLRIEDNPALAAAAHEGSVFPVFIWCPEEEGQFYPGRASRWWMKQSLAHLSQSL  67

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            ++LG+ L   ++ +++S++++ I+ TGA+ + FNHLYDP+SLVRDH  KE L  +G++V+
Sbjct  68   KALGSDLTLIKTHNTISAILDCIRVTGATKVVFNHLYDPVSLVRDHTVKEKLVERGISVQ  127

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            S+N DLLYEPWE+  ++G PFT+F+++W +CL M    E+ +LPP
Sbjct  128  SYNGDLLYEPWEIYCEKGKPFTSFNSYWKKCLDMSI--ESVMLPP  170



>gb|AAT80618.1| cryptochrome 2 [Arabidopsis thaliana]
Length=610

 Score =   215 bits (547),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 92/165 (56%), Positives = 129/165 (78%), Gaps = 2/165 (1%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLR+EDNPALAA    G++  +FIW PEEEG +YPGR SRWW+KQSLAHL  SL
Sbjct  6    IVWFRRDLRIEDNPALAAAAHEGSVFPVFIWCPEEEGQFYPGRASRWWMKQSLAHLSQSL  65

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            ++LG+ L   ++ +++S++++ I+ TGA+ + FNHLYDP+SLVRDH  KE L  +G++V+
Sbjct  66   KALGSDLTLIKTHNTISAILDCIRVTGATKVVFNHLYDPVSLVRDHTVKEKLVERGISVQ  125

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            S+N DLLYEPWE+  ++G PFT+F+++W +CL M    E+ +LPP
Sbjct  126  SYNGDLLYEPWEIYCEKGKPFTSFNSYWKKCLDMSI--ESVMLPP  168



>emb|CAA67508.1| blue light receptor [Arabidopsis thaliana]
Length=612

 Score =   215 bits (547),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 92/165 (56%), Positives = 129/165 (78%), Gaps = 2/165 (1%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLR+EDNPALAA    G++  +FIW PEEEG +YPGR SRWW+KQSLAHL  SL
Sbjct  8    IVWFRRDLRIEDNPALAAAAHEGSVFPVFIWCPEEEGQFYPGRASRWWMKQSLAHLSQSL  67

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            ++LG+ L   ++ +++S++++ I+ TGA+ + FNHLYDP+SLVRDH  KE L  +G++V+
Sbjct  68   KALGSDLTLIKTHNTISAILDCIRVTGATKVVFNHLYDPVSLVRDHTVKEKLVERGISVQ  127

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            S+N DLLYEPWE+  ++G PFT+F+++W +CL M    E+ +LPP
Sbjct  128  SYNGDLLYEPWEIYCEKGKPFTSFNSYWKKCLDMSI--ESVMLPP  170



>ref|XP_006418132.1| hypothetical protein EUTSA_v10007081mg [Eutrema salsugineum]
 ref|XP_006418133.1| hypothetical protein EUTSA_v10007081mg [Eutrema salsugineum]
 gb|ESQ36485.1| hypothetical protein EUTSA_v10007081mg [Eutrema salsugineum]
 gb|ESQ36486.1| hypothetical protein EUTSA_v10007081mg [Eutrema salsugineum]
Length=621

 Score =   215 bits (548),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 94/165 (57%), Positives = 127/165 (77%), Gaps = 2/165 (1%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLR+EDNPALAA    G++  +FIW PEEEG +YPGR SRWW+KQSLAHL  SL
Sbjct  8    IVWFRRDLRIEDNPALAAAAHEGSVFPVFIWCPEEEGQFYPGRASRWWMKQSLAHLSQSL  67

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            ++LG+ L   ++ ++VS++++ I++TGA+ + FNHLYDP+SLVRDH  KE L   G++V+
Sbjct  68   KALGSELTLIKTHNTVSAILDCIRATGATKVVFNHLYDPVSLVRDHTVKEKLVELGISVQ  127

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            S+N DLLYEPWE+  ++G PFT+FS +W +CL M    E  +LPP
Sbjct  128  SYNGDLLYEPWEIYCEKGKPFTSFSLYWKKCLDMSI--ETVMLPP  170



