BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001N07

Length=613
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009626835.1|  PREDICTED: erlin-2-B                               298   5e-97   Nicotiana tomentosiformis
ref|XP_009778129.1|  PREDICTED: erlin-2-B                               298   6e-97   Nicotiana sylvestris
ref|XP_006348696.1|  PREDICTED: erlin-2-B-like                          294   1e-95   Solanum tuberosum [potatoes]
ref|XP_004239055.1|  PREDICTED: erlin-2-B                               294   2e-95   Solanum lycopersicum
emb|CDP00430.1|  unnamed protein product                                280   7e-90   Coffea canephora [robusta coffee]
ref|XP_006378572.1|  hypothetical protein POPTR_0010s16620g             277   1e-88   Populus trichocarpa [western balsam poplar]
ref|XP_004297242.1|  PREDICTED: erlin-1                                 276   4e-88   Fragaria vesca subsp. vesca
gb|KDP41298.1|  hypothetical protein JCGZ_15705                         273   3e-87   Jatropha curcas
ref|XP_011075603.1|  PREDICTED: erlin-1                                 272   7e-87   Sesamum indicum [beniseed]
ref|XP_011011936.1|  PREDICTED: erlin-1-like                            272   1e-86   Populus euphratica
ref|XP_010258063.1|  PREDICTED: erlin-2-B-like                          270   4e-86   Nelumbo nucifera [Indian lotus]
ref|XP_008368234.1|  PREDICTED: erlin-1-like                            270   8e-86   Malus domestica [apple tree]
ref|XP_002316089.2|  band 7 family protein                              269   9e-86   
ref|XP_009356401.1|  PREDICTED: erlin-1                                 270   9e-86   Pyrus x bretschneideri [bai li]
ref|XP_008243857.1|  PREDICTED: erlin-2-B                               267   9e-85   Prunus mume [ume]
gb|KGN47646.1|  hypothetical protein Csa_6G366440                       266   1e-84   Cucumis sativus [cucumbers]
ref|XP_002512086.1|  SPFH domain-containing protein 2 precursor, ...    266   1e-84   Ricinus communis
ref|XP_008350891.1|  PREDICTED: erlin-2-B-like                          266   2e-84   
ref|XP_007223328.1|  hypothetical protein PRUPE_ppa007348mg             265   4e-84   Prunus persica
ref|XP_003556691.1|  PREDICTED: erlin-2-like isoform X1                 265   7e-84   Glycine max [soybeans]
ref|XP_004144261.1|  PREDICTED: LOW QUALITY PROTEIN: erlin-2-B-like     265   1e-83   
ref|XP_004171702.1|  PREDICTED: LOW QUALITY PROTEIN: erlin-2-B-like     265   1e-83   
gb|EPS71381.1|  hypothetical protein M569_03378                         261   7e-83   Genlisea aurea
ref|XP_003528559.1|  PREDICTED: erlin-2-like                            261   1e-82   Glycine max [soybeans]
emb|CDY65417.1|  BnaC02g47990D                                          259   5e-82   Brassica napus [oilseed rape]
ref|XP_010554285.1|  PREDICTED: erlin-1                                 259   6e-82   Tarenaya hassleriana [spider flower]
ref|XP_008445457.1|  PREDICTED: erlin-2-B                               259   6e-82   Cucumis melo [Oriental melon]
ref|XP_007157834.1|  hypothetical protein PHAVU_002G102100g             258   1e-81   Phaseolus vulgaris [French bean]
ref|XP_004505361.1|  PREDICTED: erlin-2-B-like                          258   2e-81   Cicer arietinum [garbanzo]
ref|XP_010259731.1|  PREDICTED: erlin-2-B-like                          258   2e-81   Nelumbo nucifera [Indian lotus]
gb|KCW86497.1|  hypothetical protein EUGRSUZ_B03154                     256   7e-81   Eucalyptus grandis [rose gum]
ref|XP_010680704.1|  PREDICTED: erlin-1                                 257   7e-81   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009114153.1|  PREDICTED: erlin-2-B                               256   9e-81   Brassica rapa
ref|XP_007045881.1|  SPFH/Band 7/PHB domain-containing membrane-a...    258   1e-80   
emb|CDY04155.1|  BnaA09g19330D                                          256   2e-80   
ref|XP_010044417.1|  PREDICTED: erlin-2-B                               257   2e-80   
gb|KCW86495.1|  hypothetical protein EUGRSUZ_B03154                     256   3e-80   Eucalyptus grandis [rose gum]
emb|CDY45557.1|  BnaC09g21530D                                          254   6e-80   Brassica napus [oilseed rape]
gb|KFK26236.1|  hypothetical protein AALP_AA8G220700                    254   6e-80   Arabis alpina [alpine rockcress]
ref|XP_006395697.1|  hypothetical protein EUTSA_v10004477mg             254   8e-80   Eutrema salsugineum [saltwater cress]
gb|KJB80361.1|  hypothetical protein B456_013G093700                    254   1e-79   Gossypium raimondii
ref|XP_003607805.1|  Erlin-2                                            253   2e-79   Medicago truncatula
ref|XP_010939164.1|  PREDICTED: erlin-2-B-like                          253   3e-79   Elaeis guineensis
dbj|BAE99370.1|  hypothetical protein                                   252   4e-79   Arabidopsis thaliana [mouse-ear cress]
ref|NP_027545.1|  SPFH/Band 7/PHB domain-containing membrane-asso...    252   4e-79   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002465119.1|  hypothetical protein SORBIDRAFT_01g032340          253   4e-79   Sorghum bicolor [broomcorn]
ref|NP_001141011.1|  hypothetical protein                               252   5e-79   Zea mays [maize]
ref|XP_002267076.1|  PREDICTED: erlin-2-B                               253   5e-79   Vitis vinifera
ref|XP_010527959.1|  PREDICTED: erlin-1-like                            252   5e-79   Tarenaya hassleriana [spider flower]
gb|KDO70385.1|  hypothetical protein CISIN_1g018056mg                   252   6e-79   Citrus sinensis [apfelsine]
ref|XP_004984014.1|  PREDICTED: erlin-2-B-like                          252   8e-79   Setaria italica
ref|XP_006437938.1|  hypothetical protein CICLE_v10031905mg             251   1e-78   Citrus clementina [clementine]
ref|XP_006437939.1|  hypothetical protein CICLE_v10031905mg             251   1e-78   
ref|NP_001168508.1|  hypothetical protein                               251   1e-78   Zea mays [maize]
ref|XP_010514121.1|  PREDICTED: erlin-2-B-like                          251   1e-78   Camelina sativa [gold-of-pleasure]
ref|XP_006291384.1|  hypothetical protein CARUB_v10017522mg             251   1e-78   Capsella rubella
dbj|BAJ89191.1|  predicted protein                                      250   3e-78   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010502373.1|  PREDICTED: erlin-2-B-like                          250   3e-78   Camelina sativa [gold-of-pleasure]
gb|KFK26235.1|  hypothetical protein AALP_AA8G220700                    249   5e-78   Arabis alpina [alpine rockcress]
ref|XP_008794156.1|  PREDICTED: erlin-2-B-like                          249   7e-78   Phoenix dactylifera
ref|XP_006651510.1|  PREDICTED: erlin-2-like                            248   2e-77   Oryza brachyantha
gb|KHN20517.1|  Erlin-2                                                 247   2e-77   Glycine soja [wild soybean]
ref|XP_010425147.1|  PREDICTED: erlin-2-B-like                          247   3e-77   Camelina sativa [gold-of-pleasure]
ref|XP_006837139.1|  hypothetical protein AMTR_s00110p00140670          245   1e-76   
ref|XP_002875209.1|  band 7 family protein                              246   1e-76   
ref|XP_003562386.1|  PREDICTED: erlin-2-B isoform X1                    246   1e-76   Brachypodium distachyon [annual false brome]
gb|AAO64812.1|  At2g03510                                               243   3e-76   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010936489.1|  PREDICTED: LOW QUALITY PROTEIN: erlin-2-B-like     245   3e-76   
gb|EYU28860.1|  hypothetical protein MIMGU_mgv1a010144mg                243   3e-76   Erythranthe guttata [common monkey flower]
ref|XP_006409591.1|  hypothetical protein EUTSA_v10022792mg             242   3e-76   
ref|XP_006409592.1|  hypothetical protein EUTSA_v10022792mg             242   5e-76   
gb|KCW86499.1|  hypothetical protein EUGRSUZ_B03155                     239   1e-75   Eucalyptus grandis [rose gum]
ref|XP_010091570.1|  hypothetical protein L484_026416                   241   2e-75   
gb|ACN40257.1|  unknown                                                 240   2e-74   Picea sitchensis
emb|CAE54276.1|  putative integral membrane protein that regulate...    235   2e-74   Triticum aestivum [Canadian hard winter wheat]
gb|AAT85034.1|  putative SPFH domain / Band 7 family                    241   2e-74   Oryza sativa Japonica Group [Japonica rice]
gb|KHN42949.1|  Erlin-2-B                                               237   6e-74   Glycine soja [wild soybean]
ref|XP_002965145.1|  hypothetical protein SELMODRAFT_227516             231   3e-71   
gb|ADE77372.1|  unknown                                                 231   6e-71   Picea sitchensis
ref|XP_001759598.1|  predicted protein                                  228   4e-70   
ref|XP_009396430.1|  PREDICTED: erlin-2-B isoform X1                    229   7e-70   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMS50295.1|  hypothetical protein TRIUR3_30715                       228   8e-70   Triticum urartu
ref|XP_009396431.1|  PREDICTED: erlin-2-B isoform X2                    229   8e-70   
ref|XP_001751456.1|  predicted protein                                  227   2e-69   
ref|XP_002962231.1|  hypothetical protein SELMODRAFT_76972              225   4e-69   
ref|XP_009396432.1|  PREDICTED: erlin-2-B isoform X3                    223   5e-68   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010044413.1|  PREDICTED: erlin-2-B-like isoform X2               223   1e-67   Eucalyptus grandis [rose gum]
ref|XP_010044412.1|  PREDICTED: erlin-2-B-like isoform X1               224   1e-67   Eucalyptus grandis [rose gum]
gb|KCW86496.1|  hypothetical protein EUGRSUZ_B03154                     200   2e-59   Eucalyptus grandis [rose gum]
emb|CDW91496.1|  spfh band 7 phb domain-containing membrane-assoc...    196   6e-58   Stylonychia lemnae
gb|EJY71854.1|  hypothetical protein OXYTRI_07151                       194   4e-57   Oxytricha trifallax
ref|XP_008871318.1|  hypothetical protein, variant 1                    192   2e-56   Aphanomyces invadans
ref|XP_009831327.1|  hypothetical protein H257_07483                    192   2e-56   Aphanomyces astaci
ref|XP_009831328.1|  hypothetical protein, variant                      192   2e-56   Aphanomyces astaci
ref|XP_008871319.1|  hypothetical protein, variant 2                    191   4e-56   Aphanomyces invadans
ref|XP_008871317.1|  hypothetical protein H310_07669                    192   5e-56   Aphanomyces invadans
ref|XP_005646983.1|  hypothetical protein COCSUDRAFT_53813              192   5e-56   Coccomyxa subellipsoidea C-169
ref|NP_001086246.1|  erlin-2-B precursor                                187   3e-54   Xenopus laevis [clawed frog]
gb|AAH05950.1|  ERLIN2 protein                                          187   4e-54   Homo sapiens [man]
ref|XP_010602982.1|  PREDICTED: erlin-2 isoform X2                      188   4e-54   Fukomys damarensis [Damara mole rat]
ref|XP_002720834.1|  PREDICTED: erlin-2                                 186   8e-54   Oryctolagus cuniculus [domestic rabbit]
ref|XP_009045292.1|  hypothetical protein LOTGIDRAFT_211937             186   8e-54   Lottia gigantea
ref|NP_001244470.1|  erlin-2 precursor                                  186   9e-54   Macaca mulatta [rhesus macaque]
ref|XP_011270124.1|  hypothetical protein CAOG_08542                    186   1e-53   Capsaspora owczarzaki ATCC 30864
ref|XP_004884322.1|  PREDICTED: erlin-2                                 186   1e-53   
ref|XP_007516752.1|  PREDICTED: erlin-2                                 186   1e-53   Erinaceus europaeus [common hedgehog]
ref|XP_006896709.1|  PREDICTED: erlin-2                                 186   1e-53   Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_003938158.1|  PREDICTED: erlin-2 isoform X2                      186   1e-53   Saimiri boliviensis boliviensis
ref|XP_002756994.1|  PREDICTED: erlin-2                                 186   2e-53   Callithrix jacchus [common marmoset]
emb|CDS31008.1|  erlin 2                                                192   2e-53   Hymenolepis microstoma
ref|XP_010602989.1|  PREDICTED: erlin-2 isoform X3                      186   2e-53   Fukomys damarensis [Damara mole rat]
ref|XP_010602975.1|  PREDICTED: erlin-2 isoform X1                      187   2e-53   Fukomys damarensis [Damara mole rat]
ref|XP_005563111.1|  PREDICTED: erlin-2                                 186   2e-53   Macaca fascicularis [crab eating macaque]
emb|CDQ73083.1|  unnamed protein product                                185   2e-53   Oncorhynchus mykiss
ref|NP_001016719.1|  erlin-2 precursor                                  185   2e-53   Xenopus tropicalis [western clawed frog]
ref|XP_007933159.1|  PREDICTED: erlin-2                                 185   2e-53   Orycteropus afer afer
ref|XP_848949.1|  PREDICTED: erlin-2 isoformX4                          185   2e-53   Canis lupus familiaris [dogs]
ref|XP_003738176.1|  PREDICTED: erlin-2-B-like                          185   2e-53   Galendromus occidentalis
ref|XP_007960361.1|  PREDICTED: erlin-2 isoform X1                      186   2e-53   Chlorocebus sabaeus
ref|XP_004394468.1|  PREDICTED: erlin-2                                 185   3e-53   Odobenus rosmarus divergens
ref|XP_004598559.1|  PREDICTED: erlin-2                                 185   3e-53   Ochotona princeps [southern American pika]
ref|XP_001493841.1|  PREDICTED: erlin-2 isoform X1                      185   3e-53   Equus caballus [domestic horse]
ref|XP_004758310.1|  PREDICTED: erlin-2 isoform X1                      185   3e-53   Mustela putorius furo [black ferret]
ref|XP_006263967.1|  PREDICTED: erlin-2-like isoform X2                 185   3e-53   
ref|XP_002917270.1|  PREDICTED: erlin-2                                 185   3e-53   Ailuropoda melanoleuca
ref|XP_008144402.1|  PREDICTED: erlin-2 isoform X1                      185   3e-53   Eptesicus fuscus
ref|XP_005856473.1|  PREDICTED: erlin-2 isoform X1                      185   3e-53   Myotis brandtii
ref|XP_005629927.1|  PREDICTED: erlin-2 isoform X5                      185   3e-53   Canis lupus familiaris [dogs]
ref|XP_004637321.1|  PREDICTED: erlin-2                                 185   3e-53   Octodon degus
ref|XP_008684811.1|  PREDICTED: erlin-2 isoform X2                      184   4e-53   Ursus maritimus [white bear]
ref|XP_005398468.1|  PREDICTED: erlin-2 isoform X2                      184   4e-53   Chinchilla lanigera
ref|NP_001088269.1|  erlin-2-A precursor                                184   4e-53   Xenopus laevis [clawed frog]
ref|NP_009106.1|  erlin-2 isoform 1                                     184   4e-53   Homo sapiens [man]
ref|XP_004671559.1|  PREDICTED: erlin-2                                 184   4e-53   Jaculus jaculus
ref|XP_006625610.1|  PREDICTED: erlin-2-like                            184   4e-53   Lepisosteus oculatus
emb|CAH90754.1|  hypothetical protein                                   184   4e-53   Pongo abelii [orang utan]
ref|XP_008070569.1|  PREDICTED: erlin-2                                 184   4e-53   Carlito syrichta
ref|XP_003498266.1|  PREDICTED: erlin-2                                 184   4e-53   Cricetulus griseus [Chinese hamsters]
ref|XP_008845823.1|  PREDICTED: erlin-2                                 184   5e-53   
ref|XP_005398467.1|  PREDICTED: erlin-2 isoform X1                      184   5e-53   
ref|XP_008586169.1|  PREDICTED: erlin-2 isoform X1                      184   5e-53   Galeopterus variegatus [Malayan flying lemur]
ref|XP_004383453.1|  PREDICTED: erlin-2                                 184   5e-53   Trichechus manatus latirostris
ref|XP_004682291.1|  PREDICTED: erlin-2                                 184   6e-53   Condylura cristata
gb|EPQ01538.1|  Erlin-2                                                 185   6e-53   Myotis brandtii
ref|XP_006170719.1|  PREDICTED: erlin-2                                 184   6e-53   Tupaia chinensis
ref|XP_006916376.1|  PREDICTED: erlin-2 isoform X1                      184   6e-53   Pteropus alecto
ref|XP_004318395.1|  PREDICTED: erlin-2                                 184   7e-53   Tursiops truncatus [Atlantic bottle-nosed dolphin]
ref|XP_006982987.1|  PREDICTED: erlin-2                                 184   7e-53   Peromyscus maniculatus bairdii
ref|XP_005066638.1|  PREDICTED: erlin-2                                 184   7e-53   Mesocricetus auratus [Syrian golden hamster]
ref|XP_003412458.1|  PREDICTED: erlin-2                                 184   7e-53   Loxodonta africana [African bush elephant]
ref|XP_003796348.1|  PREDICTED: erlin-2                                 184   7e-53   Otolemur garnettii
ref|XP_006028964.1|  PREDICTED: erlin-2 isoform X3                      184   7e-53   Alligator sinensis
ref|XP_003984836.1|  PREDICTED: erlin-2                                 184   7e-53   Felis catus [cat]
gb|EYB82447.1|  hypothetical protein Y032_0360g3455                     183   7e-53   Ancylostoma ceylanicum
ref|XP_001512901.1|  PREDICTED: erlin-2                                 184   7e-53   
ref|XP_005338432.1|  PREDICTED: erlin-2                                 184   7e-53   Ictidomys tridecemlineatus
ref|NP_705820.1|  erlin-2                                               184   7e-53   Mus musculus [mouse]
ref|XP_004469435.1|  PREDICTED: erlin-2                                 184   8e-53   Dasypus novemcinctus
dbj|BAC27019.1|  unnamed protein product                                184   8e-53   Mus musculus [mouse]
ref|XP_004284919.1|  PREDICTED: erlin-2                                 184   8e-53   Orcinus orca [Orca]
ref|XP_008684810.1|  PREDICTED: erlin-2 isoform X1                      184   8e-53   Ursus maritimus [white bear]
gb|ERE89623.1|  erlin-2-like protein                                    184   8e-53   Cricetulus griseus [Chinese hamsters]
ref|XP_011370467.1|  PREDICTED: erlin-2 isoform X2                      184   8e-53   Pteropus vampyrus
ref|XP_006051017.1|  PREDICTED: erlin-2                                 184   9e-53   Bubalus bubalis [domestic water buffalo]
ref|XP_007448372.1|  PREDICTED: erlin-2 isoform X2                      184   9e-53   Lipotes vexillifer [baiji]
ref|XP_010346995.1|  PREDICTED: erlin-2 isoform X1                      184   9e-53   Saimiri boliviensis boliviensis
ref|XP_010561073.1|  PREDICTED: erlin-2 isoform X2                      182   9e-53   Haliaeetus leucocephalus
ref|XP_004606925.1|  PREDICTED: erlin-2                                 184   1e-52   Sorex araneus [Eurasian shrew]
gb|KIH61869.1|  SPFH/Band 7/PHB domain protein                          183   1e-52   Ancylostoma duodenale
ref|XP_007113337.1|  PREDICTED: erlin-2 isoform X1                      184   1e-52   
ref|NP_001099558.1|  erlin-2                                            183   1e-52   Rattus norvegicus [brown rat]
gb|ETE72080.1|  Erlin-2                                                 179   1e-52   Ophiophagus hannah
ref|XP_003462936.1|  PREDICTED: erlin-2 isoform X1                      183   1e-52   Cavia porcellus [guinea pig]
ref|XP_001169738.2|  PREDICTED: erlin-2 isoform X1                      184   1e-52   
ref|XP_007476402.1|  PREDICTED: erlin-2 isoform X5                      182   1e-52   Monodelphis domestica
ref|XP_005981675.1|  PREDICTED: erlin-2                                 183   1e-52   Pantholops hodgsonii [Tibetan antelope]
ref|NP_001040041.1|  erlin-2 precursor                                  183   1e-52   Bos taurus [bovine]
ref|XP_007170161.1|  PREDICTED: erlin-2 isoform X2                      183   1e-52   Balaenoptera acutorostrata scammoni
gb|ELK08766.1|  Erlin-2                                                 184   1e-52   Pteropus alecto
ref|XP_005671838.1|  PREDICTED: erlin-2 isoform X2                      183   1e-52   Sus scrofa [pigs]
ref|XP_004428905.1|  PREDICTED: erlin-2 isoform 1                       183   1e-52   Ceratotherium simum simum [southern square-lipped rhinoceros]
ref|XP_004021822.1|  PREDICTED: erlin-2                                 183   1e-52   Ovis aries [domestic sheep]
ref|NP_001167060.1|  Erlin-2 precursor                                  183   1e-52   Salmo salar
ref|XP_006201197.1|  PREDICTED: erlin-2                                 183   1e-52   Vicugna pacos
ref|XP_005286570.1|  PREDICTED: erlin-2                                 183   1e-52   Chrysemys picta bellii
ref|XP_006183419.1|  PREDICTED: erlin-2                                 183   1e-52   Camelus ferus
ref|XP_006509177.1|  PREDICTED: erlin-2 isoform X2                      184   1e-52   
ref|XP_006132694.1|  PREDICTED: erlin-2                                 183   2e-52   Pelodiscus sinensis [Chinese softshell turtle]
ref|XP_005362531.1|  PREDICTED: erlin-2                                 183   2e-52   Microtus ochrogaster [prairie voles]
ref|XP_004428906.1|  PREDICTED: erlin-2 isoform 2                       183   2e-52   
ref|XP_007053523.1|  PREDICTED: erlin-2                                 182   2e-52   
ref|XP_005226182.1|  PREDICTED: erlin-2 isoform X3                      183   2e-52   Bos taurus [bovine]
ref|XP_010874935.1|  PREDICTED: erlin-2 isoform X1                      182   2e-52   Esox lucius
ref|NP_001137178.1|  erlin-2 precursor                                  182   2e-52   Sus scrofa [pigs]
ref|XP_009969602.1|  PREDICTED: erlin-1                                 177   2e-52   Tyto alba [Schleiereule]
ref|XP_424380.1|  PREDICTED: erlin-2                                    182   2e-52   Gallus gallus [bantam]
ref|XP_010874936.1|  PREDICTED: erlin-2 isoform X2                      182   2e-52   Esox lucius
ref|XP_010837091.1|  PREDICTED: erlin-2 isoform X4                      183   2e-52   Bison bison bison
ref|XP_011370460.1|  PREDICTED: erlin-2 isoform X1                      184   2e-52   Pteropus vampyrus
ref|XP_007448371.1|  PREDICTED: erlin-2 isoform X1                      183   3e-52   Lipotes vexillifer [baiji]
ref|XP_009010827.1|  hypothetical protein HELRODRAFT_190088             181   4e-52   Helobdella robusta
ref|XP_011444952.1|  PREDICTED: erlin-2-like                            182   4e-52   Crassostrea gigas
ref|XP_005671837.1|  PREDICTED: erlin-2 isoform X1                      182   4e-52   Sus scrofa [pigs]
ref|XP_007170160.1|  PREDICTED: erlin-2 isoform X1                      182   5e-52   Balaenoptera acutorostrata scammoni
ref|XP_004696558.1|  PREDICTED: erlin-2                                 182   5e-52   
ref|XP_010561072.1|  PREDICTED: erlin-2 isoform X1                      182   5e-52   Haliaeetus leucocephalus
ref|XP_007436946.1|  PREDICTED: erlin-2                                 181   5e-52   Python bivittatus
ref|XP_010979431.1|  PREDICTED: erlin-2                                 182   5e-52   Camelus dromedarius [camel]
ref|XP_005142523.1|  PREDICTED: erlin-2                                 181   6e-52   Melopsittacus undulatus
ref|XP_001381844.1|  PREDICTED: erlin-2 isoform X1                      181   7e-52   Monodelphis domestica
gb|ELU09244.1|  hypothetical protein CAPTEDRAFT_175010                  181   8e-52   Capitella teleta
ref|XP_010154781.1|  PREDICTED: erlin-1                                 181   1e-51   Eurypyga helias
gb|KFQ73480.1|  Erlin-1                                                 176   1e-51   Phoenicopterus ruber ruber
ref|XP_003758037.1|  PREDICTED: erlin-2                                 181   1e-51   Sarcophilus harrisii
ref|XP_009879907.1|  PREDICTED: erlin-1                                 181   1e-51   Charadrius vociferus
ref|XP_005273448.1|  PREDICTED: erlin-2 isoform X1                      183   1e-51   
gb|EJW75533.1|  erlin-2                                                 177   2e-51   Wuchereria bancrofti [agent of lymphatic filariasis]
ref|XP_002186753.1|  PREDICTED: erlin-1                                 176   2e-51   Taeniopygia guttata
ref|XP_009511928.1|  PREDICTED: erlin-1                                 175   2e-51   Phalacrocorax carbo [common cormorant]
ref|XP_005226181.1|  PREDICTED: erlin-2 isoform X2                      182   2e-51   Bos taurus [bovine]
ref|XP_010837087.1|  PREDICTED: erlin-2 isoform X1                      182   2e-51   Bison bison bison
ref|XP_005089259.1|  PREDICTED: erlin-1-like isoform X1                 180   2e-51   Aplysia californica
ref|XP_005017337.1|  PREDICTED: erlin-1 isoform X1                      180   2e-51   
ref|XP_004622491.1|  PREDICTED: erlin-2-like                            179   2e-51   Sorex araneus [Eurasian shrew]
ref|XP_009577783.1|  PREDICTED: erlin-1                                 180   2e-51   Fulmarus glacialis
gb|EUB55643.1|  Erlin-1                                                 181   3e-51   Echinococcus granulosus
ref|XP_009681498.1|  PREDICTED: erlin-1                                 180   3e-51   Struthio camelus australis
ref|XP_009273335.1|  PREDICTED: erlin-1                                 180   3e-51   
emb|CDJ04352.1|  erlin 1                                                181   3e-51   
ref|XP_010298285.1|  PREDICTED: erlin-1                                 174   3e-51   Balearica regulorum gibbericeps
ref|XP_009491710.1|  PREDICTED: erlin-1                                 180   3e-51   Pelecanus crispus
ref|XP_010116335.1|  PREDICTED: erlin-1                                 180   4e-51   Chlamydotis macqueenii
ref|XP_009635828.1|  PREDICTED: LOW QUALITY PROTEIN: erlin-1            180   4e-51   Egretta garzetta
ref|XP_003379790.1|  erlin-2                                            179   4e-51   Trichinella spiralis
gb|KFP07218.1|  Erlin-1                                                 179   4e-51   Calypte anna
ref|XP_009464323.1|  PREDICTED: erlin-1                                 179   4e-51   Nipponia nippon
gb|EHJ65120.1|  putative SPFH domain family, member 1                   179   4e-51   
ref|XP_011505896.1|  PREDICTED: erlin-1-like                            179   4e-51   Ceratosolen solmsi marchali
ref|XP_010204333.1|  PREDICTED: LOW QUALITY PROTEIN: erlin-1-like       180   4e-51   Colius striatus
ref|XP_001892051.1|  hypothetical protein                               179   4e-51   Brugia malayi [agent of lymphatic filariasis]
ref|XP_007883614.1|  PREDICTED: erlin-2-B-like                          179   4e-51   Callorhinchus milii [Australian ghost shark]
ref|XP_002115838.1|  hypothetical protein TRIADDRAFT_38143              179   5e-51   Trichoplax adhaerens
ref|XP_003141777.1|  hypothetical protein LOAG_06193                    179   5e-51   Loa loa
ref|XP_010406982.1|  PREDICTED: erlin-1                                 179   5e-51   
ref|XP_003226774.2|  PREDICTED: erlin-2                                 180   5e-51   
ref|XP_010006086.1|  PREDICTED: erlin-1                                 179   5e-51   Chaetura pelagica
ref|XP_010014816.1|  PREDICTED: erlin-1                                 179   5e-51   Nestor notabilis
ref|XP_010568434.1|  PREDICTED: LOW QUALITY PROTEIN: erlin-1            179   5e-51   Haliaeetus leucocephalus
ref|XP_005242641.1|  PREDICTED: LOW QUALITY PROTEIN: erlin-1            179   6e-51   Falco peregrinus [peregrine]
ref|XP_009331047.1|  PREDICTED: LOW QUALITY PROTEIN: erlin-1            179   7e-51   Pygoscelis adeliae
gb|ERE89622.1|  zinc finger protein                                     187   7e-51   Cricetulus griseus [Chinese hamsters]
ref|XP_006000350.1|  PREDICTED: erlin-2                                 179   7e-51   Latimeria chalumnae
ref|NP_001026394.1|  erlin-1                                            179   8e-51   
ref|XP_005048072.1|  PREDICTED: LOW QUALITY PROTEIN: erlin-1            179   8e-51   
ref|XP_009933875.1|  PREDICTED: LOW QUALITY PROTEIN: erlin-1            179   8e-51   Opisthocomus hoazin [hoatzin]
emb|CAX82884.1|  SPFH domain-containing protein 1 precursor             178   9e-51   Schistosoma japonicum
ref|XP_007883572.1|  PREDICTED: erlin-2                                 176   1e-50   Callorhinchus milii [Australian ghost shark]
ref|XP_006126417.1|  PREDICTED: erlin-1 isoform X1                      178   1e-50   Pelodiscus sinensis [Chinese softshell turtle]
ref|XP_005530795.1|  PREDICTED: LOW QUALITY PROTEIN: erlin-1            179   1e-50   Pseudopodoces humilis [Tibetan ground-jay]
ref|XP_010383610.1|  PREDICTED: erlin-2 isoform X2                      172   1e-50   Rhinopithecus roxellana
ref|XP_002949148.1|  hypothetical protein VOLCADRAFT_59054              179   1e-50   Volvox carteri f. nagariensis
ref|XP_008333941.1|  PREDICTED: erlin-2                                 178   1e-50   Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_010292502.1|  PREDICTED: LOW QUALITY PROTEIN: erlin-1-like       178   1e-50   Phaethon lepturus
ref|NP_001279118.1|  ER lipid raft associated 1                         178   1e-50   Callorhinchus milii [Australian ghost shark]
ref|XP_008500274.1|  PREDICTED: LOW QUALITY PROTEIN: erlin-1            178   1e-50   Calypte anna
gb|EYB82446.1|  hypothetical protein Y032_0360g3455                     185   2e-50   Ancylostoma ceylanicum
ref|XP_010346998.1|  PREDICTED: erlin-2 isoform X3                      172   2e-50   Saimiri boliviensis boliviensis
gb|KFM69687.1|  Erlin-2-B                                               177   2e-50   Stegodyphus mimosarum
ref|XP_005530872.1|  PREDICTED: erlin-2                                 177   2e-50   Pseudopodoces humilis [Tibetan ground-jay]
ref|XP_005058155.1|  PREDICTED: erlin-2                                 177   2e-50   Ficedula albicollis
ref|XP_009696459.1|  PREDICTED: LOW QUALITY PROTEIN: erlin-1-like       178   2e-50   Cariama cristata
ref|XP_008144404.1|  PREDICTED: erlin-2 isoform X2                      171   3e-50   
emb|CAF93211.1|  unnamed protein product                                172   3e-50   Tetraodon nigroviridis
ref|XP_009912300.1|  PREDICTED: erlin-1                                 172   3e-50   Haliaeetus albicilla
ref|XP_005310847.1|  PREDICTED: LOW QUALITY PROTEIN: erlin-1            178   3e-50   
ref|XP_003974611.1|  PREDICTED: erlin-2-like                            176   4e-50   Takifugu rubripes [tiger puffer]
ref|XP_010135333.1|  PREDICTED: erlin-1                                 177   4e-50   Buceros rhinoceros silvestris
ref|NP_001016892.1|  erlin-1 precursor                                  176   4e-50   Xenopus tropicalis [western clawed frog]
ref|NP_001121887.1|  erlin-2 precursor                                  176   5e-50   Danio rerio [leopard danio]
ref|XP_008631526.1|  PREDICTED: LOW QUALITY PROTEIN: erlin-1-like       177   5e-50   
ref|NP_001003791.1|  erlin-2 isoform 2                                  171   5e-50   
ref|XP_008586172.1|  PREDICTED: erlin-2 isoform X2                      171   5e-50   
ref|XP_009817265.1|  PREDICTED: erlin-1                                 176   6e-50   
ref|XP_008925327.1|  PREDICTED: LOW QUALITY PROTEIN: erlin-1            177   6e-50   
gb|ACO10602.1|  Erlin-2                                                 176   6e-50   
ref|XP_010736786.1|  PREDICTED: erlin-2                                 176   7e-50   
ref|XP_006916377.1|  PREDICTED: erlin-2 isoform X2                      170   7e-50   
emb|CAG02452.1|  unnamed protein product                                176   8e-50   
ref|XP_004321007.1|  PREDICTED: erlin-1                                 172   8e-50   
ref|XP_001943498.1|  PREDICTED: erlin-1-like                            175   8e-50   
ref|XP_010212968.1|  PREDICTED: erlin-1                                 177   8e-50   
ref|XP_005430350.1|  PREDICTED: LOW QUALITY PROTEIN: erlin-1            177   9e-50   
sp|Q91X78.1|ERLN1_MOUSE  RecName: Full=Erlin-1; AltName: Full=End...    176   9e-50   
emb|CDJ81719.1|  Mitochondrial substrate solute carrier and Major...    183   1e-49   
ref|XP_009008379.1|  PREDICTED: erlin-1 isoform X4                      174   1e-49   
ref|NP_663477.3|  erlin-1                                               176   1e-49   
ref|NP_001099823.1|  erlin-1                                            176   1e-49   
ref|XP_003311715.2|  PREDICTED: erlin-2 isoform X4                      171   1e-49   
gb|EGT40100.1|  hypothetical protein CAEBREN_10030                      175   1e-49   
ref|XP_009085990.1|  PREDICTED: LOW QUALITY PROTEIN: erlin-1-like       177   1e-49   
gb|ADD37977.1|  Erlin-2                                                 175   1e-49   
ref|XP_006765654.1|  PREDICTED: erlin-2                                 175   1e-49   
ref|XP_004428907.1|  PREDICTED: erlin-2 isoform 3                       169   2e-49   
ref|XP_006157436.1|  PREDICTED: erlin-1 isoform X1                      175   2e-49   
emb|CCD80452.1|  putative spfh domain protein 1 precursor               181   2e-49   
ref|XP_004884588.1|  PREDICTED: erlin-1-like                            175   2e-49   
ref|XP_005945192.1|  PREDICTED: erlin-2-like isoform X2                 175   2e-49   
ref|XP_004567347.1|  PREDICTED: erlin-2-like isoform X2                 174   2e-49   
ref|XP_004567346.1|  PREDICTED: erlin-2-like isoform X1                 175   2e-49   
gb|ACO13149.1|  Erlin-2 precursor                                       175   2e-49   
ref|XP_006831306.1|  PREDICTED: erlin-1                                 175   2e-49   
ref|XP_008142399.1|  PREDICTED: erlin-1                                 175   3e-49   
ref|XP_006880096.1|  PREDICTED: erlin-1                                 175   3e-49   
ref|XP_005885424.1|  PREDICTED: erlin-1                                 175   3e-49   
ref|XP_006756623.1|  PREDICTED: erlin-1 isoform X1                      175   3e-49   
ref|XP_002718692.1|  PREDICTED: erlin-1                                 174   3e-49   
ref|XP_004931715.1|  PREDICTED: erlin-2-like                            174   3e-49   
ref|XP_008568819.1|  PREDICTED: erlin-1                                 174   4e-49   
ref|XP_004370085.1|  PREDICTED: erlin-1                                 174   4e-49   
ref|XP_003383395.1|  PREDICTED: erlin-1-like                            174   4e-49   
gb|ACO14872.1|  Erlin-1                                                 174   4e-49   
ref|XP_009457352.1|  PREDICTED: erlin-1 isoform X2                      174   4e-49   
ref|XP_002924322.1|  PREDICTED: erlin-1                                 174   4e-49   
ref|XP_007187431.1|  PREDICTED: erlin-1 isoform X6                      173   4e-49   
ref|XP_007530326.1|  PREDICTED: erlin-1                                 174   4e-49   
ref|XP_004616415.1|  PREDICTED: erlin-1                                 174   4e-49   
ref|XP_006277090.1|  PREDICTED: erlin-1-like                            174   4e-49   
ref|XP_010636835.1|  PREDICTED: erlin-1                                 174   4e-49   
ref|XP_003409227.1|  PREDICTED: erlin-1                                 174   4e-49   
ref|XP_007938156.1|  PREDICTED: erlin-1                                 174   5e-49   
dbj|BAG37953.1|  unnamed protein product                                174   5e-49   
ref|XP_004669931.1|  PREDICTED: erlin-1                                 174   5e-49   
ref|XP_003255385.1|  PREDICTED: erlin-1                                 174   5e-49   
ref|XP_002424435.1|  SPFH domain-containing protein 1 precursor, ...    176   5e-49   
ref|XP_011302345.1|  PREDICTED: erlin-1-like                            174   5e-49   
ref|XP_006741206.1|  PREDICTED: erlin-1                                 174   5e-49   
ref|XP_010561074.1|  PREDICTED: erlin-2 isoform X3                      168   5e-49   
ref|XP_005407742.1|  PREDICTED: erlin-1 isoform X1                      174   5e-49   
ref|XP_008703758.1|  PREDICTED: erlin-1                                 174   5e-49   
ref|XP_005602362.1|  PREDICTED: erlin-1                                 174   5e-49   
ref|NP_001136368.1|  erlin-1                                            174   5e-49   
ref|XP_005335284.1|  PREDICTED: erlin-1                                 174   5e-49   
ref|XP_004459249.1|  PREDICTED: erlin-1 isoform 1                       174   5e-49   
ref|XP_004428001.1|  PREDICTED: erlin-1 isoform 1                       174   5e-49   
ref|NP_001181295.1|  erlin-1                                            174   5e-49   
ref|XP_010868506.1|  PREDICTED: erlin-1-like                            174   5e-49   
sp|O75477.1|ERLN1_HUMAN  RecName: Full=Erlin-1; AltName: Full=End...    174   5e-49   
ref|XP_003787315.1|  PREDICTED: erlin-1                                 174   5e-49   
ref|XP_007080226.1|  PREDICTED: erlin-1                                 174   5e-49   
ref|XP_003479839.1|  PREDICTED: erlin-1                                 174   5e-49   
dbj|BAD96200.1|  SPFH domain family, member 1 variant                   174   5e-49   
ref|XP_004749560.1|  PREDICTED: erlin-1                                 174   5e-49   
ref|NP_006450.2|  erlin-1                                               174   5e-49   
ref|XP_004401965.1|  PREDICTED: erlin-1 isoform 1                       174   5e-49   
ref|XP_003922355.1|  PREDICTED: erlin-1                                 174   5e-49   
ref|XP_004268498.1|  PREDICTED: erlin-1 isoform 1                       174   6e-49   
ref|XP_008123433.1|  PREDICTED: erlin-1-like                            174   6e-49   
ref|XP_007117679.1|  PREDICTED: erlin-1                                 174   6e-49   
gb|EDL41919.1|  SPFH domain family, member 1, isoform CRA_b             175   6e-49   
ref|NP_001125267.1|  erlin-1                                            174   6e-49   
ref|XP_007187428.1|  PREDICTED: erlin-1 isoform X3                      174   6e-49   
ref|XP_004701054.1|  PREDICTED: erlin-1                                 174   6e-49   
ref|XP_002756567.1|  PREDICTED: erlin-1 isoform X2                      174   6e-49   
sp|Q5RCJ9.2|ERLN1_PONAB  RecName: Full=Erlin-1; AltName: Full=End...    174   6e-49   
ref|XP_004049988.1|  PREDICTED: erlin-1                                 174   7e-49   
ref|XP_009008378.1|  PREDICTED: erlin-1 isoform X3                      174   7e-49   
ref|XP_007187426.1|  PREDICTED: erlin-1 isoform X1                      174   7e-49   
ref|XP_006741505.1|  PREDICTED: erlin-2                                 173   7e-49   
ref|XP_006067671.1|  PREDICTED: erlin-1                                 174   7e-49   
ref|NP_001157504.1|  erlin-1                                            174   7e-49   
ref|XP_007564792.1|  PREDICTED: erlin-2                                 173   7e-49   
ref|XP_006182979.1|  PREDICTED: erlin-1 isoform X1                      174   7e-49   
ref|XP_004625604.1|  PREDICTED: erlin-1                                 174   7e-49   
ref|XP_009213408.1|  PREDICTED: erlin-1 isoform X2                      172   8e-49   
ref|XP_006797550.1|  PREDICTED: erlin-2-like                            174   8e-49   
ref|XP_005746167.1|  PREDICTED: erlin-2-like                            174   8e-49   
ref|XP_002633499.1|  Hypothetical protein CBG06271                      172   8e-49   
ref|XP_008843768.1|  PREDICTED: erlin-1                                 174   8e-49   
ref|XP_011162717.1|  PREDICTED: erlin-2-B-like                          173   8e-49   
ref|XP_006988215.1|  PREDICTED: erlin-1                                 173   8e-49   
ref|XP_010857836.1|  PREDICTED: erlin-1 isoform X2                      173   9e-49   
ref|XP_006210588.1|  PREDICTED: erlin-1                                 173   9e-49   
ref|NP_502339.1|  Protein ERL-1                                         172   9e-49   
ref|XP_005802194.1|  PREDICTED: erlin-2-like                            173   1e-48   
gb|KDR18219.1|  Erlin-1                                                 174   1e-48   
ref|XP_004680599.1|  PREDICTED: erlin-1                                 173   1e-48   
gb|AAH67765.1|  ERLIN2 protein                                          169   1e-48   
gb|AAH23849.1|  ER lipid raft associated 1                              173   1e-48   
gb|AAH50611.1|  ERLIN2 protein                                          169   1e-48   
ref|XP_005698381.1|  PREDICTED: erlin-1                                 173   1e-48   
ref|XP_004020157.1|  PREDICTED: erlin-1                                 173   1e-48   
ref|XP_008415899.1|  PREDICTED: erlin-2                                 172   1e-48   
ref|XP_003448634.2|  PREDICTED: erlin-2-like                            174   2e-48   
ref|XP_004072804.1|  PREDICTED: erlin-2                                 172   2e-48   
emb|CAP26134.2|  Protein CBR-ERL-1                                      172   2e-48   
ref|XP_009008375.1|  PREDICTED: erlin-1 isoform X1                      173   2e-48   
ref|XP_003399846.1|  PREDICTED: erlin-1-like                            171   2e-48   
ref|XP_011064919.1|  PREDICTED: erlin-2-B-like                          172   2e-48   
ref|XP_005273450.1|  PREDICTED: erlin-2 isoform X3                      170   3e-48   
ref|XP_011147325.1|  PREDICTED: erlin-2-like                            172   3e-48   
ref|XP_003754982.1|  PREDICTED: erlin-1-like                            172   3e-48   
ref|XP_006615708.1|  PREDICTED: erlin-1-like                            171   3e-48   
ref|XP_003695194.1|  PREDICTED: erlin-1-like                            171   3e-48   
ref|XP_001377959.2|  PREDICTED: LOW QUALITY PROTEIN: erlin-1-like       172   3e-48   
ref|XP_623822.2|  PREDICTED: erlin-1-like                               171   3e-48   
ref|XP_005637667.1|  PREDICTED: erlin-1                                 172   3e-48   
ref|XP_003700681.1|  PREDICTED: erlin-1-like                            171   3e-48   
ref|XP_005063613.1|  PREDICTED: erlin-1 isoform X1                      172   4e-48   
ref|XP_006263966.1|  PREDICTED: erlin-2-like isoform X1                 172   4e-48   
ref|XP_006925949.1|  PREDICTED: erlin-1                                 172   4e-48   
gb|EFX84809.1|  hypothetical protein DAPPUDRAFT_300721                  171   5e-48   
emb|CDQ70286.1|  unnamed protein product                                167   5e-48   
ref|XP_011333266.1|  PREDICTED: erlin-1-like                            171   6e-48   
gb|KGB39011.1|  Erlin-1                                                 171   7e-48   
ref|XP_002127010.1|  PREDICTED: erlin-1                                 171   8e-48   
ref|XP_003486875.1|  PREDICTED: hypothetical protein LOC100747756       177   8e-48   
ref|XP_974446.1|  PREDICTED: erlin-1                                    170   8e-48   
ref|XP_005141391.1|  PREDICTED: erlin-1                                 174   9e-48   
ref|XP_007962019.1|  PREDICTED: erlin-1 isoform X2                      173   9e-48   
ref|XP_009950915.1|  PREDICTED: erlin-1-like                            164   1e-47   
ref|XP_007962018.1|  PREDICTED: erlin-1 isoform X1                      173   1e-47   
ref|XP_010857835.1|  PREDICTED: erlin-1 isoform X1                      172   1e-47   
ref|XP_006028962.1|  PREDICTED: erlin-2 isoform X1                      171   1e-47   
ref|XP_003508504.2|  PREDICTED: erlin-1 isoform X1                      170   1e-47   
ref|XP_011262979.1|  PREDICTED: erlin-1-like                            170   1e-47   
ref|XP_008547233.1|  PREDICTED: erlin-2-B-like                          170   1e-47   
gb|ELK35652.1|  Inhibitor of nuclear factor kappa-B kinase subuni...    178   2e-47   
ref|XP_007618048.1|  PREDICTED: erlin-1 isoform X2                      171   2e-47   
ref|XP_005980744.1|  PREDICTED: erlin-1                                 170   2e-47   
ref|XP_004586414.1|  PREDICTED: erlin-1-like                            170   2e-47   
ref|XP_008333651.1|  PREDICTED: LOW QUALITY PROTEIN: erlin-2-like       169   2e-47   
ref|XP_007433207.1|  PREDICTED: erlin-1-like isoform X1                 170   3e-47   
ref|NP_001014325.1|  erlin-1 precursor                                  169   4e-47   
ref|XP_004555959.1|  PREDICTED: erlin-1-like isoform X1                 169   4e-47   
gb|KHN73041.1|  Erlin-1                                                 170   5e-47   
ref|XP_008320240.1|  PREDICTED: LOW QUALITY PROTEIN: erlin-1            168   5e-47   
ref|XP_008470776.1|  PREDICTED: erlin-1-like                            168   6e-47   
ref|XP_003441158.2|  PREDICTED: erlin-1-like isoform X1                 168   6e-47   
gb|KCW86505.1|  hypothetical protein EUGRSUZ_B03159                     165   7e-47   
ref|XP_008468971.1|  PREDICTED: erlin-1-like                            167   8e-47   
ref|XP_003100754.1|  hypothetical protein CRE_15509                     167   1e-46   
ref|XP_006800766.1|  PREDICTED: erlin-1-like isoform X1                 167   1e-46   
ref|XP_004988992.1|  erlin-1                                            167   1e-46   
ref|XP_007248637.1|  PREDICTED: erlin-1-like                            168   1e-46   
ref|XP_007546164.1|  PREDICTED: erlin-1                                 167   2e-46   
pir||T32896  hypothetical protein C42C1.9 - Caenorhabditis elegans      172   2e-46
ref|XP_010787914.1|  PREDICTED: erlin-1                                 167   2e-46   
ref|XP_006820497.1|  PREDICTED: erlin-2-like                            167   2e-46   
ref|XP_003964203.1|  PREDICTED: erlin-1-like                            167   3e-46   
ref|XP_010743498.1|  PREDICTED: erlin-1                                 166   3e-46   
ref|XP_008295819.1|  PREDICTED: erlin-1                                 166   3e-46   
gb|KHJ45192.1|  SPFH/Band 7/PHB domain protein                          166   4e-46   
gb|AEE62519.1|  unknown                                                 166   4e-46   
ref|XP_008427977.1|  PREDICTED: erlin-1                                 166   5e-46   
ref|XP_005837507.1|  hypothetical protein GUITHDRAFT_159367             164   1e-45   
ref|XP_001622641.1|  predicted protein                                  164   1e-45   
gb|KFD65955.1|  hypothetical protein M514_03886                         172   4e-45   
gb|KFD55245.1|  hypothetical protein M513_03886                         172   4e-45   
gb|EHA98402.1|  Erlin-1                                                 161   4e-45   
ref|XP_006630389.1|  PREDICTED: erlin-1-like                            164   7e-45   
emb|CBN79723.1|  conserved unknown protein                              161   9e-45   
ref|XP_005352640.1|  PREDICTED: erlin-1                                 160   6e-44   
ref|XP_005017338.1|  PREDICTED: erlin-1 isoform X2                      159   1e-43   
ref|XP_009901414.1|  PREDICTED: erlin-1                                 159   2e-43   
emb|CAG09393.1|  unnamed protein product                                158   3e-43   
ref|XP_009560088.1|  PREDICTED: erlin-1                                 157   4e-43   
gb|EPY82621.1|  cytochrome P450 2C23-like protein                       162   6e-43   
ref|XP_010073515.1|  PREDICTED: erlin-1                                 157   7e-43   
ref|XP_007476400.1|  PREDICTED: erlin-2 isoform X3                      157   2e-42   
ref|XP_010190812.1|  PREDICTED: erlin-1                                 155   4e-42   
ref|XP_001512971.1|  PREDICTED: erlin-1                                 155   4e-42   
gb|EFB29112.1|  hypothetical protein PANDA_013640                       154   6e-42   
ref|XP_009868022.1|  PREDICTED: LOW QUALITY PROTEIN: erlin-1-like       155   1e-41   
ref|XP_002163147.2|  PREDICTED: erlin-2-like                            156   1e-41   
gb|EMC81502.1|  Erlin-2                                                 152   5e-41   
ref|XP_005510935.1|  PREDICTED: erlin-2                                 154   8e-41   
ref|XP_006033773.1|  PREDICTED: erlin-1-like                            151   1e-40   
ref|XP_006003567.1|  PREDICTED: erlin-1                                 152   2e-40   
ref|XP_009843311.1|  hypothetical protein, variant 3                    150   2e-40   
ref|XP_004794817.1|  PREDICTED: LOW QUALITY PROTEIN: erlin-1            151   4e-40   
ref|XP_009843312.1|  hypothetical protein, variant 4                    147   5e-40   
gb|ERE80422.1|  inhibitor of nuclear factor kappa-B kinase subuni...    156   6e-40   
gb|ETE62532.1|  Erlin-1                                                 151   8e-40   
ref|XP_009843310.1|  hypothetical protein, variant 2                    149   9e-40   
ref|XP_009843309.1|  hypothetical protein, variant 1                    149   1e-39   
gb|ABQ13012.1|  SPFH domain family, member 1                            144   1e-39   
ref|XP_008864289.1|  hypothetical protein, variant 2                    147   2e-39   
ref|XP_009843313.1|  hypothetical protein H257_16548                    148   4e-39   
ref|NP_001050383.1|  Os03g0421400                                       145   5e-39   
ref|XP_009095947.1|  PREDICTED: erlin-2                                 147   8e-39   
ref|XP_008864287.1|  hypothetical protein H310_02526                    147   1e-38   
ref|XP_001746005.1|  hypothetical protein                               142   6e-37   
gb|KJE90411.1|  hypothetical protein, variant                           140   9e-37   
gb|KJB50570.1|  hypothetical protein B456_008G177400                    134   1e-36   
emb|CDW53098.1|  Band 7 domain containing protein                       138   9e-36   
ref|XP_010233452.1|  PREDICTED: erlin-2 isoform X2                      137   2e-35   
ref|XP_005505258.1|  PREDICTED: erlin-1                                 135   8e-35   
gb|ETN83216.1|  SPFH/Band 7/PHB domain protein                          134   5e-34   
ref|XP_008059056.1|  PREDICTED: erlin-1                                 132   1e-33   
ref|XP_007476401.1|  PREDICTED: erlin-2 isoform X4                      131   2e-33   



