BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001N10

Length=520
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDO98827.1|  unnamed protein product                                137   1e-34   Coffea canephora [robusta coffee]
ref|XP_011091009.1|  PREDICTED: ATP-dependent RNA helicase glh-2-...    129   7e-32   Sesamum indicum [beniseed]
ref|XP_004229269.1|  PREDICTED: uncharacterized transmembrane pro...    125   1e-30   Solanum lycopersicum
ref|XP_006354280.1|  PREDICTED: P17/29C-like protein DDB_G0287399...    119   2e-28   Solanum tuberosum [potatoes]
ref|XP_009758238.1|  PREDICTED: uncharacterized transmembrane pro...    101   1e-21   Nicotiana sylvestris
ref|XP_009597159.1|  PREDICTED: putative lysozyme-like protein is...    100   2e-21   Nicotiana tomentosiformis
ref|XP_010667124.1|  PREDICTED: uncharacterized transmembrane pro...  96.3    7e-20   Beta vulgaris subsp. vulgaris [field beet]
gb|EYU45527.1|  hypothetical protein MIMGU_mgv1a005693mg              95.1    1e-19   Erythranthe guttata [common monkey flower]
gb|EYU45529.1|  hypothetical protein MIMGU_mgv1a005693mg              95.1    1e-19   Erythranthe guttata [common monkey flower]
ref|XP_004296868.1|  PREDICTED: mucin-19                              95.1    1e-19   Fragaria vesca subsp. vesca
ref|XP_002516970.1|  chaperone binding protein, putative              92.4    1e-18   Ricinus communis
gb|KEH32306.1|  TPR repeat protein                                    92.0    1e-18   Medicago truncatula
ref|XP_007222128.1|  hypothetical protein PRUPE_ppa004662mg           91.7    3e-18   Prunus persica
ref|XP_007154309.1|  hypothetical protein PHAVU_003G107800g           90.9    5e-18   Phaseolus vulgaris [French bean]
ref|XP_004134227.1|  PREDICTED: uncharacterized protein LOC101207802  90.5    6e-18   Cucumis sativus [cucumbers]
ref|XP_004508191.1|  PREDICTED: P17/29C-like protein DDB_G0287399...  89.7    1e-17   Cicer arietinum [garbanzo]
ref|XP_007035661.1|  Chaperone binding protein, putative              89.7    1e-17   
emb|CAN69220.1|  hypothetical protein VITISV_012016                   89.7    1e-17   Vitis vinifera
ref|XP_004162200.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  89.0    2e-17   
ref|XP_010649572.1|  PREDICTED: uncharacterized protein LOC100255130  89.4    2e-17   Vitis vinifera
ref|XP_008223249.1|  PREDICTED: uncharacterized protein DDB_G0271670  89.0    2e-17   Prunus mume [ume]
ref|XP_010109585.1|  Sperm-associated antigen 1                       87.8    4e-17   Morus notabilis
ref|XP_008353211.1|  PREDICTED: cell wall protein AWA1-like           87.4    6e-17   
ref|XP_008340778.1|  PREDICTED: cell wall protein AWA1                87.8    6e-17   
ref|XP_009370003.1|  PREDICTED: nucleoporin nup189                    87.8    6e-17   Pyrus x bretschneideri [bai li]
ref|XP_008438908.1|  PREDICTED: dentin sialophosphoprotein            87.0    1e-16   Cucumis melo [Oriental melon]
ref|XP_009597160.1|  PREDICTED: jacalin-related lectin 5 isoform X2   84.7    8e-16   Nicotiana tomentosiformis
ref|XP_002467886.1|  hypothetical protein SORBIDRAFT_01g035880        84.0    1e-15   Sorghum bicolor [broomcorn]
ref|XP_011071419.1|  PREDICTED: P17/29C-like protein DDB_G0287399     83.6    2e-15   Sesamum indicum [beniseed]
ref|XP_010039541.1|  PREDICTED: uncharacterized transmembrane pro...  82.8    4e-15   Eucalyptus grandis [rose gum]
gb|KCW84767.1|  hypothetical protein EUGRSUZ_B01574                   82.4    4e-15   Eucalyptus grandis [rose gum]
ref|NP_001149491.1|  TPR domain containing protein                    82.4    4e-15   Zea mays [maize]
gb|KDO71760.1|  hypothetical protein CISIN_1g010705mg                 82.0    6e-15   Citrus sinensis [apfelsine]
ref|XP_006489031.1|  PREDICTED: uncharacterized transmembrane pro...  81.6    7e-15   Citrus sinensis [apfelsine]
ref|XP_006419499.1|  hypothetical protein CICLE_v10004804mg           81.6    7e-15   
ref|XP_010269601.1|  PREDICTED: cell wall protein RBR3-like           80.9    2e-14   Nelumbo nucifera [Indian lotus]
gb|KHG25339.1|  Sperm-associated antigen 1                            80.5    2e-14   Gossypium arboreum [tree cotton]
ref|XP_010259472.1|  PREDICTED: uncharacterized serine-rich prote...  80.5    2e-14   Nelumbo nucifera [Indian lotus]
ref|XP_003550543.1|  PREDICTED: P17/29C-like protein DDB_G0287399...  79.3    4e-14   Glycine max [soybeans]
ref|XP_010524552.1|  PREDICTED: uncharacterized transmembrane pro...  78.2    1e-13   Tarenaya hassleriana [spider flower]
ref|XP_006650059.1|  PREDICTED: flocculation protein FLO11-like       77.8    1e-13   Oryza brachyantha
ref|XP_003528629.1|  PREDICTED: uncharacterized protein DDB_G0271...  77.4    2e-13   Glycine max [soybeans]
gb|KJB72727.1|  hypothetical protein B456_011G193400                  77.0    3e-13   Gossypium raimondii
ref|XP_010487542.1|  PREDICTED: ATP-dependent RNA helicase glh-2-...  76.6    4e-13   Camelina sativa [gold-of-pleasure]
ref|XP_002883024.1|  tetratricopeptide repeat-containing protein      73.9    3e-12   
ref|XP_009414136.1|  PREDICTED: mucin-1-like isoform X2               73.2    5e-12   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDP27843.1|  hypothetical protein JCGZ_18923                       73.2    7e-12   Jatropha curcas
ref|XP_009414135.1|  PREDICTED: mucin-1-like isoform X1               72.8    8e-12   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009417747.1|  PREDICTED: nuclear pore complex protein Nup2...  72.8    9e-12   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003557950.1|  PREDICTED: clathrin coat assembly protein AP180  70.9    3e-11   Brachypodium distachyon [annual false brome]
gb|EMT10127.1|  Sperm-associated antigen 1                            70.5    5e-11   
emb|CDY28338.1|  BnaC01g35080D                                        69.3    1e-10   Brassica napus [oilseed rape]
emb|CDY34976.1|  BnaA01g27580D                                        68.6    2e-10   Brassica napus [oilseed rape]
ref|XP_009114517.1|  PREDICTED: uncharacterized transmembrane pro...  68.6    2e-10   Brassica rapa
dbj|BAJ85500.1|  predicted protein                                    68.2    3e-10   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002315491.2|  hypothetical protein POPTR_0010s00910g           67.8    4e-10   
ref|XP_004980338.1|  PREDICTED: spore coat protein SP96-like          64.3    1e-09   Setaria italica
ref|XP_004984439.1|  PREDICTED: mucin-19-like                         65.5    2e-09   Setaria italica
ref|XP_008789905.1|  PREDICTED: nuclear pore complex protein Nup2...  65.5    2e-09   Phoenix dactylifera
ref|XP_011009082.1|  PREDICTED: pro-resilin                           65.1    3e-09   Populus euphratica
dbj|BAB02768.1|  unnamed protein product                              64.3    4e-09   Arabidopsis thaliana [mouse-ear cress]
ref|NP_188298.3|  tetratricopeptide repeat domain-containing protein  64.3    5e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010504635.1|  PREDICTED: fibroin heavy chain-like              63.9    7e-09   Camelina sativa [gold-of-pleasure]
ref|XP_010465698.1|  PREDICTED: P17/29C-like protein DDB_G0287399     63.9    7e-09   Camelina sativa [gold-of-pleasure]
ref|NP_851004.1|  tetratricopeptide repeat domain-containing protein  63.9    7e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006297499.1|  hypothetical protein CARUB_v10013518mg           63.9    9e-09   Capsella rubella
ref|XP_006406809.1|  hypothetical protein EUTSA_v10020624mg           62.8    2e-08   Eutrema salsugineum [saltwater cress]
gb|KFK39022.1|  hypothetical protein AALP_AA3G190400                  62.8    2e-08   Arabis alpina [alpine rockcress]
ref|XP_010938369.1|  PREDICTED: nuclear pore complex protein Nup2...  62.0    4e-08   Elaeis guineensis
emb|CBI22961.3|  unnamed protein product                              58.9    3e-07   Vitis vinifera
ref|NP_001050066.1|  Os03g0340700                                     56.6    2e-06   
gb|EAY89947.1|  hypothetical protein OsI_11499                        55.1    6e-06   Oryza sativa Indica Group [Indian rice]
gb|KHN03338.1|  Sperm-associated antigen 1                            53.5    2e-05   Glycine soja [wild soybean]
ref|XP_002992259.1|  hypothetical protein SELMODRAFT_448707           50.1    3e-04   Selaginella moellendorffii
ref|XP_002987750.1|  hypothetical protein SELMODRAFT_447095           48.5    7e-04   Selaginella moellendorffii
ref|XP_008784777.1|  PREDICTED: sperm-associated antigen 1-like       48.5    0.001   



>emb|CDO98827.1| unnamed protein product [Coffea canephora]
Length=505

 Score =   137 bits (344),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 91/139 (65%), Positives = 98/139 (71%), Gaps = 21/139 (15%)
 Frame = +1

Query  148  MNSNYGKSNMKSGSMN--DFDFGLNTGCSRSLNDQKNQTss--ysssaqsKPYGTASWTN  315
            MNSNYGKSN KSGS+N  DFD GL    SRSLNDQKNQTSS    SSAQ+KP  T SWT+
Sbjct  1    MNSNYGKSNTKSGSLNSFDFDLGLGKSGSRSLNDQKNQTSSYGSYSSAQAKPSTTPSWTH  60

Query  316  QSNTNKASWTHQPV--------GSLSGPTSMVGDIFGKSWGSAAPS---NTGSASTVGIV  462
            Q   NK SWTHQP         GSLSGPTSMVGDIFGKSWGS+AP+   N+GS      V
Sbjct  61   QP-INKPSWTHQPAAPAQSAGTGSLSGPTSMVGDIFGKSWGSSAPASSLNSGSG-----V  114

Query  463  TKKDPNLFGDLVNSALRQN  519
              KDPNLFGDL+ SAL QN
Sbjct  115  VNKDPNLFGDLLGSALGQN  133



>ref|XP_011091009.1| PREDICTED: ATP-dependent RNA helicase glh-2-like [Sesamum indicum]
Length=523

 Score =   129 bits (324),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 87/140 (62%), Positives = 102/140 (73%), Gaps = 19/140 (14%)
 Frame = +1

Query  148  MNSNYGKSNMKSGSMN--DFDFGLNTGCSRSLNDQKNQTssyss------saqsKPYGTA  303
            MNS+YGKSN KSGS+N  DFD GL +G S+S+NDQKNQTSSYSS      SAQ KP  ++
Sbjct  1    MNSSYGKSNSKSGSINAFDFDLGLGSGRSKSMNDQKNQTSSYSSTPYTYSSAQQKPNTSS  60

Query  304  SWTNQSNTNKASWTHQPV--------GSLSGPTSMVGDIFGKSWGSAAPSNTGSASTVGI  459
            SWT+Q   NK +WTHQP         GSLSGPTSMVGDIFGKSW S+A S +G  S VGI
Sbjct  61   SWTHQ--PNKPAWTHQPATSVQSGMAGSLSGPTSMVGDIFGKSWNSSATSGSG-VSGVGI  117

Query  460  VTKKDPNLFGDLVNSALRQN  519
            V  K+PNLFGDL++SA+  N
Sbjct  118  VNSKNPNLFGDLLSSAMGMN  137



>ref|XP_004229269.1| PREDICTED: uncharacterized transmembrane protein DDB_G0289901 
[Solanum lycopersicum]
Length=533

 Score =   125 bits (315),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 89/135 (66%), Positives = 101/135 (75%), Gaps = 18/135 (13%)
 Frame = +1