>ref|NP_171935.1| cryptochrome 2 [Arabidopsis thaliana]
 ref|NP_849588.1| cryptochrome 2 [Arabidopsis thaliana]
 sp|Q96524.2|CRY2_ARATH RecName: Full=Cryptochrome-2; AltName: Full=Blue light photoreceptor 
[Arabidopsis thaliana]
 gb|AAD09837.1| cryptochrome 2 apoprotein [Arabidopsis thaliana]
 gb|AAP40403.1| putative cryptochrome 2 apoprotein [Arabidopsis thaliana]
 gb|AAP40463.1| putative cryptochrome 2 apoprotein [Arabidopsis thaliana]
 gb|ABY77601.1| At1g04400 [Arabidopsis thaliana]
 gb|ABY77606.1| At1g04400 [Arabidopsis thaliana]
 gb|ABY77608.1| At1g04400 [Arabidopsis thaliana]
 gb|ABY77610.1| At1g04400 [Arabidopsis thaliana]
 gb|ABY77613.1| At1g04400 [Arabidopsis thaliana]
 gb|ABY77614.1| At1g04400 [Arabidopsis thaliana]
 gb|ABY77615.1| At1g04400 [Arabidopsis thaliana]
 gb|ABY77616.1| At1g04400 [Arabidopsis thaliana]
 gb|ABY77618.1| At1g04400 [Arabidopsis thaliana]
 gb|ABY77620.1| At1g04400 [Arabidopsis thaliana]
 gb|ABY77621.1| At1g04400 [Arabidopsis thaliana]
 gb|ABY77622.1| At1g04400 [Arabidopsis thaliana]
 gb|ABY77623.1| At1g04400 [Arabidopsis thaliana]
 gb|ABY77626.1| At1g04400 [Arabidopsis thaliana]
 gb|ABY77628.1| At1g04400 [Arabidopsis thaliana]
 gb|ABY77629.1| At1g04400 [Arabidopsis thaliana]
 gb|ABY77632.1| At1g04400 [Arabidopsis thaliana]
 gb|AEE27692.1| cryptochrome 2 [Arabidopsis thaliana]
 gb|AEE27693.1| cryptochrome 2 [Arabidopsis thaliana]
 gb|AEM06547.1| cryptochrome 2 [Arabidopsis thaliana]
 gb|AEM06565.1| cryptochrome 2 [Arabidopsis thaliana]
 gb|AEM06579.1| cryptochrome 2 [Arabidopsis thaliana]
 gb|AEM06598.1| cryptochrome 2 [Arabidopsis thaliana]
 gb|AEM06603.1| cryptochrome 2 [Arabidopsis thaliana]
 gb|AEM06620.1| cryptochrome 2 [Arabidopsis thaliana]
 gb|AEM06627.1| cryptochrome 2 [Arabidopsis thaliana]
 gb|AEM06634.1| cryptochrome 2 [Arabidopsis thaliana]
 gb|AEM06662.1| cryptochrome 2 [Arabidopsis thaliana]
 gb|AEM06667.1| cryptochrome 2 [Arabidopsis thaliana]
 gb|AEM06672.1| cryptochrome 2 [Arabidopsis thaliana]
 gb|AEM06685.1| cryptochrome 2 [Arabidopsis thaliana]
 gb|AEM06718.1| cryptochrome 2 [Arabidopsis thaliana]
Length=612

 Score =   215 bits (547),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 92/165 (56%), Positives = 129/165 (78%), Gaps = 2/165 (1%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLR+EDNPALAA    G++  +FIW PEEEG +YPGR SRWW+KQSLAHL  SL
Sbjct  8    IVWFRRDLRIEDNPALAAAAHEGSVFPVFIWCPEEEGQFYPGRASRWWMKQSLAHLSQSL  67

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            ++LG+ L   ++ +++S++++ I+ TGA+ + FNHLYDP+SLVRDH  KE L  +G++V+
Sbjct  68   KALGSDLTLIKTHNTISAILDCIRVTGATKVVFNHLYDPVSLVRDHTVKEKLVERGISVQ  127

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            S+N DLLYEPWE+  ++G PFT+F+++W +CL M    E+ +LPP
Sbjct  128  SYNGDLLYEPWEIYCEKGKPFTSFNSYWKKCLDMSI--ESVMLPP  170