>ref|XP_009626835.1| PREDICTED: erlin-2-B [Nicotiana tomentosiformis]
Length=362

 Score =   298 bits (763),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 139/157 (89%), Positives = 147/157 (94%), Gaps = 2/157 (1%)
 Frame = +1

Query  148  DFTPILFVFLSFIAIFVMVVTPLLST--NSFSTLHQVPEGHVGVYWRGGALLSTITTPGF  321
            DFTPIL V +SFIAIFV++V P +ST  NS S LHQVPEGHVGVYWRGGALL+TIT PGF
Sbjct  28   DFTPILTVLVSFIAIFVLIVAPSMSTLNNSLSILHQVPEGHVGVYWRGGALLNTITDPGF  87

Query  322  HLKLPFITHFEPIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGV  501
            HLKLPFIT FEPIQVTLQTDLVRDIPCGTKGGVMINF+KIEVVNRLRK+HVYDTLLNYGV
Sbjct  88   HLKLPFITQFEPIQVTLQTDLVRDIPCGTKGGVMINFDKIEVVNRLRKDHVYDTLLNYGV  147

Query  502  HYDNTWIYDKIHHEINQFCSGHSLQQVYIDMFDQIDE  612
            +YDNTWIYDKIHHEINQFCSGHSLQQVYIDMFDQIDE
Sbjct  148  NYDNTWIYDKIHHEINQFCSGHSLQQVYIDMFDQIDE  184



>ref|XP_009778129.1| PREDICTED: erlin-2-B [Nicotiana sylvestris]
Length=362

 Score =   298 bits (763),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 139/157 (89%), Positives = 147/157 (94%), Gaps = 2/157 (1%)
 Frame = +1

Query  148  DFTPILFVFLSFIAIFVMVVTPLLST--NSFSTLHQVPEGHVGVYWRGGALLSTITTPGF  321
            DFTPIL V +SFIAIFV++V P +ST  NS S LHQVPEGHVGVYWRGGALL+TIT PGF
Sbjct  28   DFTPILTVLVSFIAIFVLIVAPSMSTLNNSLSILHQVPEGHVGVYWRGGALLNTITDPGF  87

Query  322  HLKLPFITHFEPIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGV  501
            HLKLPFIT FEPIQVTLQTDLVRDIPCGTKGGVMINF+KIEVVNRLRK+HVYDTLLNYGV
Sbjct  88   HLKLPFITQFEPIQVTLQTDLVRDIPCGTKGGVMINFDKIEVVNRLRKDHVYDTLLNYGV  147

Query  502  HYDNTWIYDKIHHEINQFCSGHSLQQVYIDMFDQIDE  612
            +YDNTWIYDKIHHEINQFCSGHSLQQVYIDMFDQIDE
Sbjct  148  NYDNTWIYDKIHHEINQFCSGHSLQQVYIDMFDQIDE  184



>ref|XP_006348696.1| PREDICTED: erlin-2-B-like [Solanum tuberosum]
Length=358

 Score =   294 bits (753),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 135/157 (86%), Positives = 145/157 (92%), Gaps = 2/157 (1%)
 Frame = +1

Query  148  DFTPILFVFLSFIAIFVMVVTPLLST--NSFSTLHQVPEGHVGVYWRGGALLSTITTPGF  321
            DFTPIL V ++FIAIF ++V P +ST  NS S LHQVPEGHVGVYWRGGALL+TIT PGF
Sbjct  24   DFTPILTVLVAFIAIFALIVAPSISTLNNSVSILHQVPEGHVGVYWRGGALLNTITDPGF  83

Query  322  HLKLPFITHFEPIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGV  501
            H+KLPFIT FEPIQVTLQTDLVRDIPCGTKGGVMINFEK+EVVNRLRK+HVYDTLLNYGV
Sbjct  84   HMKLPFITQFEPIQVTLQTDLVRDIPCGTKGGVMINFEKVEVVNRLRKDHVYDTLLNYGV  143

Query  502  HYDNTWIYDKIHHEINQFCSGHSLQQVYIDMFDQIDE  612
            +YDNTWIYDKIHHEINQFCS HSLQQVYIDMFDQIDE
Sbjct  144  NYDNTWIYDKIHHEINQFCSAHSLQQVYIDMFDQIDE  180



>ref|XP_004239055.1| PREDICTED: erlin-2-B [Solanum lycopersicum]
Length=361

 Score =   294 bits (752),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 136/157 (87%), Positives = 145/157 (92%), Gaps = 2/157 (1%)
 Frame = +1

Query  148  DFTPILFVFLSFIAIFVMVVTPLLST--NSFSTLHQVPEGHVGVYWRGGALLSTITTPGF  321
            DFTPIL V ++FI+IF ++V P +ST  NS S LHQVPEGHVGVYWRGGALL+TIT PGF
Sbjct  27   DFTPILTVLVAFISIFALIVAPSISTLNNSVSILHQVPEGHVGVYWRGGALLNTITDPGF  86

Query  322  HLKLPFITHFEPIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGV  501
            HLKLPFIT FEPIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRK+HVYDTLLNYGV
Sbjct  87   HLKLPFITQFEPIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKDHVYDTLLNYGV  146

Query  502  HYDNTWIYDKIHHEINQFCSGHSLQQVYIDMFDQIDE  612
            +YDNTWIYDKIHHEINQFCS HSLQQVYIDMFDQIDE
Sbjct  147  NYDNTWIYDKIHHEINQFCSAHSLQQVYIDMFDQIDE  183



>emb|CDP00430.1| unnamed protein product [Coffea canephora]
Length=363

 Score =   280 bits (716),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 132/161 (82%), Positives = 144/161 (89%), Gaps = 6/161 (4%)
 Frame = +1

Query  148  DFTPILFVFLSFIAIFVMVVTPLL---STN---SFSTLHQVPEGHVGVYWRGGALLSTIT  309
            DFTPIL VF +FIAIF++  + +L   S+N   S +TLHQVPEGHVGVYWRGGALL TIT
Sbjct  24   DFTPILTVFFAFIAIFLVATSQVLVPSSSNLLDSLATLHQVPEGHVGVYWRGGALLKTIT  83

Query  310  TPGFHLKLPFITHFEPIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLL  489
             PGFH+KLP IT FEPIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRK++VY+TLL
Sbjct  84   DPGFHVKLPLITQFEPIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKQYVYETLL  143

Query  490  NYGVHYDNTWIYDKIHHEINQFCSGHSLQQVYIDMFDQIDE  612
            NYGV+YDNTWIYDKIHHEINQFCS HSLQQVYIDMFDQIDE
Sbjct  144  NYGVNYDNTWIYDKIHHEINQFCSVHSLQQVYIDMFDQIDE  184



>ref|XP_006378572.1| hypothetical protein POPTR_0010s16620g [Populus trichocarpa]
 gb|ERP56369.1| hypothetical protein POPTR_0010s16620g [Populus trichocarpa]
Length=362

 Score =   277 bits (708),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 129/157 (82%), Positives = 139/157 (89%), Gaps = 2/157 (1%)
 Frame = +1

Query  148  DFTPILFVFLSFIAIFVMVVTPLLST--NSFSTLHQVPEGHVGVYWRGGALLSTITTPGF  321
            DF+PIL VFLSFIAIF ++V P  S   NS S LHQVPEGHVGVYWRGGALL T+T PGF
Sbjct  21   DFSPILTVFLSFIAIFALIVIPSSSNIKNSLSILHQVPEGHVGVYWRGGALLQTVTDPGF  80

Query  322  HLKLPFITHFEPIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGV  501
            HLKLP IT +EP+QVTLQTD VRDIPCGTKGGVMINFEKIEVVNRL KE+VY+TLLNYGV
Sbjct  81   HLKLPLITQYEPVQVTLQTDQVRDIPCGTKGGVMINFEKIEVVNRLGKEYVYETLLNYGV  140