Query  148  MNSNYGKSNMKSGSMN--DFDFGLNTGCSRSLNDQKNQTssysssa--------qsKPYG  297
            MNSNYGKS     SMN  DFD G+N+G SRSLNDQKN+TSSYSSS+        QSKP  
Sbjct  1    MNSNYGKSG---SSMNRFDFDLGMNSGRSRSLNDQKNKTSSYSSSSSSYTYSSTQSKPNS  57

Query  298  TASWTNQSNTNKASWTHQPVGSLSGPTSMVGDIFGKSWGSAAPSNTGS-ASTVGIVTKKD  474
             +SWT     NK+SWTHQPVGSLSGP SM GDIFGKSWGS+APS T + AS+VG+ T K+
Sbjct  58   GSSWTQ---PNKSSWTHQPVGSLSGPNSMAGDIFGKSWGSSAPSTTSNVASSVGM-TNKN  113

Query  475  PNLFGDLVNSALRQN  519
            PNLFGDLV+SAL  N
Sbjct  114  PNLFGDLVSSALGGN  128



>ref|XP_006354280.1| PREDICTED: P17/29C-like protein DDB_G0287399-like [Solanum tuberosum]
Length=503

 Score =   119 bits (298),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 83/130 (64%), Positives = 95/130 (73%), Gaps = 14/130 (11%)
 Frame = +1

Query  148  MNSNYGKSNMKSGSMNDFDFGLNTGCSRSLNDQKNQTssysssa--------qsKPYGTA  303
            MNSNYGKS     +  DFD GLN+G SRSLNDQKN+TSSYSSS+        QSKP   +
Sbjct  1    MNSNYGKSGSSVNNF-DFDLGLNSGRSRSLNDQKNKTSSYSSSSSSYTYSSTQSKPNSGS  59

Query  304  SWTNQSNTNKASWTHQPVGSLSGPTSMVGDIFGKSWGSAAPSNTGS-ASTVGIVTKKDPN  480
            SWT     NK++WTHQPVGS SGP SM GDIFGKSWGS+ PS T + AS+VGI   K+PN
Sbjct  60   SWTQ---PNKSTWTHQPVGSSSGPNSMAGDIFGKSWGSSTPSTTSNVASSVGIAN-KNPN  115

Query  481  LFGDLVNSAL  510
            LFGDLV+SAL
Sbjct  116  LFGDLVSSAL  125



>ref|XP_009758238.1| PREDICTED: uncharacterized transmembrane protein DDB_G0289901 
[Nicotiana sylvestris]
Length=514

 Score =   101 bits (251),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 81/130 (62%), Positives = 96/130 (74%), Gaps = 17/130 (13%)
 Frame = +1

Query  148  MNSNYGKSNMKSGSMNDFDFGLNTGCSRS-LNDQKNQTssysssaqs-----KPYGTASW  309
            MNSNYGKS    GS  DFD  LN+G SRS LNDQKN+TSSYSSS+ S     KP   +SW
Sbjct  1    MNSNYGKS----GSSFDFDLSLNSGRSRSSLNDQKNKTSSYSSSSSSYTYSSKPNPGSSW  56

Query  310  TNQSNTNKASWTHQPVGSLSGPTSMVGDIFGKSWGSAAPSNTGSA---STVGIVTKKDPN  480
            T     NK++WTHQPVGSLSGP SMVGDIFGKSWGS++ + + ++   ST+GI   K+PN
Sbjct  57   TQ---PNKSTWTHQPVGSLSGPNSMVGDIFGKSWGSSSAAPSSTSNVTSTIGIAN-KNPN  112

Query  481  LFGDLVNSAL  510
            LFGDLV+SAL
Sbjct  113  LFGDLVSSAL  122



>ref|XP_009597159.1| PREDICTED: putative lysozyme-like protein isoform X1 [Nicotiana 
tomentosiformis]
Length=515

 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 80/130 (62%), Positives = 97/130 (75%), Gaps = 17/130 (13%)
 Frame = +1

Query  148  MNSNYGKSNMKSGSMNDFDFGLNTGCSRS-LNDQKNQTssysssaqs-----KPYGTASW  309
            MNSNYGKS    G+  DFD GLN+G SRS LNDQKN+TSSYSSS+ S     KP   +SW
Sbjct  1    MNSNYGKS----GNSFDFDMGLNSGRSRSSLNDQKNKTSSYSSSSSSYTYSSKPNSGSSW  56

Query  310  TNQSNTNKASWTHQPVGSLSGPTSMVGDIFGKSWGSAAPSNTGSAS---TVGIVTKKDPN  480
            T     NK++WTHQPVGSLSGP SMVGDIFGKSWGS++ + + +++   T+GI   K+PN
Sbjct  57   TQ---PNKSTWTHQPVGSLSGPNSMVGDIFGKSWGSSSAAPSSTSNVTPTIGIAN-KNPN  112

Query  481  LFGDLVNSAL  510
            LFGDLV+SAL
Sbjct  113  LFGDLVSSAL  122



>ref|XP_010667124.1| PREDICTED: uncharacterized transmembrane protein DDB_G0289901 
[Beta vulgaris subsp. vulgaris]
Length=507

 Score = 96.3 bits (238),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 70/142 (49%), Positives = 88/142 (62%), Gaps = 25/142 (18%)
 Frame = +1

Query  148  MNSNYGKSNMKSGSMNDFDFGLNTGCSRS--LNDQKNQTssysssaqsKPYGTASWTNQS  321
            MNSNYGK+     SMN+FDF L  G +RS  LNDQKN ++S S+S       T S++   
Sbjct  1    MNSNYGKN-----SMNNFDFDLGIGSNRSKSLNDQKNNSNSNSNSHSYMSSKTPSFSQPK  55

Query  322  --------NTNKASWTHQPVGS--------LSGPTSMVGDIFGKSWGSAAPSNTGSASTV  453
                       K SWTHQP  S        L GP++MVGDIFGK+W SAAP+ TG ++ +
Sbjct  56   PGATTPYWQPGKPSWTHQPAPSNTGVTRSELGGPSTMVGDIFGKNWNSAAPT-TGQSTNI  114

Query  454  GIVTKKDPNLFGDLVNSALRQN  519
            G+V  K+PNLFGDLV+SAL QN
Sbjct  115  GVV-NKNPNLFGDLVSSALGQN  135



>gb|EYU45527.1| hypothetical protein MIMGU_mgv1a005693mg [Erythranthe guttata]
 gb|EYU45528.1| hypothetical protein MIMGU_mgv1a005693mg [Erythranthe guttata]
Length=474

 Score = 95.1 bits (235),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 69/136 (51%), Positives = 89/136 (65%), Gaps = 16/136 (12%)
 Frame = +1

Query  148  MNSNYGKSNMKSGSMN--DFDFGLNTGCSRSLNDQKNQ--TssysssaqsKPYGTASWTN  315
            MNS+YGKSN KS S N  DFD GL +G  + +ND K+Q  + +YSS+ Q KP  T SW++
Sbjct  1    MNSSYGKSNNKSASTNAFDFDLGLGSGRPKPMNDPKSQASSYTYSSTPQQKPNTTPSWSH  60

Query  316  QSNTNKASWTHQPV--------GSLSGPTSMVGDIFGKSWGSAAPSNTGSASTVGIVT-K  468
            Q    K +WTHQP         GSLSGPTSMVGDIFGKSW S+A S++  +     +   
Sbjct  61   QP---KPAWTHQPAAPVQSGVAGSLSGPTSMVGDIFGKSWNSSASSSSSVSGVGIGIVNN  117

Query  469  KDPNLFGDLVNSALRQ  516
            K+PNLFGDL+ S++ Q
Sbjct  118  KNPNLFGDLLTSSIGQ  133



>gb|EYU45529.1| hypothetical protein MIMGU_mgv1a005693mg [Erythranthe guttata]
Length=460

 Score = 95.1 bits (235),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 69/136 (51%), Positives = 89/136 (65%), Gaps = 16/136 (12%)
 Frame = +1

Query  148  MNSNYGKSNMKSGSMN--DFDFGLNTGCSRSLNDQKNQ--TssysssaqsKPYGTASWTN  315
            MNS+YGKSN KS S N  DFD GL +G  + +ND K+Q  + +YSS+ Q KP  T SW++
Sbjct  1    MNSSYGKSNNKSASTNAFDFDLGLGSGRPKPMNDPKSQASSYTYSSTPQQKPNTTPSWSH  60

Query  316  QSNTNKASWTHQPV--------GSLSGPTSMVGDIFGKSWGSAAPSNTGSASTVGIVT-K  468
            Q    K +WTHQP         GSLSGPTSMVGDIFGKSW S+A S++  +     +   
Sbjct  61   QP---KPAWTHQPAAPVQSGVAGSLSGPTSMVGDIFGKSWNSSASSSSSVSGVGIGIVNN  117

Query  469  KDPNLFGDLVNSALRQ  516
            K+PNLFGDL+ S++ Q
Sbjct  118  KNPNLFGDLLTSSIGQ  133



>ref|XP_004296868.1| PREDICTED: mucin-19 [Fragaria vesca subsp. vesca]
Length=479

 Score = 95.1 bits (235),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 65/126 (52%), Positives = 78/126 (62%), Gaps = 26/126 (21%)
 Frame = +1

Query  148  MNSNYGKSNMKSGSMNDFDFGLNTGCSRSLNDQKNQTssysssaqsKPYGTASWTNQSNT  327
            MNSN+           DFD GL +   RSLNDQKN+TSS+S+ +  +P    +W      
Sbjct  1    MNSNF-----------DFDLGLGSNRPRSLNDQKNKTSSFSTPS--QPPSKPAW----QP  43

Query  328  NKASWTHQPVGS----LSGPTSMVGDIFGKSWGSAAPSNTGSASTVGI-VTKKDPNLFGD  492
            NK SWTHQP  +    L+GPTSMVGDIFGKSW S AP    S ST  I V  K+PNLFGD
Sbjct  44   NKTSWTHQPAPTQTTPLNGPTSMVGDIFGKSWASTAP----SVSTTPIAVVNKNPNLFGD  99

Query  493  LVNSAL  510
            LV+SA+
Sbjct  100  LVSSAM  105



>ref|XP_002516970.1| chaperone binding protein, putative [Ricinus communis]
 gb|EEF45584.1| chaperone binding protein, putative [Ricinus communis]
Length=508

 Score = 92.4 bits (228),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 74/131 (56%), Positives = 85/131 (65%), Gaps = 16/131 (12%)
 Frame = +1

Query  148  MNSNYGKSNMKSGSMNDF--DFGLNTGCSRSLNDQKNQTssysssaqsKPYGTASWTNQS  321
            MNSNYGK    SGS+N+F  DFG+ +  S+SLNDQKNQTSS  SS  S     +    QS
Sbjct  1    MNSNYGKGT--SGSLNNFNFDFGIGSNRSKSLNDQKNQTSSSYSSYSSSTTTQSKPAWQS  58

Query  322  NTNKASWTHQPVGS------LSGPTSMVGDIFGKSWGSAAPSNTGSASTVGIVTKKDPNL  483
              NK SWTHQP  S      L+GP+SMVGDI GKSW S      GS S +GIV +K PNL
Sbjct  59   --NKPSWTHQPAPSQSTRPGLNGPSSMVGDISGKSWNSMG---VGSGSGLGIV-EKSPNL  112

Query  484  FGDLVNSALRQ  516
            FGDLV+SAL Q
Sbjct  113  FGDLVSSALGQ  123



>gb|KEH32306.1| TPR repeat protein [Medicago truncatula]
Length=467

 Score = 92.0 bits (227),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 65/134 (49%), Positives = 78/134 (58%), Gaps = 25/134 (19%)
 Frame = +1

Query  148  MNSNYGKSN---MKSGSMNDFDFGLNTGC----SRSLNDQKNQTssysssaqsKPYGTAS  306
            MNSNYGK N     S S+N+F+F L+ G     S+SL DQK      +S      Y T S
Sbjct  1    MNSNYGKPNPPKQSSASLNNFNFDLDLGIGSNRSKSLKDQKTPNPPSNS------YSTPS  54

Query  307  WTNQSNTNKASWTHQPVGSLSG----PTSMVGDIFGKSWGSAAPSNTGSASTVGIVTKKD  474
            +   S+     WTHQPV + +G    P SMVGDIFGKSWGS  P    S  ++GIV  K+
Sbjct  55   Y---SSAQPKKWTHQPVQTPAGLPGAPPSMVGDIFGKSWGSTQP----SGPSIGIVN-KN  106

Query  475  PNLFGDLVNSALRQ  516
            PNLFGDLV SAL Q
Sbjct  107  PNLFGDLVTSALGQ  120



>ref|XP_007222128.1| hypothetical protein PRUPE_ppa004662mg [Prunus persica]
 gb|EMJ23327.1| hypothetical protein PRUPE_ppa004662mg [Prunus persica]
Length=497