>gb|AGC92990.1| cryptochrome 2 [Coffea arabica]
 gb|AGC92993.1| cryptochrome 2 [Coffea arabica]
Length=640

 Score =   216 bits (549),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 97/165 (59%), Positives = 125/165 (76%), Gaps = 1/165 (1%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLR+EDNPALAA  R G +  +FIW P+EEG +YPGRVSRWWLKQSL  L+ SL
Sbjct  8    IVWFRRDLRIEDNPALAAAARDGCVFPVFIWCPKEEGQFYPGRVSRWWLKQSLIQLELSL  67

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            RSLG  L+  ++  ++ +L+E I + GA+ + +NHLYDP+SLVRDH  K+ L   G++V+
Sbjct  68   RSLGAKLVLIKAQSTLEALLECIGAAGATKVVYNHLYDPVSLVRDHDIKQKLGELGISVQ  127

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            S+N +LLYEPWEV  D+GH FTTF AFWD+C+ M  +P A  LPP
Sbjct  128  SYNGELLYEPWEVYGDDGHAFTTFDAFWDKCVHMQNEP-ASQLPP  171



>gb|AAB70435.1| Match to Arabidopsis photolysase (PHH1) gene (gb|X99061) and 
cryptochrome 2 apoprotein (CRY2) (gb|U43397). ESTs gb|W43661 
and gb|Z25638 come from this gene [Arabidopsis thaliana]
 gb|AAT80593.1| cryptochrome 2 [Arabidopsis thaliana]
 gb|AAT80594.1| cryptochrome 2 [Arabidopsis thaliana]
 gb|AAT80595.1| cryptochrome 2 [Arabidopsis thaliana]
 gb|AAT80596.1| cryptochrome 2 [Arabidopsis thaliana]
 gb|AAT80597.1| cryptochrome 2 [Arabidopsis thaliana]
 gb|AAT80607.1| cryptochrome 2 [Arabidopsis thaliana]
 gb|AAT80608.1| cryptochrome 2 [Arabidopsis thaliana]
 gb|AAT80609.1| cryptochrome 2 [Arabidopsis thaliana]
 gb|AAT80610.1| cryptochrome 2 [Arabidopsis thaliana]
 gb|AAT80611.1| cryptochrome 2 [Arabidopsis thaliana]
 gb|AAT80612.1| cryptochrome 2 [Arabidopsis thaliana]
 gb|AAT80613.1| cryptochrome 2 [Arabidopsis thaliana]
 gb|AAT80614.1| cryptochrome 2 [Arabidopsis thaliana]
 gb|AAT80615.1| cryptochrome 2 [Arabidopsis thaliana]
 gb|AAT80616.1| cryptochrome 2 [Arabidopsis thaliana]
 gb|AAT80617.1| cryptochrome 2 [Arabidopsis thaliana]
Length=610

 Score =   215 bits (547),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 92/165 (56%), Positives = 129/165 (78%), Gaps = 2/165 (1%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLR+EDNPALAA    G++  +FIW PEEEG +YPGR SRWW+KQSLAHL  SL
Sbjct  6    IVWFRRDLRIEDNPALAAAAHEGSVFPVFIWCPEEEGQFYPGRASRWWMKQSLAHLSQSL  65

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            ++LG+ L   ++ +++S++++ I+ TGA+ + FNHLYDP+SLVRDH  KE L  +G++V+
Sbjct  66   KALGSDLTLIKTHNTISAILDCIRVTGATKVVFNHLYDPVSLVRDHTVKEKLVERGISVQ  125

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            S+N DLLYEPWE+  ++G PFT+F+++W +CL M    E+ +LPP
Sbjct  126  SYNGDLLYEPWEIYCEKGKPFTSFNSYWKKCLDMSI--ESVMLPP  168



>dbj|BAK61591.1| cryptochrome2a [Glycine soja]
 dbj|BAK61592.1| cryptochrome2a [Glycine soja]
 dbj|BAK61593.1| cryptochrome2a [Glycine soja]
 dbj|BAK61594.1| cryptochrome2a [Glycine soja]
 dbj|BAK61595.1| cryptochrome2a [Glycine soja]
 dbj|BAK61596.1| cryptochrome2a [Glycine soja]
 dbj|BAK61597.1| cryptochrome2a [Glycine soja]
Length=631