Query  502  HYDNTWIYDKIHHEINQFCSGHSLQQVYIDMFDQIDE  612
             YD+TWIYDKIHHEINQFCS HSLQQVYID+FDQIDE
Sbjct  141  QYDHTWIYDKIHHEINQFCSSHSLQQVYIDVFDQIDE  177



>ref|XP_004297242.1| PREDICTED: erlin-1 [Fragaria vesca subsp. vesca]
Length=386

 Score =   276 bits (707),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 127/155 (82%), Positives = 139/155 (90%), Gaps = 2/155 (1%)
 Frame = +1

Query  154  TPILFVFLSFIAIFVMVVTPLLST--NSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHL  327
            + ILFV + F+AIF M+V P +ST  NSFS LHQVPEGHVGVYWRGGALL TIT PGFHL
Sbjct  30   SSILFVLVGFLAIFSMLVLPSVSTISNSFSILHQVPEGHVGVYWRGGALLKTITDPGFHL  89

Query  328  KLPFITHFEPIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHY  507
            KLP IT +EP+QVTLQTD V+DIPCGTKGGVMINFEKIEVVNRLRKE+VY+TLLNYGVHY
Sbjct  90   KLPLITQYEPVQVTLQTDQVKDIPCGTKGGVMINFEKIEVVNRLRKEYVYETLLNYGVHY  149

Query  508  DNTWIYDKIHHEINQFCSGHSLQQVYIDMFDQIDE  612
            DNTWIYDKIHHEINQFCS +SLQ VYID+FDQIDE
Sbjct  150  DNTWIYDKIHHEINQFCSSNSLQDVYIDVFDQIDE  184



>gb|KDP41298.1| hypothetical protein JCGZ_15705 [Jatropha curcas]
Length=367

 Score =   273 bits (699),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 127/158 (80%), Positives = 139/158 (88%), Gaps = 3/158 (2%)
 Frame = +1

Query  148  DFTPILFVFLSFIAIFVMVVTPLLST---NSFSTLHQVPEGHVGVYWRGGALLSTITTPG  318
            DF+PIL VFL FIA+  ++V P  S+   NS S LHQVPEGHVGVYWRGGALL TIT PG
Sbjct  21   DFSPILTVFLLFIAVISVIVLPSASSSFKNSLSILHQVPEGHVGVYWRGGALLKTITDPG  80

Query  319  FHLKLPFITHFEPIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYG  498
            FHLK+P ITH+EP+QVTLQTD VRDIPCGTKGGVMINFEKIEVVNRL KE+VY+TLLNYG
Sbjct  81   FHLKMPLITHYEPVQVTLQTDQVRDIPCGTKGGVMINFEKIEVVNRLHKEYVYETLLNYG  140

Query  499  VHYDNTWIYDKIHHEINQFCSGHSLQQVYIDMFDQIDE  612
            V YD+TWIYDKIHHEINQFCS HSLQQVYID+FDQIDE
Sbjct  141  VQYDHTWIYDKIHHEINQFCSSHSLQQVYIDVFDQIDE  178



>ref|XP_011075603.1| PREDICTED: erlin-1 [Sesamum indicum]
Length=361

 Score =   272 bits (696),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 126/157 (80%), Positives = 134/157 (85%), Gaps = 2/157 (1%)
 Frame = +1

Query  148  DFTPILFVFLSFIAIFVMVVTPLLST--NSFSTLHQVPEGHVGVYWRGGALLSTITTPGF  321
            DF+ I  V  +F+AI  M++ P  S    S S LHQVPEGHVGVYWRGGALL TIT PGF
Sbjct  25   DFSAIFTVLFTFVAIAAMIIVPSSSNLKQSLSILHQVPEGHVGVYWRGGALLKTITDPGF  84

Query  322  HLKLPFITHFEPIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGV  501
            H KLP ITHFEPIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRL K++VY+TLLNYGV
Sbjct  85   HSKLPLITHFEPIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLHKDYVYETLLNYGV  144

Query  502  HYDNTWIYDKIHHEINQFCSGHSLQQVYIDMFDQIDE  612
             YDNTWIYDKIHHEINQFCS HSLQQVYIDMFDQIDE
Sbjct  145  QYDNTWIYDKIHHEINQFCSAHSLQQVYIDMFDQIDE  181



>ref|XP_011011936.1| PREDICTED: erlin-1-like [Populus euphratica]
 ref|XP_011011945.1| PREDICTED: erlin-1-like [Populus euphratica]
Length=362

 Score =   272 bits (695),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 126/157 (80%), Positives = 139/157 (89%), Gaps = 2/157 (1%)
 Frame = +1

Query  148  DFTPILFVFLSFIAIFVMVVTPLLST--NSFSTLHQVPEGHVGVYWRGGALLSTITTPGF  321
            DF+PIL VFLSFIAIF ++V P  S   NS S LHQVPEGHVGVYWRGGALL T+T PGF
Sbjct  21   DFSPILTVFLSFIAIFALIVIPSSSNIKNSLSILHQVPEGHVGVYWRGGALLQTVTDPGF  80

Query  322  HLKLPFITHFEPIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGV  501
            HLKLP IT +EP+QVTLQTD VR+IPCGTKGGVMINFEKIEVVNRL K++VY+TLLNYGV
Sbjct  81   HLKLPLITQYEPVQVTLQTDQVRNIPCGTKGGVMINFEKIEVVNRLGKKYVYETLLNYGV  140

Query  502  HYDNTWIYDKIHHEINQFCSGHSLQQVYIDMFDQIDE  612
             YD+TWIYDKIHHEINQFCS H+LQQVYID+FDQIDE
Sbjct  141  QYDHTWIYDKIHHEINQFCSSHTLQQVYIDVFDQIDE  177



>ref|XP_010258063.1| PREDICTED: erlin-2-B-like [Nelumbo nucifera]
Length=357

 Score =   270 bits (690),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 122/158 (77%), Positives = 138/158 (87%), Gaps = 3/158 (2%)
 Frame = +1

Query  148  DFTPILFVFLSFIAIFVMVVTPL---LSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPG  318
            DF+ I+ V + F++   +VV P     ++NSFS LHQVPEGHVGVYWRGGALL+TIT PG
Sbjct  21   DFSAIISVLMVFVSFAALVVVPSSFSTASNSFSILHQVPEGHVGVYWRGGALLNTITNPG  80

Query  319  FHLKLPFITHFEPIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYG  498
            FHLK+P IT FEPIQVT+QTD VRDIPCGTKGGVMI+FEKIEVVNRLRKE+VY+TLLNYG
Sbjct  81   FHLKMPLITQFEPIQVTIQTDQVRDIPCGTKGGVMISFEKIEVVNRLRKEYVYETLLNYG  140

Query  499  VHYDNTWIYDKIHHEINQFCSGHSLQQVYIDMFDQIDE  612
            + YD+TWIYDKIHHEINQFCS HSLQQVYIDMFDQIDE
Sbjct  141  IQYDHTWIYDKIHHEINQFCSAHSLQQVYIDMFDQIDE  178



>ref|XP_008368234.1| PREDICTED: erlin-1-like [Malus domestica]
Length=360

 Score =   270 bits (689),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 122/155 (79%), Positives = 137/155 (88%), Gaps = 2/155 (1%)
 Frame = +1

Query  148  DFTPILFVFLSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHL  327
            D + I FVF +F+AIF + V P  ++ + S LHQVPEGHVGVYWRGGALL TIT PGFHL
Sbjct  24   DSSAIFFVFFAFLAIFAVTVLP--TSTTLSILHQVPEGHVGVYWRGGALLKTITDPGFHL  81

Query  328  KLPFITHFEPIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHY  507
            KLP +THFEP+QVTLQTD VRDIPCGTKGGVMINFEKIEVVNRLRK+ VY+TLLNYG+HY
Sbjct  82   KLPLVTHFEPVQVTLQTDQVRDIPCGTKGGVMINFEKIEVVNRLRKDFVYETLLNYGIHY  141

Query  508  DNTWIYDKIHHEINQFCSGHSLQQVYIDMFDQIDE  612
            DNTWIYDKIHHEINQFC+ HSLQ+VYID+FDQIDE
Sbjct  142  DNTWIYDKIHHEINQFCTSHSLQEVYIDVFDQIDE  176



>ref|XP_002316089.2| band 7 family protein [Populus trichocarpa]
 gb|EEF02260.2| band 7 family protein [Populus trichocarpa]
Length=357

 Score =   269 bits (688),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 128/157 (82%), Positives = 139/157 (89%), Gaps = 7/157 (4%)
 Frame = +1

Query  148  DFTPILFVFLSFIAIFVMVV--TPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGF  321
            DF+PIL VFLSFIAIF +VV  +P+LS      LHQVPEGHVGVYWRGGALL T+T PGF
Sbjct  21   DFSPILTVFLSFIAIFALVVALSPVLSI-----LHQVPEGHVGVYWRGGALLQTVTDPGF  75

Query  322  HLKLPFITHFEPIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGV  501
            HLKLP IT +EP+QVTLQTD VRDIPCGTKGGVMINFEKIEVVNRL KE+VY+TLLNYGV
Sbjct  76   HLKLPLITQYEPVQVTLQTDQVRDIPCGTKGGVMINFEKIEVVNRLGKEYVYETLLNYGV  135

Query  502  HYDNTWIYDKIHHEINQFCSGHSLQQVYIDMFDQIDE  612
             YD+TWIYDKIHHEINQFCS HSLQQVYID+FDQIDE
Sbjct  136  QYDHTWIYDKIHHEINQFCSSHSLQQVYIDVFDQIDE  172



>ref|XP_009356401.1| PREDICTED: erlin-1 [Pyrus x bretschneideri]
Length=377

 Score =   270 bits (690),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 125/155 (81%), Positives = 137/155 (88%), Gaps = 1/155 (1%)
 Frame = +1

Query  148  DFTPILFVFLSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHL  327
            D + ILFV  +F+AIF   VT L ++++ S LHQVPEGHVGVYWRGGALL TIT PGFHL
Sbjct  27   DSSAILFVLFAFLAIF-FAVTVLPTSSTISILHQVPEGHVGVYWRGGALLKTITDPGFHL  85

Query  328  KLPFITHFEPIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHY  507
            KLP +THFEP+QVTLQTD VRDIPCGTKGGVMINFEKIEVVNRLRKE VY+TLLNYGV Y
Sbjct  86   KLPLVTHFEPVQVTLQTDQVRDIPCGTKGGVMINFEKIEVVNRLRKEFVYETLLNYGVQY  145

Query  508  DNTWIYDKIHHEINQFCSGHSLQQVYIDMFDQIDE  612
            DNTWIYDKIHHEINQFCS HSLQ+VYID+FDQIDE
Sbjct  146  DNTWIYDKIHHEINQFCSSHSLQEVYIDVFDQIDE  180



>ref|XP_008243857.1| PREDICTED: erlin-2-B [Prunus mume]
Length=371

 Score =   267 bits (683),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 122/155 (79%), Positives = 133/155 (86%), Gaps = 3/155 (2%)
 Frame = +1

Query  148  DFTPILFVFLSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHL  327
            D + +LFV   F+AIF + + P   + S S LHQVPEGHVGVYWRGGALL TIT PGFHL
Sbjct  25   DSSAVLFVLFGFLAIFALTMLP---STSLSILHQVPEGHVGVYWRGGALLKTITDPGFHL  81

Query  328  KLPFITHFEPIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHY  507
            KLP +T FEP+QVTLQTD VRDIPCGTKGGVMINFEKIEVVNRLRKE VY+TLLNYGV Y
Sbjct  82   KLPLVTQFEPVQVTLQTDQVRDIPCGTKGGVMINFEKIEVVNRLRKEFVYETLLNYGVQY  141

Query  508  DNTWIYDKIHHEINQFCSGHSLQQVYIDMFDQIDE  612
            DNTWIYDKIHHEINQFCS HSLQ+VYID+FDQIDE
Sbjct  142  DNTWIYDKIHHEINQFCSSHSLQEVYIDVFDQIDE  176



>gb|KGN47646.1| hypothetical protein Csa_6G366440 [Cucumis sativus]
Length=348

 Score =   266 bits (680),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 125/155 (81%), Positives = 135/155 (87%), Gaps = 2/155 (1%)
 Frame = +1

Query  154  TPILFVFLSFIAIFVMVVTPLLS--TNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHL  327
            + IL VF SF+AIF MV+ P  S  +N+ S LHQVPEGHVGVYWRGGALL TIT PGFHL
Sbjct  24   SSILLVFASFLAIFSMVLFPSQSNLSNNLSILHQVPEGHVGVYWRGGALLKTITDPGFHL  83

Query  328  KLPFITHFEPIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHY  507
            KLP IT F  +QVTLQTD VRDIPCGTKGGVMINFEKIEVVNRLRKE+VYDTL+NYGV+Y
Sbjct  84   KLPLITQFVAVQVTLQTDQVRDIPCGTKGGVMINFEKIEVVNRLRKEYVYDTLVNYGVNY  143

Query  508  DNTWIYDKIHHEINQFCSGHSLQQVYIDMFDQIDE  612
            DN WIYDKIHHEINQFCS HSLQQVYID+FDQIDE
Sbjct  144  DNIWIYDKIHHEINQFCSSHSLQQVYIDVFDQIDE  178



>ref|XP_002512086.1| SPFH domain-containing protein 2 precursor, putative [Ricinus 
communis]
 gb|EEF50755.1| SPFH domain-containing protein 2 precursor, putative [Ricinus 
communis]
Length=365

 Score =   266 bits (681),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 127/157 (81%), Positives = 140/157 (89%), Gaps = 2/157 (1%)
 Frame = +1

Query  148  DFTPILFVFLSFIAIFVMVVTPLLST--NSFSTLHQVPEGHVGVYWRGGALLSTITTPGF  321
            DF+PIL VFL+FI I  ++V P  +   NS S LHQVPEGHVGVYWRGGALL TIT+PGF
Sbjct  25   DFSPILTVFLAFIGIISIIVIPSSANIKNSLSILHQVPEGHVGVYWRGGALLDTITSPGF  84

Query  322  HLKLPFITHFEPIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGV  501
            HLK+P +TH+EP+QVTLQTD VRDIPCGTKGGVMINFEKIEVVNRLRKE+VY+TLLNYGV
Sbjct  85   HLKMPLLTHYEPVQVTLQTDQVRDIPCGTKGGVMINFEKIEVVNRLRKEYVYETLLNYGV  144

Query  502  HYDNTWIYDKIHHEINQFCSGHSLQQVYIDMFDQIDE  612
             YDNTWIYDKIHHEINQFCS HSLQQVYID+FDQIDE
Sbjct  145  DYDNTWIYDKIHHEINQFCSSHSLQQVYIDVFDQIDE  181



>ref|XP_008350891.1| PREDICTED: erlin-2-B-like [Malus domestica]
Length=375

 Score =   266 bits (681),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 124/155 (80%), Positives = 136/155 (88%), Gaps = 1/155 (1%)
 Frame = +1

Query  148  DFTPILFVFLSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHL  327
            D + ILFV  +F+AIF   VT L ++++ S LHQVPEGHVGVYWRGGALL TIT PGFHL
Sbjct  25   DSSAILFVLFAFLAIF-FAVTVLPTSSTISILHQVPEGHVGVYWRGGALLKTITDPGFHL  83

Query  328  KLPFITHFEPIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHY  507
            KLP +THFEP+QVTLQTD VRDIPCGTKGGVMINFEKIEVVNRL KE VY+TLLNYGV Y
Sbjct  84   KLPLVTHFEPVQVTLQTDQVRDIPCGTKGGVMINFEKIEVVNRLXKEFVYETLLNYGVQY  143

Query  508  DNTWIYDKIHHEINQFCSGHSLQQVYIDMFDQIDE  612
            DNTWIYDKIHHEINQFCS HSLQ+VYID+FDQIDE
Sbjct  144  DNTWIYDKIHHEINQFCSSHSLQEVYIDVFDQIDE  178



>ref|XP_007223328.1| hypothetical protein PRUPE_ppa007348mg [Prunus persica]
 gb|EMJ24527.1| hypothetical protein PRUPE_ppa007348mg [Prunus persica]
Length=371

 Score =   265 bits (678),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 121/155 (78%), Positives = 132/155 (85%), Gaps = 3/155 (2%)
 Frame = +1

Query  148  DFTPILFVFLSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHL  327
            D + +LFV   F+AI  + + P   + S S LHQVPEGHVGVYWRGGALL TIT PGFHL
Sbjct  25   DSSAVLFVLFGFLAILALTMLP---STSLSILHQVPEGHVGVYWRGGALLKTITDPGFHL  81

Query  328  KLPFITHFEPIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHY  507
            KLP +T FEP+QVTLQTD VRDIPCGTKGGVMINFEKIEVVNRLRKE VY+TLLNYGV Y
Sbjct  82   KLPLVTQFEPVQVTLQTDQVRDIPCGTKGGVMINFEKIEVVNRLRKEFVYETLLNYGVQY  141

Query  508  DNTWIYDKIHHEINQFCSGHSLQQVYIDMFDQIDE  612
            DNTWIYDKIHHEINQFCS HSLQ+VYID+FDQIDE
Sbjct  142  DNTWIYDKIHHEINQFCSSHSLQEVYIDVFDQIDE  176



>ref|XP_003556691.1| PREDICTED: erlin-2-like isoform X1 [Glycine max]
Length=361

 Score =   265 bits (676),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 123/158 (78%), Positives = 134/158 (85%), Gaps = 3/158 (2%)
 Frame = +1

Query  148  DFTPILFVFLSFIAIFVMVVTPLLS---TNSFSTLHQVPEGHVGVYWRGGALLSTITTPG  318
            D T ILF  LSF AI  +V+ P  S    NS S LHQVPEGHVGVYWRGGALL TIT PG
Sbjct  20   DSTAILFTLLSFFAIVALVLLPSASPFFQNSLSILHQVPEGHVGVYWRGGALLKTITEPG  79

Query  319  FHLKLPFITHFEPIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYG  498
            FHLK+PF+T +EP+QVTLQTD+V DIPCGTKGGVMI+F KIEVVNRLRKE V++TLLNYG
Sbjct  80   FHLKMPFLTQYEPVQVTLQTDMVTDIPCGTKGGVMISFGKIEVVNRLRKEFVFETLLNYG  139

Query  499  VHYDNTWIYDKIHHEINQFCSGHSLQQVYIDMFDQIDE  612
            VHYD TWIYDKIHHEINQFCS HSLQQVYID+FDQIDE
Sbjct  140  VHYDKTWIYDKIHHEINQFCSSHSLQQVYIDVFDQIDE  177



>ref|XP_004144261.1| PREDICTED: LOW QUALITY PROTEIN: erlin-2-B-like [Cucumis sativus]
Length=399

 Score =   265 bits (678),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 125/155 (81%), Positives = 135/155 (87%), Gaps = 2/155 (1%)
 Frame = +1

Query  154  TPILFVFLSFIAIFVMVVTPLLS--TNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHL  327
            + IL VF SF+AIF MV+ P  S  +N+ S LHQVPEGHVGVYWRGGALL TIT PGFHL
Sbjct  24   SSILLVFASFLAIFSMVLFPSQSNLSNNLSILHQVPEGHVGVYWRGGALLKTITDPGFHL  83

Query  328  KLPFITHFEPIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHY  507
            KLP IT F  +QVTLQTD VRDIPCGTKGGVMINFEKIEVVNRLRKE+VYDTL+NYGV+Y
Sbjct  84   KLPLITQFVAVQVTLQTDQVRDIPCGTKGGVMINFEKIEVVNRLRKEYVYDTLVNYGVNY  143

Query  508  DNTWIYDKIHHEINQFCSGHSLQQVYIDMFDQIDE  612
            DN WIYDKIHHEINQFCS HSLQQVYID+FDQIDE
Sbjct  144  DNIWIYDKIHHEINQFCSSHSLQQVYIDVFDQIDE  178



>ref|XP_004171702.1| PREDICTED: LOW QUALITY PROTEIN: erlin-2-B-like, partial [Cucumis 
sativus]
Length=398

 Score =   265 bits (677),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 125/155 (81%), Positives = 135/155 (87%), Gaps = 2/155 (1%)
 Frame = +1

Query  154  TPILFVFLSFIAIFVMVVTPLLS--TNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHL  327
            + IL VF SF+AIF MV+ P  S  +N+ S LHQVPEGHVGVYWRGGALL TIT PGFHL
Sbjct  24   SSILLVFASFLAIFSMVLFPSQSNLSNNLSILHQVPEGHVGVYWRGGALLKTITDPGFHL  83

Query  328  KLPFITHFEPIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHY  507
            KLP IT F  +QVTLQTD VRDIPCGTKGGVMINFEKIEVVNRLRKE+VYDTL+NYGV+Y
Sbjct  84   KLPLITQFVAVQVTLQTDQVRDIPCGTKGGVMINFEKIEVVNRLRKEYVYDTLVNYGVNY  143

Query  508  DNTWIYDKIHHEINQFCSGHSLQQVYIDMFDQIDE  612
            DN WIYDKIHHEINQFCS HSLQQVYID+FDQIDE
Sbjct  144  DNIWIYDKIHHEINQFCSSHSLQQVYIDVFDQIDE  178



>gb|EPS71381.1| hypothetical protein M569_03378, partial [Genlisea aurea]
Length=319

 Score =   261 bits (666),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 118/140 (84%), Positives = 129/140 (92%), Gaps = 1/140 (1%)
 Frame = +1

Query  196  VMVVTPLLST-NSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFEPIQVTL  372
            + ++ P  S  +SFS LHQVPEGHVG YWRGGALL T+T PGFHLKLPFITHFEPIQVT+
Sbjct  1    LQIIIPTTSLGDSFSVLHQVPEGHVGAYWRGGALLKTLTNPGFHLKLPFITHFEPIQVTI  60

Query  373  QTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKIHHEINQ  552
            QTDLVRDIPCGTKGGVMI+F+KIEVVNRLRKE+V+DTLLNYGV+YDNTWIYDKIHHEINQ
Sbjct  61   QTDLVRDIPCGTKGGVMISFDKIEVVNRLRKEYVHDTLLNYGVNYDNTWIYDKIHHEINQ  120

Query  553  FCSGHSLQQVYIDMFDQIDE  612
            FCS HSLQQVYIDMFDQIDE
Sbjct  121  FCSAHSLQQVYIDMFDQIDE  140



>ref|XP_003528559.1| PREDICTED: erlin-2-like [Glycine max]
Length=364

 Score =   261 bits (668),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 123/158 (78%), Positives = 134/158 (85%), Gaps = 3/158 (2%)
 Frame = +1

Query  148  DFTPILFVFLSFIAIFVMVVTPLLS---TNSFSTLHQVPEGHVGVYWRGGALLSTITTPG  318
            D T ILF FLSF AI  +V+ P  S    NS S LHQVPEGHVGVYWRGGALL TIT PG
Sbjct  23   DSTSILFTFLSFFAIVALVLLPSASPSFQNSLSILHQVPEGHVGVYWRGGALLKTITEPG  82

Query  319  FHLKLPFITHFEPIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYG  498
            FHLK+PFIT +EP+QVTLQTD+V DIPCGTKGGVMI+F KIEVVN+L KE V++TLLNYG
Sbjct  83   FHLKMPFITQYEPVQVTLQTDMVIDIPCGTKGGVMISFGKIEVVNQLHKEFVFETLLNYG  142

Query  499  VHYDNTWIYDKIHHEINQFCSGHSLQQVYIDMFDQIDE  612
            VHYD TWIYDKIHHEINQFCS HSLQQVYID+FDQIDE
Sbjct  143  VHYDKTWIYDKIHHEINQFCSSHSLQQVYIDVFDQIDE  180



>emb|CDY65417.1| BnaC02g47990D [Brassica napus]
Length=347

 Score =   259 bits (662),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 120/155 (77%), Positives = 132/155 (85%), Gaps = 6/155 (4%)
 Frame = +1

Query  148  DFTPILFVFLSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHL  327
            + TPIL  F  FIAI  +V+ P       S++HQVPEGHVG YWRGGALL+ IT PGFHL
Sbjct  19   NMTPILVAFGVFIAIAALVMFP------SSSVHQVPEGHVGAYWRGGALLNIITEPGFHL  72

Query  328  KLPFITHFEPIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHY  507
            KLPFITH+EP+QVTLQTD VRDIPCGTKGGVM+ FEKIEVVNRLRK++VYDTLLNYGV Y
Sbjct  73   KLPFITHYEPVQVTLQTDQVRDIPCGTKGGVMVTFEKIEVVNRLRKDYVYDTLLNYGVDY  132

Query  508  DNTWIYDKIHHEINQFCSGHSLQQVYIDMFDQIDE  612
            DN WIYDKIHHEINQFCS HSLQQVYID+FDQIDE
Sbjct  133  DNAWIYDKIHHEINQFCSSHSLQQVYIDIFDQIDE  167



>ref|XP_010554285.1| PREDICTED: erlin-1 [Tarenaya hassleriana]
Length=359

 Score =   259 bits (663),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 119/155 (77%), Positives = 134/155 (86%), Gaps = 6/155 (4%)
 Frame = +1

Query  148  DFTPILFVFLSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHL  327
            DF+ I+ VF  F+AI  +V++P       S LHQVPEGHVG YWRGGALL+TI  PGFHL
Sbjct  22   DFSSIIAVFAIFLAIATVVMSPT------SILHQVPEGHVGAYWRGGALLNTINEPGFHL  75

Query  328  KLPFITHFEPIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHY  507
            KLPFITH+EP+QVTLQTD V+DIPCGTKGGVMI F+KIEVVNRLRK++VY+TLLNYGV Y
Sbjct  76   KLPFITHYEPVQVTLQTDQVKDIPCGTKGGVMITFDKIEVVNRLRKDYVYETLLNYGVDY  135

Query  508  DNTWIYDKIHHEINQFCSGHSLQQVYIDMFDQIDE  612
            DNTWIYDKIHHEINQFCS HSLQQVYID+FDQIDE
Sbjct  136  DNTWIYDKIHHEINQFCSSHSLQQVYIDIFDQIDE  170



>ref|XP_008445457.1| PREDICTED: erlin-2-B [Cucumis melo]
 ref|XP_008445458.1| PREDICTED: erlin-2-B [Cucumis melo]
Length=366

 Score =   259 bits (663),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 125/153 (82%), Positives = 133/153 (87%), Gaps = 2/153 (1%)
 Frame = +1

Query  160  ILFVFLSFIAIFVMVVTPLLSTNSFST--LHQVPEGHVGVYWRGGALLSTITTPGFHLKL  333
            IL VF SF+AIF MVV P  S  S +   LHQVPEGHVGVYWRGGALL TIT PGFHLKL
Sbjct  26   ILIVFASFLAIFSMVVFPSQSNLSSNLSILHQVPEGHVGVYWRGGALLKTITDPGFHLKL  85

Query  334  PFITHFEPIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDN  513
            P IT F P+QVTLQTD V+DIPCGTKGGVMINFEKIEVVNRLRKE+VYDTL+NYGV+YDN
Sbjct  86   PLITQFVPVQVTLQTDQVKDIPCGTKGGVMINFEKIEVVNRLRKEYVYDTLVNYGVNYDN  145

Query  514  TWIYDKIHHEINQFCSGHSLQQVYIDMFDQIDE  612
             WIYDKIHHEINQFCS HSLQQVYID+FDQIDE
Sbjct  146  IWIYDKIHHEINQFCSSHSLQQVYIDVFDQIDE  178



>ref|XP_007157834.1| hypothetical protein PHAVU_002G102100g [Phaseolus vulgaris]
 gb|ESW29828.1| hypothetical protein PHAVU_002G102100g [Phaseolus vulgaris]
Length=359

 Score =   258 bits (660),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 121/158 (77%), Positives = 131/158 (83%), Gaps = 3/158 (2%)
 Frame = +1

Query  148  DFTPILFVFLSFIAIFVMVVTPLLS---TNSFSTLHQVPEGHVGVYWRGGALLSTITTPG  318
            D   ILF FLSF A+  +V  P  S    N+ S LHQVPEGHVGVYWRGGALL TIT PG
Sbjct  18   DSIAILFTFLSFFAVVALVFVPAASPSFQNTLSILHQVPEGHVGVYWRGGALLKTITEPG  77

Query  319  FHLKLPFITHFEPIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYG  498
            FHLK+PF+T +EP+QVTLQTD V DIPCGTKGGVMINFEKIEVVNRL KE V++TLLNYG
Sbjct  78   FHLKMPFLTQYEPVQVTLQTDQVTDIPCGTKGGVMINFEKIEVVNRLHKEFVFETLLNYG  137

Query  499  VHYDNTWIYDKIHHEINQFCSGHSLQQVYIDMFDQIDE  612
            V YD TWIYDKIHHEINQFCS HSLQQVYID+FDQIDE
Sbjct  138  VGYDKTWIYDKIHHEINQFCSSHSLQQVYIDVFDQIDE  175



>ref|XP_004505361.1| PREDICTED: erlin-2-B-like [Cicer arietinum]
Length=360

 Score =   258 bits (660),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 120/156 (77%), Positives = 131/156 (84%), Gaps = 3/156 (2%)
 Frame = +1

Query  154  TPILFVFLSFIAIFVMVVTPLLS---TNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFH  324
            T I   FLSFIAI  +V+ P  S    N+ S +HQVPEGHVGVYW GGALL TIT PGFH
Sbjct  20   TSIAIPFLSFIAIAALVLVPSASPSFKNTLSIIHQVPEGHVGVYWIGGALLKTITEPGFH  79

Query  325  LKLPFITHFEPIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVH  504
            +K+PF+T FEP+QVTLQTD V DIPCGTKGGVMI+F KIEVVNRLRKE VY+TLLNYGVH
Sbjct  80   MKMPFLTQFEPVQVTLQTDEVTDIPCGTKGGVMISFGKIEVVNRLRKESVYETLLNYGVH  139