 Score = 91.7 bits (226),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 65/128 (51%), Positives = 79/128 (62%), Gaps = 24/128 (19%)
 Frame = +1

Query  148  MNSNYGKSNMKSGSMNDFDFGLNTGCSRSLNDQKNQTssysssaqsKPYGTASWTNQSNT  327
            MNSN+           DFD GL +   +SLNDQKN+TSS+SS+A  +     +W  Q+N 
Sbjct  1    MNSNF-----------DFDLGLGSSRPKSLNDQKNKTSSFSSTATGQ--SRPAWQPQTN-  46

Query  328  NKASWTHQPV-------GSLSGPTSMVGDIFGKSWGSAAPSNTGSASTVGIVTKKDPNLF  486
               SWTHQP        G  + PTSMVGDIFGKSWGSAAPS    +ST   V  K+PNLF
Sbjct  47   KTTSWTHQPTPAQTVRPGLTNAPTSMVGDIFGKSWGSAAPS---VSSTPIAVVNKNPNLF  103

Query  487  GDLVNSAL  510
            GDLV+SA+
Sbjct  104  GDLVSSAM  111



>ref|XP_007154309.1| hypothetical protein PHAVU_003G107800g [Phaseolus vulgaris]
 gb|ESW26303.1| hypothetical protein PHAVU_003G107800g [Phaseolus vulgaris]
Length=551

 Score = 90.9 bits (224),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 65/136 (48%), Positives = 85/136 (63%), Gaps = 16/136 (12%)
 Frame = +1

Query  145  EMNSNYGKSNM---KSGSMN----DFDFGLNTGCSRSLNDQKNQTssysssaqsKPYGTA  303
            EMNSNYG+S+     S S+N    DFD G+ +   +SLNDQKN   SYS++  +  Y   
Sbjct  64   EMNSNYGQSSTNKSPSVSLNNLNFDFDLGIGSNRPKSLNDQKNPKPSYSTTTTTSSYSYP  123

Query  304  SWTNQSNTNKASWTHQPVGSLS-----GPTSMVGDIFGKSWGSAAPSNTGSASTVGIVTK  468
              + Q N  + SWTHQP  + +     GP SMVGDIFGKSWG+  PS   ++  +GI+  
Sbjct  124  YSSAQPN-KQPSWTHQPAPTQTTSLPGGPPSMVGDIFGKSWGTTQPST--ASKNIGIIN-  179

Query  469  KDPNLFGDLVNSALRQ  516
            K+PNLFGDLV+SAL Q
Sbjct  180  KNPNLFGDLVSSALGQ  195



>ref|XP_004134227.1| PREDICTED: uncharacterized protein LOC101207802 [Cucumis sativus]
 gb|KGN57138.1| hypothetical protein Csa_3G164570 [Cucumis sativus]
Length=497

 Score = 90.5 bits (223),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 66/130 (51%), Positives = 81/130 (62%), Gaps = 20/130 (15%)
 Frame = +1

Query  148  MNSNYGKSNMKSGSMNDFDFGLNTGCSRSLNDQKNQTssysssaqsKPYGTASWTNQS-N  324
            MNSN+GK+        DFD GL +  S+SLNDQKN+T SYSS   S    +++ T  +  
Sbjct  1    MNSNFGKNF-------DFDLGLGSSGSKSLNDQKNKTPSYSSYTPSASSYSSTPTRPAWQ  53

Query  325  TNKASWTHQPVGSLSG-------PTSMVGDIFGKSWGSAAPSNTGSASTVGI-VTKKDPN  480
             NK SWTHQP  + +        P SMVGDIFGK+WGS A     SAST GI + +K+PN
Sbjct  54   PNKPSWTHQPAMNQAARPNLSNSPASMVGDIFGKTWGSKA----TSASTTGIGIAEKNPN  109

Query  481  LFGDLVNSAL  510
            LFGDLV SAL
Sbjct  110  LFGDLVGSAL  119



>ref|XP_004508191.1| PREDICTED: P17/29C-like protein DDB_G0287399-like [Cicer arietinum]
Length=467

 Score = 89.7 bits (221),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 64/134 (48%), Positives = 79/134 (59%), Gaps = 24/134 (18%)
 Frame = +1

Query  148  MNSNYGKSNMK---SGSMNDFDFGLNTGC----SRSLNDQKNQTssysssaqsKPYGTAS  306
            MNSNYGKSN +   S S+N+F+F L+ G     S+SL DQK       S         +S
Sbjct  1    MNSNYGKSNPQKPSSVSLNNFNFDLDLGIGSNRSKSLKDQKTPNPPSYS--------NSS  52

Query  307  WTNQSNTNKASWTHQPVGSLSG----PTSMVGDIFGKSWGSAAPSNTGSASTVGIVTKKD  474
              + +   K +WTHQPV + +G    P SMVGDIFGKSWGS  P    S  ++GIV  K+
Sbjct  53   SYSSAQPKKTTWTHQPVQTPAGLPGAPPSMVGDIFGKSWGSTQP----SGPSIGIVN-KN  107

Query  475  PNLFGDLVNSALRQ  516
            PNLFGDLV SAL Q
Sbjct  108  PNLFGDLVTSALGQ  121



>ref|XP_007035661.1| Chaperone binding protein, putative [Theobroma cacao]
 gb|EOY06587.1| Chaperone binding protein, putative [Theobroma cacao]
Length=500

 Score = 89.7 bits (221),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 71/136 (52%), Positives = 84/136 (62%), Gaps = 23/136 (17%)
 Frame = +1

Query  148  MNSNYGKSNMKSGSMNDFDFGLNTGCSRSLNDQKNQ-------TssysssaqsKPYGTAS  306
            MNSNYG+ +  S    DFD GL +G S+S+NDQKNQ        SS +S+AQSKP    S
Sbjct  1    MNSNYGRGSSGSLKNFDFDLGLGSGRSKSMNDQKNQTTSSFSSYSSTTSTAQSKP----S  56

Query  307  WTNQSNTNKASWTHQPVGS------LSGPTSMVGDIFGKSWGSAAPSNTGSASTVGIVTK  468
            W      NK SWTHQP  +      LSGPTSMVGDIFGKSW  A+   +GS S+   +  
Sbjct  57   W----QPNKPSWTHQPAANQANQSGLSGPTSMVGDIFGKSW--ASSGPSGSHSSGIGIVN  110

Query  469  KDPNLFGDLVNSALRQ  516
            K PNLF DLV+SAL Q
Sbjct  111  KTPNLFEDLVSSALGQ  126



>emb|CAN69220.1| hypothetical protein VITISV_012016 [Vitis vinifera]
Length=532

 Score = 89.7 bits (221),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 70/135 (52%), Positives = 80/135 (59%), Gaps = 26/135 (19%)
 Frame = +1

Query  148  MNSNYGK---SNMKSGSMN----DFDFGLNTGCSRSLNDQKNQTssysssaqsKPYGTAS  306
            MNSNYGK   S    GS+      FDFGL +  SR LNDQK Q+S  SS +  + +    
Sbjct  1    MNSNYGKTTNSQRGGGSVPLNNYQFDFGLGSSRSRPLNDQKQQSSHSSSFSAPQSH---P  57

Query  307  WTNQSNTNKASWTHQPV-------GSLSGPTSMVGDIFGKSWGSAAPSNTGSASTVGIVT  465
            W      NK SWTHQP        GS +GP SMVGDIFGKSW   APS  G +S +GIV 
Sbjct  58   W----QPNKPSWTHQPAPTQTTRSGSSNGPGSMVGDIFGKSW---APS-PGPSSGIGIV-  108

Query  466  KKDPNLFGDLVNSAL  510
             K+PNLFGDLV SAL
Sbjct  109  DKNPNLFGDLVGSAL  123



>ref|XP_004162200.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101223791 
[Cucumis sativus]
Length=497

 Score = 89.0 bits (219),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 65/130 (50%), Positives = 80/130 (62%), Gaps = 20/130 (15%)
 Frame = +1

Query  148  MNSNYGKSNMKSGSMNDFDFGLNTGCSRSLNDQKNQTssysssaqsKPYGTASWTNQS-N  324
            MNSN+GK+        DFD GL +  S+SLNDQKN+T SYSS   S    +++ T  +  
Sbjct  1    MNSNFGKNF-------DFDLGLGSSGSKSLNDQKNKTPSYSSYTPSASSYSSTPTRPAWQ  53

Query  325  TNKASWTHQPVGSLSG-------PTSMVGDIFGKSWGSAAPSNTGSASTVGI-VTKKDPN  480
             NK SWTHQP  + +        P SMVGDIFGK+WGS A     SAST GI + +K+PN
Sbjct  54   PNKPSWTHQPAMNQAARPNLSNSPASMVGDIFGKTWGSKA----TSASTTGIGIAEKNPN  109

Query  481  LFGDLVNSAL  510
            LFGD V SAL
Sbjct  110  LFGDFVGSAL  119



>ref|XP_010649572.1| PREDICTED: uncharacterized protein LOC100255130 [Vitis vinifera]
Length=532

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 69/135 (51%), Positives = 79/135 (59%), Gaps = 26/135 (19%)
 Frame = +1

Query  148  MNSNYGK---SNMKSGSMN----DFDFGLNTGCSRSLNDQKNQTssysssaqsKPYGTAS  306
            MNSNYGK   S    GS+      FDFGL +  SR LNDQK Q+S  SS +  + +    
Sbjct  1    MNSNYGKTTNSQRGGGSVPLNNYQFDFGLGSSRSRPLNDQKQQSSHSSSFSAPQSH---P  57

Query  307  WTNQSNTNKASWTHQPV-------GSLSGPTSMVGDIFGKSWGSAAPSNTGSASTVGIVT  465
            W      NK SWTHQP        G  +GP SMVGDIFGKSW   APS  G +S +GIV 
Sbjct  58   W----QPNKPSWTHQPAPTQTTRSGPSNGPASMVGDIFGKSW---APS-PGPSSGIGIV-  108

Query  466  KKDPNLFGDLVNSAL  510
             K+PNLFGDLV SAL
Sbjct  109  DKNPNLFGDLVGSAL  123



>ref|XP_008223249.1| PREDICTED: uncharacterized protein DDB_G0271670 [Prunus mume]
Length=491

 Score = 89.0 bits (219),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 62/128 (48%), Positives = 75/128 (59%), Gaps = 30/128 (23%)
 Frame = +1

Query  148  MNSNYGKSNMKSGSMNDFDFGLNTGCSRSLNDQKNQTssysssaqsKPYGTASWTNQSNT  327
            MNSN+           DFD GL +   +SLNDQKN+TS+  S    +P    +W  Q+N 
Sbjct  1    MNSNF-----------DFDLGLGSSRPKSLNDQKNKTSTGQS----RP----AWQPQTN-  40

Query  328  NKASWTHQPV-------GSLSGPTSMVGDIFGKSWGSAAPSNTGSASTVGIVTKKDPNLF  486
               SWTHQP        G  + PTSMVGDIFGKSWGS APS    +ST   V  K+PNLF
Sbjct  41   KTTSWTHQPAPAQTVRPGLTNAPTSMVGDIFGKSWGSTAPS---VSSTPIAVVNKNPNLF  97

Query  487  GDLVNSAL  510
            GDLV+SA+
Sbjct  98   GDLVSSAM  105



>ref|XP_010109585.1| Sperm-associated antigen 1 [Morus notabilis]
 gb|EXC23294.1| Sperm-associated antigen 1 [Morus notabilis]
Length=467

 Score = 87.8 bits (216),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 64/124 (52%), Positives = 78/124 (63%), Gaps = 14/124 (11%)
 Frame = +1

Query  148  MNSNYGKSNMKSGSMNDFDFGLNTGCSRSLNDQKNQTssysssaqsKPYGTASWTNQSNT  327
            MNSN+GK+        DFD GL +  + SLND+KN+ SSYSS +      +A        
Sbjct  1    MNSNFGKNF-------DFDLGLGSSRTTSLNDKKNKNSSYSSYSSYSSSSSAQSKPAWQP  53

Query  328  NKASWTHQPVGSLSGPTSMVGDIFGKSWGSAAPSNTGSASTVGIVTKKDPNLFGDLVNSA  507
             K SWTHQP  + S P+SMVGDIFGKSW S+ PS     S +GIV  K+PNLFGDLVNSA
Sbjct  54   TKPSWTHQPAAAPSQPSSMVGDIFGKSW-SSDPS-----SGIGIV-DKNPNLFGDLVNSA  106

Query  508  LRQN  519
            L Q+
Sbjct  107  LGQD  110



>ref|XP_008353211.1| PREDICTED: cell wall protein AWA1-like [Malus domestica]
Length=440