 Score =   215 bits (548),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 92/157 (59%), Positives = 122/157 (78%), Gaps = 0/157 (0%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLR+EDNPAL A  + G+++ +++W P+EEG +YPGRVSRWWLKQSLAHLD SL
Sbjct  7    IVWFRRDLRIEDNPALTAAAKEGSVLPVYVWCPKEEGQFYPGRVSRWWLKQSLAHLDQSL  66

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            +SLG+ L+  ++  +  +L+E +K+  A+ + FNHLYDP+SLVRDH  KE L  QG++V+
Sbjct  67   KSLGSRLVLIKTHSTAVALVECVKAIQATKVVFNHLYDPVSLVRDHNIKEKLVEQGISVQ  126

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYD  545
            S+N DLLYEPWEV  + G  FTTF+AFW +CL M  D
Sbjct  127  SYNGDLLYEPWEVNSESGRAFTTFNAFWKKCLHMQMD  163



>ref|XP_006588363.1| PREDICTED: cryptochrome 2 isoform X1 [Glycine max]
 ref|XP_006588364.1| PREDICTED: cryptochrome 2 isoform X2 [Glycine max]
 gb|KHN30568.1| Cryptochrome-2 [Glycine soja]
Length=642

 Score =   215 bits (548),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 92/157 (59%), Positives = 122/157 (78%), Gaps = 0/157 (0%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLR+EDNPAL A  + G+++ +++W P+EEG +YPGRVSRWWLKQSLAHLD SL
Sbjct  7    IVWFRRDLRIEDNPALTAAAKEGSVLPVYVWCPKEEGQFYPGRVSRWWLKQSLAHLDQSL  66

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            +SLG+ L+  ++  +  +L+E +K+  A+ + FNHLYDP+SLVRDH  KE L  QG++V+
Sbjct  67   KSLGSRLVLIKTHSTAVALVECVKAIQATKVVFNHLYDPVSLVRDHNIKEKLVEQGISVQ  126

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYD  545
            S+N DLLYEPWEV  + G  FTTF+AFW +CL M  D
Sbjct  127  SYNGDLLYEPWEVNSESGRAFTTFNAFWKKCLHMQMD  163



>ref|NP_001235220.1| cryptochrome 2 [Glycine max]
 gb|ABD63262.1| cryptochrome 2 [Glycine max]
Length=634

 Score =   215 bits (548),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 92/157 (59%), Positives = 122/157 (78%), Gaps = 0/157 (0%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLR+EDNPAL A  + G+++ +++W P+EEG +YPGRVSRWWLKQSLAHLD SL
Sbjct  7    IVWFRRDLRIEDNPALTAAAKEGSVLPVYVWCPKEEGQFYPGRVSRWWLKQSLAHLDQSL  66

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            +SLG+ L+  ++  +  +L+E +K+  A+ + FNHLYDP+SLVRDH  KE L  QG++V+
Sbjct  67   KSLGSRLVLIKTHSTAVALVECVKAIQATKVVFNHLYDPVSLVRDHNIKEKLVEQGISVQ  126

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYD  545
            S+N DLLYEPWEV  + G  FTTF+AFW +CL M  D
Sbjct  127  SYNGDLLYEPWEVNSESGRAFTTFNAFWKKCLHMQMD  163



>ref|XP_009111108.1| PREDICTED: cryptochrome-2 isoform X3 [Brassica rapa]
 gb|ADM47404.1| cryptochrome 2 [Brassica juncea]
Length=619

 Score =   214 bits (546),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 92/165 (56%), Positives = 128/165 (78%), Gaps = 2/165 (1%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLR+EDNPALAA    G++  +FIW PEEEG +YPGR SRWW+KQSLAHL  SL
Sbjct  8    IVWFRRDLRIEDNPALAAAAHEGSVFPVFIWCPEEEGQFYPGRASRWWMKQSLAHLTQSL  67

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            ++LG+ L   ++ ++VS++++ +++TGA+ + FNHLYDP+SLVRDH  KE L  +G+ V+
Sbjct  68   KALGSELTLIKTHNTVSAILDCVRATGATKVVFNHLYDPVSLVRDHTVKEKLVERGIAVQ  127