Query  505  YDNTWIYDKIHHEINQFCSGHSLQQVYIDMFDQIDE  612
            YD TWIYDKIHHEINQFCS HSLQQVYID+FDQIDE
Sbjct  140  YDKTWIYDKIHHEINQFCSSHSLQQVYIDVFDQIDE  175



>ref|XP_010259731.1| PREDICTED: erlin-2-B-like [Nelumbo nucifera]
Length=357

 Score =   258 bits (659),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 117/156 (75%), Positives = 135/156 (87%), Gaps = 2/156 (1%)
 Frame = +1

Query  151  FTPILFVFLSFIAIFVMVVTPLLSTNS--FSTLHQVPEGHVGVYWRGGALLSTITTPGFH  324
            F+ I+ V ++F++   +V+ P  ST S  FS LHQVPEG+VGVYWRGGALL TIT PGFH
Sbjct  22   FSAIVTVLIAFLSFAALVLVPAFSTASGNFSILHQVPEGYVGVYWRGGALLKTITNPGFH  81

Query  325  LKLPFITHFEPIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVH  504
            LK+P IT FEPIQVTLQTD V+DIPCGTKGGVMI+FEKIEVVNRL+K++VY+TLLNYG+ 
Sbjct  82   LKMPLITQFEPIQVTLQTDKVKDIPCGTKGGVMISFEKIEVVNRLQKDYVYETLLNYGIQ  141

Query  505  YDNTWIYDKIHHEINQFCSGHSLQQVYIDMFDQIDE  612
            YDNTWIYDKIHHEINQFCS H+LQQVYIDMFDQI E
Sbjct  142  YDNTWIYDKIHHEINQFCSSHTLQQVYIDMFDQIGE  177



>gb|KCW86497.1| hypothetical protein EUGRSUZ_B03154 [Eucalyptus grandis]
 gb|KCW86498.1| hypothetical protein EUGRSUZ_B03154 [Eucalyptus grandis]
Length=332

 Score =   256 bits (653),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 120/151 (79%), Positives = 136/151 (90%), Gaps = 1/151 (1%)
 Frame = +1

Query  160  ILFVFLSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPF  339
            +LF F++ IA+F+++ +     +S S LHQVPEGHVGVYWRGGALL TIT+PGFHLK+PF
Sbjct  65   VLFSFVA-IALFILIPSTSSIKSSLSILHQVPEGHVGVYWRGGALLETITSPGFHLKMPF  123

Query  340  ITHFEPIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTW  519
            ITH+EP+QVTLQTD VRDIPCGTKGGVMI FEKIEVVNRLRK++VYDTLLNYGV YDNTW
Sbjct  124  ITHYEPVQVTLQTDQVRDIPCGTKGGVMITFEKIEVVNRLRKDYVYDTLLNYGVQYDNTW  183

Query  520  IYDKIHHEINQFCSGHSLQQVYIDMFDQIDE  612
            IYDKIHHEINQFCS HSLQQVYID+FDQIDE
Sbjct  184  IYDKIHHEINQFCSSHSLQQVYIDVFDQIDE  214



>ref|XP_010680704.1| PREDICTED: erlin-1 [Beta vulgaris subsp. vulgaris]
Length=360

 Score =   257 bits (656),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 121/154 (79%), Positives = 131/154 (85%), Gaps = 5/154 (3%)
 Frame = +1

Query  157  PILFVFLSFIAIFVMVVTPLLSTN--SFSTLHQVPEGHVGVYWRGGALLSTITTPGFHLK  330
            P+LF+F   +A F  +V    STN  S + LHQVPEGHVGVYWRGGALL  IT PGFHLK
Sbjct  32   PLLFLF---VAAFTAIVLSSTSTNKISLTILHQVPEGHVGVYWRGGALLKIITDPGFHLK  88

Query  331  LPFITHFEPIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYD  510
            LP ITH+EPIQVTLQTD VRDIPCGTKGGVMINF +IEVVNRL KE+V+DTLLNYGVHYD
Sbjct  89   LPIITHYEPIQVTLQTDQVRDIPCGTKGGVMINFTRIEVVNRLNKEYVHDTLLNYGVHYD  148

Query  511  NTWIYDKIHHEINQFCSGHSLQQVYIDMFDQIDE  612
             TWIYDKIHHEINQFCS H+LQQVYIDMFDQIDE
Sbjct  149  KTWIYDKIHHEINQFCSSHALQQVYIDMFDQIDE  182



>ref|XP_009114153.1| PREDICTED: erlin-2-B [Brassica rapa]
Length=361

 Score =   256 bits (655),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 119/155 (77%), Positives = 131/155 (85%), Gaps = 6/155 (4%)
 Frame = +1

Query  148  DFTPILFVFLSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHL  327
            D T I   F  FIAI  +V++P       S +HQVPEGHVG YWRGGALL+ IT PGFHL
Sbjct  23   DLTSIFIAFGVFIAIAALVMSP------SSLVHQVPEGHVGAYWRGGALLNIITEPGFHL  76

Query  328  KLPFITHFEPIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHY  507
            KLPFIT++EP+QVTLQTD V+DIPCGTKGGVMI FEKIEVVNRLRK++VYDTLLNYGV Y
Sbjct  77   KLPFITNYEPVQVTLQTDQVKDIPCGTKGGVMITFEKIEVVNRLRKDYVYDTLLNYGVDY  136

Query  508  DNTWIYDKIHHEINQFCSGHSLQQVYIDMFDQIDE  612
            DNTWIYDKIHHEINQFCS HSLQQVYID+FDQIDE
Sbjct  137  DNTWIYDKIHHEINQFCSSHSLQQVYIDIFDQIDE  171



>ref|XP_007045881.1| SPFH/Band 7/PHB domain-containing membrane-associated protein 
family [Theobroma cacao]
 gb|EOY01713.1| SPFH/Band 7/PHB domain-containing membrane-associated protein 
family [Theobroma cacao]
Length=409

 Score =   258 bits (659),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 130/154 (84%), Gaps = 2/154 (1%)
 Frame = +1

Query  157  PILFVFLSFIAIFVMVVTPLLST--NSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHLK  330
            PI+ +  +FI I    + P  S   N+ S LHQVPEGHVGVYWRGGALL TIT PGFHLK
Sbjct  29   PIIVIVFAFIVIASSAMIPPSSNIKNTLSILHQVPEGHVGVYWRGGALLKTITEPGFHLK  88

Query  331  LPFITHFEPIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYD  510
            +P IT  EP+ VTLQTD VRDIPCGTKGGVMINFEKIEVVNRLRKE+VY+TLLNYGVHYD
Sbjct  89   MPLITQHEPVLVTLQTDQVRDIPCGTKGGVMINFEKIEVVNRLRKEYVYETLLNYGVHYD  148

Query  511  NTWIYDKIHHEINQFCSGHSLQQVYIDMFDQIDE  612
            NTWIYDKIHHEINQFCS H+LQQVYID+FDQIDE
Sbjct  149  NTWIYDKIHHEINQFCSSHTLQQVYIDVFDQIDE  182



>emb|CDY04155.1| BnaA09g19330D [Brassica napus]
Length=361

 Score =   256 bits (653),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 119/155 (77%), Positives = 131/155 (85%), Gaps = 6/155 (4%)
 Frame = +1

Query  148  DFTPILFVFLSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHL  327
            D T I   F  FIAI  +V++P       S +HQVPEGHVG YWRGGALL+ IT PGFHL
Sbjct  23   DLTSIFIAFGVFIAIAALVMSP------SSLVHQVPEGHVGAYWRGGALLNIITEPGFHL  76

Query  328  KLPFITHFEPIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHY  507
            KLPFIT++EP+QVTLQTD V+DIPCGTKGGVMI FEKIEVVNRLRK++VYDTLLNYGV Y
Sbjct  77   KLPFITNYEPVQVTLQTDQVKDIPCGTKGGVMITFEKIEVVNRLRKDYVYDTLLNYGVDY  136

Query  508  DNTWIYDKIHHEINQFCSGHSLQQVYIDMFDQIDE  612
            DNTWIYDKIHHEINQFCS HSLQQVYID+FDQIDE
Sbjct  137  DNTWIYDKIHHEINQFCSSHSLQQVYIDIFDQIDE  171



>ref|XP_010044417.1| PREDICTED: erlin-2-B [Eucalyptus grandis]
Length=402

 Score =   257 bits (657),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 120/151 (79%), Positives = 136/151 (90%), Gaps = 1/151 (1%)
 Frame = +1

Query  160  ILFVFLSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPF  339
            +LF F++ IA+F+++ +     +S S LHQVPEGHVGVYWRGGALL TIT+PGFHLK+PF
Sbjct  65   VLFSFVA-IALFILIPSTSSIKSSLSILHQVPEGHVGVYWRGGALLETITSPGFHLKMPF  123

Query  340  ITHFEPIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTW  519
            ITH+EP+QVTLQTD VRDIPCGTKGGVMI FEKIEVVNRLRK++VYDTLLNYGV YDNTW
Sbjct  124  ITHYEPVQVTLQTDQVRDIPCGTKGGVMITFEKIEVVNRLRKDYVYDTLLNYGVQYDNTW  183

Query  520  IYDKIHHEINQFCSGHSLQQVYIDMFDQIDE  612
            IYDKIHHEINQFCS HSLQQVYID+FDQIDE
Sbjct  184  IYDKIHHEINQFCSSHSLQQVYIDVFDQIDE  214



>gb|KCW86495.1| hypothetical protein EUGRSUZ_B03154 [Eucalyptus grandis]
Length=394

 Score =   256 bits (654),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 120/151 (79%), Positives = 136/151 (90%), Gaps = 1/151 (1%)
 Frame = +1

Query  160  ILFVFLSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPF  339
            +LF F++ IA+F+++ +     +S S LHQVPEGHVGVYWRGGALL TIT+PGFHLK+PF
Sbjct  65   VLFSFVA-IALFILIPSTSSIKSSLSILHQVPEGHVGVYWRGGALLETITSPGFHLKMPF  123

Query  340  ITHFEPIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTW  519
            ITH+EP+QVTLQTD VRDIPCGTKGGVMI FEKIEVVNRLRK++VYDTLLNYGV YDNTW
Sbjct  124  ITHYEPVQVTLQTDQVRDIPCGTKGGVMITFEKIEVVNRLRKDYVYDTLLNYGVQYDNTW  183

Query  520  IYDKIHHEINQFCSGHSLQQVYIDMFDQIDE  612
            IYDKIHHEINQFCS HSLQQVYID+FDQIDE
Sbjct  184  IYDKIHHEINQFCSSHSLQQVYIDVFDQIDE  214



>emb|CDY45557.1| BnaC09g21530D [Brassica napus]
Length=358

 Score =   254 bits (649),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 118/155 (76%), Positives = 131/155 (85%), Gaps = 6/155 (4%)
 Frame = +1

Query  148  DFTPILFVFLSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHL  327
            D T I   F  FIAI  +V++P       S +HQVPEGHVG YWRGGALL+ IT PGFH+
Sbjct  22   DVTSIFIAFGVFIAIAALVMSP------SSLVHQVPEGHVGAYWRGGALLNIITEPGFHV  75

Query  328  KLPFITHFEPIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHY  507
            KLPFIT++EP+QVTLQTD V+DIPCGTKGGVMI FEKIEVVNRLRK++VYDTLLNYGV Y
Sbjct  76   KLPFITNYEPVQVTLQTDQVKDIPCGTKGGVMITFEKIEVVNRLRKDYVYDTLLNYGVDY  135

Query  508  DNTWIYDKIHHEINQFCSGHSLQQVYIDMFDQIDE  612
            DNTWIYDKIHHEINQFCS HSLQQVYID+FDQIDE
Sbjct  136  DNTWIYDKIHHEINQFCSSHSLQQVYIDIFDQIDE  170



>gb|KFK26236.1| hypothetical protein AALP_AA8G220700 [Arabis alpina]
Length=356

 Score =   254 bits (649),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 118/155 (76%), Positives = 131/155 (85%), Gaps = 6/155 (4%)
 Frame = +1

Query  148  DFTPILFVFLSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHL  327
            D T I   F  FIAI  +V+ P       S +HQVPEGHVG YWRGGALL+ I+ PGFHL
Sbjct  22   DVTSIFLAFGVFIAIAALVMFP------SSLVHQVPEGHVGAYWRGGALLNMISEPGFHL  75

Query  328  KLPFITHFEPIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHY  507
            KLPFIT++EP+QVTLQTD V+DIPCGTKGGVMI FEKIEVVNRLRK++VYDTLLNYGV+Y
Sbjct  76   KLPFITNYEPVQVTLQTDQVKDIPCGTKGGVMITFEKIEVVNRLRKDYVYDTLLNYGVNY  135

Query  508  DNTWIYDKIHHEINQFCSGHSLQQVYIDMFDQIDE  612
            DNTWIYDKIHHEINQFCS HSLQQVYID+FDQIDE
Sbjct  136  DNTWIYDKIHHEINQFCSSHSLQQVYIDIFDQIDE  170



>ref|XP_006395697.1| hypothetical protein EUTSA_v10004477mg [Eutrema salsugineum]
 gb|ESQ32983.1| hypothetical protein EUTSA_v10004477mg [Eutrema salsugineum]
Length=358

 Score =   254 bits (649),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 119/155 (77%), Positives = 131/155 (85%), Gaps = 6/155 (4%)
 Frame = +1

Query  148  DFTPILFVFLSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHL  327
            D T I   F  FIAI  +V+ P       S +HQVPEGHVG YWRGGALL+ IT PGFHL
Sbjct  22   DVTSIFVAFGVFIAIAALVMFP------SSLVHQVPEGHVGAYWRGGALLNMITEPGFHL  75

Query  328  KLPFITHFEPIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHY  507
            KLPFIT++EP+QVTLQTD V+DIPCGTKGGVMI FEKIEVVNRLRK++VYDTLLNYGV+Y
Sbjct  76   KLPFITNYEPVQVTLQTDQVKDIPCGTKGGVMITFEKIEVVNRLRKDYVYDTLLNYGVNY  135

Query  508  DNTWIYDKIHHEINQFCSGHSLQQVYIDMFDQIDE  612
            DNTWIYDKIHHEINQFCS HSLQQVYID+FDQIDE
Sbjct  136  DNTWIYDKIHHEINQFCSSHSLQQVYIDIFDQIDE  170



>gb|KJB80361.1| hypothetical protein B456_013G093700 [Gossypium raimondii]
Length=366

 Score =   254 bits (648),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 115/154 (75%), Positives = 131/154 (85%), Gaps = 2/154 (1%)
 Frame = +1

Query  157  PILFVFLSFIAIFVMVVTPLL--STNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHLK  330
            P + VF S + I  + V P    + +S S LHQVPEGHVGVYW+GGALL TIT PGFHLK
Sbjct  24   PAMLVFASIVIIASLAVVPSCWYTRSSLSILHQVPEGHVGVYWKGGALLKTITEPGFHLK  83

Query  331  LPFITHFEPIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYD  510
            +P +T +EP+ VTLQTD VRDIPCGTKGGVMINFEKIEVVN+L+KE+VY+TLLNYGV+YD
Sbjct  84   MPLVTQYEPVLVTLQTDQVRDIPCGTKGGVMINFEKIEVVNKLKKEYVYETLLNYGVNYD  143

Query  511  NTWIYDKIHHEINQFCSGHSLQQVYIDMFDQIDE  612
            NTWIYDKIHHEINQFCS HSLQQVYID+FDQIDE
Sbjct  144  NTWIYDKIHHEINQFCSSHSLQQVYIDVFDQIDE  177



>ref|XP_003607805.1| Erlin-2 [Medicago truncatula]
 gb|AES90002.1| SPFH domain/band 7 family protein [Medicago truncatula]
Length=361

 Score =   253 bits (646),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 119/156 (76%), Positives = 130/156 (83%), Gaps = 3/156 (2%)
 Frame = +1

Query  154  TPILFVFLSFIAIFVMVVTPLLS---TNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFH  324
            + IL  FLSFIAI V V+ P  S    N+ + +HQVPEGHVGVYWRGGALL TIT PGFH
Sbjct  21   SSILVPFLSFIAIAVFVLVPSASPSFKNTMAIVHQVPEGHVGVYWRGGALLKTITEPGFH  80

Query  325  LKLPFITHFEPIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVH  504
            +K+PF+T FEP+QVTLQTD V DIPCGTKGGVMI F KIEVVNRL KE VY+TLLNYGV 
Sbjct  81   MKMPFLTQFEPVQVTLQTDEVTDIPCGTKGGVMIVFGKIEVVNRLHKESVYETLLNYGVQ  140

Query  505  YDNTWIYDKIHHEINQFCSGHSLQQVYIDMFDQIDE  612
            YD TWIYDKIHHEINQFCS HSLQQVYID+FDQIDE
Sbjct  141  YDKTWIYDKIHHEINQFCSSHSLQQVYIDVFDQIDE  176



>ref|XP_010939164.1| PREDICTED: erlin-2-B-like [Elaeis guineensis]
Length=357

 Score =   253 bits (645),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 115/148 (78%), Positives = 127/148 (86%), Gaps = 1/148 (1%)
 Frame = +1

Query  169  VFLSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITH  348
            +F + I I +    P    +SFS LHQVPEGHVG YWRGGALL TIT PGFHLKLP IT 
Sbjct  31   IFFALIPIMLSFSIPT-PRSSFSILHQVPEGHVGAYWRGGALLKTITDPGFHLKLPLITQ  89

Query  349  FEPIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYD  528
            FEPIQVTLQTD VRDIPCGTKGGVMI+F+KIEVVNRLRKE+VY+TLLNYG++YD TWIYD
Sbjct  90   FEPIQVTLQTDQVRDIPCGTKGGVMISFDKIEVVNRLRKEYVYETLLNYGIYYDKTWIYD  149

Query  529  KIHHEINQFCSGHSLQQVYIDMFDQIDE  612
            KIHHEINQFCS H++QQVYIDMFDQIDE
Sbjct  150  KIHHEINQFCSAHTMQQVYIDMFDQIDE  177



>dbj|BAE99370.1| hypothetical protein [Arabidopsis thaliana]
Length=342

 Score =   252 bits (643),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 118/155 (76%), Positives = 130/155 (84%), Gaps = 6/155 (4%)
 Frame = +1

Query  148  DFTPILFVFLSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHL  327
            D + IL  F  F AI  +V+ P       S +HQVPEGHVG YWRGGALL+ IT PGFHL
Sbjct  8    DISSILIAFGVFAAIAALVMFP------SSLVHQVPEGHVGAYWRGGALLNIITEPGFHL  61

Query  328  KLPFITHFEPIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHY  507
            KLPFIT++EP+QVTLQTD VRDIPCGTKGGV+I FEKIEVVNRLRK+ VYDTLLNYGV+Y
Sbjct  62   KLPFITNYEPVQVTLQTDQVRDIPCGTKGGVLITFEKIEVVNRLRKDFVYDTLLNYGVNY  121

Query  508  DNTWIYDKIHHEINQFCSGHSLQQVYIDMFDQIDE  612
            DNTWIYDKIHHEINQFCS HSLQQVYID+FDQIDE
Sbjct  122  DNTWIYDKIHHEINQFCSSHSLQQVYIDIFDQIDE  156



>ref|NP_027545.1| SPFH/Band 7/PHB domain-containing membrane-associated protein 
[Arabidopsis thaliana]
 gb|AAD17426.2| expressed protein [Arabidopsis thaliana]
 gb|AAM65678.1| unknown [Arabidopsis thaliana]
 gb|AEC05709.1| SPFH/Band 7/PHB domain-containing membrane-associated protein 
[Arabidopsis thaliana]
Length=356

 Score =   252 bits (644),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 118/155 (76%), Positives = 130/155 (84%), Gaps = 6/155 (4%)
 Frame = +1

Query  148  DFTPILFVFLSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHL  327
            D + IL  F  F AI  +V+ P       S +HQVPEGHVG YWRGGALL+ IT PGFHL
Sbjct  22   DISSILIAFGVFAAIAALVMFP------SSLVHQVPEGHVGAYWRGGALLNIITEPGFHL  75

Query  328  KLPFITHFEPIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHY  507
            KLPFIT++EP+QVTLQTD VRDIPCGTKGGV+I FEKIEVVNRLRK+ VYDTLLNYGV+Y
Sbjct  76   KLPFITNYEPVQVTLQTDQVRDIPCGTKGGVLITFEKIEVVNRLRKDFVYDTLLNYGVNY  135

Query  508  DNTWIYDKIHHEINQFCSGHSLQQVYIDMFDQIDE  612
            DNTWIYDKIHHEINQFCS HSLQQVYID+FDQIDE
Sbjct  136  DNTWIYDKIHHEINQFCSSHSLQQVYIDIFDQIDE  170



>ref|XP_002465119.1| hypothetical protein SORBIDRAFT_01g032340 [Sorghum bicolor]
 gb|EER92117.1| hypothetical protein SORBIDRAFT_01g032340 [Sorghum bicolor]
Length=372

 Score =   253 bits (645),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 120/152 (79%), Positives = 131/152 (86%), Gaps = 3/152 (2%)
 Frame = +1

Query  157  PILFVFLSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLP  336
            P  F  ++FI I  ++++  LS  S S LHQVPEGHVGVYWRGGALL TIT PGFHLKLP
Sbjct  44   PFAFGVVAFIGICFVLIS--LSAPS-SVLHQVPEGHVGVYWRGGALLKTITPPGFHLKLP  100

Query  337  FITHFEPIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNT  516
             IT +EPIQVTLQTD VRDIPCGTKGGVMI+F+KIEVVNRLRKE V++TLLNYGVHYD T
Sbjct  101  LITQYEPIQVTLQTDQVRDIPCGTKGGVMISFDKIEVVNRLRKEFVHETLLNYGVHYDKT  160

Query  517  WIYDKIHHEINQFCSGHSLQQVYIDMFDQIDE  612
            WIYDKIHHEINQFCS HSLQQVYIDMFDQIDE
Sbjct  161  WIYDKIHHEINQFCSAHSLQQVYIDMFDQIDE  192



>ref|NP_001141011.1| hypothetical protein [Zea mays]
 gb|ACF85166.1| unknown [Zea mays]
 tpg|DAA45821.1| TPA: hypothetical protein ZEAMMB73_141028 [Zea mays]
Length=371

 Score =   252 bits (644),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 121/152 (80%), Positives = 131/152 (86%), Gaps = 3/152 (2%)
 Frame = +1

Query  157  PILFVFLSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLP  336
            P  F  ++FI I  ++V+  LS  S S LHQVPEGHVGVYWRGGALL TIT PGFHLKLP
Sbjct  43   PFAFGIVAFIGICFVLVS--LSVPS-SVLHQVPEGHVGVYWRGGALLKTITPPGFHLKLP  99

Query  337  FITHFEPIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNT  516
             IT +EPIQVTLQTD VRDIPCGTKGGVMI+F+KIEVVNRLRKE V++TLLNYGVHYD T
Sbjct  100  LITQYEPIQVTLQTDQVRDIPCGTKGGVMISFDKIEVVNRLRKEFVHETLLNYGVHYDKT  159

Query  517  WIYDKIHHEINQFCSGHSLQQVYIDMFDQIDE  612
            WIYDKIHHEINQFCS HSLQQVYIDMFDQIDE
Sbjct  160  WIYDKIHHEINQFCSAHSLQQVYIDMFDQIDE  191



>ref|XP_002267076.1| PREDICTED: erlin-2-B [Vitis vinifera]
 emb|CBI27284.3| unnamed protein product [Vitis vinifera]
Length=379

 Score =   253 bits (645),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 112/130 (86%), Positives = 120/130 (92%), Gaps = 0/130 (0%)
 Frame = +1

Query  223  TNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFEPIQVTLQTDLVRDIPC  402
            TN+ + LHQVPEGHVG+YWRGGALL TIT PGFHLK+P +T FEPIQVTLQTD VRDIPC
Sbjct  68   TNNLTLLHQVPEGHVGMYWRGGALLKTITEPGFHLKMPLVTQFEPIQVTLQTDQVRDIPC  127

Query  403  GTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKIHHEINQFCSGHSLQQV  582
            GTKGGVMINFEKIEVVNRL K++VY+TLLNYGV YDNTWIYDKIHHEINQFCS HSLQQV
Sbjct  128  GTKGGVMINFEKIEVVNRLHKDYVYETLLNYGVQYDNTWIYDKIHHEINQFCSAHSLQQV  187

Query  583  YIDMFDQIDE  612
            YIDMFDQIDE
Sbjct  188  YIDMFDQIDE  197



>ref|XP_010527959.1| PREDICTED: erlin-1-like [Tarenaya hassleriana]
Length=352

 Score =   252 bits (643),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 116/151 (77%), Positives = 132/151 (87%), Gaps = 7/151 (5%)
 Frame = +1

Query  160  ILFVFLSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPF  339
            +L VF++ IAI  +V++P       S LHQVPEGHVG YWRGGALL+TI+ PG HLKLP+
Sbjct  29   VLAVFIA-IAILTVVISPT------SILHQVPEGHVGAYWRGGALLNTISEPGIHLKLPY  81

Query  340  ITHFEPIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTW  519
            ITH+EP+QVTLQTD VRDIPCGTKGGVMI F KIEVVNRLRK++VY+TLLNYGV+YDNTW
Sbjct  82   ITHYEPVQVTLQTDQVRDIPCGTKGGVMITFAKIEVVNRLRKDYVYETLLNYGVNYDNTW  141

Query  520  IYDKIHHEINQFCSGHSLQQVYIDMFDQIDE  612
            IYDKIHHEINQFCS HSLQQVYID+FDQIDE
Sbjct  142  IYDKIHHEINQFCSSHSLQQVYIDIFDQIDE  172



>gb|KDO70385.1| hypothetical protein CISIN_1g018056mg [Citrus sinensis]
Length=361

 Score =   252 bits (643),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 120/157 (76%), Positives = 134/157 (85%), Gaps = 2/157 (1%)
 Frame = +1

Query  148  DFTPILFVFLSFIAIFVMVVTPLLSTNS--FSTLHQVPEGHVGVYWRGGALLSTITTPGF  321
            D + IL VFL+FIAI  +++ P  S+     + LHQ+PEGHVGVYWRGGALL TIT PGF
Sbjct  21   DSSAILAVFLTFIAIVSLILIPSSSSVKSSLAILHQIPEGHVGVYWRGGALLETITHPGF  80

Query  322  HLKLPFITHFEPIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGV  501
            HLKLP ITH+EP+QVTLQTD V DIPCGTKGGVMINFEKIEVVNRLRKE+VY+TL +YGV
Sbjct  81   HLKLPLITHYEPVQVTLQTDQVTDIPCGTKGGVMINFEKIEVVNRLRKEYVYETLRDYGV  140

Query  502  HYDNTWIYDKIHHEINQFCSGHSLQQVYIDMFDQIDE  612
             YD TWIYDKIHHEINQFCS HSLQQVYID+FDQIDE
Sbjct  141  QYDKTWIYDKIHHEINQFCSSHSLQQVYIDVFDQIDE  177



>ref|XP_004984014.1| PREDICTED: erlin-2-B-like [Setaria italica]
Length=371

 Score =   252 bits (643),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 120/152 (79%), Positives = 132/152 (87%), Gaps = 3/152 (2%)
 Frame = +1

Query  157  PILFVFLSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLP  336
            P  F  ++FI I  ++++  LS  S S LHQVPEGHVGVYWRGGALL TIT PGFHLKLP
Sbjct  43   PFAFGIVAFIGICFVLIS--LSVPS-SVLHQVPEGHVGVYWRGGALLKTITPPGFHLKLP  99

Query  337  FITHFEPIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNT  516
            +IT +EPIQVTLQTD VRDIPCGTKGGVMI+F+KIEVVNRLRKE V++TLLNYGVHYD T
Sbjct  100  WITQYEPIQVTLQTDQVRDIPCGTKGGVMISFDKIEVVNRLRKEFVHETLLNYGVHYDKT  159

Query  517  WIYDKIHHEINQFCSGHSLQQVYIDMFDQIDE  612
            WIYDKIHHEINQFCS HSLQQVYIDMFDQIDE
Sbjct  160  WIYDKIHHEINQFCSAHSLQQVYIDMFDQIDE  191



>ref|XP_006437938.1| hypothetical protein CICLE_v10031905mg [Citrus clementina]
 ref|XP_006484199.1| PREDICTED: erlin-2-like [Citrus sinensis]
 gb|ESR51178.1| hypothetical protein CICLE_v10031905mg [Citrus clementina]
Length=363

 Score =   251 bits (641),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 120/157 (76%), Positives = 134/157 (85%), Gaps = 2/157 (1%)
 Frame = +1

Query  148  DFTPILFVFLSFIAIFVMVVTPLLSTNSF--STLHQVPEGHVGVYWRGGALLSTITTPGF  321
            D + IL VFL+FIAI  +++ P  S+     + LHQ+PEGHVGVYWRGGALL TIT PGF
Sbjct  23   DSSAILAVFLTFIAIVSLILIPSSSSIKSSLAILHQIPEGHVGVYWRGGALLETITHPGF  82

Query  322  HLKLPFITHFEPIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGV  501
            HLKLP ITH+EP+QVTLQTD V DIPCGTKGGVMINFEKIEVVNRLRKE+VY+TL +YGV
Sbjct  83   HLKLPLITHYEPVQVTLQTDQVTDIPCGTKGGVMINFEKIEVVNRLRKEYVYETLRDYGV  142

Query  502  HYDNTWIYDKIHHEINQFCSGHSLQQVYIDMFDQIDE  612
             YD TWIYDKIHHEINQFCS HSLQQVYID+FDQIDE
Sbjct  143  QYDKTWIYDKIHHEINQFCSSHSLQQVYIDVFDQIDE  179



>ref|XP_006437939.1| hypothetical protein CICLE_v10031905mg [Citrus clementina]
 gb|ESR51179.1| hypothetical protein CICLE_v10031905mg [Citrus clementina]
Length=355

 Score =   251 bits (640),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 120/157 (76%), Positives = 134/157 (85%), Gaps = 2/157 (1%)
 Frame = +1