 Score = 87.4 bits (215),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 59/128 (46%), Positives = 76/128 (59%), Gaps = 23/128 (18%)
 Frame = +1

Query  148  MNSNYGKSNMKSGSMNDFDFGLNTGCSRSLNDQKNQTssysssaqsKPYGTASWTNQSNT  327
            MNSN+           DFD GL +   +SLNDQKN+TSS+SS+  ++     SW   +  
Sbjct  1    MNSNF-----------DFDLGLGSSRPKSLNDQKNKTSSFSSATAAQ--SRPSWQQPTAG  47

Query  328  NKASWTHQPV-------GSLSGPTSMVGDIFGKSWGSAAPSNTGSASTVGIVTKKDPNLF  486
               SWTHQP        G  + PTSMVGDIFGK+W SAAP+ + +  T   V  K+PNLF
Sbjct  48   RTTSWTHQPAPTQTARPGLTNAPTSMVGDIFGKTWTSAAPAVSATPIT---VVNKNPNLF  104

Query  487  GDLVNSAL  510
            GDLV+SA+
Sbjct  105  GDLVSSAM  112



>ref|XP_008340778.1| PREDICTED: cell wall protein AWA1 [Malus domestica]
Length=491

 Score = 87.8 bits (216),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 59/128 (46%), Positives = 76/128 (59%), Gaps = 23/128 (18%)
 Frame = +1

Query  148  MNSNYGKSNMKSGSMNDFDFGLNTGCSRSLNDQKNQTssysssaqsKPYGTASWTNQSNT  327
            MNSN+           DFD GL +   +SLNDQKN+TSS+SS+  ++     SW   +  
Sbjct  1    MNSNF-----------DFDLGLGSSRPKSLNDQKNKTSSFSSATAAQ--SRPSWQQPTAG  47

Query  328  NKASWTHQPV-------GSLSGPTSMVGDIFGKSWGSAAPSNTGSASTVGIVTKKDPNLF  486
               SWTHQP        G  + PTSMVGDIFGK+W SAAP+ + +  T   V  K+PNLF
Sbjct  48   RTTSWTHQPAPTQTARPGLTNAPTSMVGDIFGKTWTSAAPAVSATPIT---VVNKNPNLF  104

Query  487  GDLVNSAL  510
            GDLV+SA+
Sbjct  105  GDLVSSAM  112



>ref|XP_009370003.1| PREDICTED: nucleoporin nup189 [Pyrus x bretschneideri]
Length=492

 Score = 87.8 bits (216),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 60/128 (47%), Positives = 77/128 (60%), Gaps = 22/128 (17%)
 Frame = +1

Query  148  MNSNYGKSNMKSGSMNDFDFGLNTGCSRSLNDQKNQTssysssaqsKPYGTASWTNQSNT  327
            MNSN+           DFD GL +   +SLNDQKN+TSS++SSA +      +W   + +
Sbjct  1    MNSNF-----------DFDLGLGSSRPKSLNDQKNKTSSFTSSATAA-QSRPTWQQPTAS  48

Query  328  NKASWTHQPV-------GSLSGPTSMVGDIFGKSWGSAAPSNTGSASTVGIVTKKDPNLF  486
               SWTHQP        G  + PTSMVGDIFGKSW SAAP+ + +  T   V  K+PNLF
Sbjct  49   RTTSWTHQPAPTQSARPGLTNAPTSMVGDIFGKSWTSAAPAVSATPIT---VVNKNPNLF  105

Query  487  GDLVNSAL  510
            GDLV+SA+
Sbjct  106  GDLVSSAM  113



>ref|XP_008438908.1| PREDICTED: dentin sialophosphoprotein [Cucumis melo]
Length=498

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 65/129 (50%), Positives = 82/129 (64%), Gaps = 18/129 (14%)
 Frame = +1

Query  148  MNSNYGKSNMKSGSMNDFDFGLNTGCSRSLNDQKNQTssysssaqsKPYGTASWTNQS-N  324
            MNSN+GK+        +FD GL +  S+SLNDQKN+T SYSS   S    +++ T  +  
Sbjct  1    MNSNFGKNF-------EFDLGLGSSRSKSLNDQKNKTQSYSSYTSSASSYSSTPTRPAWQ  53

Query  325  TNKASWTHQPVGSLSG-------PTSMVGDIFGKSWGSAAPSNTGSASTVGIVTKKDPNL  483
             NK SWTHQP  + +        P SMVGDIFGK+WGS A S  GS + +GIV +K+PNL
Sbjct  54   PNKPSWTHQPAMNQAARPNLSNSPASMVGDIFGKTWGSTATS--GSTAGIGIV-EKNPNL  110

Query  484  FGDLVNSAL  510
            FGDLV SAL
Sbjct  111  FGDLVGSAL  119



>ref|XP_009597160.1| PREDICTED: jacalin-related lectin 5 isoform X2 [Nicotiana tomentosiformis]
Length=500

 Score = 84.7 bits (208),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 68/111 (61%), Positives = 84/111 (76%), Gaps = 13/111 (12%)
 Frame = +1

Query  205  FGLNTGCSRS-LNDQKNQTssysssaqs-----KPYGTASWTNQSNTNKASWTHQPVGSL  366
             GLN+G SRS LNDQKN+TSSYSSS+ S     KP   +SWT     NK++WTHQPVGSL
Sbjct  1    MGLNSGRSRSSLNDQKNKTSSYSSSSSSYTYSSKPNSGSSWTQ---PNKSTWTHQPVGSL  57

Query  367  SGPTSMVGDIFGKSWGSAAPSNTGSAS---TVGIVTKKDPNLFGDLVNSAL  510
            SGP SMVGDIFGKSWGS++ + + +++   T+GI   K+PNLFGDLV+SAL
Sbjct  58   SGPNSMVGDIFGKSWGSSSAAPSSTSNVTPTIGIAN-KNPNLFGDLVSSAL  107



>ref|XP_002467886.1| hypothetical protein SORBIDRAFT_01g035880 [Sorghum bicolor]
 gb|EER94884.1| hypothetical protein SORBIDRAFT_01g035880 [Sorghum bicolor]
Length=495

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 50/114 (44%), Positives = 64/114 (56%), Gaps = 15/114 (13%)
 Frame = +1

Query  199  FDFGLNTGCSRSLNDQKNQTssysssaqsKPYGTASWTNQSNTNKASWTHQP--------  354
            FDFG+N   S      ++Q    +++  ++P   ASWT+Q  + K SWTHQP        
Sbjct  26   FDFGINASRSSGSRPLRDQRPGAATNPPARPATGASWTHQPASAKPSWTHQPSPATASAA  85

Query  355  --VGSLSGPTSMVGDIFGKSWGSAAPSNTGSASTVGIVTKKDPNLFGDLVNSAL  510
               G  S PTSMVGDIFG+SW SAAPS     S +GI    +P LF DL+ SAL
Sbjct  86   TMAGPGSRPTSMVGDIFGRSWSSAAPS-----SGLGIPQANNPGLFSDLLGSAL  134



>ref|XP_011071419.1| PREDICTED: P17/29C-like protein DDB_G0287399 [Sesamum indicum]
Length=507

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 66/139 (47%), Positives = 85/139 (61%), Gaps = 19/139 (14%)
 Frame = +1

Query  148  MNSNYGKSNMKSGSMN--DFDFGLNTGCSRSLNDQKN------QTssysssaqsKPYGTA  303
            M S+YGKSN K+GS N  DFD GL +G ++S+ND +N       TS   +S Q KP  T+
Sbjct  1    MKSSYGKSNDKTGSTNAFDFDLGLGSGRAKSMNDLRNPTSSYTSTSYTYTSPQHKPNTTS  60

Query  304  SWTNQSNTNKASWTHQPV--------GSLSGPTSMVGDIFGKSWGSAAPSNTGSASTVGI  459
            SWT Q   NK +WTHQP         GS SGPTSMVGDI GKSW S+   +  S+S++ I
Sbjct  61   SWTYQ--PNKPAWTHQPATSVQWGWAGSSSGPTSMVGDISGKSWDSSC-PSGSSSSSIWI  117

Query  460  VTKKDPNLFGDLVNSALRQ  516
            +   + NLF DL++S   Q
Sbjct  118  LDSNNSNLFADLLSSGTGQ  136



>ref|XP_010039541.1| PREDICTED: uncharacterized transmembrane protein DDB_G0289901 
[Eucalyptus grandis]
 gb|KCW84768.1| hypothetical protein EUGRSUZ_B01574 [Eucalyptus grandis]
Length=519

 Score = 82.8 bits (203),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 66/141 (47%), Positives = 80/141 (57%), Gaps = 20/141 (14%)
 Frame = +1

Query  148  MNSNYGKSN---MKSGSMNDFDFGLNTGCS--RSLNDQKNQTssysssaqsKPYGTASWT  312
            MNSNYGK N     SGS+  FDF +  G +  RSLNDQKN+T+S+S +A + P       
Sbjct  1    MNSNYGKPNNPQRSSGSLGSFDFDIGIGSNKPRSLNDQKNKTTSFSYAAAAAPSPAQPSR  60

Query  313  NQSNTNKASWTHQP--------------VGSLSGPTSMVGDIFGKSW-GSAAPSNTGSAS  447
                 NK SWTHQP                SL GPTSMVGDIFGKSW  S+  + +  + 
Sbjct  61   PAWQPNKPSWTHQPAAGAGAPGPAQSAGAASLGGPTSMVGDIFGKSWSSSSTSTGSLGSG  120

Query  448  TVGIVTKKDPNLFGDLVNSAL  510
                + KKD NLFGDLV+SAL
Sbjct  121  LGIGIAKKDTNLFGDLVSSAL  141



>gb|KCW84767.1| hypothetical protein EUGRSUZ_B01574 [Eucalyptus grandis]
Length=505

 Score = 82.4 bits (202),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 66/141 (47%), Positives = 80/141 (57%), Gaps = 20/141 (14%)
 Frame = +1

Query  148  MNSNYGKSN---MKSGSMNDFDFGLNTGCS--RSLNDQKNQTssysssaqsKPYGTASWT  312
            MNSNYGK N     SGS+  FDF +  G +  RSLNDQKN+T+S+S +A + P       
Sbjct  1    MNSNYGKPNNPQRSSGSLGSFDFDIGIGSNKPRSLNDQKNKTTSFSYAAAAAPSPAQPSR  60

Query  313  NQSNTNKASWTHQP--------------VGSLSGPTSMVGDIFGKSW-GSAAPSNTGSAS  447
                 NK SWTHQP                SL GPTSMVGDIFGKSW  S+  + +  + 
Sbjct  61   PAWQPNKPSWTHQPAAGAGAPGPAQSAGAASLGGPTSMVGDIFGKSWSSSSTSTGSLGSG  120

Query  448  TVGIVTKKDPNLFGDLVNSAL  510
                + KKD NLFGDLV+SAL
Sbjct  121  LGIGIAKKDTNLFGDLVSSAL  141



>ref|NP_001149491.1| TPR domain containing protein [Zea mays]
 gb|ACF87831.1| unknown [Zea mays]
 gb|ACG35596.1| TPR domain containing protein [Zea mays]
 tpg|DAA45283.1| TPA: TPR domain containing protein [Zea mays]
Length=495

 Score = 82.4 bits (202),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 49/114 (43%), Positives = 64/114 (56%), Gaps = 15/114 (13%)
 Frame = +1

Query  199  FDFGLNTGCSRSLNDQKNQTssysssaqsKPYGTASWTNQSNTNKASWTHQP--------  354
            FDFG+N+  S      ++Q    +++  ++P   A+W +Q  + K SWTHQP        
Sbjct  26   FDFGINSSRSSGSRPLRDQRPGAATNPPTRPATGATWMHQPASAKPSWTHQPSPAAASAP  85

Query  355  --VGSLSGPTSMVGDIFGKSWGSAAPSNTGSASTVGIVTKKDPNLFGDLVNSAL  510
               G  SGPTSMVGDIFG+SW SAAPS     S  GI    +P LF DL+ SAL
Sbjct  86   TMAGPGSGPTSMVGDIFGRSWSSAAPS-----SGFGIPQANNPGLFSDLLGSAL  134



>gb|KDO71760.1| hypothetical protein CISIN_1g010705mg [Citrus sinensis]
 gb|KDO71761.1| hypothetical protein CISIN_1g010705mg [Citrus sinensis]
Length=503

 Score = 82.0 bits (201),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 60/129 (47%), Positives = 78/129 (60%), Gaps = 9/129 (7%)
 Frame = +1