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            S+N DLLYEPWE+  ++G PFT F+++W +CL M    E+ +LPP
Sbjct  128  SYNGDLLYEPWEIYCEKGKPFTNFNSYWKKCLDMSV--ESVVLPP  170



>ref|XP_009111107.1| PREDICTED: cryptochrome-2 isoform X2 [Brassica rapa]
Length=620

 Score =   214 bits (546),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 92/165 (56%), Positives = 128/165 (78%), Gaps = 2/165 (1%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLR+EDNPALAA    G++  +FIW PEEEG +YPGR SRWW+KQSLAHL  SL
Sbjct  8    IVWFRRDLRIEDNPALAAAAHEGSVFPVFIWCPEEEGQFYPGRASRWWMKQSLAHLTQSL  67

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            ++LG+ L   ++ ++VS++++ +++TGA+ + FNHLYDP+SLVRDH  KE L  +G+ V+
Sbjct  68   KALGSELTLIKTHNTVSAILDCVRATGATKVVFNHLYDPVSLVRDHTVKEKLVERGIAVQ  127

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            S+N DLLYEPWE+  ++G PFT F+++W +CL M    E+ +LPP
Sbjct  128  SYNGDLLYEPWEIYCEKGKPFTNFNSYWKKCLDMSV--ESVVLPP  170



>emb|CAI63876.1| cryptochrome 2 [Brassica napus]
Length=618

 Score =   214 bits (546),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 91/165 (55%), Positives = 129/165 (78%), Gaps = 2/165 (1%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLR+EDNPALAA    G++  +FIW PEEEG +YPGR SRWW+KQSLAHL  SL
Sbjct  8    IVWFRRDLRIEDNPALAAAAHEGSVFPVFIWCPEEEGQFYPGRASRWWMKQSLAHLTQSL  67

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            ++LG+     ++ ++VS++++ +++TGA+ + FNHLYDP+SLVRDH  KE L  +G++V+
Sbjct  68   KALGSEPTLIKTHNTVSAILDCVRATGATKVVFNHLYDPVSLVRDHTVKEKLVERGISVQ  127

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            S+N DLLYEPWE+  ++G PFT F+++W +CL MP   E+ ++PP
Sbjct  128  SYNGDLLYEPWEIYCEKGKPFTNFNSYWKKCLDMPV--ESVVIPP  170



>gb|ADN34696.1| cryptochrome 2a [Brassica napus]
 gb|AEA29690.1| cryptochrome 2a [Brassica napus]
 emb|CDY15503.1| BnaA08g27870D [Brassica napus]
Length=621

 Score =   214 bits (546),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 92/165 (56%), Positives = 128/165 (78%), Gaps = 2/165 (1%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLR+EDNPALAA    G++  +FIW PEEEG +YPGR SRWW+KQSLAHL  SL
Sbjct  8    IVWFRRDLRIEDNPALAAAAHEGSVFPVFIWCPEEEGQFYPGRASRWWMKQSLAHLTQSL  67

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            ++LG+ L   ++ ++VS++++ +++TGA+ + FNHLYDP+SLVRDH  KE L  +G+ V+
Sbjct  68   KALGSELTLIKTHNTVSAILDCVRATGATKVVFNHLYDPVSLVRDHTVKEKLVERGIAVQ  127

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            S+N DLLYEPWE+  ++G PFT F+++W +CL M    E+ +LPP
Sbjct  128  SYNGDLLYEPWEIYCEKGKPFTNFNSYWKKCLDMSV--ESVVLPP  170



>emb|CDO99229.1| unnamed protein product [Coffea canephora]
Length=647

 Score =   215 bits (547),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 97/165 (59%), Positives = 124/165 (75%), Gaps = 1/165 (1%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLR+EDNPALAA  R G +  +FIW P+EEG +YPGRVSRWWLKQSL  L+ SL
Sbjct  8    IVWFRRDLRIEDNPALAAAARDGCVFPVFIWCPKEEGQFYPGRVSRWWLKQSLIQLEQSL  67

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            RSLG  L+  ++  ++ +L+E I + GA+ + +NHLYDP+SLVRDH  K+ L   G++V+
Sbjct  68   RSLGAKLVLIKAQSTLEALLECIGAAGATKVVYNHLYDPVSLVRDHDIKQKLGELGISVQ  127