Query  148  DFTPILFVFLSFIAIFVMVVTPLLSTNSF--STLHQVPEGHVGVYWRGGALLSTITTPGF  321
            D + IL VFL+FIAI  +++ P  S+     + LHQ+PEGHVGVYWRGGALL TIT PGF
Sbjct  23   DSSAILAVFLTFIAIVSLILIPSSSSIKSSLAILHQIPEGHVGVYWRGGALLETITHPGF  82

Query  322  HLKLPFITHFEPIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGV  501
            HLKLP ITH+EP+QVTLQTD V DIPCGTKGGVMINFEKIEVVNRLRKE+VY+TL +YGV
Sbjct  83   HLKLPLITHYEPVQVTLQTDQVTDIPCGTKGGVMINFEKIEVVNRLRKEYVYETLRDYGV  142

Query  502  HYDNTWIYDKIHHEINQFCSGHSLQQVYIDMFDQIDE  612
             YD TWIYDKIHHEINQFCS HSLQQVYID+FDQIDE
Sbjct  143  QYDKTWIYDKIHHEINQFCSSHSLQQVYIDVFDQIDE  179



>ref|NP_001168508.1| hypothetical protein [Zea mays]
 gb|ACN28470.1| unknown [Zea mays]
 gb|AFW88126.1| hypothetical protein ZEAMMB73_644677 [Zea mays]
Length=371

 Score =   251 bits (642),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 122/151 (81%), Positives = 132/151 (87%), Gaps = 5/151 (3%)
 Frame = +1

Query  166  FVF--LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPF  339
            FVF   +FIAI  ++++  LS  S S LHQVPEGHVGVYWRGGALL TIT PGFHLKLP 
Sbjct  44   FVFGVFAFIAICFVLIS--LSVPS-SVLHQVPEGHVGVYWRGGALLKTITPPGFHLKLPL  100

Query  340  ITHFEPIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTW  519
            IT +EPIQVTLQTD VRDIPCGTKGGVMI+F+KIEVVNRLRKE V++TLLNYGVHYD TW
Sbjct  101  ITQYEPIQVTLQTDQVRDIPCGTKGGVMISFDKIEVVNRLRKEFVHETLLNYGVHYDKTW  160

Query  520  IYDKIHHEINQFCSGHSLQQVYIDMFDQIDE  612
            IYDKIHHEINQFCS HSLQQVYIDMFDQIDE
Sbjct  161  IYDKIHHEINQFCSAHSLQQVYIDMFDQIDE  191



>ref|XP_010514121.1| PREDICTED: erlin-2-B-like [Camelina sativa]
Length=357

 Score =   251 bits (640),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 117/155 (75%), Positives = 130/155 (84%), Gaps = 6/155 (4%)
 Frame = +1

Query  148  DFTPILFVFLSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHL  327
            D + I   F  F+AI  +V+ P       S +HQVPEGHVG YWRGGALL+ IT PGFHL
Sbjct  23   DVSSIFIAFGVFVAIAALVMFP------SSLVHQVPEGHVGAYWRGGALLNIITEPGFHL  76

Query  328  KLPFITHFEPIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHY  507
            KLPFIT++EP+QVTLQTD V+DIPCGTKGGVMI FEKIEVVNRLRK+ VYDTLLNYGV+Y
Sbjct  77   KLPFITNYEPVQVTLQTDQVKDIPCGTKGGVMITFEKIEVVNRLRKDFVYDTLLNYGVNY  136

Query  508  DNTWIYDKIHHEINQFCSGHSLQQVYIDMFDQIDE  612
            DNTWIYDKIHHEINQFCS HSLQQVYID+FDQIDE
Sbjct  137  DNTWIYDKIHHEINQFCSSHSLQQVYIDIFDQIDE  171



>ref|XP_006291384.1| hypothetical protein CARUB_v10017522mg [Capsella rubella]
 gb|EOA24282.1| hypothetical protein CARUB_v10017522mg [Capsella rubella]
Length=356

 Score =   251 bits (640),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 117/155 (75%), Positives = 130/155 (84%), Gaps = 6/155 (4%)
 Frame = +1

Query  148  DFTPILFVFLSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHL  327
            D + IL  F  F AI  +V+ P       S +HQVPEGHVG YWRGGALL+ IT PGFHL
Sbjct  22   DVSSILLAFGVFAAIAALVMFP------SSLVHQVPEGHVGAYWRGGALLNIITEPGFHL  75

Query  328  KLPFITHFEPIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHY  507
            KLPFIT++EP+QVTLQTD V+DIPCGTKGGVMI FEKIEVVNRLRK+ V+DTLLNYGV+Y
Sbjct  76   KLPFITNYEPVQVTLQTDQVKDIPCGTKGGVMITFEKIEVVNRLRKDFVFDTLLNYGVNY  135

Query  508  DNTWIYDKIHHEINQFCSGHSLQQVYIDMFDQIDE  612
            DNTWIYDKIHHEINQFCS HSLQQVYID+FDQIDE
Sbjct  136  DNTWIYDKIHHEINQFCSSHSLQQVYIDIFDQIDE  170



>dbj|BAJ89191.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=366

 Score =   250 bits (639),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 119/152 (78%), Positives = 131/152 (86%), Gaps = 3/152 (2%)
 Frame = +1

Query  157  PILFVFLSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLP  336
            P+    + FIA+  ++V+  +S  S S LHQVPEGHVGVYWRGGALL TITTPG+HLKLP
Sbjct  38   PLALGVVIFIAVCFLLVS--ISAPS-SILHQVPEGHVGVYWRGGALLKTITTPGYHLKLP  94

Query  337  FITHFEPIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNT  516
            FIT FEPIQVTLQTD V+ IPCGTKGGVMI+F+KIEVVNRL K+ VYDTLLNYGVHYD T
Sbjct  95   FITQFEPIQVTLQTDQVKGIPCGTKGGVMISFDKIEVVNRLNKDFVYDTLLNYGVHYDKT  154

Query  517  WIYDKIHHEINQFCSGHSLQQVYIDMFDQIDE  612
            WIYDKIHHEINQFCS HSLQQVYIDMFDQIDE
Sbjct  155  WIYDKIHHEINQFCSAHSLQQVYIDMFDQIDE  186



>ref|XP_010502373.1| PREDICTED: erlin-2-B-like [Camelina sativa]
Length=357

 Score =   250 bits (638),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 117/155 (75%), Positives = 129/155 (83%), Gaps = 6/155 (4%)
 Frame = +1

Query  148  DFTPILFVFLSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHL  327
            D + I   F  F AI  +V+ P       S +HQVPEGHVG YWRGGALL+ IT PGFHL
Sbjct  23   DVSSIFIAFGVFAAIAALVMFP------SSLVHQVPEGHVGAYWRGGALLNIITEPGFHL  76

Query  328  KLPFITHFEPIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHY  507
            KLPFIT++EP+QVTLQTD V+DIPCGTKGGVMI FEKIEVVNRLRK+ VYDTLLNYGV+Y
Sbjct  77   KLPFITNYEPVQVTLQTDQVKDIPCGTKGGVMITFEKIEVVNRLRKDFVYDTLLNYGVNY  136

Query  508  DNTWIYDKIHHEINQFCSGHSLQQVYIDMFDQIDE  612
            DNTWIYDKIHHEINQFCS HSLQQVYID+FDQIDE
Sbjct  137  DNTWIYDKIHHEINQFCSSHSLQQVYIDIFDQIDE  171



>gb|KFK26235.1| hypothetical protein AALP_AA8G220700 [Arabis alpina]
Length=357

 Score =   249 bits (637),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 118/156 (76%), Positives = 131/156 (84%), Gaps = 7/156 (4%)
 Frame = +1

Query  148  DFTPILFVFLSFIAIFVM-VVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFH  324
            D T I   F  FIAI  + V+ P       S +HQVPEGHVG YWRGGALL+ I+ PGFH
Sbjct  22   DVTSIFLAFGVFIAIAALQVMFP------SSLVHQVPEGHVGAYWRGGALLNMISEPGFH  75

Query  325  LKLPFITHFEPIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVH  504
            LKLPFIT++EP+QVTLQTD V+DIPCGTKGGVMI FEKIEVVNRLRK++VYDTLLNYGV+
Sbjct  76   LKLPFITNYEPVQVTLQTDQVKDIPCGTKGGVMITFEKIEVVNRLRKDYVYDTLLNYGVN  135

Query  505  YDNTWIYDKIHHEINQFCSGHSLQQVYIDMFDQIDE  612
            YDNTWIYDKIHHEINQFCS HSLQQVYID+FDQIDE
Sbjct  136  YDNTWIYDKIHHEINQFCSSHSLQQVYIDIFDQIDE  171



>ref|XP_008794156.1| PREDICTED: erlin-2-B-like [Phoenix dactylifera]
Length=360

 Score =   249 bits (636),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 111/124 (90%), Positives = 117/124 (94%), Gaps = 0/124 (0%)
 Frame = +1

Query  241  LHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFEPIQVTLQTDLVRDIPCGTKGGV  420
            LHQVPEGHVGVYWRGGALL TIT PGFHLKLP ITHFEPIQVTLQTD VRDIPCGTKGGV
Sbjct  57   LHQVPEGHVGVYWRGGALLKTITNPGFHLKLPLITHFEPIQVTLQTDQVRDIPCGTKGGV  116

Query  421  MINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKIHHEINQFCSGHSLQQVYIDMFD  600
            MI+F+KIEVVNRLRKE VY+TLLNYGV+YD TWIYDKIHHEINQFCS H++QQVYIDMFD
Sbjct  117  MISFDKIEVVNRLRKEDVYETLLNYGVNYDKTWIYDKIHHEINQFCSAHTMQQVYIDMFD  176

Query  601  QIDE  612
            QIDE
Sbjct  177  QIDE  180



>ref|XP_006651510.1| PREDICTED: erlin-2-like [Oryza brachyantha]
Length=362

 Score =   248 bits (633),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 113/126 (90%), Positives = 118/126 (94%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  STLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFEPIQVTLQTDLVRDIPCGTKG  414
            S LHQVPEGHVGVYWRGGALL TIT PGFHLKLP+IT FEPIQVTLQTD VRDIPCGTKG
Sbjct  57   SILHQVPEGHVGVYWRGGALLETITPPGFHLKLPWITQFEPIQVTLQTDQVRDIPCGTKG  116

Query  415  GVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKIHHEINQFCSGHSLQQVYIDM  594
            GVMI+F+KIEVVNRLRKE V++TLLNYGVHYD TWIYDKIHHEINQFCS HSLQQVYIDM
Sbjct  117  GVMISFDKIEVVNRLRKEFVHETLLNYGVHYDKTWIYDKIHHEINQFCSAHSLQQVYIDM  176

Query  595  FDQIDE  612
            FDQIDE
Sbjct  177  FDQIDE  182



>gb|KHN20517.1| Erlin-2 [Glycine soja]
Length=336

 Score =   247 bits (631),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 117/149 (79%), Positives = 129/149 (87%), Gaps = 5/149 (3%)
 Frame = +1

Query  181  FIA--IFVMVVTPLLS---TNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFIT  345
            FIA  +F +V+ P  S    NS S LHQVPEGHVGVYWRGGALL TIT PGFHLK+PF+T
Sbjct  4    FIAPSLFRVVLLPSASPFFQNSLSILHQVPEGHVGVYWRGGALLKTITEPGFHLKMPFLT  63

Query  346  HFEPIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIY  525
             +EP+QVTLQTD+V DIPCGTKGGVMI+F KIEVVNRLRKE V++TLLNYGVHYD TWIY
Sbjct  64   QYEPVQVTLQTDMVTDIPCGTKGGVMISFGKIEVVNRLRKEFVFETLLNYGVHYDKTWIY  123

Query  526  DKIHHEINQFCSGHSLQQVYIDMFDQIDE  612
            DKIHHEINQFCS HSLQQVYID+FDQIDE
Sbjct  124  DKIHHEINQFCSFHSLQQVYIDVFDQIDE  152



>ref|XP_010425147.1| PREDICTED: erlin-2-B-like [Camelina sativa]
Length=357

 Score =   247 bits (631),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 117/151 (77%), Positives = 129/151 (85%), Gaps = 7/151 (5%)
 Frame = +1

Query  163  LFVFLS-FIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPF  339
            LF+ L  F AI  +V+ P       S +HQVPEGHVG YWRGGALL+ IT PGFHLKLPF
Sbjct  27   LFIALGVFAAIAALVMFP------SSLVHQVPEGHVGAYWRGGALLNIITEPGFHLKLPF  80

Query  340  ITHFEPIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTW  519
            IT++EP+QVTLQTD V+DIPCGTKGGVMI FEKIEVVNRLRK+ VYDTLLNYGV+YDNTW
Sbjct  81   ITNYEPVQVTLQTDQVKDIPCGTKGGVMITFEKIEVVNRLRKDFVYDTLLNYGVNYDNTW  140

Query  520  IYDKIHHEINQFCSGHSLQQVYIDMFDQIDE  612
            IYDKIHHEINQFCS HSLQQVYID+FDQIDE
Sbjct  141  IYDKIHHEINQFCSSHSLQQVYIDIFDQIDE  171



>ref|XP_006837139.1| hypothetical protein AMTR_s00110p00140670 [Amborella trichopoda]
 gb|ERM99992.1| hypothetical protein AMTR_s00110p00140670 [Amborella trichopoda]
Length=336

 Score =   245 bits (625),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 108/124 (87%), Positives = 117/124 (94%), Gaps = 0/124 (0%)
 Frame = +1

Query  241  LHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFEPIQVTLQTDLVRDIPCGTKGGV  420
            LHQVPEGHVG YWRGGALL TIT+PGFHLK+PFIT FEPIQVT+QTD V+DIPCGTKGGV
Sbjct  35   LHQVPEGHVGAYWRGGALLKTITSPGFHLKVPFITQFEPIQVTIQTDQVKDIPCGTKGGV  94

Query  421  MINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKIHHEINQFCSGHSLQQVYIDMFD  600
            MI+FEKIEVVNRL+KE+VY+TLLNYGV YD TWIYDKIHHEINQFCS H+LQQVYIDMFD
Sbjct  95   MISFEKIEVVNRLKKEYVYETLLNYGVKYDKTWIYDKIHHEINQFCSAHTLQQVYIDMFD  154

Query  601  QIDE  612
            QIDE
Sbjct  155  QIDE  158



>ref|XP_002875209.1| band 7 family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51468.1| band 7 family protein [Arabidopsis lyrata subsp. lyrata]
Length=356

 Score =   246 bits (627),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 116/155 (75%), Positives = 128/155 (83%), Gaps = 6/155 (4%)
 Frame = +1

Query  148  DFTPILFVFLSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHL  327
            D + I   F  F AI  +V+ P       S +HQVPEGHVG YWRGGALL+ IT PGFHL
Sbjct  22   DVSSIFIAFGVFAAIAALVMFP------SSLVHQVPEGHVGAYWRGGALLNIITEPGFHL  75

Query  328  KLPFITHFEPIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHY  507
            KLPFIT++EP+QVTLQTD V  IPCGTKGGVMI FEKIEVVNRLRK++VYDTLLNYGV+Y
Sbjct  76   KLPFITNYEPVQVTLQTDQVSLIPCGTKGGVMITFEKIEVVNRLRKDYVYDTLLNYGVNY  135

Query  508  DNTWIYDKIHHEINQFCSGHSLQQVYIDMFDQIDE  612
            DNTWIYDKIHHEINQFCS HSLQQVYID+FDQIDE
Sbjct  136  DNTWIYDKIHHEINQFCSSHSLQQVYIDIFDQIDE  170



>ref|XP_003562386.1| PREDICTED: erlin-2-B isoform X1 [Brachypodium distachyon]
Length=367

 Score =   246 bits (627),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 116/152 (76%), Positives = 129/152 (85%), Gaps = 3/152 (2%)
 Frame = +1

Query  157  PILFVFLSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLP  336
            P+    + FIA+  ++V+  +S  S S LHQVPEGHVGVYWRGGALL  IT+PG+HLKLP
Sbjct  39   PLALGVIVFIAVCFLLVS--ISAPS-SILHQVPEGHVGVYWRGGALLKAITSPGYHLKLP  95

Query  337  FITHFEPIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNT  516
             IT FEPIQVTLQTD V+ IPCGTKGGVMI+F+KIEVVNRL K+ VYDTLLNYGVHYD T
Sbjct  96   LITQFEPIQVTLQTDQVKGIPCGTKGGVMISFDKIEVVNRLSKDFVYDTLLNYGVHYDKT  155

Query  517  WIYDKIHHEINQFCSGHSLQQVYIDMFDQIDE  612
            WIYDKIHHEINQFCS HSLQQVYIDMFDQIDE
Sbjct  156  WIYDKIHHEINQFCSAHSLQQVYIDMFDQIDE  187



>gb|AAO64812.1| At2g03510 [Arabidopsis thaliana]
Length=316

 Score =   243 bits (621),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 118/126 (94%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  STLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFEPIQVTLQTDLVRDIPCGTKG  414
            S +HQVPEGHVG YWRGGALL+ IT PGFHLKLPFIT++EP+QVTLQTD VRDIPCGTKG
Sbjct  5    SLVHQVPEGHVGAYWRGGALLNIITEPGFHLKLPFITNYEPVQVTLQTDQVRDIPCGTKG  64

Query  415  GVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKIHHEINQFCSGHSLQQVYIDM  594
            GV+I FEKIEVVNRLRK+ VYDTLLNYGV+YDNTWIYDKIHHEINQFCS HSLQQVYID+
Sbjct  65   GVLITFEKIEVVNRLRKDFVYDTLLNYGVNYDNTWIYDKIHHEINQFCSSHSLQQVYIDI  124

Query  595  FDQIDE  612
            FDQIDE
Sbjct  125  FDQIDE  130



>ref|XP_010936489.1| PREDICTED: LOW QUALITY PROTEIN: erlin-2-B-like [Elaeis guineensis]
Length=360

 Score =   245 bits (625),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 109/123 (89%), Positives = 116/123 (94%), Gaps = 0/123 (0%)
 Frame = +1

Query  244  HQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFEPIQVTLQTDLVRDIPCGTKGGVM  423
            HQVPEGHVGVYWRGGALL TIT PGFHLKLP ITHFEPIQVTLQTD VRDIPCGTKGGVM
Sbjct  58   HQVPEGHVGVYWRGGALLKTITNPGFHLKLPLITHFEPIQVTLQTDQVRDIPCGTKGGVM  117

Query  424  INFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKIHHEINQFCSGHSLQQVYIDMFDQ  603
            I+F+KIEVVNRLRKE+VY+TLL YGV+YD TWIYDKIHHEINQFCS H++QQVYIDMFDQ
Sbjct  118  ISFDKIEVVNRLRKEYVYETLLEYGVNYDKTWIYDKIHHEINQFCSVHTMQQVYIDMFDQ  177

Query  604  IDE  612
            IDE
Sbjct  178  IDE  180



>gb|EYU28860.1| hypothetical protein MIMGU_mgv1a010144mg [Erythranthe guttata]
Length=321

 Score =   243 bits (621),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 113/141 (80%), Positives = 123/141 (87%), Gaps = 2/141 (1%)
 Frame = +1

Query  196  VMVVTPLLST--NSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFEPIQVT  369
            + V+ P LS    + S LHQVPEGHVGVYWRGGALL+  T PGFHLKLP IT+FEPIQVT
Sbjct  1    MQVILPTLSIFGQNMSILHQVPEGHVGVYWRGGALLNVNTDPGFHLKLPLITYFEPIQVT  60

Query  370  LQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKIHHEIN  549
            LQTDLVR+IPCGTKGGVMINF KIEVVNRL K++VYDTL +YGV YD+TWIYDKIHHEIN
Sbjct  61   LQTDLVRNIPCGTKGGVMINFAKIEVVNRLHKDYVYDTLRDYGVKYDDTWIYDKIHHEIN  120

Query  550  QFCSGHSLQQVYIDMFDQIDE  612
            QFCS HSLQQVYIDMFDQIDE
Sbjct  121  QFCSAHSLQQVYIDMFDQIDE  141



>ref|XP_006409591.1| hypothetical protein EUTSA_v10022792mg [Eutrema salsugineum]
 gb|ESQ51044.1| hypothetical protein EUTSA_v10022792mg [Eutrema salsugineum]
Length=282

 Score =   242 bits (618),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 115/155 (74%), Positives = 129/155 (83%), Gaps = 6/155 (4%)
 Frame = +1

Query  148  DFTPILFVFLSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHL  327
            D + I   F  FIAI  +V+ P       S +HQVPEG+VG YWRGGALL+ IT PGF L
Sbjct  22   DVSSIFIAFGVFIAIAALVMFPS------SLVHQVPEGYVGAYWRGGALLNIITEPGFQL  75

Query  328  KLPFITHFEPIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHY  507
            KLPFIT++EP+QVTLQTD V+DIPCGTKGGVMI FEKIEVVNRLRK++VYDTLLNYGV Y
Sbjct  76   KLPFITNYEPVQVTLQTDQVKDIPCGTKGGVMITFEKIEVVNRLRKDYVYDTLLNYGVDY  135

Query  508  DNTWIYDKIHHEINQFCSGHSLQQVYIDMFDQIDE  612
            DNTWIYDKIHHEINQFCS +SLQQVYID+FDQIDE
Sbjct  136  DNTWIYDKIHHEINQFCSSYSLQQVYIDIFDQIDE  170



>ref|XP_006409592.1| hypothetical protein EUTSA_v10022792mg [Eutrema salsugineum]
 ref|XP_006409595.1| hypothetical protein EUTSA_v10022979mg [Eutrema salsugineum]
 gb|ESQ51045.1| hypothetical protein EUTSA_v10022792mg [Eutrema salsugineum]
 gb|ESQ51048.1| hypothetical protein EUTSA_v10022979mg [Eutrema salsugineum]
Length=302

 Score =   242 bits (618),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 115/155 (74%), Positives = 129/155 (83%), Gaps = 6/155 (4%)
 Frame = +1

Query  148  DFTPILFVFLSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHL  327
            D + I   F  FIAI  +V+ P       S +HQVPEG+VG YWRGGALL+ IT PGF L
Sbjct  22   DVSSIFIAFGVFIAIAALVMFP------SSLVHQVPEGYVGAYWRGGALLNIITEPGFQL  75

Query  328  KLPFITHFEPIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHY  507
            KLPFIT++EP+QVTLQTD V+DIPCGTKGGVMI FEKIEVVNRLRK++VYDTLLNYGV Y
Sbjct  76   KLPFITNYEPVQVTLQTDQVKDIPCGTKGGVMITFEKIEVVNRLRKDYVYDTLLNYGVDY  135

Query  508  DNTWIYDKIHHEINQFCSGHSLQQVYIDMFDQIDE  612
            DNTWIYDKIHHEINQFCS +SLQQVYID+FDQIDE
Sbjct  136  DNTWIYDKIHHEINQFCSSYSLQQVYIDIFDQIDE  170



>gb|KCW86499.1| hypothetical protein EUGRSUZ_B03155, partial [Eucalyptus grandis]
Length=244

 Score =   239 bits (610),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 107/123 (87%), Positives = 116/123 (94%), Gaps = 0/123 (0%)
 Frame = +1

Query  244  HQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFEPIQVTLQTDLVRDIPCGTKGGVM  423
            HQVPEGHVGVYWRGGALL+TIT PGFHLK+PFITH+EP+QVTLQTD VRD+PCGTKGGVM
Sbjct  17   HQVPEGHVGVYWRGGALLNTITDPGFHLKMPFITHYEPVQVTLQTDQVRDVPCGTKGGVM  76

Query  424  INFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKIHHEINQFCSGHSLQQVYIDMFDQ  603
            I FEKIEVVNRLRK++VYDTLLNYGV YDN WIYDKIHHEIN+FCS H LQQVYID+FDQ
Sbjct  77   ITFEKIEVVNRLRKDYVYDTLLNYGVQYDNMWIYDKIHHEINRFCSSHPLQQVYIDVFDQ  136

Query  604  IDE  612
            IDE
Sbjct  137  IDE  139



>ref|XP_010091570.1| hypothetical protein L484_026416 [Morus notabilis]
 gb|EXB44836.1| hypothetical protein L484_026416 [Morus notabilis]
Length=301

 Score =   241 bits (614),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 107/152 (70%), Positives = 130/152 (86%), Gaps = 2/152 (1%)
 Frame = +1

Query  163  LFVFLSFIAIFVMVV--TPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLP  336
            L VF+ FI +F ++   + L  +NS + LHQVPEGHVGVYWRGGALL TIT PGFH+K+P
Sbjct  36   LAVFMLFIGVFAVIAMSSTLSGSNSLAILHQVPEGHVGVYWRGGALLKTITDPGFHVKMP  95

Query  337  FITHFEPIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNT  516
             IT +EP+QVT+QTD VRDIPCGTKGGVMI FEKIEVVNRLRK++V++TLLNYGV+YDNT
Sbjct  96   LITQYEPVQVTIQTDQVRDIPCGTKGGVMITFEKIEVVNRLRKDYVHETLLNYGVNYDNT  155

Query  517  WIYDKIHHEINQFCSGHSLQQVYIDMFDQIDE  612
            WIYDKIHHEINQFCS H+LQ VYID+ +++ +
Sbjct  156  WIYDKIHHEINQFCSSHTLQDVYIDIDEKMKD  187



>gb|ACN40257.1| unknown [Picea sitchensis]
Length=358

 Score =   240 bits (613),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 109/144 (76%), Positives = 124/144 (86%), Gaps = 1/144 (1%)
 Frame = +1

Query  184  IAIFVMVVTPLLSTN-SFSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFEPI  360
            +AI  M+  PL +   S   +HQVPEGHVGVYWRGGALL T+T+PGFHLK+P IT +EPI
Sbjct  30   LAICFMLYIPLSADGHSLDIVHQVPEGHVGVYWRGGALLKTVTSPGFHLKMPLITRYEPI  89

Query  361  QVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKIHH  540
            QVT+QTD V+DIPCGTKGGVMI F+KIEVVNRLRKE+VYDTL+NYGV YD TWIYDKIHH
Sbjct  90   QVTIQTDKVKDIPCGTKGGVMIFFDKIEVVNRLRKEYVYDTLMNYGVTYDKTWIYDKIHH  149

Query  541  EINQFCSGHSLQQVYIDMFDQIDE  612
            EINQFCS H+LQ+VY DMFDQIDE
Sbjct  150  EINQFCSSHTLQEVYTDMFDQIDE  173



>emb|CAE54276.1| putative integral membrane protein that regulates cation conductance 
[Triticum aestivum]
Length=215

 Score =   235 bits (600),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 107/123 (87%), Positives = 113/123 (92%), Gaps = 0/123 (0%)
 Frame = +1

Query  235  STLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFEPIQVTLQTDLVRDIPCGTKG  414
            S LHQVPEGHVGVYWRGGALL TITTPG+HLKLPFIT FEPIQVTLQTD V+ IPCGTKG
Sbjct  6    SILHQVPEGHVGVYWRGGALLKTITTPGYHLKLPFITQFEPIQVTLQTDQVKGIPCGTKG  65

Query  415  GVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKIHHEINQFCSGHSLQQVYIDM  594
            GVMI+F+KI VVNRL K+ VY+TLLNYGVHYD TWIYDKIHHEINQFCS HSLQQVYIDM
Sbjct  66   GVMISFDKIGVVNRLNKDFVYETLLNYGVHYDKTWIYDKIHHEINQFCSAHSLQQVYIDM  125

Query  595  FDQ  603
            FDQ
Sbjct  126  FDQ  128



>gb|AAT85034.1| putative SPFH domain / Band 7 family [Oryza sativa Japonica Group]
 gb|ABF96672.1| SPFH domain protein 2 precursor, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAG95945.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC75497.1| hypothetical protein OsI_12095 [Oryza sativa Indica Group]
 gb|EEE59277.1| hypothetical protein OsJ_11309 [Oryza sativa Japonica Group]
Length=374

 Score =   241 bits (614),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 115/151 (76%), Positives = 124/151 (82%), Gaps = 13/151 (9%)
 Frame = +1

Query  160  ILFVFLSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPF  339
            I FV +SF A               S LHQVPEGHVGVYWRGGALL TIT PGFH+KLP+
Sbjct  57   ICFVLISFSA-------------PSSILHQVPEGHVGVYWRGGALLETITPPGFHVKLPW  103

Query  340  ITHFEPIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTW  519
            IT FEPIQVTLQTD VR+IPCGTKGGVMI+F+KIEVVNRL KE V++TLLNYGVHYD TW
Sbjct  104  ITQFEPIQVTLQTDQVRNIPCGTKGGVMISFDKIEVVNRLHKEFVHETLLNYGVHYDKTW  163

Query  520  IYDKIHHEINQFCSGHSLQQVYIDMFDQIDE  612
            IYDKIHHEINQFCS HSLQQVYID+FDQIDE
Sbjct  164  IYDKIHHEINQFCSAHSLQQVYIDLFDQIDE  194



>gb|KHN42949.1| Erlin-2-B, partial [Glycine soja]
Length=310

 Score =   237 bits (605),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 107/126 (85%), Positives = 116/126 (92%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  STLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFEPIQVTLQTDLVRDIPCGTKG  414
            S LHQVPEGHVGVYWRGGALL TIT PGFHLK+PFIT +EP+QVTLQTD+V DIPCGTKG
Sbjct  1    SILHQVPEGHVGVYWRGGALLKTITEPGFHLKMPFITQYEPVQVTLQTDMVIDIPCGTKG  60

Query  415  GVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKIHHEINQFCSGHSLQQVYIDM  594
            GVMI+F KIEVVN+L KE V++TLLNYGVHYD TWIYDKIHHEINQFCS HSLQQVYID+
Sbjct  61   GVMISFGKIEVVNQLHKEFVFETLLNYGVHYDKTWIYDKIHHEINQFCSSHSLQQVYIDV  120

Query  595  FDQIDE  612
            FDQIDE
Sbjct  121  FDQIDE  126



>ref|XP_002965145.1| hypothetical protein SELMODRAFT_227516 [Selaginella moellendorffii]
 gb|EFJ33983.1| hypothetical protein SELMODRAFT_227516 [Selaginella moellendorffii]
Length=332