Query  148  MNSNYGKSNMKS--GSMNDFDFGLNTGCSR--SLNDQKNQTssysssaqsKPYGTASWTN  315
            MNSNY   +  S  G +N+F+F L  G ++  SL DQ+N+T+   +S+ +          
Sbjct  1    MNSNYNNKSKVSTPGMLNNFNFDLGVGSNKPASLIDQRNRTTPSFTSSFTSSTTATQPKP  60

Query  316  QSNTNKASWTHQPV--GSLSGPTSMVGDIFGKSWGSAAPSNTGSASTVGIVTKKDPNLFG  489
                +K SWTHQP   G  S P SMVGDI GKSW + APS   S+S +GIV  K+PNLFG
Sbjct  61   AWQPSKPSWTHQPAQTGIESAPVSMVGDIHGKSWATTAPSK--SSSGIGIV-DKNPNLFG  117

Query  490  DLVNSALRQ  516
            DLV+SAL Q
Sbjct  118  DLVSSALGQ  126



>ref|XP_006489031.1| PREDICTED: uncharacterized transmembrane protein DDB_G0289901-like 
[Citrus sinensis]
Length=503

 Score = 81.6 bits (200),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 60/129 (47%), Positives = 78/129 (60%), Gaps = 9/129 (7%)
 Frame = +1

Query  148  MNSNYGKSNMKS--GSMNDFDFGLNTGCSR--SLNDQKNQTssysssaqsKPYGTASWTN  315
            MNSNY   +  S  G +N+F+F L  G ++  SL DQ+N+T+   +S+ +          
Sbjct  1    MNSNYNNKSKVSTPGMLNNFNFDLGVGSNKPASLIDQRNRTTPSFTSSFTSSTTATQPKP  60

Query  316  QSNTNKASWTHQPV--GSLSGPTSMVGDIFGKSWGSAAPSNTGSASTVGIVTKKDPNLFG  489
                +K SWTHQP   G  S P SMVGDI GKSW + APS   S+S +GIV  K+PNLFG
Sbjct  61   AWQPSKPSWTHQPAQTGIESAPVSMVGDIHGKSWATTAPSK--SSSGIGIV-DKNPNLFG  117

Query  490  DLVNSALRQ  516
            DLV+SAL Q
Sbjct  118  DLVSSALGQ  126



>ref|XP_006419499.1| hypothetical protein CICLE_v10004804mg [Citrus clementina]
 ref|XP_006419500.1| hypothetical protein CICLE_v10004804mg [Citrus clementina]
 gb|ESR32739.1| hypothetical protein CICLE_v10004804mg [Citrus clementina]
 gb|ESR32740.1| hypothetical protein CICLE_v10004804mg [Citrus clementina]
Length=503

 Score = 81.6 bits (200),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 60/129 (47%), Positives = 78/129 (60%), Gaps = 9/129 (7%)
 Frame = +1

Query  148  MNSNYGKSNMKS--GSMNDFDFGLNTGCSR--SLNDQKNQTssysssaqsKPYGTASWTN  315
            MNSNY   +  S  G +N+F+F L  G ++  SL DQ+N+T+   +S+ +          
Sbjct  1    MNSNYNNKSKVSTPGMLNNFNFDLGVGSNKPASLIDQRNRTTPSFTSSFTSSTTATQPKP  60

Query  316  QSNTNKASWTHQPV--GSLSGPTSMVGDIFGKSWGSAAPSNTGSASTVGIVTKKDPNLFG  489
                +K SWTHQP   G  S P SMVGDI GKSW + APS   S+S +GIV  K+PNLFG
Sbjct  61   AWQPSKPSWTHQPAQTGIESAPVSMVGDIHGKSWATTAPSK--SSSGIGIV-DKNPNLFG  117

Query  490  DLVNSALRQ  516
            DLV+SAL Q
Sbjct  118  DLVSSALGQ  126



>ref|XP_010269601.1| PREDICTED: cell wall protein RBR3-like [Nelumbo nucifera]
 ref|XP_010269602.1| PREDICTED: cell wall protein RBR3-like [Nelumbo nucifera]
Length=514

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 66/147 (45%), Positives = 88/147 (60%), Gaps = 29/147 (20%)
 Frame = +1

Query  148  MNSNYGK-SNMKSGSMN----DFDFGLNTGCS----RSLNDQKNQ-------------Ts  261
            MNSN+G+ SN + GS++     FDFG ++  S    RSLNDQK Q              +
Sbjct  1    MNSNFGRPSNPQGGSVSLNNYQFDFGPSSEPSSNRPRSLNDQKQQYTSSYSFPSSSSSAT  60

Query  262  sysssaqsKPYGTASWTNQSNTNKASWTHQPVGSLSGPTS-MVGDIFGKSWGSAAPSNTG  438
            + + S+ ++P   +SW      NK SWTHQP  +LS  T+ MVGDIFGKSW S APS +G
Sbjct  61   TTAWSSSTQPRQPSSWA----PNKPSWTHQPSSTLSNSTTSMVGDIFGKSWASTAPS-SG  115

Query  439  SASTVGI-VTKKDPNLFGDLVNSALRQ  516
              S +G+ + +K+PNLFGDLV SA  Q
Sbjct  116  PTSCLGLGLQEKNPNLFGDLVGSAFGQ  142



>gb|KHG25339.1| Sperm-associated antigen 1 [Gossypium arboreum]
Length=518

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 63/135 (47%), Positives = 81/135 (60%), Gaps = 25/135 (19%)
 Frame = +1

Query  148  MNSNYGKSNMKSGSMNDFDFGLNTGCSRSLNDQKNQTs------sysssaqsKPYGTASW  309
            M+SNYGK +  S    DFD GL +G  +SLNDQKN+T+      S ++SA SKP    +W
Sbjct  1    MSSNYGKGSSGSLKSFDFDLGLGSGRPKSLNDQKNKTTSSFLSYSSATSAPSKP----AW  56

Query  310  TNQSNTNKASWTHQPV------GSLSGPTSMVGDIFGKSWGSAAPSNTGSASTVGIVTKK  471
                  NK SWTHQP        ++SGPTSMVGDIF       + S++G  S+   +  K
Sbjct  57   ----EPNKPSWTHQPAPNQASQAAISGPTSMVGDIF-----GKSWSSSGGNSSGIGIVNK  107

Query  472  DPNLFGDLVNSALRQ  516
            +PNLFGDLV+SAL Q
Sbjct  108  NPNLFGDLVSSALGQ  122



>ref|XP_010259472.1| PREDICTED: uncharacterized serine-rich protein C215.13 [Nelumbo 
nucifera]
Length=519

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 68/146 (47%), Positives = 89/146 (61%), Gaps = 26/146 (18%)
 Frame = +1

Query  148  MNSNYGK-SNMKSGSMN----DFDFGLNTGCS----RSLNDQKNQ--------------T  258
            MNSN+GK SN + GS++    +FDFGL +G S    RSLND K Q              T
Sbjct  1    MNSNFGKPSNPQRGSVSSNNYEFDFGLGSGFSNNRHRSLNDHKQQNASPYSYPSSSSSTT  60

Query  259  ssysssaqsKPYGTASWTNQSNTNKASWTHQPVGSLSGPTSMVGDIFGKSWGSAAPSNTG  438
            ++ + S+ ++P   +  ++    NKASWTHQ   S S PTSMVGDIFGKSW S A   +G
Sbjct  61   TTTAWSSSTQPKQPSPSSSSWTPNKASWTHQSSPSTSNPTSMVGDIFGKSWASTA--RSG  118

Query  439  SASTVGIVTKKDPNLFGDLVNSALRQ  516
            + + +GI  +K+PNLFGDLV SAL Q
Sbjct  119  NNARIGI-PEKNPNLFGDLVGSALGQ  143



>ref|XP_003550543.1| PREDICTED: P17/29C-like protein DDB_G0287399-like [Glycine max]
Length=442

 Score = 79.3 bits (194),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 49/110 (45%), Positives = 68/110 (62%), Gaps = 24/110 (22%)
 Frame = +1

Query  196  DFDFGLNTGCSRSLNDQKNQTssysssaqsKPYGTASWTNQSNTNKASWTHQPVGSLS--  369
            DFD G+ +   +SLNDQKN            P  T+S+++     + +WTH+P  + +  
Sbjct  8    DFDLGIGSNRPKSLNDQKN------------PKPTSSYSSA----QPAWTHRPAPTQTTA  51

Query  370  ---GPTSMVGDIFGKSWGSAAPSNTGSASTVGIVTKKDPNLFGDLVNSAL  510
               GP SMVGDIFGKSWG+  PS+  ++  +GIV  K+PNLFGDLV+SAL
Sbjct  52   LPGGPPSMVGDIFGKSWGTPQPSS--ASKNIGIVN-KNPNLFGDLVSSAL  98



>ref|XP_010524552.1| PREDICTED: uncharacterized transmembrane protein DDB_G0289901 
[Tarenaya hassleriana]
 ref|XP_010524553.1| PREDICTED: uncharacterized transmembrane protein DDB_G0289901 
[Tarenaya hassleriana]
 ref|XP_010524554.1| PREDICTED: uncharacterized transmembrane protein DDB_G0289901 
[Tarenaya hassleriana]
Length=499

 Score = 78.2 bits (191),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 60/135 (44%), Positives = 76/135 (56%), Gaps = 28/135 (21%)
 Frame = +1

Query  148  MNSNYGKSNMKSGSMN--DFDFGLNTGCSRSLNDQKNQTssysssaqsKPYGTASWTNQS  321
            MNSNYGK +  SGSMN  +FD GL +   RSL DQK+Q S         PY +++   + 
Sbjct  1    MNSNYGKGS--SGSMNSFNFDLGLGSNQGRSLKDQKSQPS---------PYSSSNSHPRP  49

Query  322  --NTNKASWTHQPVGSL--------SGPTSMVGDIFGKSWGSAAPSNTGSASTVGIVTKK  471
                 K SWTHQP            SGP+SMVGDIFGK+WGS++      + +   +  K
Sbjct  50   AWQPGKPSWTHQPAPKQATARSEIGSGPSSMVGDIFGKTWGSSS-----GSGSGIGIVNK  104

Query  472  DPNLFGDLVNSALRQ  516
            DP LFGDLV SA+ Q
Sbjct  105  DPTLFGDLVTSAIGQ  119



>ref|XP_006650059.1| PREDICTED: flocculation protein FLO11-like [Oryza brachyantha]
Length=487

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 53/112 (47%), Positives = 66/112 (59%), Gaps = 15/112 (13%)
 Frame = +1

Query  199  FDFGLNTGCSRSLNDQKNQTssysssaqsKPYGTAS---WTNQSNTNKASWTHQP-----  354
            FDFG     SR L DQ+   ++ + +A +KP G AS   W++Q      SWTHQP     
Sbjct  25   FDFG-GVNSSRPLRDQRPGATAAAGNAYAKPGGVASGNTWSHQP-AKTTSWTHQPSPAAA  82

Query  355  VGSLSGPTSMVGDIFGKSWGSAAPSNTGSASTVGIVTKKDPNLFGDLVNSAL  510
              + SGPTSMVGDIFG+SW SAAPS     S +GI    +P LF DL+ SAL
Sbjct  83   AATGSGPTSMVGDIFGRSWSSAAPS-----SGLGIPQANNPGLFSDLLGSAL  129



>ref|XP_003528629.1| PREDICTED: uncharacterized protein DDB_G0271670-like isoform 
X1 [Glycine max]
 ref|XP_006584017.1| PREDICTED: uncharacterized protein DDB_G0271670-like isoform 
X2 [Glycine max]
 gb|KHN02941.1| Sperm-associated antigen 1 [Glycine soja]
Length=478

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 56/121 (46%), Positives = 74/121 (61%), Gaps = 15/121 (12%)
 Frame = +1

Query  184  GSMN-----DFDFGLNTGCSRSLNDQKNQTssysssaqsKPYGTASWTNQSNTNKASWTH  348
            G+MN     DFD G+ +   +SLNDQKN   +  SS  +     +  ++Q N   A WTH
Sbjct  31   GAMNSNFNFDFDLGIGSNRPKSLNDQKNPKPTPYSSYSTT-TTASYSSSQPNKQPA-WTH  88

Query  349  QPVGSLS-----GPTSMVGDIFGKSWGSAAPSNTGSASTVGIVTKKDPNLFGDLVNSALR  513
            QP  + +     GP SMVGDIFGKSWG+  PS+  ++  +GIV  K+PNLFGDLV+SAL 
Sbjct  89   QPSPTQTTALPGGPPSMVGDIFGKSWGTPQPSS--ASKNIGIVN-KNPNLFGDLVSSALG  145