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            S+N +LLYEPWEV  D+GH FTTF AFWD C+ M  +P A  LPP
Sbjct  128  SYNGELLYEPWEVHGDDGHAFTTFDAFWDNCVHMQNEP-ASQLPP  171



>ref|XP_009111106.1| PREDICTED: cryptochrome-2 isoform X1 [Brassica rapa]
Length=645

 Score =   215 bits (547),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 92/165 (56%), Positives = 128/165 (78%), Gaps = 2/165 (1%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLR+EDNPALAA    G++  +FIW PEEEG +YPGR SRWW+KQSLAHL  SL
Sbjct  8    IVWFRRDLRIEDNPALAAAAHEGSVFPVFIWCPEEEGQFYPGRASRWWMKQSLAHLTQSL  67

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            ++LG+ L   ++ ++VS++++ +++TGA+ + FNHLYDP+SLVRDH  KE L  +G+ V+
Sbjct  68   KALGSELTLIKTHNTVSAILDCVRATGATKVVFNHLYDPVSLVRDHTVKEKLVERGIAVQ  127

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            S+N DLLYEPWE+  ++G PFT F+++W +CL M    E+ +LPP
Sbjct  128  SYNGDLLYEPWEIYCEKGKPFTNFNSYWKKCLDMSV--ESVVLPP  170



>gb|AAT80598.1| cryptochrome 2 [Arabidopsis thaliana]
 gb|AAT80599.1| cryptochrome 2 [Arabidopsis thaliana]
 gb|AAT80600.1| cryptochrome 2 [Arabidopsis thaliana]
 gb|AAT80601.1| cryptochrome 2 [Arabidopsis thaliana]
 gb|AAT80602.1| cryptochrome 2 [Arabidopsis thaliana]
 gb|AAT80603.1| cryptochrome 2 [Arabidopsis thaliana]
 gb|AAT80604.1| cryptochrome 2 [Arabidopsis thaliana]
 gb|AAT80605.1| cryptochrome 2 [Arabidopsis thaliana]
 gb|AAT80606.1| cryptochrome 2 [Arabidopsis thaliana]
Length=610

 Score =   214 bits (545),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 92/165 (56%), Positives = 128/165 (78%), Gaps = 2/165 (1%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLR+EDNPALAA    G++  +FIW PEEEG +YPGR SRWW+KQSLAHL  SL
Sbjct  6    IVWFRRDLRIEDNPALAAAAHEGSVFPVFIWCPEEEGQFYPGRASRWWMKQSLAHLSQSL  65

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            ++LG+ L   ++ +++S++++ I+ TGA+ + FNHLYDP+SLVRDH  KE L  +G++V 
Sbjct  66   KALGSDLTLIKTHNTISAILDCIRVTGATKVVFNHLYDPVSLVRDHTVKEKLVERGISVS  125

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            S+N DLLYEPWE+  ++G PFT+F+++W +CL M    E+ +LPP
Sbjct  126  SYNGDLLYEPWEIYCEKGKPFTSFNSYWKKCLDMSI--ESVMLPP  168



>gb|ABY77602.1| At1g04400 [Arabidopsis thaliana]
 gb|ABY77604.1| At1g04400 [Arabidopsis thaliana]
 gb|ABY77605.1| At1g04400 [Arabidopsis thaliana]
 gb|ABY77619.1| At1g04400 [Arabidopsis thaliana]
 gb|ABY77624.1| At1g04400 [Arabidopsis thaliana]
 gb|ABY77625.1| At1g04400 [Arabidopsis thaliana]
 gb|ABY77627.1| At1g04400 [Arabidopsis thaliana]
 gb|ABY77630.1| At1g04400 [Arabidopsis thaliana]
 gb|ABY77631.1| At1g04400 [Arabidopsis thaliana]
Length=612

 Score =   214 bits (545),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 92/165 (56%), Positives = 128/165 (78%), Gaps = 2/165 (1%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLR+EDNPALAA    G++  +FIW PEEEG +YPGR SRWW+KQSLAHL  SL
Sbjct  8    IVWFRRDLRIEDNPALAAAAHEGSVFPVFIWCPEEEGQFYPGRASRWWMKQSLAHLSQSL  67