 Score =   231 bits (589),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 102/132 (77%), Positives = 116/132 (88%), Gaps = 0/132 (0%)
 Frame = +1

Query  217  LSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFEPIQVTLQTDLVRDI  396
            ++  +F  LHQ+PEGHVGVYWRGGALL TI+ PGFHL +P +T +EPIQVT+QTD V+DI
Sbjct  36   VAGTNFGVLHQIPEGHVGVYWRGGALLKTISEPGFHLMVPILTQYEPIQVTIQTDQVKDI  95

Query  397  PCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKIHHEINQFCSGHSLQ  576
            PCGTKGGVMI FEKIEVVNRL+KE VY+T+LNYGV YD TWIYDKIHHEINQFCS HSLQ
Sbjct  96   PCGTKGGVMIYFEKIEVVNRLKKELVYETILNYGVSYDKTWIYDKIHHEINQFCSAHSLQ  155

Query  577  QVYIDMFDQIDE  612
            +VYID FDQIDE
Sbjct  156  EVYIDKFDQIDE  167



>gb|ADE77372.1| unknown [Picea sitchensis]
Length=338

 Score =   231 bits (588),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 107/155 (69%), Positives = 124/155 (80%), Gaps = 4/155 (3%)
 Frame = +1

Query  148  DFTPILFVFLSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHL  327
            +   +LFV    IA+ V +  P +S+  F  LHQVPEGHVG YW GGAL   IT PGFHL
Sbjct  16   NLVQLLFVL---IAVLVAISIPAVSS-CFGILHQVPEGHVGAYWTGGALSKRITDPGFHL  71

Query  328  KLPFITHFEPIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHY  507
            K+P +T +EPIQVT+QTD V++IPCGTKGGVMI F+KIEVVNRLRK++VYDT+LNYGV Y
Sbjct  72   KMPVLTQYEPIQVTIQTDEVKNIPCGTKGGVMIYFDKIEVVNRLRKDYVYDTILNYGVTY  131

Query  508  DNTWIYDKIHHEINQFCSGHSLQQVYIDMFDQIDE  612
            D TWIYDKIHHEINQFCS H+LQ VYID FDQIDE
Sbjct  132  DKTWIYDKIHHEINQFCSAHTLQDVYIDKFDQIDE  166



>ref|XP_001759598.1| predicted protein [Physcomitrella patens]
 gb|EDQ75510.1| predicted protein [Physcomitrella patens]
Length=312

 Score =   228 bits (580),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 99/132 (75%), Positives = 117/132 (89%), Gaps = 0/132 (0%)
 Frame = +1

Query  217  LSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFEPIQVTLQTDLVRDI  396
            ++  + + LHQ+PEGHVGVYWRGGALL+TI+ PGFHL +PF+T  EPIQVT+QTD V +I
Sbjct  3    VAGTNLAILHQIPEGHVGVYWRGGALLNTISGPGFHLMIPFLTRVEPIQVTIQTDQVMNI  62

Query  397  PCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKIHHEINQFCSGHSLQ  576
            PCGTKGGVM+ F KIEVVNRLRK +VY+T+LN+GVHYD TWIYDKIHHEINQFCSGH+LQ
Sbjct  63   PCGTKGGVMLEFAKIEVVNRLRKNYVYETILNFGVHYDKTWIYDKIHHEINQFCSGHTLQ  122

Query  577  QVYIDMFDQIDE  612
            +VYID FDQIDE
Sbjct  123  EVYIDKFDQIDE  134



>ref|XP_009396430.1| PREDICTED: erlin-2-B isoform X1 [Musa acuminata subsp. malaccensis]
Length=394

 Score =   229 bits (585),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 105/124 (85%), Positives = 108/124 (87%), Gaps = 0/124 (0%)
 Frame = +1

Query  241  LHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFEPIQVTLQTDLVRDIPCGTKGGV  420
            LHQVPEGHVGVYWRGGALL   T PGFH KLP IT FEPIQVT+QTD VRDIPCGTKGGV
Sbjct  91   LHQVPEGHVGVYWRGGALLEATTDPGFHWKLPLITQFEPIQVTIQTDQVRDIPCGTKGGV  150

Query  421  MINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKIHHEINQFCSGHSLQQVYIDMFD  600
            MI+F+KIEVVNRLRK  VY TL  YGV YD TWIYDKIHHEINQFCS HSLQQVYIDMFD
Sbjct  151  MISFDKIEVVNRLRKSFVYQTLHEYGVFYDKTWIYDKIHHEINQFCSAHSLQQVYIDMFD  210

Query  601  QIDE  612
            QIDE
Sbjct  211  QIDE  214



>gb|EMS50295.1| hypothetical protein TRIUR3_30715 [Triticum urartu]
Length=356

 Score =   228 bits (582),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 106/126 (84%), Positives = 111/126 (88%), Gaps = 7/126 (6%)
 Frame = +1

Query  235  STLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFEPIQVTLQTDLVRDIPCGTKG  414
            S LHQVPEGHVGVYWRGGALL TITTPG+HLKLPFIT FEPIQV       + IPCGTKG
Sbjct  31   SILHQVPEGHVGVYWRGGALLKTITTPGYHLKLPFITQFEPIQV-------KGIPCGTKG  83

Query  415  GVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKIHHEINQFCSGHSLQQVYIDM  594
            GVMI+F+KIEVVNRL K+ VYDTLLNYGVHYD TWIYDKIHHEINQFCS HSLQQVYIDM
Sbjct  84   GVMISFDKIEVVNRLNKDFVYDTLLNYGVHYDKTWIYDKIHHEINQFCSAHSLQQVYIDM  143

Query  595  FDQIDE  612
            FDQIDE
Sbjct  144  FDQIDE  149



>ref|XP_009396431.1| PREDICTED: erlin-2-B isoform X2 [Musa acuminata subsp. malaccensis]
Length=392

 Score =   229 bits (584),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 112/154 (73%), Positives = 125/154 (81%), Gaps = 3/154 (2%)
 Frame = +1

Query  151  FTPILFVFLSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHLK  330
            F  ++ +FL F+ +F++  +   + +S S LHQVPEGHVGVYWRGGALL   T PGFH K
Sbjct  62   FNAVVTIFL-FVLVFLVSSS--TTGSSLSVLHQVPEGHVGVYWRGGALLEATTDPGFHWK  118

Query  331  LPFITHFEPIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYD  510
            LP IT FEPIQVT+QTD VRDIPCGTKGGVMI+F+KIEVVNRLRK  VY TL  YGV YD
Sbjct  119  LPLITQFEPIQVTIQTDQVRDIPCGTKGGVMISFDKIEVVNRLRKSFVYQTLHEYGVFYD  178

Query  511  NTWIYDKIHHEINQFCSGHSLQQVYIDMFDQIDE  612
             TWIYDKIHHEINQFCS HSLQQVYIDMFDQIDE
Sbjct  179  KTWIYDKIHHEINQFCSAHSLQQVYIDMFDQIDE  212



>ref|XP_001751456.1| predicted protein [Physcomitrella patens]
 gb|EDQ83773.1| predicted protein [Physcomitrella patens]
Length=352

 Score =   227 bits (579),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 104/153 (68%), Positives = 126/153 (82%), Gaps = 4/153 (3%)
 Frame = +1

Query  157  PILFVFLSFIAIFVMVVTPL-LSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKL  333
            PILF   +  AI + ++ PL ++  +   LHQ+PEGHVGVYWRGGALL+TI+ PGFHL +
Sbjct  25   PILF---AICAIGLAILVPLAVAGTNLVLLHQIPEGHVGVYWRGGALLNTISEPGFHLMI  81

Query  334  PFITHFEPIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDN  513
            PF+T  EPIQVT+QTD V +IPCGTKGGVM+ F KIEVVNRL+K +VY+T+LN+GV YD 
Sbjct  82   PFLTRVEPIQVTIQTDQVMNIPCGTKGGVMLEFAKIEVVNRLKKNNVYETILNFGVQYDK  141

Query  514  TWIYDKIHHEINQFCSGHSLQQVYIDMFDQIDE  612
            TWIYDKIHHEINQFCS H+LQ+VYID FDQIDE
Sbjct  142  TWIYDKIHHEINQFCSCHTLQEVYIDKFDQIDE  174



>ref|XP_002962231.1| hypothetical protein SELMODRAFT_76972, partial [Selaginella moellendorffii]
 gb|EFJ37491.1| hypothetical protein SELMODRAFT_76972, partial [Selaginella moellendorffii]
Length=307

 Score =   225 bits (573),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 101/126 (80%), Positives = 112/126 (89%), Gaps = 2/126 (2%)
 Frame = +1

Query  241  LHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFEPIQVTLQTD--LVRDIPCGTKG  414
            LHQ+PEGHVGVYWRGGALL TI+ PGFHL +P +T +EPIQVT+QTD   V+DIPCGTKG
Sbjct  2    LHQIPEGHVGVYWRGGALLKTISEPGFHLMVPILTQYEPIQVTIQTDQARVKDIPCGTKG  61

Query  415  GVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKIHHEINQFCSGHSLQQVYIDM  594
            GVMI FEKIEVVNRL+KE VY+T+LNYGV YD TWIYDKIHHEINQFCS HSLQ+VYID 
Sbjct  62   GVMIYFEKIEVVNRLKKELVYETILNYGVSYDKTWIYDKIHHEINQFCSAHSLQEVYIDK  121

Query  595  FDQIDE  612
            FDQIDE
Sbjct  122  FDQIDE  127



>ref|XP_009396432.1| PREDICTED: erlin-2-B isoform X3 [Musa acuminata subsp. malaccensis]
Length=345

 Score =   223 bits (569),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 102/121 (84%), Positives = 105/121 (87%), Gaps = 0/121 (0%)
 Frame = +1

Query  241  LHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFEPIQVTLQTDLVRDIPCGTKGGV  420
            LHQVPEGHVGVYWRGGALL   T PGFH KLP IT FEPIQVT+QTD VRDIPCGTKGGV
Sbjct  91   LHQVPEGHVGVYWRGGALLEATTDPGFHWKLPLITQFEPIQVTIQTDQVRDIPCGTKGGV  150

Query  421  MINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKIHHEINQFCSGHSLQQVYIDMFD  600
            MI+F+KIEVVNRLRK  VY TL  YGV YD TWIYDKIHHEINQFCS HSLQQVYIDMFD
Sbjct  151  MISFDKIEVVNRLRKSFVYQTLHEYGVFYDKTWIYDKIHHEINQFCSAHSLQQVYIDMFD  210

Query  601  Q  603
            Q
Sbjct  211  Q  211



>ref|XP_010044413.1| PREDICTED: erlin-2-B-like isoform X2 [Eucalyptus grandis]
Length=382

 Score =   223 bits (569),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 110/154 (71%), Positives = 125/154 (81%), Gaps = 1/154 (1%)
 Frame = +1

Query  151  FTPILFVFLSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHLK  330
            F  ILF FL      +++++   + +S S LHQVPEGHVGVYWRGGALL TIT PGFHLK
Sbjct  102  FRSILF-FLVPTVCLILILSISSTKSSLSILHQVPEGHVGVYWRGGALLKTITNPGFHLK  160

Query  331  LPFITHFEPIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYD  510
            +P +T  E +QVTLQTD V+DIPCGT GGVMINFEKIEVVNRL K++VY+TLLNYGV YD
Sbjct  161  MPLVTQHEAVQVTLQTDQVKDIPCGTNGGVMINFEKIEVVNRLHKDYVYETLLNYGVQYD  220

Query  511  NTWIYDKIHHEINQFCSGHSLQQVYIDMFDQIDE  612
              WIYDKIHHEIN+FCS HSLQQVYID FDQIDE
Sbjct  221  CIWIYDKIHHEINKFCSSHSLQQVYIDAFDQIDE  254



>ref|XP_010044412.1| PREDICTED: erlin-2-B-like isoform X1 [Eucalyptus grandis]
Length=391

 Score =   224 bits (570),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 110/154 (71%), Positives = 125/154 (81%), Gaps = 1/154 (1%)
 Frame = +1

Query  151  FTPILFVFLSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHLK  330
            F  ILF FL      +++++   + +S S LHQVPEGHVGVYWRGGALL TIT PGFHLK
Sbjct  102  FRSILF-FLVPTVCLILILSISSTKSSLSILHQVPEGHVGVYWRGGALLKTITNPGFHLK  160

Query  331  LPFITHFEPIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYD  510
            +P +T  E +QVTLQTD V+DIPCGT GGVMINFEKIEVVNRL K++VY+TLLNYGV YD
Sbjct  161  MPLVTQHEAVQVTLQTDQVKDIPCGTNGGVMINFEKIEVVNRLHKDYVYETLLNYGVQYD  220

Query  511  NTWIYDKIHHEINQFCSGHSLQQVYIDMFDQIDE  612
              WIYDKIHHEIN+FCS HSLQQVYID FDQIDE
Sbjct  221  CIWIYDKIHHEINKFCSSHSLQQVYIDAFDQIDE  254



>gb|KCW86496.1| hypothetical protein EUGRSUZ_B03154 [Eucalyptus grandis]
Length=305

 Score =   200 bits (508),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 89/99 (90%), Positives = 95/99 (96%), Gaps = 0/99 (0%)
 Frame = +1

Query  316  GFHLKLPFITHFEPIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNY  495
            GFHLK+PFITH+EP+QVTLQTD VRDIPCGTKGGVMI FEKIEVVNRLRK++VYDTLLNY
Sbjct  19   GFHLKMPFITHYEPVQVTLQTDQVRDIPCGTKGGVMITFEKIEVVNRLRKDYVYDTLLNY  78

Query  496  GVHYDNTWIYDKIHHEINQFCSGHSLQQVYIDMFDQIDE  612
            GV YDNTWIYDKIHHEINQFCS HSLQQVYID+FDQIDE
Sbjct  79   GVQYDNTWIYDKIHHEINQFCSSHSLQQVYIDVFDQIDE  117



>emb|CDW91496.1| spfh band 7 phb domain-containing membrane-associated protein 
[Stylonychia lemnae]
Length=319

 Score =   196 bits (499),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 93/150 (62%), Positives = 112/150 (75%), Gaps = 7/150 (5%)
 Frame = +1

Query  163  LFVFLSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFI  342
            LF FL  +    ++V        F+  H + EGHVGVY+RGGALL + T PGFH KLP I
Sbjct  6    LFCFLCALLFPALLVL-------FNGFHIIEEGHVGVYYRGGALLESTTEPGFHFKLPLI  58

Query  343  THFEPIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWI  522
            T FE IQVT+QTD V +IPCGT GGV+I F+ IEVVNRLRK+ VYDT+ NY +HYD TWI
Sbjct  59   TSFENIQVTVQTDKVINIPCGTAGGVVITFDHIEVVNRLRKDSVYDTIKNYTIHYDKTWI  118

Query  523  YDKIHHEINQFCSGHSLQQVYIDMFDQIDE  612
            +DKIHHEINQFCS H+LQ+V+ID FD +DE
Sbjct  119  FDKIHHEINQFCSKHTLQEVFIDKFDALDE  148



>gb|EJY71854.1| hypothetical protein OXYTRI_07151 [Oxytricha trifallax]
Length=318

 Score =   194 bits (494),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 92/148 (62%), Positives = 115/148 (78%), Gaps = 5/148 (3%)
 Frame = +1

Query  169  VFLSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITH  348
            +F +F AI + +V  L     F+  H V EGHVGVY++ GAL++ I+ PGFH KLP IT 
Sbjct  4    MFFAFGAIILPIVVTL-----FNGFHIVHEGHVGVYYKAGALMNEISEPGFHFKLPLITT  58

Query  349  FEPIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYD  528
            FE IQVT+QTD V +IPCGT GGV+I F+ IEVVNRL+KE+VYDT+ NY V+YD TWI+D
Sbjct  59   FENIQVTVQTDKVINIPCGTAGGVVIYFDHIEVVNRLKKEYVYDTIKNYTVNYDKTWIFD  118

Query  529  KIHHEINQFCSGHSLQQVYIDMFDQIDE  612
            KIHHEINQFCS H+LQ+VY+D FD +DE
Sbjct  119  KIHHEINQFCSKHTLQEVYVDKFDSLDE  146



>ref|XP_008871318.1| hypothetical protein, variant 1 [Aphanomyces invadans]
 gb|ETW00293.1| hypothetical protein, variant 1 [Aphanomyces invadans]
Length=307

 Score =   192 bits (488),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 90/141 (64%), Positives = 114/141 (81%), Gaps = 1/141 (1%)
 Frame = +1

Query  193  FVMVVTPLLSTNSFS-TLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFEPIQVT  369
            F++  T +L+  S   +LH V EG+VGVY+RGGALLS +T PGF+ +LPF+T    +QVT
Sbjct  3    FLVGATAMLAFLSIPLSLHTVQEGYVGVYFRGGALLSEVTGPGFNWQLPFVTSCYHVQVT  62

Query  370  LQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKIHHEIN  549
            +QTD V +IPCGT GGV+I+F+K+EVVNRLR E VYDT+ NY VHYD TWI+DKIHHEIN
Sbjct  63   VQTDHVDNIPCGTSGGVLISFDKVEVVNRLRSESVYDTIKNYTVHYDKTWIFDKIHHEIN  122

Query  550  QFCSGHSLQQVYIDMFDQIDE  612
            QFCS H+LQ+VYID+FD +DE
Sbjct  123  QFCSKHTLQEVYIDLFDTLDE  143



>ref|XP_009831327.1| hypothetical protein H257_07483 [Aphanomyces astaci]
 gb|ETV79486.1| hypothetical protein H257_07483 [Aphanomyces astaci]
Length=307

 Score =   192 bits (488),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 88/142 (62%), Positives = 112/142 (79%), Gaps = 7/142 (5%)
 Frame = +1

Query  187  AIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFEPIQV  366
            A+   +  PL       +LH V EG+VGVY+RGGALLS +T+PGF+ K+PF+T    +QV
Sbjct  9    ALLAFIAMPL-------SLHTVNEGYVGVYFRGGALLSDVTSPGFNWKMPFVTSCFHVQV  61

Query  367  TLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKIHHEI  546
            T+QTD V +IPCGT GGV+I+F+K+EVVNRLR + VYDT+ NY VHYD TWI+DKIHHEI
Sbjct  62   TVQTDHVDNIPCGTSGGVLISFDKVEVVNRLRTKDVYDTIKNYTVHYDKTWIFDKIHHEI  121

Query  547  NQFCSGHSLQQVYIDMFDQIDE  612
            NQFCS H+LQ+VYID+FD +DE
Sbjct  122  NQFCSKHTLQEVYIDLFDTLDE  143



>ref|XP_009831328.1| hypothetical protein, variant [Aphanomyces astaci]
 gb|ETV79487.1| hypothetical protein, variant [Aphanomyces astaci]
Length=305

 Score =   192 bits (488),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 88/142 (62%), Positives = 112/142 (79%), Gaps = 7/142 (5%)
 Frame = +1

Query  187  AIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFEPIQV  366
            A+   +  PL       +LH V EG+VGVY+RGGALLS +T+PGF+ K+PF+T    +QV
Sbjct  9    ALLAFIAMPL-------SLHTVNEGYVGVYFRGGALLSDVTSPGFNWKMPFVTSCFHVQV  61

Query  367  TLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKIHHEI  546
            T+QTD V +IPCGT GGV+I+F+K+EVVNRLR + VYDT+ NY VHYD TWI+DKIHHEI
Sbjct  62   TVQTDHVDNIPCGTSGGVLISFDKVEVVNRLRTKDVYDTIKNYTVHYDKTWIFDKIHHEI  121

Query  547  NQFCSGHSLQQVYIDMFDQIDE  612
            NQFCS H+LQ+VYID+FD +DE
Sbjct  122  NQFCSKHTLQEVYIDLFDTLDE  143



>ref|XP_008871319.1| hypothetical protein, variant 2 [Aphanomyces invadans]
 ref|XP_008871320.1| hypothetical protein, variant 3 [Aphanomyces invadans]
 ref|XP_008871321.1| hypothetical protein, variant 4 [Aphanomyces invadans]
 gb|ETW00294.1| hypothetical protein, variant 2 [Aphanomyces invadans]
 gb|ETW00295.1| hypothetical protein, variant 3 [Aphanomyces invadans]
 gb|ETW00296.1| hypothetical protein, variant 4 [Aphanomyces invadans]
Length=273

 Score =   191 bits (484),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 90/141 (64%), Positives = 114/141 (81%), Gaps = 1/141 (1%)
 Frame = +1

Query  193  FVMVVTPLLSTNSFS-TLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFEPIQVT  369
            F++  T +L+  S   +LH V EG+VGVY+RGGALLS +T PGF+ +LPF+T    +QVT
Sbjct  3    FLVGATAMLAFLSIPLSLHTVQEGYVGVYFRGGALLSEVTGPGFNWQLPFVTSCYHVQVT  62

Query  370  LQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKIHHEIN  549
            +QTD V +IPCGT GGV+I+F+K+EVVNRLR E VYDT+ NY VHYD TWI+DKIHHEIN
Sbjct  63   VQTDHVDNIPCGTSGGVLISFDKVEVVNRLRSESVYDTIKNYTVHYDKTWIFDKIHHEIN  122

Query  550  QFCSGHSLQQVYIDMFDQIDE  612
            QFCS H+LQ+VYID+FD +DE
Sbjct  123  QFCSKHTLQEVYIDLFDTLDE  143



>ref|XP_008871317.1| hypothetical protein H310_07669 [Aphanomyces invadans]
 gb|ETW00292.1| hypothetical protein H310_07669 [Aphanomyces invadans]
Length=334

 Score =   192 bits (487),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 90/141 (64%), Positives = 114/141 (81%), Gaps = 1/141 (1%)
 Frame = +1

Query  193  FVMVVTPLLSTNSFS-TLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFEPIQVT  369
            F++  T +L+  S   +LH V EG+VGVY+RGGALLS +T PGF+ +LPF+T    +QVT
Sbjct  3    FLVGATAMLAFLSIPLSLHTVQEGYVGVYFRGGALLSEVTGPGFNWQLPFVTSCYHVQVT  62

Query  370  LQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKIHHEIN  549
            +QTD V +IPCGT GGV+I+F+K+EVVNRLR E VYDT+ NY VHYD TWI+DKIHHEIN
Sbjct  63   VQTDHVDNIPCGTSGGVLISFDKVEVVNRLRSESVYDTIKNYTVHYDKTWIFDKIHHEIN  122

Query  550  QFCSGHSLQQVYIDMFDQIDE  612
            QFCS H+LQ+VYID+FD +DE
Sbjct  123  QFCSKHTLQEVYIDLFDTLDE  143



>ref|XP_005646983.1| hypothetical protein COCSUDRAFT_53813 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE22439.1| hypothetical protein COCSUDRAFT_53813 [Coccomyxa subellipsoidea 
C-169]
Length=346

 Score =   192 bits (488),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 93/151 (62%), Positives = 113/151 (75%), Gaps = 5/151 (3%)
 Frame = +1

Query  160  ILFVFLSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPF  339
            +L   L++I I  +++   L    FS LH VPEGHVGVYWRGG+LLS +T PG  LKLPF
Sbjct  25   VLLSTLNYIVIGSLLLAVFLK---FS-LHSVPEGHVGVYWRGGSLLSRVTEPGLRLKLPF  80

Query  340  ITHFEPIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTW  519
            +  F PIQVTLQTD V DIPCGTK GVM+ F+K+EVVNRL+KE+V +T+  YG  YDN W
Sbjct  81   LDLFSPIQVTLQTDKVADIPCGTK-GVMVYFDKVEVVNRLKKEYVLETIRAYGEDYDNLW  139

Query  520  IYDKIHHEINQFCSGHSLQQVYIDMFDQIDE  612
            I+ KIHHE+NQ CS  +LQ +YID FDQIDE
Sbjct  140  IFSKIHHEMNQLCSHSTLQDIYIDKFDQIDE  170



>ref|NP_001086246.1| erlin-2-B precursor [Xenopus laevis]
 sp|Q6DKC0.1|ERL2B_XENLA RecName: Full=Erlin-2-B; AltName: Full=Endoplasmic reticulum 
lipid raft-associated protein 2-B; AltName: Full=Stomatin-prohibitin-flotillin-HflC/K 
domain-containing protein 2-B; Short=SPFH 
domain-containing protein 2-B [Xenopus laevis]
 gb|AAH74372.1| MGC84282 protein [Xenopus laevis]
Length=330

 Score =   187 bits (475),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 82/133 (62%), Positives = 105/133 (79%), Gaps = 0/133 (0%)
 Frame = +1

Query  214  LLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFEPIQVTLQTDLVRD  393
            L++   FS +H++ EGHVGVY+RGGALL+T + PGFHL LPFIT F+ +Q TLQTD V++
Sbjct  14   LIAAALFSAIHKIEEGHVGVYYRGGALLTTTSGPGFHLMLPFITSFKSVQSTLQTDEVKN  73

Query  394  IPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKIHHEINQFCSGHSL  573
            +PCGT GGVMI F++IEVVN L    VYD + NY   YD   I++KIHHE+NQFCS H+L
Sbjct  74   VPCGTSGGVMIYFDRIEVVNYLISSAVYDIVKNYTADYDKALIFNKIHHELNQFCSVHNL  133

Query  574  QQVYIDMFDQIDE  612
            Q+VYI++FDQIDE
Sbjct  134  QEVYIELFDQIDE  146



>gb|AAH05950.1| ERLIN2 protein, partial [Homo sapiens]
Length=347

 Score =   187 bits (476),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 81/146 (55%), Positives = 110/146 (75%), Gaps = 0/146 (0%)
 Frame = +1

Query  175  LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFE  354
            ++ +   V V +     + FS +H++ EGH+GVY+RGGALL++ + PGFHL LPFIT ++
Sbjct  1    MAQLGAVVAVASSFFCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGFHLMLPFITSYK  60

Query  355  PIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKI  534
            P+Q TLQTD V+++PCGT GGVMI F++IEVVN L    VYD + NY   YD   I++KI
Sbjct  61   PVQTTLQTDEVKNVPCGTSGGVMIYFDRIEVVNFLVPNAVYDIVKNYTADYDKALIFNKI  120

Query  535  HHEINQFCSGHSLQQVYIDMFDQIDE  612
            HHE+NQFCS H+LQ+VYI++FDQIDE
Sbjct  121  HHELNQFCSVHTLQEVYIELFDQIDE  146



>ref|XP_010602982.1| PREDICTED: erlin-2 isoform X2 [Fukomys damarensis]
 gb|KFO37062.1| Erlin-2 [Fukomys damarensis]
Length=369

 Score =   188 bits (477),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 82/147 (56%), Positives = 110/147 (75%), Gaps = 0/147 (0%)
 Frame = +1

Query  172  FLSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHF  351
             ++ +   V V +  L  + FS +H++ EGH+GVY+RGGALL++ + PGFHL LPFIT F
Sbjct  30   LMAQLGAVVAVASSFLCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGFHLMLPFITSF  89

Query  352  EPIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDK  531
            + +Q TLQTD V+++PCGT GGVMI F++IEVVN L    VYD + NY   YD   I++K
Sbjct  90   KSVQTTLQTDEVKNVPCGTSGGVMIYFDRIEVVNFLVPNAVYDIVKNYTADYDKALIFNK  149

Query  532  IHHEINQFCSGHSLQQVYIDMFDQIDE  612
            IHHE+NQFCS H+LQ+VYI++FDQIDE
Sbjct  150  IHHELNQFCSVHTLQEVYIELFDQIDE  176



>ref|XP_002720834.1| PREDICTED: erlin-2 [Oryctolagus cuniculus]
 ref|XP_008272221.1| PREDICTED: erlin-2 [Oryctolagus cuniculus]
Length=339

 Score =   186 bits (473),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 81/146 (55%), Positives = 110/146 (75%), Gaps = 0/146 (0%)
 Frame = +1

Query  175  LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFE  354
            ++ +   V V +  L  + FS +H++ EGH+GVY+RGGALL++ + PGFHL LPFIT ++
Sbjct  1    MAQLGAVVAVASSFLCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGFHLMLPFITSYK  60

Query  355  PIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKI  534
             +Q TLQTD V+++PCGT GGVMI F++IEVVN L    VYD + NY   YD   I++KI
Sbjct  61   SVQTTLQTDEVKNVPCGTSGGVMIYFDRIEVVNFLVPNAVYDIVKNYTADYDKALIFNKI  120

Query  535  HHEINQFCSGHSLQQVYIDMFDQIDE  612
            HHE+NQFCS H+LQ+VYI++FDQIDE
Sbjct  121  HHELNQFCSVHTLQEVYIELFDQIDE  146



>ref|XP_009045292.1| hypothetical protein LOTGIDRAFT_211937 [Lottia gigantea]
 gb|ESP03810.1| hypothetical protein LOTGIDRAFT_211937 [Lottia gigantea]
Length=323

 Score =   186 bits (472),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 79/125 (63%), Positives = 103/125 (82%), Gaps = 0/125 (0%)
 Frame = +1

Query  238  TLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFEPIQVTLQTDLVRDIPCGTKGG  417
            ++H++ EGHVGVY+RGGALLS+ + PG+H  LPF+T F  +Q TLQTD V+++PCGT GG
Sbjct  23   SIHKIEEGHVGVYYRGGALLSSTSEPGYHFMLPFLTTFRSVQTTLQTDEVKNVPCGTSGG  82

Query  418  VMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKIHHEINQFCSGHSLQQVYIDMF  597
            V+I FE+IEVVN+L +  VY+T+ NY   YD T IY+KIHHE+NQFCS H+LQ+VYID+F
Sbjct  83   VIIYFERIEVVNKLDRAIVYETVRNYTADYDKTLIYNKIHHELNQFCSVHNLQEVYIDLF  142