Query  514  Q  516
            Q
Sbjct  146  Q  146



>gb|KJB72727.1| hypothetical protein B456_011G193400 [Gossypium raimondii]
Length=510

 Score = 77.0 bits (188),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 61/129 (47%), Positives = 77/129 (60%), Gaps = 13/129 (10%)
 Frame = +1

Query  148  MNSNYGKSNMKSGSMNDFDFGLNTGCSRSLNDQKNQTssysssaqsKPYGTASWTNQSNT  327
            M+SNYGK +  S    DFD GL +G  +SLNDQKN+T+S  SS  S     +    Q   
Sbjct  1    MSSNYGKGSSGSLKSFDFDLGLGSGRPKSLNDQKNKTTSSFSSYSSATSAPSKPAWQ--P  58

Query  328  NKASWTHQPV------GSLSGPTSMVGDIFGKSWGSAAPSNTGSASTVGIVTKKDPNLFG  489
            NK SWTHQP        ++SGPTSMVGDIF       + S++G  S+   +  K+PNLFG
Sbjct  59   NKPSWTHQPAPNQASQAAISGPTSMVGDIF-----GKSWSSSGGNSSGIGIVNKNPNLFG  113

Query  490  DLVNSALRQ  516
            DLV+SAL Q
Sbjct  114  DLVSSALGQ  122



>ref|XP_010487542.1| PREDICTED: ATP-dependent RNA helicase glh-2-like [Camelina sativa]
Length=478

 Score = 76.6 bits (187),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 70/133 (53%), Positives = 78/133 (59%), Gaps = 26/133 (20%)
 Frame = +1

Query  148  MNSNYGKSNMKSGSMNDFDFGLNTGCS--RSLNDQKNQTssysssaqsKPYGTASWTNQS  321
            MNSN+GK +  SGS N FDF L  G S  R LN QK+QTSSYSSS         +W    
Sbjct  1    MNSNFGKRS--SGSTNSFDFDLGLGSSQGRPLNGQKSQTSSYSSSNSQP---RPAW----  51

Query  322  NTNKASWTHQPVGSL--------SGPTSMVGDIFGKSWGSAAPSNTGSASTVGIVTKKDP  477
               K SWTHQP            SGPTSMVGDI GK+WGSA      S S +GIV  KDP
Sbjct  52   QPGKPSWTHQPAPKQTTIRSEIGSGPTSMVGDIHGKTWGSA------SGSGIGIVN-KDP  104

Query  478  NLFGDLVNSALRQ  516
            +LFGDLV SA+ Q
Sbjct  105  SLFGDLVGSAIGQ  117



>ref|XP_002883024.1| tetratricopeptide repeat-containing protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH59283.1| tetratricopeptide repeat-containing protein [Arabidopsis lyrata 
subsp. lyrata]
Length=474

 Score = 73.9 bits (180),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 63/133 (47%), Positives = 76/133 (57%), Gaps = 24/133 (18%)
 Frame = +1

Query  148  MNSNYGKSNMKSGSMNDFDFGLNTGCS--RSLNDQKNQTssysssaqsKPYGTASWTNQS  321
            MNSN+GK +  SG +N FDF L  G S  R LN QK+QTSSY+SS         +W    
Sbjct  1    MNSNFGKRS--SGPINSFDFDLGLGSSQGRPLNGQKSQTSSYTSSNSQP---RPAW----  51

Query  322  NTNKASWTHQPVGSLS--------GPTSMVGDIFGKSWGSAAPSNTGSASTVGIVTKKDP  477
               K SWTHQP    S        GPTSMVGDI GK+WGSA+      + +   +  KDP
Sbjct  52   QPGKPSWTHQPAPKQSTIRSEIGSGPTSMVGDIHGKTWGSAS-----GSGSGIGIVNKDP  106

Query  478  NLFGDLVNSALRQ  516
            +LFGDLV SA+ Q
Sbjct  107  SLFGDLVGSAIGQ  119



>ref|XP_009414136.1| PREDICTED: mucin-1-like isoform X2 [Musa acuminata subsp. malaccensis]
Length=420

 Score = 73.2 bits (178),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 53/122 (43%), Positives = 68/122 (56%), Gaps = 20/122 (16%)
 Frame = +1

Query  193  NDFDFGL----NTGCSRSLNDQKNQTssysssaqsKPYGTASWTNQSNTNKASWTHQPVG  360
            + FDFGL     +  SR L DQK+ +   +    S+P   A W++Q   ++ SWT     
Sbjct  17   DQFDFGLGGSTRSSASRPLKDQKS-SPYATPGTASRPTAPA-WSHQ--PSRPSWTPAAPS  72

Query  361  SLSG----------PTSMVGDIFGKSWGSAAPSNTGSASTVGIVTKKDPNLFGDLVNSAL  510
             ++G          P SMVGDIFGK+W SAAP  + S S +GI  K DPNLFGDLV SAL
Sbjct  73   VITGAARSGNLANAPVSMVGDIFGKTWASAAPPRSAS-SGIGI-PKSDPNLFGDLVGSAL  130

Query  511  RQ  516
             Q
Sbjct  131  GQ  132



>gb|KDP27843.1| hypothetical protein JCGZ_18923 [Jatropha curcas]
Length=505

 Score = 73.2 bits (178),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 63/134 (47%), Positives = 80/134 (60%), Gaps = 25/134 (19%)
 Frame = +1

Query  148  MNSNYGKSNMKSGSMNDFDFGLNTGCSRSLNDQKN-----QTssysssaqsKPYGTASWT  312
            MNSNYGK +  S +  +FDFGL +   +SLNDQKN      + S S++ Q KP    +W 
Sbjct  1    MNSNYGKGSSSSLNNFNFDFGLGSSRPKSLNDQKNPTSSYSSYSSSTTTQPKP----AW-  55

Query  313  NQSNTNKASWTHQPVGS------LSGPTSMVGDIFGKSWGSAAPSNTGSASTVGIVTKKD  474
                 NK SWTHQP  S      L+GP SMVGDI        + +++ SAS +GIV +K+
Sbjct  56   ---QPNKPSWTHQPAPSQPTWSGLNGPPSMVGDI-----SGKSWNSSSSASGIGIV-EKN  106

Query  475  PNLFGDLVNSALRQ  516
            PNLFGDLV SAL Q
Sbjct  107  PNLFGDLVTSALGQ  120



>ref|XP_009414135.1| PREDICTED: mucin-1-like isoform X1 [Musa acuminata subsp. malaccensis]
Length=486

 Score = 72.8 bits (177),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 53/122 (43%), Positives = 68/122 (56%), Gaps = 20/122 (16%)
 Frame = +1

Query  193  NDFDFGL----NTGCSRSLNDQKNQTssysssaqsKPYGTASWTNQSNTNKASWTHQPVG  360
            + FDFGL     +  SR L DQK+ +   +    S+P   A W++Q   ++ SWT     
Sbjct  17   DQFDFGLGGSTRSSASRPLKDQKS-SPYATPGTASRPTAPA-WSHQ--PSRPSWTPAAPS  72

Query  361  SLSG----------PTSMVGDIFGKSWGSAAPSNTGSASTVGIVTKKDPNLFGDLVNSAL  510
             ++G          P SMVGDIFGK+W SAAP  + S S +GI  K DPNLFGDLV SAL
Sbjct  73   VITGAARSGNLANAPVSMVGDIFGKTWASAAPPRSAS-SGIGI-PKSDPNLFGDLVGSAL  130

Query  511  RQ  516
             Q
Sbjct  131  GQ  132



>ref|XP_009417747.1| PREDICTED: nuclear pore complex protein Nup214-like [Musa acuminata 
subsp. malaccensis]
Length=497

 Score = 72.8 bits (177),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 59/122 (48%), Positives = 67/122 (55%), Gaps = 22/122 (18%)
 Frame = +1

Query  199  FDFGL----NTGCSRSLNDQKNQTssysssaqsKPYGTASWTNQSNTNKASWTHQ---PV  357
            FDFGL        +R L DQK      SS+  SKP   A W++Q   ++ SWT     P 
Sbjct  24   FDFGLAGSARGSAARPLKDQKPSPYVASSAPSSKPAAPA-WSHQ--PSRPSWTPAAPAPS  80

Query  358  G----SLSG-----PTSMVGDIFGKSWGSAAPSNTGSASTVGIVTKKDPNLFGDLVNSAL  510
            G    S SG     P SMVGDIFGKSW SAAPS   SA +   + K DPNLFGDLV SAL
Sbjct  81   GASGISRSGNLSSTPASMVGDIFGKSWVSAAPS---SAKSGLAIPKSDPNLFGDLVGSAL  137

Query  511  RQ  516
             Q
Sbjct  138  GQ  139



>ref|XP_003557950.1| PREDICTED: clathrin coat assembly protein AP180 [Brachypodium 
distachyon]
Length=476

 Score = 70.9 bits (172),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 45/110 (41%), Positives = 62/110 (56%), Gaps = 13/110 (12%)
 Frame = +1

Query  199  FDFGLNTGCSRSLNDQKNQTssysssaqsKPYGTASWTNQSNTNKASWTHQPVGSLSG--  372
            FDFG N   S +    ++Q    +++   +P  T +W++Q    K SWTHQP  + +   
Sbjct  24   FDFGANASRSSTSRPLRDQRQGGATNPSPRPAATTTWSHQ--PVKTSWTHQPSPAAATAA  81

Query  373  ----PTSMVGDIFGKSWGSAAPSNTGSASTVGIVTKKDPNLFGDLVNSAL  510
                PTSMVGDIFG+SW SAAPS     S +G+    +PNLF DL+  AL
Sbjct  82   PGSGPTSMVGDIFGRSWASAAPS-----SGIGLPQSNNPNLFSDLLGPAL  126



>gb|EMT10127.1| Sperm-associated antigen 1 [Aegilops tauschii]
Length=479

 Score = 70.5 bits (171),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 44/109 (40%), Positives = 61/109 (56%), Gaps = 12/109 (11%)
 Frame = +1

Query  199  FDFGLNTGCSRSLNDQKNQTssysssaqsKPYGTASWTNQSNTNKASWTHQPVGSL----  366
            FDFG N   S +    ++Q    +++   +P  T +W++Q    K SWTHQP  S+    
Sbjct  23   FDFGANASRSSTSRPLRDQRPGGATNPSPRPTTTNTWSHQ--PVKTSWTHQPSPSVAAAL  80

Query  367  -SGPTSMVGDIFGKSWGSAAPSNTGSASTVGIVTKKDPNLFGDLVNSAL  510
             SGP SMVGDI G+SW + APS     S +G+    +PNLF DL+  AL
Sbjct  81   GSGPVSMVGDISGRSWSATAPS-----SGIGLPQSNNPNLFSDLLGPAL  124



>emb|CDY28338.1| BnaC01g35080D [Brassica napus]
Length=473

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 56/134 (42%), Positives = 71/134 (53%), Gaps = 31/134 (23%)
 Frame = +1

Query  148  MNSNYGKSNMKSGSMN--DFDFGLNTGCSRSLNDQKNQTssysssaqsKPYGTASWTNQS  321
            MNSNYGK +  S S+N  DFD GL +   + LN QK+QT               S++ Q 
Sbjct  1    MNSNYGKRSSGS-SINAFDFDLGLGSNQGKPLNGQKSQT--------------PSYSQQP  45

Query  322  NT----NKASWTHQPV-------GSLSGPTSMVGDIFGKSWGSAAPSNTGSASTVGIVTK  468
                   K SWTHQP          + GPTSMVGDI GK+W S++ S +GS      +  
Sbjct  46   RPAFQPGKPSWTHQPAPKQKTIRSEIGGPTSMVGDIHGKTWSSSSSSGSGSGIG---IVN  102

Query  469  KDPNLFGDLVNSAL  510
            KDP+LFGDLV S +
Sbjct  103  KDPSLFGDLVGSVI  116



>emb|CDY34976.1| BnaA01g27580D [Brassica napus]
Length=464

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 53/134 (40%), Positives = 69/134 (51%), Gaps = 30/134 (22%)
 Frame = +1

Query  148  MNSNYGKSNMKSGSMN--DFDFGLNTGCSRSLNDQKNQTssysssaqsKPYGTASWTNQS  321
            MNSNYGK +  S S+N  DFD GL +   + LN QK+Q                S++ Q 
Sbjct  1    MNSNYGKRSSGS-SINAFDFDLGLGSNQGKPLNGQKSQA--------------PSYSQQP  45