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            ++LG+ L   ++ +++S++++ I+ TGA+ + FNHLYDP+SLVRDH  KE L  +G++V 
Sbjct  68   KALGSDLTLIKTHNTISAILDCIRVTGATKVVFNHLYDPVSLVRDHTVKEKLVERGISVS  127

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            S+N DLLYEPWE+  ++G PFT+F+++W +CL M    E+ +LPP
Sbjct  128  SYNGDLLYEPWEIYCEKGKPFTSFNSYWKKCLDMSI--ESVMLPP  170



>ref|XP_009119306.1| PREDICTED: LOW QUALITY PROTEIN: cryptochrome-1 [Brassica rapa]
Length=610

 Score =   214 bits (545),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 92/165 (56%), Positives = 128/165 (78%), Gaps = 2/165 (1%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLR+EDNPALAA  R G++  +FIW PEEEG ++PGR SRWW+KQSLAHL+ SL
Sbjct  8    IVWFRRDLRIEDNPALAAAAREGSVFPVFIWCPEEEGQFHPGRASRWWMKQSLAHLNQSL  67

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            +SLG+ L   ++  +VS++++ +++TGA+ + FNHLYDP+SLVRDH  KE L  +G++++
Sbjct  68   KSLGSHLTFIKTHSTVSAILDCVRATGATKVVFNHLYDPVSLVRDHNVKEKLMERGISMQ  127

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
             +N DLLYEPWE+  + G PFT+FS +W +CL M    E+ +LPP
Sbjct  128  GYNGDLLYEPWEINSENGKPFTSFSPYWKKCLDMSV--ESVMLPP  170



>gb|AAL16379.1| cryptochrome 2 [Arabidopsis thaliana]
Length=612

 Score =   214 bits (544),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 92/165 (56%), Positives = 128/165 (78%), Gaps = 2/165 (1%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLR+EDNPALAA    G++  +FIW PEEEG +YPGR SRWW+KQSLAHL  SL
Sbjct  8    IVWFRRDLRIEDNPALAAAAHEGSVFPVFIWCPEEEGQFYPGRASRWWMKQSLAHLSQSL  67

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            ++LG+ L   ++ +++S++++ I+ TGA+ + FNHLYDP+SLVRDH  KE L  +G++V 
Sbjct  68   KALGSDLTLIKTHNTISAILDCIRVTGATKVVFNHLYDPVSLVRDHTVKEKLVERGISVS  127

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLPP  569
            S+N DLLYEPWE+  ++G PFT+F+++W +CL M    E+ +LPP
Sbjct  128  SYNGDLLYEPWEIYCEKGKPFTSFNSYWKKCLDMSI--ESVMLPP  170



>ref|XP_002531529.1| DNA photolyase, putative [Ricinus communis]
 gb|EEF30848.1| DNA photolyase, putative [Ricinus communis]
Length=640

 Score =   214 bits (546),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 93/164 (57%), Positives = 123/164 (75%), Gaps = 0/164 (0%)
 Frame = +3

Query  75   IVWFRRDLRVEDNPALAAGVRSGAIIALFIWAPEEEGHYYPGRVSRWWLKQSLAHLDSSL  254
            IVWFRRDLR+EDNPALAA  R G I+ +FIW P+EEG +YPGRVSRWWLKQSLAHL  SL
Sbjct  7    IVWFRRDLRIEDNPALAAAARDGCILPVFIWCPQEEGQFYPGRVSRWWLKQSLAHLGHSL  66

Query  255  RSLGTTLITKRSTDSVSSLIEVIKSTGASHLFFNHLYDPLSLVRDHRAKEILTAQGVTVR  434
            +SLG  L+  ++  ++++L++ +   GA+ + FN LYDP+SLVRDH  KE L   G++++
Sbjct  67   KSLGAELLLIKTHSTLAALLDCVNVIGATKVVFNRLYDPVSLVRDHNIKEKLVELGISIQ  126

Query  435  SFNSDLLYEPWEVVDDEGHPFTTFSAFWDRCLSMPYDPEAPLLP  566
            S+N DLLYEPWE+ D+ GH F TF  +WD+CL M  +P + L P
Sbjct  127  SYNGDLLYEPWEIYDESGHAFMTFDQYWDKCLHMQMEPVSHLPP  170



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 669314531515