Query  598  DQIDE  612
            DQIDE
Sbjct  143  DQIDE  147



>ref|NP_001244470.1| erlin-2 precursor [Macaca mulatta]
 ref|XP_007960362.1| PREDICTED: erlin-2 isoform X2 [Chlorocebus sabaeus]
 ref|XP_003902691.2| PREDICTED: erlin-2 [Papio anubis]
 ref|XP_009211141.1| PREDICTED: erlin-2 [Papio anubis]
 ref|XP_009211142.1| PREDICTED: erlin-2 [Papio anubis]
 ref|XP_009211143.1| PREDICTED: erlin-2 [Papio anubis]
 ref|XP_010383609.1| PREDICTED: erlin-2 isoform X1 [Rhinopithecus roxellana]
 gb|EHH28411.1| Endoplasmic reticulum lipid raft-associated protein 2 [Macaca 
mulatta]
 gb|EHH64102.1| Endoplasmic reticulum lipid raft-associated protein 2 [Macaca 
fascicularis]
Length=339

 Score =   186 bits (472),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 81/146 (55%), Positives = 110/146 (75%), Gaps = 0/146 (0%)
 Frame = +1

Query  175  LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFE  354
            ++ +   V V +  L  + FS +H++ EGH+GVY+RGGALL++ + PGFHL LPFIT ++
Sbjct  1    MAQLGAVVAVASSFLCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGFHLMLPFITSYK  60

Query  355  PIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKI  534
             +Q TLQTD V+++PCGT GGVMI F++IEVVN L    VYD + NY   YD   I++KI
Sbjct  61   SVQTTLQTDEVKNVPCGTSGGVMIYFDRIEVVNFLVPNAVYDIVKNYTADYDKALIFNKI  120

Query  535  HHEINQFCSGHSLQQVYIDMFDQIDE  612
            HHE+NQFCS H+LQ+VYI++FDQIDE
Sbjct  121  HHELNQFCSVHTLQEVYIELFDQIDE  146



>ref|XP_011270124.1| hypothetical protein CAOG_08542 [Capsaspora owczarzaki ATCC 30864]
 gb|KJE90410.1| hypothetical protein CAOG_008542 [Capsaspora owczarzaki ATCC 
30864]
Length=324

 Score =   186 bits (471),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 85/147 (58%), Positives = 109/147 (74%), Gaps = 8/147 (5%)
 Frame = +1

Query  172  FLSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHF  351
             +  +AI +M++         +++H+V EGHVG+Y RGGALL   T PG+H+ LPFIT  
Sbjct  7    LIGLLAIAIMLIN--------ASIHRVEEGHVGIYKRGGALLKETTAPGYHVMLPFITTH  58

Query  352  EPIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDK  531
              IQVTLQTD VRD+PCGT GGV+I FE++EVVN L +  VYDT+ NY V YD   I++K
Sbjct  59   HDIQVTLQTDEVRDVPCGTSGGVIITFERVEVVNMLDQRFVYDTVKNYTVDYDKLLIFNK  118

Query  532  IHHEINQFCSGHSLQQVYIDMFDQIDE  612
            IHHEIN+FCS H+LQ+VYIDMFD+IDE
Sbjct  119  IHHEINEFCSSHTLQEVYIDMFDRIDE  145



>ref|XP_004884322.1| PREDICTED: erlin-2 [Heterocephalus glaber]
 ref|XP_004855445.1| PREDICTED: erlin-2 [Heterocephalus glaber]
 gb|EHB02707.1| Erlin-2 [Heterocephalus glaber]
Length=339

 Score =   186 bits (472),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 81/146 (55%), Positives = 110/146 (75%), Gaps = 0/146 (0%)
 Frame = +1

Query  175  LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFE  354
            ++ +   V V +  L  + FS +H++ EGH+GVY+RGGALL++ + PGFHL LPFIT ++
Sbjct  1    MAQLGAVVAVASSFLCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGFHLMLPFITSYK  60

Query  355  PIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKI  534
             +Q TLQTD V+++PCGT GGVMI F++IEVVN L    VYD + NY   YD   I++KI
Sbjct  61   SVQTTLQTDEVKNVPCGTSGGVMIYFDRIEVVNFLVPNAVYDIVKNYTADYDKALIFNKI  120

Query  535  HHEINQFCSGHSLQQVYIDMFDQIDE  612
            HHE+NQFCS H+LQ+VYI++FDQIDE
Sbjct  121  HHELNQFCSVHTLQEVYIELFDQIDE  146



>ref|XP_007516752.1| PREDICTED: erlin-2 [Erinaceus europaeus]
Length=339

 Score =   186 bits (472),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 81/146 (55%), Positives = 110/146 (75%), Gaps = 0/146 (0%)
 Frame = +1

Query  175  LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFE  354
            ++ +   V V    L  + FS++H++ EGH+GVY+RGGALL++ + PGFHL LPFIT ++
Sbjct  1    MAQLGAVVAVAASFLCASLFSSVHKIEEGHIGVYYRGGALLTSTSGPGFHLMLPFITSYK  60

Query  355  PIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKI  534
             +Q TLQTD V+++PCGT GGVMI F++IEVVN L    VYD + NY   YD   I++KI
Sbjct  61   SVQTTLQTDEVKNVPCGTSGGVMIYFDRIEVVNFLVPNAVYDIVKNYTADYDKALIFNKI  120

Query  535  HHEINQFCSGHSLQQVYIDMFDQIDE  612
            HHE+NQFCS H+LQ+VYI++FDQIDE
Sbjct  121  HHELNQFCSVHTLQEVYIELFDQIDE  146



>ref|XP_006896709.1| PREDICTED: erlin-2 [Elephantulus edwardii]
Length=339

 Score =   186 bits (471),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 81/146 (55%), Positives = 109/146 (75%), Gaps = 0/146 (0%)
 Frame = +1

Query  175  LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFE  354
            ++ +   V V    L  + FS +H++ EGH+GVY+RGGALL++ + PGFHL LPFIT ++
Sbjct  1    MAQLGAVVAVAASFLCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGFHLMLPFITSYK  60

Query  355  PIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKI  534
             +Q TLQTD V+++PCGT GGVMI F++IEVVN L    VYD + NY   YD   I++KI
Sbjct  61   SVQTTLQTDEVKNVPCGTSGGVMIYFDRIEVVNFLVPNAVYDIVKNYTADYDKALIFNKI  120

Query  535  HHEINQFCSGHSLQQVYIDMFDQIDE  612
            HHE+NQFCS H+LQ+VYI++FDQIDE
Sbjct  121  HHELNQFCSVHTLQEVYIELFDQIDE  146



>ref|XP_003938158.1| PREDICTED: erlin-2 isoform X2 [Saimiri boliviensis boliviensis]
 ref|XP_010346996.1| PREDICTED: erlin-2 isoform X2 [Saimiri boliviensis boliviensis]
 ref|XP_010346997.1| PREDICTED: erlin-2 isoform X2 [Saimiri boliviensis boliviensis]
Length=339

 Score =   186 bits (471),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 81/146 (55%), Positives = 110/146 (75%), Gaps = 0/146 (0%)
 Frame = +1

Query  175  LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFE  354
            ++ +   V VV+     + FS +H++ EGH+GVY+RGGALL++ + PGFHL LPFIT ++
Sbjct  1    MAQLGAAVAVVSSFFCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGFHLMLPFITSYK  60

Query  355  PIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKI  534
             +Q TLQTD V+++PCGT GGVMI F++IEVVN L    VYD + NY   YD   I++KI
Sbjct  61   SVQTTLQTDEVKNVPCGTSGGVMIYFDRIEVVNFLVPNAVYDIVKNYTADYDKALIFNKI  120

Query  535  HHEINQFCSGHSLQQVYIDMFDQIDE  612
            HHE+NQFCS H+LQ+VYI++FDQIDE
Sbjct  121  HHELNQFCSVHTLQEVYIELFDQIDE  146



>ref|XP_002756994.1| PREDICTED: erlin-2 [Callithrix jacchus]
 ref|XP_008977566.1| PREDICTED: erlin-2 [Callithrix jacchus]
 ref|XP_008977568.1| PREDICTED: erlin-2 [Callithrix jacchus]
Length=339

 Score =   186 bits (471),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 81/146 (55%), Positives = 110/146 (75%), Gaps = 0/146 (0%)
 Frame = +1

Query  175  LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFE  354
            ++ +   V VV+     + FS +H++ EGH+GVY+RGGALL++ + PGFHL LPFIT ++
Sbjct  1    MAQLGAVVAVVSSFFCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGFHLMLPFITSYK  60

Query  355  PIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKI  534
             +Q TLQTD V+++PCGT GGVMI F++IEVVN L    VYD + NY   YD   I++KI
Sbjct  61   SVQTTLQTDEVKNVPCGTSGGVMIYFDRIEVVNFLVPNAVYDIVKNYTADYDKALIFNKI  120

Query  535  HHEINQFCSGHSLQQVYIDMFDQIDE  612
            HHE+NQFCS H+LQ+VYI++FDQIDE
Sbjct  121  HHELNQFCSVHTLQEVYIELFDQIDE  146



>emb|CDS31008.1| erlin 2 [Hymenolepis microstoma]
Length=725

 Score =   192 bits (488),  Expect = 2e-53, Method: Composition-based stats.
 Identities = 87/146 (60%), Positives = 112/146 (77%), Gaps = 4/146 (3%)
 Frame = +1

Query  175  LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFE  354
            LS+ A  V++   LLS    S++H++ EGHVGVY+RGGALL   + PGFHL +PFIT ++
Sbjct  341  LSYFAGAVVIWALLLS----SSVHKIEEGHVGVYYRGGALLKDTSAPGFHLMIPFITTYK  396

Query  355  PIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKI  534
             +QVTLQTD V ++PCGT GGV+I F++IEVVN L  +H YD + NY   YD T IY+K+
Sbjct  397  EVQVTLQTDEVTNVPCGTSGGVVIYFDRIEVVNLLSADHAYDIVKNYSPDYDKTLIYNKV  456

Query  535  HHEINQFCSGHSLQQVYIDMFDQIDE  612
            HHE+NQFCS HSLQ+VYID+FDQIDE
Sbjct  457  HHELNQFCSSHSLQEVYIDLFDQIDE  482



>ref|XP_010602989.1| PREDICTED: erlin-2 isoform X3 [Fukomys damarensis]
Length=360

 Score =   186 bits (472),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 82/146 (56%), Positives = 110/146 (75%), Gaps = 0/146 (0%)
 Frame = +1

Query  175  LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFE  354
            ++ +   V V +  L  + FS +H++ EGH+GVY+RGGALL++ + PGFHL LPFIT F+
Sbjct  1    MAQLGAVVAVASSFLCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGFHLMLPFITSFK  60

Query  355  PIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKI  534
             +Q TLQTD V+++PCGT GGVMI F++IEVVN L    VYD + NY   YD   I++KI
Sbjct  61   SVQTTLQTDEVKNVPCGTSGGVMIYFDRIEVVNFLVPNAVYDIVKNYTADYDKALIFNKI  120

Query  535  HHEINQFCSGHSLQQVYIDMFDQIDE  612
            HHE+NQFCS H+LQ+VYI++FDQIDE
Sbjct  121  HHELNQFCSVHTLQEVYIELFDQIDE  146



>ref|XP_010602975.1| PREDICTED: erlin-2 isoform X1 [Fukomys damarensis]
Length=390

 Score =   187 bits (474),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 82/147 (56%), Positives = 110/147 (75%), Gaps = 0/147 (0%)
 Frame = +1

Query  172  FLSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHF  351
             ++ +   V V +  L  + FS +H++ EGH+GVY+RGGALL++ + PGFHL LPFIT F
Sbjct  30   LMAQLGAVVAVASSFLCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGFHLMLPFITSF  89

Query  352  EPIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDK  531
            + +Q TLQTD V+++PCGT GGVMI F++IEVVN L    VYD + NY   YD   I++K
Sbjct  90   KSVQTTLQTDEVKNVPCGTSGGVMIYFDRIEVVNFLVPNAVYDIVKNYTADYDKALIFNK  149

Query  532  IHHEINQFCSGHSLQQVYIDMFDQIDE  612
            IHHE+NQFCS H+LQ+VYI++FDQIDE
Sbjct  150  IHHELNQFCSVHTLQEVYIELFDQIDE  176



>ref|XP_005563111.1| PREDICTED: erlin-2 [Macaca fascicularis]
Length=380

 Score =   186 bits (473),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 81/147 (55%), Positives = 110/147 (75%), Gaps = 0/147 (0%)
 Frame = +1

Query  172  FLSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHF  351
             ++ +   V V +  L  + FS +H++ EGH+GVY+RGGALL++ + PGFHL LPFIT +
Sbjct  41   LMAQLGAVVAVASSFLCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGFHLMLPFITSY  100

Query  352  EPIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDK  531
            + +Q TLQTD V+++PCGT GGVMI F++IEVVN L    VYD + NY   YD   I++K
Sbjct  101  KSVQTTLQTDEVKNVPCGTSGGVMIYFDRIEVVNFLVPNAVYDIVKNYTADYDKALIFNK  160

Query  532  IHHEINQFCSGHSLQQVYIDMFDQIDE  612
            IHHE+NQFCS H+LQ+VYI++FDQIDE
Sbjct  161  IHHELNQFCSVHTLQEVYIELFDQIDE  187



>emb|CDQ73083.1| unnamed protein product [Oncorhynchus mykiss]
Length=330

 Score =   185 bits (469),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 79/127 (62%), Positives = 103/127 (81%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  FSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFEPIQVTLQTDLVRDIPCGTK  411
            FS++H++ EGH GVY+RGGALL+T ++PGFHL +PFITHF+ +Q TLQTD V+++PCGT 
Sbjct  20   FSSVHKIEEGHTGVYYRGGALLTTTSSPGFHLMMPFITHFKSVQTTLQTDEVKNVPCGTG  79

Query  412  GGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKIHHEINQFCSGHSLQQVYID  591
            GGVMI F++IEVVN L    VYD + N+   YD   I++K+HHE+NQFCS HSLQ+VYI 
Sbjct  80   GGVMIYFDRIEVVNYLVPSAVYDIVKNFTADYDKALIFNKVHHELNQFCSVHSLQEVYIG  139

Query  592  MFDQIDE  612
            +FDQIDE
Sbjct  140  LFDQIDE  146



>ref|NP_001016719.1| erlin-2 precursor [Xenopus (Silurana) tropicalis]
 sp|Q28J34.1|ERLN2_XENTR RecName: Full=Erlin-2; AltName: Full=Endoplasmic reticulum lipid 
raft-associated protein 2; AltName: Full=Stomatin-prohibitin-flotillin-HflC/K 
domain-containing protein 2; Short=SPFH 
domain-containing protein 2 [Xenopus (Silurana) tropicalis]
 emb|CAJ82623.1| SPFH domain family, member 2 [Xenopus (Silurana) tropicalis]
 gb|AAI58954.1| hypothetical protein LOC549473 [Xenopus (Silurana) tropicalis]
Length=335

 Score =   185 bits (469),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 81/133 (61%), Positives = 106/133 (80%), Gaps = 0/133 (0%)
 Frame = +1

Query  214  LLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFEPIQVTLQTDLVRD  393
            L++   FS +H++ EGHVGVY+RGGALL++ + PGFHL LPFIT F+ +Q T+QTD V++
Sbjct  14   LIAAALFSAIHKIEEGHVGVYYRGGALLTSTSGPGFHLMLPFITSFKSVQSTMQTDEVKN  73

Query  394  IPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKIHHEINQFCSGHSL  573
            +PCGT GGVMI F++IEVVN L    VYD + NY   YD T I++KIHHE+NQFCS H+L
Sbjct  74   VPCGTSGGVMIYFDRIEVVNYLIPSAVYDIVKNYTADYDKTLIFNKIHHELNQFCSVHNL  133

Query  574  QQVYIDMFDQIDE  612
            Q+VYI++FDQIDE
Sbjct  134  QEVYIELFDQIDE  146



>ref|XP_007933159.1| PREDICTED: erlin-2 [Orycteropus afer afer]
Length=339

 Score =   185 bits (470),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 81/146 (55%), Positives = 109/146 (75%), Gaps = 0/146 (0%)
 Frame = +1

Query  175  LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFE  354
            ++ +   V VV      + FS +H++ EGH+GVY+RGGALL++ + PGFHL LPFIT ++
Sbjct  1    MAQLGAVVAVVASFFCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGFHLMLPFITSYK  60

Query  355  PIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKI  534
             +Q TLQTD V+++PCGT GGVMI F++IEVVN L    VYD + NY   YD   I++KI
Sbjct  61   SVQTTLQTDEVKNVPCGTSGGVMIYFDRIEVVNFLVPNAVYDIVKNYTADYDKALIFNKI  120

Query  535  HHEINQFCSGHSLQQVYIDMFDQIDE  612
            HHE+NQFCS H+LQ+VYI++FDQIDE
Sbjct  121  HHELNQFCSVHTLQEVYIELFDQIDE  146



>ref|XP_848949.1| PREDICTED: erlin-2 isoformX4 [Canis lupus familiaris]
 ref|XP_005629928.1| PREDICTED: erlin-2 isoform X6 [Canis lupus familiaris]
 ref|XP_005629929.1| PREDICTED: erlin-2 isoform X7 [Canis lupus familiaris]
 ref|XP_005629930.1| PREDICTED: erlin-2 isoform X8 [Canis lupus familiaris]
 ref|XP_005629931.1| PREDICTED: erlin-2 isoform X9 [Canis lupus familiaris]
Length=337

 Score =   185 bits (470),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 81/146 (55%), Positives = 109/146 (75%), Gaps = 0/146 (0%)
 Frame = +1

Query  175  LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFE  354
            ++ +   V V T     + FS +H++ EGH+GVY+RGGALL++ + PGFHL LPFIT ++
Sbjct  1    MAQLGAVVAVATSFFCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGFHLMLPFITSYK  60

Query  355  PIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKI  534
             +Q TLQTD V+++PCGT GGVMI F++IEVVN L    VYD + NY   YD   I++KI
Sbjct  61   SVQTTLQTDEVKNVPCGTSGGVMIYFDRIEVVNFLVPNAVYDIVKNYTADYDKALIFNKI  120

Query  535  HHEINQFCSGHSLQQVYIDMFDQIDE  612
            HHE+NQFCS H+LQ+VYI++FDQIDE
Sbjct  121  HHELNQFCSVHTLQEVYIELFDQIDE  146



>ref|XP_003738176.1| PREDICTED: erlin-2-B-like [Metaseiulus occidentalis]
Length=329

 Score =   185 bits (469),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 78/125 (62%), Positives = 103/125 (82%), Gaps = 0/125 (0%)
 Frame = +1

Query  238  TLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFEPIQVTLQTDLVRDIPCGTKGG  417
            + H++ EGH+GVY+RGGALL T++ PGFHL +PFIT F  IQ+T+QTD V+++PCGT GG
Sbjct  22   SFHRIEEGHMGVYYRGGALLKTLSNPGFHLMIPFITTFRSIQITMQTDEVKNVPCGTSGG  81

Query  418  VMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKIHHEINQFCSGHSLQQVYIDMF  597
            VMI F++IEVVN L +E VY+ + NY   YD T I++K+HHE+NQFCS H+LQ+VYID+F
Sbjct  82   VMIYFDRIEVVNVLARESVYEIVKNYTADYDKTLIFNKVHHELNQFCSRHNLQEVYIDLF  141

Query  598  DQIDE  612
            DQIDE
Sbjct  142  DQIDE  146



>ref|XP_007960361.1| PREDICTED: erlin-2 isoform X1 [Chlorocebus sabaeus]
Length=380

 Score =   186 bits (472),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 81/147 (55%), Positives = 110/147 (75%), Gaps = 0/147 (0%)
 Frame = +1

Query  172  FLSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHF  351
             ++ +   V V +  L  + FS +H++ EGH+GVY+RGGALL++ + PGFHL LPFIT +
Sbjct  41   LMAQLGAVVAVASSFLCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGFHLMLPFITSY  100

Query  352  EPIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDK  531
            + +Q TLQTD V+++PCGT GGVMI F++IEVVN L    VYD + NY   YD   I++K
Sbjct  101  KSVQTTLQTDEVKNVPCGTSGGVMIYFDRIEVVNFLVPNAVYDIVKNYTADYDKALIFNK  160

Query  532  IHHEINQFCSGHSLQQVYIDMFDQIDE  612
            IHHE+NQFCS H+LQ+VYI++FDQIDE
Sbjct  161  IHHELNQFCSVHTLQEVYIELFDQIDE  187



>ref|XP_004394468.1| PREDICTED: erlin-2 [Odobenus rosmarus divergens]
Length=337

 Score =   185 bits (469),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 81/146 (55%), Positives = 109/146 (75%), Gaps = 0/146 (0%)
 Frame = +1

Query  175  LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFE  354
            ++ +   V V T     + FS +H++ EGH+GVY+RGGALL++ + PGFHL LPFIT ++
Sbjct  1    MAQLGAVVAVATSFFCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGFHLMLPFITSYK  60

Query  355  PIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKI  534
             +Q TLQTD V+++PCGT GGVMI F++IEVVN L    VYD + NY   YD   I++KI
Sbjct  61   SVQTTLQTDEVKNVPCGTSGGVMIYFDRIEVVNFLVPNAVYDIVKNYTADYDKALIFNKI  120

Query  535  HHEINQFCSGHSLQQVYIDMFDQIDE  612
            HHE+NQFCS H+LQ+VYI++FDQIDE
Sbjct  121  HHELNQFCSVHTLQEVYIELFDQIDE  146



>ref|XP_004598559.1| PREDICTED: erlin-2 [Ochotona princeps]
Length=339

 Score =   185 bits (469),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 81/146 (55%), Positives = 110/146 (75%), Gaps = 0/146 (0%)
 Frame = +1

Query  175  LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFE  354
            ++ +   V VV+     + FS +H++ EGH+GVY+RGGALL++ + PGFHL LPFIT ++
Sbjct  1    MAQLGAVVAVVSSFFCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGFHLMLPFITSYK  60

Query  355  PIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKI  534
             +Q TLQTD V+++PCGT GGVMI F++IEVVN L    VYD + NY   YD   I++KI
Sbjct  61   SVQTTLQTDEVKNVPCGTSGGVMIYFDRIEVVNFLIPNAVYDIVKNYTADYDKALIFNKI  120

Query  535  HHEINQFCSGHSLQQVYIDMFDQIDE  612
            HHE+NQFCS H+LQ+VYI++FDQIDE
Sbjct  121  HHELNQFCSVHTLQEVYIELFDQIDE  146



>ref|XP_001493841.1| PREDICTED: erlin-2 isoform X1 [Equus caballus]
 ref|XP_005606388.1| PREDICTED: erlin-2 isoform X2 [Equus caballus]
 ref|XP_008521772.1| PREDICTED: erlin-2 [Equus przewalskii]
 ref|XP_008521773.1| PREDICTED: erlin-2 [Equus przewalskii]
Length=339

 Score =   185 bits (469),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 81/146 (55%), Positives = 109/146 (75%), Gaps = 0/146 (0%)
 Frame = +1

Query  175  LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFE  354
            ++ +   V V T     + FS +H++ EGH+GVY+RGGALL++ + PGFHL LPFIT ++
Sbjct  1    MAQLGAIVAVATSFFCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGFHLMLPFITSYK  60

Query  355  PIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKI  534
             +Q TLQTD V+++PCGT GGVMI F++IEVVN L    VYD + NY   YD   I++KI
Sbjct  61   SVQTTLQTDEVKNVPCGTSGGVMIYFDRIEVVNFLVPNAVYDIVKNYTADYDKALIFNKI  120

Query  535  HHEINQFCSGHSLQQVYIDMFDQIDE  612
            HHE+NQFCS H+LQ+VYI++FDQIDE
Sbjct  121  HHELNQFCSVHTLQEVYIELFDQIDE  146



>ref|XP_004758310.1| PREDICTED: erlin-2 isoform X1 [Mustela putorius furo]
 ref|XP_004758311.1| PREDICTED: erlin-2 isoform X2 [Mustela putorius furo]
 ref|XP_004758312.1| PREDICTED: erlin-2 isoform X3 [Mustela putorius furo]
 ref|XP_004758313.1| PREDICTED: erlin-2 isoform X4 [Mustela putorius furo]
 ref|XP_004758314.1| PREDICTED: erlin-2 isoform X5 [Mustela putorius furo]
 ref|XP_004806140.1| PREDICTED: erlin-2 isoform X1 [Mustela putorius furo]
 ref|XP_004806141.1| PREDICTED: erlin-2 isoform X2 [Mustela putorius furo]
 ref|XP_004806142.1| PREDICTED: erlin-2 isoform X3 [Mustela putorius furo]
 ref|XP_004806143.1| PREDICTED: erlin-2 isoform X4 [Mustela putorius furo]
 ref|XP_004806144.1| PREDICTED: erlin-2 isoform X5 [Mustela putorius furo]
Length=337

 Score =   185 bits (469),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 81/146 (55%), Positives = 109/146 (75%), Gaps = 0/146 (0%)
 Frame = +1

Query  175  LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFE  354
            ++ +   V V T     + FS +H++ EGH+GVY+RGGALL++ + PGFHL LPFIT ++
Sbjct  1    MAQLGAVVAVATSFFCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGFHLMLPFITSYK  60

Query  355  PIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKI  534
             +Q TLQTD V+++PCGT GGVMI F++IEVVN L    VYD + NY   YD   I++KI
Sbjct  61   SVQTTLQTDEVKNVPCGTSGGVMIYFDRIEVVNFLVPNAVYDIVKNYTADYDKALIFNKI  120

Query  535  HHEINQFCSGHSLQQVYIDMFDQIDE  612
            HHE+NQFCS H+LQ+VYI++FDQIDE
Sbjct  121  HHELNQFCSVHTLQEVYIELFDQIDE  146



>ref|XP_006263967.1| PREDICTED: erlin-2-like isoform X2 [Alligator mississippiensis]
Length=335

 Score =   185 bits (469),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 80/146 (55%), Positives = 109/146 (75%), Gaps = 0/146 (0%)
 Frame = +1

Query  175  LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFE  354
            ++ +     V    ++   FS +H++ EGH+GVY+RGGALL++ + PGFHL LPFIT F+
Sbjct  1    MAQLGAIAAVTVSFVAAAFFSAIHKIEEGHIGVYYRGGALLTSTSGPGFHLMLPFITSFK  60

Query  355  PIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKI  534
             +Q TLQTD V+++PCGT GGVMI F++IEVVN L +  VYD + NY   YD   I++KI
Sbjct  61   SVQTTLQTDEVKNVPCGTSGGVMIYFDRIEVVNFLIQNAVYDIVKNYTADYDKALIFNKI  120

Query  535  HHEINQFCSGHSLQQVYIDMFDQIDE  612
            HHE+NQFCS H+LQ+VYI++FDQIDE
Sbjct  121  HHELNQFCSVHTLQEVYIELFDQIDE  146



>ref|XP_002917270.1| PREDICTED: erlin-2 [Ailuropoda melanoleuca]
 gb|EFB22472.1| hypothetical protein PANDA_005478 [Ailuropoda melanoleuca]
Length=337

 Score =   185 bits (469),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 81/146 (55%), Positives = 109/146 (75%), Gaps = 0/146 (0%)
 Frame = +1

Query  175  LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFE  354
            ++ +   V V T     + FS +H++ EGH+GVY+RGGALL++ + PGFHL LPFIT ++
Sbjct  1    MAQLGAVVAVATSFFCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGFHLMLPFITSYK  60

Query  355  PIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKI  534
             +Q TLQTD V+++PCGT GGVMI F++IEVVN L    VYD + NY   YD   I++KI
Sbjct  61   SVQTTLQTDEVKNVPCGTSGGVMIYFDRIEVVNFLVPNAVYDIVKNYTADYDKALIFNKI  120

Query  535  HHEINQFCSGHSLQQVYIDMFDQIDE  612
            HHE+NQFCS H+LQ+VYI++FDQIDE
Sbjct  121  HHELNQFCSVHTLQEVYIELFDQIDE  146



>ref|XP_008144402.1| PREDICTED: erlin-2 isoform X1 [Eptesicus fuscus]
Length=339

 Score =   185 bits (469),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 81/146 (55%), Positives = 108/146 (74%), Gaps = 0/146 (0%)
 Frame = +1

Query  175  LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFE  354
            ++ +   V V T       FS +H++ EGH+GVY+RGGALL++ + PGFHL LPFIT ++
Sbjct  1    MAQLGAVVAVATSFFCAALFSAVHKIEEGHIGVYYRGGALLTSTSGPGFHLMLPFITSYK  60

Query  355  PIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKI  534
             +Q TLQTD V+++PCGT GGVMI F++IEVVN L    VYD + NY   YD   I++KI
Sbjct  61   SVQTTLQTDEVKNVPCGTSGGVMIYFDRIEVVNFLVPSAVYDIVKNYTADYDKALIFNKI  120

Query  535  HHEINQFCSGHSLQQVYIDMFDQIDE  612
            HHE+NQFCS H+LQ+VYI++FDQIDE
Sbjct  121  HHELNQFCSVHTLQEVYIELFDQIDE  146



>ref|XP_005856473.1| PREDICTED: erlin-2 isoform X1 [Myotis brandtii]
 ref|XP_005856474.1| PREDICTED: erlin-2 isoform X2 [Myotis brandtii]
 ref|XP_006086286.1| PREDICTED: erlin-2 isoform X1 [Myotis lucifugus]
 ref|XP_006086287.1| PREDICTED: erlin-2 isoform X2 [Myotis lucifugus]
Length=339

 Score =   185 bits (469),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 81/146 (55%), Positives = 108/146 (74%), Gaps = 0/146 (0%)
 Frame = +1

Query  175  LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFE  354
            ++ +   V V T       FS +H++ EGH+GVY+RGGALL++ + PGFHL LPFIT ++
Sbjct  1    MAQLGAVVAVATSFFCAALFSAVHKIEEGHIGVYYRGGALLTSTSGPGFHLMLPFITSYK  60

Query  355  PIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKI  534
             +Q TLQTD V+++PCGT GGVMI F++IEVVN L    VYD + NY   YD   I++KI
Sbjct  61   SVQTTLQTDEVKNVPCGTSGGVMIYFDRIEVVNFLVPSAVYDIVKNYTADYDKALIFNKI  120