Query  322  NT----NKASWTHQPV-------GSLSGPTSMVGDIFGKSWGSAAPSNTGSASTVGIVTK  468
                   K SWTHQP          + GPTSMVGDI GK+W S++ S+   +    +   
Sbjct  46   RPAFQPGKPSWTHQPAPKQTTIRSEIGGPTSMVGDIHGKTWNSSSSSSGSGSGIGIV--N  103

Query  469  KDPNLFGDLVNSAL  510
            KDP+LFGDLV S +
Sbjct  104  KDPSLFGDLVGSVI  117



>ref|XP_009114517.1| PREDICTED: uncharacterized transmembrane protein DDB_G0289901 
[Brassica rapa]
Length=464

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 53/134 (40%), Positives = 69/134 (51%), Gaps = 30/134 (22%)
 Frame = +1

Query  148  MNSNYGKSNMKSGSMN--DFDFGLNTGCSRSLNDQKNQTssysssaqsKPYGTASWTNQS  321
            MNSNYGK +  S S+N  DFD GL +   + LN QK+Q                S++ Q 
Sbjct  1    MNSNYGKRSSGS-SINAFDFDLGLGSNQGKPLNGQKSQA--------------PSYSQQP  45

Query  322  NT----NKASWTHQPV-------GSLSGPTSMVGDIFGKSWGSAAPSNTGSASTVGIVTK  468
                   K SWTHQP          + GPTSMVGDI GK+W S++ S+   +    +   
Sbjct  46   RPAFQPGKPSWTHQPAPKQTTIRSEIGGPTSMVGDIHGKTWNSSSSSSGSGSGIGIV--N  103

Query  469  KDPNLFGDLVNSAL  510
            KDP+LFGDLV S +
Sbjct  104  KDPSLFGDLVGSVI  117



>dbj|BAJ85500.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=479

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 43/109 (39%), Positives = 59/109 (54%), Gaps = 12/109 (11%)
 Frame = +1

Query  199  FDFGLNTGCSRSLNDQKNQTssysssaqsKPYGTASWTNQSNTNKASWTHQPVGSL----  366
            FDFG N   S +    ++Q    +++   +P  T +W++Q    K SWTHQP  S     
Sbjct  23   FDFGANASRSSTSRPLRDQRPGGATNPSPRPTTTNTWSHQ--PVKTSWTHQPPPSAAAAL  80

Query  367  -SGPTSMVGDIFGKSWGSAAPSNTGSASTVGIVTKKDPNLFGDLVNSAL  510
             SGP  MVGDI G+SW + APS     S +G+    +PNLF DL+  AL
Sbjct  81   GSGPMPMVGDISGRSWSATAPS-----SDIGLPQSNNPNLFSDLLGPAL  124



>ref|XP_002315491.2| hypothetical protein POPTR_0010s00910g [Populus trichocarpa]
 gb|EEF01662.2| hypothetical protein POPTR_0010s00910g [Populus trichocarpa]
Length=481

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 50/117 (43%), Positives = 63/117 (54%), Gaps = 27/117 (23%)
 Frame = +1

Query  196  DFDFGLNTGCSRSLNDQKNQTssysssaqsKPYGTASWTNQS----NTNKASWTHQPV--  357
            +FDFG+ +   +SLNDQ+N   S        PY  +S T QS      NK SWTHQP   
Sbjct  5    NFDFGIGSNRPKSLNDQRNPNPS--------PY--SSSTQQSKPTWQPNKPSWTHQPAPA  54

Query  358  ------GSLSGPTSMVGDIFGKSWGSAAPSNTGSASTVGIVTKKDPNLFGDLVNSAL  510
                  G L+GP SMVGDI GKSW S        + +   + +K+PNLF DLV SA+
Sbjct  55   QSMVRPGGLNGPASMVGDITGKSWNSGI-----GSGSGIGIVEKNPNLFCDLVTSAI  106



>ref|XP_004980338.1| PREDICTED: spore coat protein SP96-like, partial [Setaria italica]
Length=240

 Score = 64.3 bits (155),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 42/106 (40%), Positives = 58/106 (55%), Gaps = 13/106 (12%)
 Frame = +1

Query  199  FDFGLNTGCSRSLNDQKNQTssysssaqsKPYGTASWTNQSNTNKASWTHQPVGSLSGP-  375
            FDFG+N   S      ++Q    +++  ++P   ASWT+Q  + K +WTHQP  + +   
Sbjct  11   FDFGVNASRSSGSRPLRDQHPGAAANTSTRPATGASWTHQPASTKPAWTHQPSPAAASAA  70

Query  376  -------TSMVGDIFGKSWGSAAPSNTGSASTVGIVTKKDPNLFGD  492
                   TSMVGDIFG+SW SAAPS     S +GI    +P LF D
Sbjct  71   AGPGSGPTSMVGDIFGRSWSSAAPS-----SGLGIPQANNPALFSD  111



>ref|XP_004984439.1| PREDICTED: mucin-19-like [Setaria italica]
Length=496

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 44/106 (42%), Positives = 58/106 (55%), Gaps = 13/106 (12%)
 Frame = +1

Query  199  FDFGLNTGCSRSLNDQKNQTssysssaqsKPYGTASWTNQSNTNKASWTHQ--------P  354
            FDFG+N   S      ++Q    +++  ++P   ASWT+Q  + K +WTHQ         
Sbjct  26   FDFGVNASRSSGSRPLRDQRPGAAANTSTRPATGASWTHQPASAKPAWTHQPSPAAASAA  85

Query  355  VGSLSGPTSMVGDIFGKSWGSAAPSNTGSASTVGIVTKKDPNLFGD  492
             G  SG TSMVGDIFG+SW SAAPS     S +GI    +P LF D
Sbjct  86   AGPGSGSTSMVGDIFGRSWSSAAPS-----SGLGIPQANNPALFSD  126



>ref|XP_008789905.1| PREDICTED: nuclear pore complex protein Nup214-like [Phoenix 
dactylifera]
Length=488

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 53/115 (46%), Positives = 63/115 (55%), Gaps = 18/115 (16%)
 Frame = +1

Query  199  FDFGLNTG---CSRSLNDQKNQTssysssaqsKPYGTASWTNQSNTNKASWTHQPV----  357
            FDFG+  G    SR L DQK   S    +A      TA +T+Q    + SWTHQP     
Sbjct  28   FDFGVAAGRSSTSRPLRDQKPNPSPAPYAAAPL--PTAPFTHQ--PARPSWTHQPASAVP  83

Query  358  --GSLSGPTSMVGDIFGKSWGSAAPSNTGSASTVGIVTKKDPNLFGDLVNSALRQ  516
              G    P+SMVGDI GKSW SAAP+     S +GI  + +PNLF DLV SAL Q
Sbjct  84   RSGIADPPSSMVGDISGKSWTSAAPTT----SRLGI-PENNPNLFSDLVGSALGQ  133



>ref|XP_011009082.1| PREDICTED: pro-resilin [Populus euphratica]
Length=481

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 48/117 (41%), Positives = 63/117 (54%), Gaps = 27/117 (23%)
 Frame = +1

Query  196  DFDFGLNTGCSRSLNDQKNQTssysssaqsKPYGTASWTNQS----NTNKASWTHQPV--  357
            +FDFG+ +   +SLN+Q+N   S        PY  +S T QS      NK SWTHQP   
Sbjct  5    NFDFGIGSNRPKSLNEQRNPNPS--------PY--SSSTTQSKPTWQPNKPSWTHQPAPA  54

Query  358  ------GSLSGPTSMVGDIFGKSWGSAAPSNTGSASTVGIVTKKDPNLFGDLVNSAL  510
                  G L+GP SMVGDI GK+W S        + +   + +K+PNLF DLV SA+
Sbjct  55   QSMVRPGGLNGPASMVGDITGKTWNSGI-----GSGSGIGIVEKNPNLFCDLVTSAI  106



>dbj|BAB02768.1| unnamed protein product [Arabidopsis thaliana]
Length=400

 Score = 64.3 bits (155),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 65/133 (49%), Positives = 75/133 (56%), Gaps = 24/133 (18%)
 Frame = +1

Query  148  MNSNYGKSNMKSGSMNDFDFGLNTGCS--RSLNDQKNQTssysssaqsKPYGTASWTNQS  321
            MNSN+GK    SGS N FDF L  G S  R LN QK+QTSSYSSS         +W    
Sbjct  1    MNSNFGK--RSSGSTNSFDFDLGLGSSQGRPLNGQKSQTSSYSSSNSQP---RPAW----  51

Query  322  NTNKASWTHQPVGSLS--------GPTSMVGDIFGKSWGSAAPSNTGSASTVGIVTKKDP  477
               K SWTHQP    S        GPTSMVGDI GK+WGSA+      + +   +  KDP
Sbjct  52   QPGKPSWTHQPAPKQSTIRSEIGSGPTSMVGDIHGKTWGSAS-----GSGSGIGIVNKDP  106

Query  478  NLFGDLVNSALRQ  516
            +LFGDLV SA+ Q
Sbjct  107  SLFGDLVGSAIGQ  119



>ref|NP_188298.3| tetratricopeptide repeat domain-containing protein [Arabidopsis 
thaliana]
 gb|AEE75861.1| tetratricopeptide repeat domain-containing protein [Arabidopsis 
thaliana]
Length=456

 Score = 64.3 bits (155),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 65/133 (49%), Positives = 76/133 (57%), Gaps = 24/133 (18%)
 Frame = +1

Query  148  MNSNYGKSNMKSGSMNDFDFGLNTGCS--RSLNDQKNQTssysssaqsKPYGTASWTNQS  321
            MNSN+GK +  SGS N FDF L  G S  R LN QK+QTSSYSSS         +W    
Sbjct  1    MNSNFGKRS--SGSTNSFDFDLGLGSSQGRPLNGQKSQTSSYSSSNSQP---RPAW----  51

Query  322  NTNKASWTHQPVGSLS--------GPTSMVGDIFGKSWGSAAPSNTGSASTVGIVTKKDP  477
               K SWTHQP    S        GPTSMVGDI GK+WGSA+      + +   +  KDP
Sbjct  52   QPGKPSWTHQPAPKQSTIRSEIGSGPTSMVGDIHGKTWGSAS-----GSGSGIGIVNKDP  106

Query  478  NLFGDLVNSALRQ  516
            +LFGDLV SA+ Q
Sbjct  107  SLFGDLVGSAIGQ  119



>ref|XP_010504635.1| PREDICTED: fibroin heavy chain-like [Camelina sativa]
Length=481

 Score = 63.9 bits (154),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 68/133 (51%), Positives = 78/133 (59%), Gaps = 22/133 (17%)
 Frame = +1

Query  148  MNSNYGKSNMKSGSMNDFDFGLNTGCS--RSLNDQKNQTssysssaqsKPYGTASWTNQS  321
            MNSN+GK +  SGS N FDF L  G S  R LN QK+QTSSYSSS         +W    
Sbjct  1    MNSNFGKRS--SGSTNSFDFDLGLGSSQGRPLNGQKSQTSSYSSSNSQP---RPAW----  51

Query  322  NTNKASWTHQPVGSL--------SGPTSMVGDIFGKSWGSAAPSNTGSASTVGIVTKKDP  477
               K SWTHQP            SGPTSMVGDI GK+WGSA+ S +GS      +  KDP
Sbjct  52   QPGKPSWTHQPAPKQTTIRSEIGSGPTSMVGDIHGKTWGSASGSGSGSGIG---IVNKDP  108

Query  478  NLFGDLVNSALRQ  516
            +LFGDLV SA+ Q
Sbjct  109  SLFGDLVGSAIGQ  121



>ref|XP_010465698.1| PREDICTED: P17/29C-like protein DDB_G0287399 [Camelina sativa]
Length=470

 Score = 63.9 bits (154),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 66/131 (50%), Positives = 79/131 (60%), Gaps = 16/131 (12%)
 Frame = +1

Query  148  MNSNYGKSNMKSGSMNDFDFGLNTGCSRSLNDQKNQTssysssaqsKPYGTASWTNQSNT  327
            MNSN+GK +  S +  DFD GL +   + LN QK+QTSSYSSS         +W      
Sbjct  1    MNSNFGKRSSGSNNSFDFDLGLGSSQGKPLNGQKSQTSSYSSSNSQP---RPAW----QP  53

Query  328  NKASWTHQPVGSL--------SGPTSMVGDIFGKSWGSAAPSNTGSASTVGIVTKKDPNL  483
             K SWTHQP            SGPTSMVGDI GK+W SA+ S +GS S +GIV  KDP+L
Sbjct  54   GKPSWTHQPAPKQTTIRSEIGSGPTSMVGDIHGKTWSSASGSGSGSGSGIGIVN-KDPSL  112

Query  484  FGDLVNSALRQ  516
            FGDLV SA+ Q
Sbjct  113  FGDLVGSAIGQ  123



>ref|NP_851004.1| tetratricopeptide repeat domain-containing protein [Arabidopsis 
thaliana]
 gb|AAS49048.1| At3g16760 [Arabidopsis thaliana]
 gb|AAT71974.1| At3g16760 [Arabidopsis thaliana]
 dbj|BAF00191.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE75862.1| tetratricopeptide repeat domain-containing protein [Arabidopsis 
thaliana]
Length=475

 Score = 63.9 bits (154),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 65/133 (49%), Positives = 76/133 (57%), Gaps = 24/133 (18%)
 Frame = +1

Query  148  MNSNYGKSNMKSGSMNDFDFGLNTGCS--RSLNDQKNQTssysssaqsKPYGTASWTNQS  321
            MNSN+GK +  SGS N FDF L  G S  R LN QK+QTSSYSSS         +W    
Sbjct  1    MNSNFGKRS--SGSTNSFDFDLGLGSSQGRPLNGQKSQTSSYSSSNSQP---RPAW----  51

Query  322  NTNKASWTHQPVGSLS--------GPTSMVGDIFGKSWGSAAPSNTGSASTVGIVTKKDP  477
               K SWTHQP    S        GPTSMVGDI GK+WGSA+      + +   +  KDP
Sbjct  52   QPGKPSWTHQPAPKQSTIRSEIGSGPTSMVGDIHGKTWGSAS-----GSGSGIGIVNKDP  106

Query  478  NLFGDLVNSALRQ  516
            +LFGDLV SA+ Q
Sbjct  107  SLFGDLVGSAIGQ  119



>ref|XP_006297499.1| hypothetical protein CARUB_v10013518mg [Capsella rubella]
 gb|EOA30397.1| hypothetical protein CARUB_v10013518mg [Capsella rubella]
Length=498

 Score = 63.9 bits (154),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 65/133 (49%), Positives = 76/133 (57%), Gaps = 24/133 (18%)
 Frame = +1

Query  148  MNSNYGKSNMKSGSMNDFDFGLNTGCS--RSLNDQKNQTssysssaqsKPYGTASWTNQS  321
            MNSN+GK +  SGS N FDF L  G S  R LN QK+QTSSYSSS         +W    
Sbjct  1    MNSNFGKRS--SGSTNSFDFDLGLGSSQGRPLNGQKSQTSSYSSSNSQP---RPAW----  51

Query  322  NTNKASWTHQPVGSL--------SGPTSMVGDIFGKSWGSAAPSNTGSASTVGIVTKKDP  477
               K SWTHQP            SGPTSMVGDI GK+WGSA+      + +   +  KDP
Sbjct  52   QPGKPSWTHQPAPKQTTIRSEIGSGPTSMVGDIHGKTWGSAS-----GSGSGIGIVNKDP  106

Query  478  NLFGDLVNSALRQ  516
            +LFGDLV SA+ Q
Sbjct  107  SLFGDLVGSAIGQ  119



>ref|XP_006406809.1| hypothetical protein EUTSA_v10020624mg [Eutrema salsugineum]
 gb|ESQ48262.1| hypothetical protein EUTSA_v10020624mg [Eutrema salsugineum]
Length=480

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 62/131 (47%), Positives = 76/131 (58%), Gaps = 24/131 (18%)
 Frame = +1

Query  148  MNSNYGKSNMKSGSMNDFDFGLNTGCS--RSLNDQKNQTssysssaqsKPYGTASWTNQS  321
            MNSN+GK +  SGS+N FDF L  G S  + LN QK+QTSSYSSS         +W    
Sbjct  1    MNSNFGKRS--SGSINSFDFDLGLGSSHGKPLNGQKSQTSSYSSSNSQP---RPAW----  51

Query  322  NTNKASWTHQPVGSL--------SGPTSMVGDIFGKSWGSAAPSNTGSASTVGIVTKKDP  477
               K SWTHQP            SGPTSMVGDI GK+WGS++      + +   +  KDP
Sbjct  52   QPGKPSWTHQPAPKQTTIRSEIGSGPTSMVGDIHGKTWGSSS-----GSGSGIGIVNKDP  106

Query  478  NLFGDLVNSAL  510
            +LFGDLV SA+
Sbjct  107  SLFGDLVGSAI  117



>gb|KFK39022.1| hypothetical protein AALP_AA3G190400 [Arabis alpina]
Length=468

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 63/131 (48%), Positives = 75/131 (57%), Gaps = 24/131 (18%)
 Frame = +1

Query  148  MNSNYGKSNMKSGSMNDFDFGLNTGCS--RSLNDQKNQTssysssaqsKPYGTASWTNQS  321
            MNSN+GK +  SGS N FDF L  G S  R LN QK+QTSSYSSS         +W    
Sbjct  1    MNSNFGKRS--SGSTNSFDFDLGLGSSQGRPLNGQKSQTSSYSSSNSQP---RPAW----  51

Query  322  NTNKASWTHQPVGSL--------SGPTSMVGDIFGKSWGSAAPSNTGSASTVGIVTKKDP  477
               K SWTHQP            SGPTSMVGDI GK+WGS++      + +   +  KDP
Sbjct  52   QPGKPSWTHQPAPKQTTIRSELGSGPTSMVGDIHGKTWGSSS-----GSGSGIGIVNKDP  106

Query  478  NLFGDLVNSAL  510
            +LFGDLV SA+
Sbjct  107  SLFGDLVGSAI  117



>ref|XP_010938369.1| PREDICTED: nuclear pore complex protein Nup214-like [Elaeis guineensis]
Length=492

 Score = 62.0 bits (149),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 54/117 (46%), Positives = 64/117 (55%), Gaps = 22/117 (19%)
 Frame = +1

Query  199  FDFGLNTG---CSRSLNDQKNQTssysssaqsKPYGTASWTNQSNTNKASWTHQPV----  357
            FDFG+  G    SR L DQ    S   S+A  +   TA +TNQ    + SWTHQP     
Sbjct  28   FDFGVAAGRSSASRPLRDQNPNPSPAPSAAAPR--PTAPFTNQ--PARPSWTHQPAASAA  83

Query  358  ------GSLSGPTSMVGDIFGKSWGSAAPSNTGSASTVGIVTKKDPNLFGDLVNSAL  510
                  G  + P SMVGDIFGKSW SAAP    ++S +GI    +PNLF DLV SAL
Sbjct  84   STAPRSGVANPPPSMVGDIFGKSWTSAAP----TSSRIGI-PANNPNLFSDLVGSAL  135



>emb|CBI22961.3| unnamed protein product [Vitis vinifera]
Length=451

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 52/129 (40%), Positives = 62/129 (48%), Gaps = 37/129 (29%)
 Frame = +1

Query  148  MNSNYGK---SNMKSGSMN----DFDFGLNTGCSRSLNDQKNQTssysssaqsKPYGTAS  306
            MNSNYGK   S    GS+      FDFGL +  SR LNDQK Q+S  SS +  + +    
Sbjct  1    MNSNYGKTTNSQRGGGSVPLNNYQFDFGLGSSRSRPLNDQKQQSSHSSSFSAPQSH---P  57

Query  307  WTNQSNTNKASWTHQPVGSLSGPTSMVGDIFGKSWGSAAPSNTGSASTVGI-VTKKDPNL  483
            W      NK SWTHQP                      AP+ T  +   GI +  K+PNL
Sbjct  58   W----QPNKPSWTHQP----------------------APTQTTRSGPSGIGIVDKNPNL  91

Query  484  FGDLVNSAL  510
            FGDLV SAL
Sbjct  92   FGDLVGSAL  100



>ref|NP_001050066.1| Os03g0340700 [Oryza sativa Japonica Group]
 gb|ABF95857.1| TPR Domain containing protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF11980.1| Os03g0340700 [Oryza sativa Japonica Group]
 dbj|BAG94622.1| unnamed protein product [Oryza sativa Japonica Group]
Length=492

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 47/113 (42%), Positives = 61/113 (54%), Gaps = 16/113 (14%)
 Frame = +1

Query  199  FDFGLNTG---CSRSLNDQKNQTssysssaqsKPYGTASWTNQSNTNKASWTHQPVGSLS  369
            FDFG+N+     SR L      T+  +++      G+A WT+Q      SWTHQP  + +
Sbjct  27   FDFGVNSSRSSASRPLRPGPGATAGGAAAGGVGVGGSA-WTHQP-AKTTSWTHQPSPASA  84

Query  370  GP------TSMVGDIFGKSWGSAAPSNTGSASTVGIVTKKDPNLFGDLVNSAL  510
                    TSMVGDIFG+SW SAAPS     S +GI    +P LF DL+ SAL
Sbjct  85   AAGAGSGPTSMVGDIFGRSWSSAAPS-----SGLGIPQANNPGLFSDLLGSAL  132



>gb|EAY89947.1| hypothetical protein OsI_11499 [Oryza sativa Indica Group]
Length=492

 Score = 55.1 bits (131),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 47/113 (42%), Positives = 61/113 (54%), Gaps = 16/113 (14%)
 Frame = +1

Query  199  FDFGLNTG---CSRSLNDQKNQTssysssaqsKPYGTASWTNQSNTNKASWTHQPVGSLS  369
            FDFG+N+     SR L      TS  +++      G ++WT+Q      SWTHQP  + +
Sbjct  27   FDFGVNSSRSSASRPLRPGPGATSGGAAAGGVG-VGGSAWTHQP-AKTTSWTHQPSPASA  84

Query  370  GP------TSMVGDIFGKSWGSAAPSNTGSASTVGIVTKKDPNLFGDLVNSAL  510
                    TSMVGDIFG+SW SAAPS     S +GI    +P LF DL+ SAL
Sbjct  85   AAGAGSGPTSMVGDIFGRSWSSAAPS-----SGLGIPQANNPGLFSDLLGSAL  132



>gb|KHN03338.1| Sperm-associated antigen 1 [Glycine soja]
Length=384

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 35/43 (81%), Gaps = 3/43 (7%)
 Frame = +1

Query  382  MVGDIFGKSWGSAAPSNTGSASTVGIVTKKDPNLFGDLVNSAL  510
            MVGDIFGKSWG+  PS+  ++  +GIV  K+PNLFGDLV+SAL
Sbjct  1    MVGDIFGKSWGTPQPSS--ASKNIGIVN-KNPNLFGDLVSSAL  40



>ref|XP_002992259.1| hypothetical protein SELMODRAFT_448707 [Selaginella moellendorffii]
 gb|EFJ06640.1| hypothetical protein SELMODRAFT_448707 [Selaginella moellendorffii]
Length=401

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 37/62 (60%), Gaps = 5/62 (8%)
 Frame = +1

Query  340  WTHQPVGSLSGPTSMVGDIFGKSW-----GSAAPSNTGSASTVGIVTKKDPNLFGDLVNS  504
            WTH+PV SL+G +SMVGDI G+SW      + A S   S+  VG V     +LF DL+ +
Sbjct  71   WTHKPVSSLTGTSSMVGDITGRSWVPLESSATAKSRPASSGVVGGVGNSKADLFSDLLKT  130

Query  505  AL  510
             +
Sbjct  131  PM  132



>ref|XP_002987750.1| hypothetical protein SELMODRAFT_447095 [Selaginella moellendorffii]
 gb|EFJ11053.1| hypothetical protein SELMODRAFT_447095 [Selaginella moellendorffii]
Length=400

 Score = 48.5 bits (114),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 36/62 (58%), Gaps = 5/62 (8%)
 Frame = +1

Query  340  WTHQPVGSLSGPTSMVGDIFGKSW-----GSAAPSNTGSASTVGIVTKKDPNLFGDLVNS  504
            WTH+PV SL+G +SMVGDI G+SW      + A S   S   VG V     +LF DL+ +
Sbjct  71   WTHKPVSSLTGTSSMVGDITGRSWVPLESSATAKSRPASNGVVGGVGNSKADLFSDLLKT  130

Query  505  AL  510
             +
Sbjct  131  PM  132



>ref|XP_008784777.1| PREDICTED: sperm-associated antigen 1-like [Phoenix dactylifera]
Length=397

 Score = 48.5 bits (114),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 29/45 (64%), Positives = 33/45 (73%), Gaps = 3/45 (7%)
 Frame = +1

Query  382  MVGDIFGKSWGSAAPSNTGSASTVGIVTKKDPNLFGDLVNSALRQ  516
            MVGDIFGKSW SAAP  T S+S +GI    +P+LF DLV SAL Q
Sbjct  1    MVGDIFGKSWTSAAP--TPSSSRLGI-PNNNPSLFSDLVGSALGQ  42



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 566636427000