Query  535  HHEINQFCSGHSLQQVYIDMFDQIDE  612
            HHE+NQFCS H+LQ+VYI++FDQIDE
Sbjct  121  HHELNQFCSVHTLQEVYIELFDQIDE  146



>ref|XP_005629927.1| PREDICTED: erlin-2 isoform X5 [Canis lupus familiaris]
Length=353

 Score =   185 bits (470),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 81/147 (55%), Positives = 109/147 (74%), Gaps = 0/147 (0%)
 Frame = +1

Query  172  FLSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHF  351
             ++ +   V V T     + FS +H++ EGH+GVY+RGGALL++ + PGFHL LPFIT +
Sbjct  16   LMAQLGAVVAVATSFFCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGFHLMLPFITSY  75

Query  352  EPIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDK  531
            + +Q TLQTD V+++PCGT GGVMI F++IEVVN L    VYD + NY   YD   I++K
Sbjct  76   KSVQTTLQTDEVKNVPCGTSGGVMIYFDRIEVVNFLVPNAVYDIVKNYTADYDKALIFNK  135

Query  532  IHHEINQFCSGHSLQQVYIDMFDQIDE  612
            IHHE+NQFCS H+LQ+VYI++FDQIDE
Sbjct  136  IHHELNQFCSVHTLQEVYIELFDQIDE  162



>ref|XP_004637321.1| PREDICTED: erlin-2 [Octodon degus]
Length=339

 Score =   185 bits (469),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 81/146 (55%), Positives = 109/146 (75%), Gaps = 0/146 (0%)
 Frame = +1

Query  175  LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFE  354
            ++ +   V V +  L    FS +H++ EGH+GVY+RGGALL++ + PGFHL LPFIT ++
Sbjct  1    MAQLGAVVAVASSFLCACLFSAVHKIEEGHIGVYYRGGALLTSTSGPGFHLMLPFITSYK  60

Query  355  PIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKI  534
             +Q TLQTD V+++PCGT GGVMI F++IEVVN L    VYD + NY   YD   I++KI
Sbjct  61   SVQTTLQTDEVKNVPCGTSGGVMIYFDRIEVVNFLVPNAVYDIVKNYTADYDKALIFNKI  120

Query  535  HHEINQFCSGHSLQQVYIDMFDQIDE  612
            HHE+NQFCS H+LQ+VYI++FDQIDE
Sbjct  121  HHELNQFCSVHTLQEVYIELFDQIDE  146



>ref|XP_008684811.1| PREDICTED: erlin-2 isoform X2 [Ursus maritimus]
Length=337

 Score =   184 bits (468),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 81/146 (55%), Positives = 109/146 (75%), Gaps = 0/146 (0%)
 Frame = +1

Query  175  LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFE  354
            ++ +   V V T     + FS +H++ EGH+GVY+RGGALL++ + PGFHL LPFIT ++
Sbjct  1    MAQLGAVVAVATSFFCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGFHLMLPFITSYK  60

Query  355  PIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKI  534
             +Q TLQTD V+++PCGT GGVMI F++IEVVN L    VYD + NY   YD   I++KI
Sbjct  61   SVQTTLQTDEVKNVPCGTSGGVMIYFDRIEVVNFLVPNAVYDIVKNYTADYDKALIFNKI  120

Query  535  HHEINQFCSGHSLQQVYIDMFDQIDE  612
            HHE+NQFCS H+LQ+VYI++FDQIDE
Sbjct  121  HHELNQFCSVHTLQEVYIELFDQIDE  146



>ref|XP_005398468.1| PREDICTED: erlin-2 isoform X2 [Chinchilla lanigera]
Length=339

 Score =   184 bits (468),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 80/146 (55%), Positives = 110/146 (75%), Gaps = 0/146 (0%)
 Frame = +1

Query  175  LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFE  354
            ++ +   + V +  L  + FS +H++ EGH+GVY+RGGALL++ + PGFHL LPFIT ++
Sbjct  1    MAQLGAVLAVASSFLCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGFHLMLPFITSYK  60

Query  355  PIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKI  534
             +Q TLQTD V+++PCGT GGVMI F++IEVVN L    VYD + NY   YD   I++KI
Sbjct  61   SVQTTLQTDEVKNVPCGTSGGVMIYFDRIEVVNFLVPNAVYDIVKNYTADYDKALIFNKI  120

Query  535  HHEINQFCSGHSLQQVYIDMFDQIDE  612
            HHE+NQFCS H+LQ+VYI++FDQIDE
Sbjct  121  HHELNQFCSVHTLQEVYIELFDQIDE  146



>ref|NP_001088269.1| erlin-2-A precursor [Xenopus laevis]
 sp|Q5XH03.1|ERL2A_XENLA RecName: Full=Erlin-2-A; AltName: Full=Endoplasmic reticulum 
lipid raft-associated protein 2-A; AltName: Full=Stomatin-prohibitin-flotillin-HflC/K 
domain-containing protein 2-A; Short=SPFH 
domain-containing protein 2-A [Xenopus laevis]
 gb|AAH84273.1| LOC495100 protein [Xenopus laevis]
Length=335

 Score =   184 bits (468),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 82/146 (56%), Positives = 108/146 (74%), Gaps = 0/146 (0%)
 Frame = +1

Query  175  LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFE  354
            +S     V +   L++   FS +H++ EGHVGVY+RGGALLST + PGFHL  PFIT F+
Sbjct  1    MSHAGAIVGLGVALIAAALFSAIHKIEEGHVGVYYRGGALLSTTSGPGFHLMFPFITSFK  60

Query  355  PIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKI  534
             +Q TLQTD ++++PCGT GGVMI F++IEVVN L    VYD + N+   YD   I++KI
Sbjct  61   SVQSTLQTDEIKNVPCGTSGGVMIYFDRIEVVNYLISSAVYDIVKNFTADYDKALIFNKI  120

Query  535  HHEINQFCSGHSLQQVYIDMFDQIDE  612
            HHE+NQFCS H+LQ+VYI++FDQIDE
Sbjct  121  HHELNQFCSVHNLQEVYIELFDQIDE  146



>ref|NP_009106.1| erlin-2 isoform 1 [Homo sapiens]
 ref|NP_001126372.1| erlin-2 [Pongo abelii]
 ref|XP_003830787.1| PREDICTED: erlin-2 isoform X1 [Pan paniscus]
 ref|XP_005273449.1| PREDICTED: erlin-2 isoform X2 [Homo sapiens]
 ref|XP_008954404.1| PREDICTED: erlin-2 isoform X1 [Pan paniscus]
 ref|XP_008954405.1| PREDICTED: erlin-2 isoform X1 [Pan paniscus]
 ref|XP_009241970.1| PREDICTED: erlin-2 isoform X1 [Pongo abelii]
 ref|XP_009241971.1| PREDICTED: erlin-2 isoform X1 [Pongo abelii]
 ref|XP_009241972.1| PREDICTED: erlin-2 isoform X1 [Pongo abelii]
 ref|XP_009453464.1| PREDICTED: erlin-2 isoform X3 [Pan troglodytes]
 sp|O94905.1|ERLN2_HUMAN RecName: Full=Erlin-2; AltName: Full=Endoplasmic reticulum lipid 
raft-associated protein 2; AltName: Full=Stomatin-prohibitin-flotillin-HflC/K 
domain-containing protein 2; Short=SPFH 
domain-containing protein 2 [Homo sapiens]
 sp|Q5R7C5.1|ERLN2_PONAB RecName: Full=Erlin-2; AltName: Full=Endoplasmic reticulum lipid 
raft-associated protein 2; AltName: Full=Stomatin-prohibitin-flotillin-HflC/K 
domain-containing protein 2; Short=SPFH 
domain-containing protein 2 [Pongo abelii]
 dbj|BAA36845.1| unnamed protein product [Homo sapiens]
 emb|CAC09443.1| hypothetical protein [Homo sapiens]
 gb|AAQ88475.1| C8orf2 [Homo sapiens]
 emb|CAH92335.1| hypothetical protein [Pongo abelii]
 emb|CAL37919.1| hypothetical protein [synthetic construct]
 emb|CAL37946.1| hypothetical protein, partial [synthetic construct]
 gb|EAW63365.1| SPFH domain family, member 2, isoform CRA_a [Homo sapiens]
 gb|EAW63366.1| SPFH domain family, member 2, isoform CRA_a [Homo sapiens]
 dbj|BAF84083.1| unnamed protein product [Homo sapiens]
 dbj|BAG72542.1| ER lipid raft associated 2 [synthetic construct]
Length=339

 Score =   184 bits (468),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 80/146 (55%), Positives = 109/146 (75%), Gaps = 0/146 (0%)
 Frame = +1

Query  175  LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFE  354
            ++ +   V V +     + FS +H++ EGH+GVY+RGGALL++ + PGFHL LPFIT ++
Sbjct  1    MAQLGAVVAVASSFFCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGFHLMLPFITSYK  60

Query  355  PIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKI  534
             +Q TLQTD V+++PCGT GGVMI F++IEVVN L    VYD + NY   YD   I++KI
Sbjct  61   SVQTTLQTDEVKNVPCGTSGGVMIYFDRIEVVNFLVPNAVYDIVKNYTADYDKALIFNKI  120

Query  535  HHEINQFCSGHSLQQVYIDMFDQIDE  612
            HHE+NQFCS H+LQ+VYI++FDQIDE
Sbjct  121  HHELNQFCSVHTLQEVYIELFDQIDE  146



>ref|XP_004671559.1| PREDICTED: erlin-2 [Jaculus jaculus]
Length=339

 Score =   184 bits (468),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 80/146 (55%), Positives = 109/146 (75%), Gaps = 0/146 (0%)
 Frame = +1

Query  175  LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFE  354
            ++ +   V V +     + FS +H++ EGH+GVY+RGGALL++ + PGFHL LPFIT ++
Sbjct  1    MAQLGAIVAVASSFFCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGFHLMLPFITSYK  60

Query  355  PIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKI  534
             +Q TLQTD V+++PCGT GGVMI F++IEVVN L    VYD + NY   YD   I++KI
Sbjct  61   SVQTTLQTDEVKNVPCGTSGGVMIYFDRIEVVNFLVPNAVYDIVKNYTADYDKALIFNKI  120

Query  535  HHEINQFCSGHSLQQVYIDMFDQIDE  612
            HHE+NQFCS H+LQ+VYI++FDQIDE
Sbjct  121  HHELNQFCSVHTLQEVYIELFDQIDE  146



>ref|XP_006625610.1| PREDICTED: erlin-2-like [Lepisosteus oculatus]
Length=330

 Score =   184 bits (467),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 83/146 (57%), Positives = 111/146 (76%), Gaps = 3/146 (2%)
 Frame = +1

Query  175  LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFE  354
            L  IA  VM +T   +   FS++H++ EGH+GVY+RGGALL++ + PGFHL LPFIT ++
Sbjct  4    LGAIASVVMAIT---AAALFSSVHKIEEGHIGVYYRGGALLTSTSGPGFHLMLPFITSYK  60

Query  355  PIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKI  534
             +Q TLQTD V+++PCGT GGVMI F++IEVVN L    VYD + N+   YD   I++KI
Sbjct  61   SVQTTLQTDEVKNVPCGTSGGVMIYFDRIEVVNFLIPSAVYDIVRNFTADYDKALIFNKI  120

Query  535  HHEINQFCSGHSLQQVYIDMFDQIDE  612
            HHE+NQFCS H+LQ+VYI++FDQIDE
Sbjct  121  HHELNQFCSVHTLQEVYIELFDQIDE  146



>emb|CAH90754.1| hypothetical protein [Pongo abelii]
Length=338

 Score =   184 bits (468),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 80/146 (55%), Positives = 109/146 (75%), Gaps = 0/146 (0%)
 Frame = +1

Query  175  LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFE  354
            ++ +   V V +     + FS +H++ EGH+GVY+RGGALL++ + PGFHL LPFIT ++
Sbjct  1    MAQLGAVVAVASSFFCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGFHLMLPFITSYK  60

Query  355  PIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKI  534
             +Q TLQTD V+++PCGT GGVMI F++IEVVN L    VYD + NY   YD   I++KI
Sbjct  61   SVQTTLQTDEVKNVPCGTSGGVMIYFDRIEVVNFLVPNAVYDIVKNYTADYDKALIFNKI  120

Query  535  HHEINQFCSGHSLQQVYIDMFDQIDE  612
            HHE+NQFCS H+LQ+VYI++FDQIDE
Sbjct  121  HHELNQFCSVHTLQEVYIELFDQIDE  146



>ref|XP_008070569.1| PREDICTED: erlin-2 [Tarsius syrichta]
Length=339

 Score =   184 bits (468),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 80/146 (55%), Positives = 109/146 (75%), Gaps = 0/146 (0%)
 Frame = +1

Query  175  LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFE  354
            ++ +   V V +     + FS +H++ EGH+GVY+RGGALL++ + PGFHL LPFIT ++
Sbjct  1    MAQLGAVVAVASSFFCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGFHLMLPFITSYK  60

Query  355  PIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKI  534
             +Q TLQTD V+++PCGT GGVMI F++IEVVN L    VYD + NY   YD   I++KI
Sbjct  61   SVQTTLQTDEVKNVPCGTSGGVMIYFDRIEVVNFLVPNAVYDIVKNYTADYDKALIFNKI  120

Query  535  HHEINQFCSGHSLQQVYIDMFDQIDE  612
            HHE+NQFCS H+LQ+VYI++FDQIDE
Sbjct  121  HHELNQFCSVHTLQEVYIELFDQIDE  146



>ref|XP_003498266.1| PREDICTED: erlin-2 [Cricetulus griseus]
 ref|XP_007622680.1| PREDICTED: erlin-2 [Cricetulus griseus]
 ref|XP_007622686.1| PREDICTED: erlin-2 [Cricetulus griseus]
 ref|XP_007610932.1| PREDICTED: erlin-2 [Cricetulus griseus]
 ref|XP_007610933.1| PREDICTED: erlin-2 [Cricetulus griseus]
 ref|XP_007610934.1| PREDICTED: erlin-2 [Cricetulus griseus]
 gb|EGV94642.1| Erlin-2 [Cricetulus griseus]
 gb|ERE89621.1| erlin-2-like protein [Cricetulus griseus]
Length=339

 Score =   184 bits (468),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 80/146 (55%), Positives = 110/146 (75%), Gaps = 0/146 (0%)
 Frame = +1

Query  175  LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFE  354
            ++ +   V V +     + FS++H++ EGH+GVY+RGGALL++ + PGFHL LPFIT ++
Sbjct  1    MAQLGAVVAVASSFFCASLFSSVHKIEEGHIGVYYRGGALLTSTSGPGFHLMLPFITSYK  60

Query  355  PIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKI  534
             +Q TLQTD V+++PCGT GGVMI F++IEVVN L    VYD + NY   YD   I++KI
Sbjct  61   SVQTTLQTDEVKNVPCGTSGGVMIYFDRIEVVNFLVPNAVYDIVKNYTADYDKALIFNKI  120

Query  535  HHEINQFCSGHSLQQVYIDMFDQIDE  612
            HHE+NQFCS H+LQ+VYI++FDQIDE
Sbjct  121  HHELNQFCSVHTLQEVYIELFDQIDE  146



>ref|XP_008845823.1| PREDICTED: erlin-2 [Nannospalax galili]
 ref|XP_008845824.1| PREDICTED: erlin-2 [Nannospalax galili]
Length=339

 Score =   184 bits (468),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 80/146 (55%), Positives = 109/146 (75%), Gaps = 0/146 (0%)
 Frame = +1

Query  175  LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFE  354
            ++ +   V V +     + FS +H++ EGH+GVY+RGGALL++ + PGFHL LPFIT ++
Sbjct  1    MAQLGAIVAVASSFFCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGFHLMLPFITSYK  60

Query  355  PIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKI  534
             +Q TLQTD V+++PCGT GGVMI F++IEVVN L    VYD + NY   YD   I++KI
Sbjct  61   SVQTTLQTDEVKNVPCGTSGGVMIYFDRIEVVNFLVPNAVYDIVKNYTADYDKALIFNKI  120

Query  535  HHEINQFCSGHSLQQVYIDMFDQIDE  612
            HHE+NQFCS H+LQ+VYI++FDQIDE
Sbjct  121  HHELNQFCSVHTLQEVYIELFDQIDE  146



>ref|XP_005398467.1| PREDICTED: erlin-2 isoform X1 [Chinchilla lanigera]
Length=348

 Score =   184 bits (468),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 80/146 (55%), Positives = 110/146 (75%), Gaps = 0/146 (0%)
 Frame = +1

Query  175  LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFE  354
            ++ +   + V +  L  + FS +H++ EGH+GVY+RGGALL++ + PGFHL LPFIT ++
Sbjct  1    MAQLGAVLAVASSFLCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGFHLMLPFITSYK  60

Query  355  PIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKI  534
             +Q TLQTD V+++PCGT GGVMI F++IEVVN L    VYD + NY   YD   I++KI
Sbjct  61   SVQTTLQTDEVKNVPCGTSGGVMIYFDRIEVVNFLVPNAVYDIVKNYTADYDKALIFNKI  120

Query  535  HHEINQFCSGHSLQQVYIDMFDQIDE  612
            HHE+NQFCS H+LQ+VYI++FDQIDE
Sbjct  121  HHELNQFCSVHTLQEVYIELFDQIDE  146



>ref|XP_008586169.1| PREDICTED: erlin-2 isoform X1 [Galeopterus variegatus]
 ref|XP_008586170.1| PREDICTED: erlin-2 isoform X1 [Galeopterus variegatus]
 ref|XP_008586171.1| PREDICTED: erlin-2 isoform X1 [Galeopterus variegatus]
Length=339

 Score =   184 bits (468),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 80/146 (55%), Positives = 109/146 (75%), Gaps = 0/146 (0%)
 Frame = +1

Query  175  LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFE  354
            ++ +   V V +     + FS +H++ EGH+GVY+RGGALL++ + PGFHL LPFIT ++
Sbjct  1    MAQLGAVVAVASSFFCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGFHLMLPFITSYK  60

Query  355  PIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKI  534
             +Q TLQTD V+++PCGT GGVMI F++IEVVN L    VYD + NY   YD   I++KI
Sbjct  61   SVQTTLQTDEVKNVPCGTSGGVMIYFDRIEVVNFLVPNAVYDIVKNYTADYDKALIFNKI  120

Query  535  HHEINQFCSGHSLQQVYIDMFDQIDE  612
            HHE+NQFCS H+LQ+VYI++FDQIDE
Sbjct  121  HHELNQFCSVHTLQEVYIELFDQIDE  146



>ref|XP_004383453.1| PREDICTED: erlin-2 [Trichechus manatus latirostris]
Length=340

 Score =   184 bits (468),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 80/146 (55%), Positives = 109/146 (75%), Gaps = 0/146 (0%)
 Frame = +1

Query  175  LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFE  354
            ++ +   V V       + FS++H++ EGH+GVY+RGGALL++ + PGFHL LPFIT ++
Sbjct  1    MAQLGAVVAVAASFFCASLFSSVHKIEEGHIGVYYRGGALLTSTSGPGFHLMLPFITSYK  60

Query  355  PIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKI  534
             +Q TLQTD V+++PCGT GGVMI F++IEVVN L    VYD + NY   YD   I++KI
Sbjct  61   SVQTTLQTDEVKNVPCGTSGGVMIYFDRIEVVNFLVPNAVYDIVKNYTADYDKALIFNKI  120

Query  535  HHEINQFCSGHSLQQVYIDMFDQIDE  612
            HHE+NQFCS H+LQ+VYI++FDQIDE
Sbjct  121  HHELNQFCSVHTLQEVYIELFDQIDE  146



>ref|XP_004682291.1| PREDICTED: erlin-2 [Condylura cristata]
Length=339

 Score =   184 bits (467),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 80/146 (55%), Positives = 109/146 (75%), Gaps = 0/146 (0%)
 Frame = +1

Query  175  LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFE  354
            ++ +   V V       + FS++H++ EGH+GVY+RGGALL++ + PGFHL LPFIT ++
Sbjct  1    MAQLGAVVAVAASFFCASLFSSVHKIEEGHIGVYYRGGALLTSTSGPGFHLMLPFITSYK  60

Query  355  PIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKI  534
             +Q TLQTD V+++PCGT GGVMI F++IEVVN L    VYD + NY   YD   I++KI
Sbjct  61   SVQTTLQTDEVKNVPCGTSGGVMIYFDRIEVVNFLVPNAVYDIVKNYTADYDKALIFNKI  120

Query  535  HHEINQFCSGHSLQQVYIDMFDQIDE  612
            HHE+NQFCS H+LQ+VYI++FDQIDE
Sbjct  121  HHELNQFCSVHTLQEVYIELFDQIDE  146



>gb|EPQ01538.1| Erlin-2 [Myotis brandtii]
Length=365

 Score =   185 bits (469),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 81/147 (55%), Positives = 108/147 (73%), Gaps = 0/147 (0%)
 Frame = +1

Query  172  FLSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHF  351
             ++ +   V V T       FS +H++ EGH+GVY+RGGALL++ + PGFHL LPFIT +
Sbjct  26   LMAQLGAVVAVATSFFCAALFSAVHKIEEGHIGVYYRGGALLTSTSGPGFHLMLPFITSY  85

Query  352  EPIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDK  531
            + +Q TLQTD V+++PCGT GGVMI F++IEVVN L    VYD + NY   YD   I++K
Sbjct  86   KSVQTTLQTDEVKNVPCGTSGGVMIYFDRIEVVNFLVPSAVYDIVKNYTADYDKALIFNK  145

Query  532  IHHEINQFCSGHSLQQVYIDMFDQIDE  612
            IHHE+NQFCS H+LQ+VYI++FDQIDE
Sbjct  146  IHHELNQFCSVHTLQEVYIELFDQIDE  172



>ref|XP_006170719.1| PREDICTED: erlin-2 [Tupaia chinensis]
 gb|ELV09838.1| Erlin-2 [Tupaia chinensis]
Length=341

 Score =   184 bits (467),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 80/146 (55%), Positives = 109/146 (75%), Gaps = 0/146 (0%)
 Frame = +1

Query  175  LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFE  354
            ++ +   V V +     + FS +H++ EGH+GVY+RGGALL++ + PGFHL LPFIT ++
Sbjct  1    MAQLGAVVAVASSFFCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGFHLMLPFITSYK  60

Query  355  PIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKI  534
             +Q TLQTD V+++PCGT GGVMI F++IEVVN L    VYD + NY   YD   I++KI
Sbjct  61   SVQTTLQTDEVKNVPCGTSGGVMIYFDRIEVVNFLVPNAVYDIVKNYTADYDKALIFNKI  120

Query  535  HHEINQFCSGHSLQQVYIDMFDQIDE  612
            HHE+NQFCS H+LQ+VYI++FDQIDE
Sbjct  121  HHELNQFCSVHTLQEVYIELFDQIDE  146



>ref|XP_006916376.1| PREDICTED: erlin-2 isoform X1 [Pteropus alecto]
 ref|XP_011370474.1| PREDICTED: erlin-2 isoform X3 [Pteropus vampyrus]
Length=339

 Score =   184 bits (467),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 80/146 (55%), Positives = 108/146 (74%), Gaps = 0/146 (0%)
 Frame = +1

Query  175  LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFE  354
            ++ +   V V       + FS +H++ EGH+GVY+RGGALL++ + PGFHL LPFIT ++
Sbjct  1    MAQLGAVVAVAASFFCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGFHLMLPFITSYK  60

Query  355  PIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKI  534
             +Q TLQTD V+++PCGT GGVMI F++IEVVN L    VYD + NY   YD   I++KI
Sbjct  61   SVQTTLQTDEVKNVPCGTSGGVMIYFDRIEVVNFLVPNAVYDIVKNYTADYDKALIFNKI  120

Query  535  HHEINQFCSGHSLQQVYIDMFDQIDE  612
            HHE+NQFCS H+LQ+VYI++FDQIDE
Sbjct  121  HHELNQFCSVHTLQEVYIELFDQIDE  146



>ref|XP_004318395.1| PREDICTED: erlin-2 [Tursiops truncatus]
Length=339

 Score =   184 bits (467),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 80/146 (55%), Positives = 109/146 (75%), Gaps = 0/146 (0%)
 Frame = +1

Query  175  LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFE  354
            ++ +   + V    L  + FS +H++ EGH+GVY+RGGALL++ + PGFHL LPFIT ++
Sbjct  1    MAQLGAVLAVAASFLCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGFHLMLPFITSYK  60

Query  355  PIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKI  534
             +Q TLQTD V+++PCGT GGVMI F++IEVVN L    VYD + NY   YD   I++KI
Sbjct  61   SVQTTLQTDEVKNVPCGTSGGVMIYFDRIEVVNFLVPHAVYDIVKNYTADYDKALIFNKI  120

Query  535  HHEINQFCSGHSLQQVYIDMFDQIDE  612
            HHE+NQFCS H+LQ+VYI++FDQIDE
Sbjct  121  HHELNQFCSVHTLQEVYIELFDQIDE  146



>ref|XP_006982987.1| PREDICTED: erlin-2 [Peromyscus maniculatus bairdii]
Length=339

 Score =   184 bits (467),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 80/146 (55%), Positives = 109/146 (75%), Gaps = 0/146 (0%)
 Frame = +1

Query  175  LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFE  354
            ++ +   V V +     + FS +H++ EGH+GVY+RGGALL++ + PGFHL LPFIT ++
Sbjct  1    MAQLGAVVAVASSFFCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGFHLMLPFITSYK  60

Query  355  PIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKI  534
             +Q TLQTD V+++PCGT GGVMI F++IEVVN L    VYD + NY   YD   I++KI
Sbjct  61   SVQTTLQTDEVKNVPCGTSGGVMIYFDRIEVVNFLVPNAVYDIVKNYTADYDKALIFNKI  120

Query  535  HHEINQFCSGHSLQQVYIDMFDQIDE  612
            HHE+NQFCS H+LQ+VYI++FDQIDE
Sbjct  121  HHELNQFCSVHTLQEVYIELFDQIDE  146



>ref|XP_005066638.1| PREDICTED: erlin-2 [Mesocricetus auratus]
Length=339

 Score =   184 bits (467),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 80/146 (55%), Positives = 109/146 (75%), Gaps = 0/146 (0%)
 Frame = +1

Query  175  LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFE  354
            ++ +   V V +     + FS +H++ EGH+GVY+RGGALL++ + PGFHL LPFIT ++
Sbjct  1    MAQLGAVVAVASSFFCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGFHLMLPFITSYK  60

Query  355  PIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKI  534
             +Q TLQTD V+++PCGT GGVMI F++IEVVN L    VYD + NY   YD   I++KI
Sbjct  61   SVQTTLQTDEVKNVPCGTSGGVMIYFDRIEVVNFLVPNAVYDIVKNYTADYDKALIFNKI  120

Query  535  HHEINQFCSGHSLQQVYIDMFDQIDE  612
            HHE+NQFCS H+LQ+VYI++FDQIDE
Sbjct  121  HHELNQFCSVHTLQEVYIELFDQIDE  146



>ref|XP_003412458.1| PREDICTED: erlin-2 [Loxodonta africana]
 ref|XP_010590761.1| PREDICTED: erlin-2 [Loxodonta africana]
Length=339

 Score =   184 bits (467),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 80/146 (55%), Positives = 108/146 (74%), Gaps = 0/146 (0%)
 Frame = +1

Query  175  LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFE  354
            ++ +   V V       + FS +H++ EGH+GVY+RGGALL++ + PGFHL LPFIT ++
Sbjct  1    MAQLGAVVAVAASFFCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGFHLMLPFITSYK  60

Query  355  PIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKI  534
             +Q TLQTD V+++PCGT GGVMI F++IEVVN L    VYD + NY   YD   I++KI
Sbjct  61   SVQTTLQTDEVKNVPCGTSGGVMIYFDRIEVVNFLVPNAVYDIVKNYTADYDKALIFNKI  120

Query  535  HHEINQFCSGHSLQQVYIDMFDQIDE  612
            HHE+NQFCS H+LQ+VYI++FDQIDE
Sbjct  121  HHELNQFCSVHTLQEVYIELFDQIDE  146



>ref|XP_003796348.1| PREDICTED: erlin-2 [Otolemur garnettii]
Length=339

 Score =   184 bits (467),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 80/146 (55%), Positives = 109/146 (75%), Gaps = 0/146 (0%)
 Frame = +1

Query  175  LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFE  354
            ++ +   V + +  L    FS +H++ EGH+GVY+RGGALL++ + PGFHL LPFIT ++
Sbjct  1    MAQLGAIVALTSSFLCAALFSAVHKIEEGHIGVYYRGGALLTSTSGPGFHLMLPFITSYK  60

Query  355  PIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKI  534
             +Q TLQTD V+++PCGT GGVMI F++IEVVN L    VYD + NY   YD   I++KI
Sbjct  61   SVQTTLQTDEVKNVPCGTSGGVMIYFDRIEVVNFLVPNAVYDIVKNYTADYDKALIFNKI  120

Query  535  HHEINQFCSGHSLQQVYIDMFDQIDE  612
            HHE+NQFCS H+LQ+VYI++FDQIDE
Sbjct  121  HHELNQFCSVHTLQEVYIELFDQIDE  146



>ref|XP_006028964.1| PREDICTED: erlin-2 isoform X3 [Alligator sinensis]
Length=335

 Score =   184 bits (466),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 79/146 (54%), Positives = 109/146 (75%), Gaps = 0/146 (0%)
 Frame = +1

Query  175  LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFE  354
            ++ +     V    ++   FS +H++ EGH+GVY+RGGALL++ + PGFHL LPFIT ++
Sbjct  1    MAQLGAIAAVTVSFVAAAFFSAIHKIEEGHIGVYYRGGALLTSTSGPGFHLMLPFITSYK  60

Query  355  PIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKI  534
             +Q TLQTD V+++PCGT GGVMI F++IEVVN L +  VYD + NY   YD   I++KI
Sbjct  61   SVQTTLQTDEVKNVPCGTSGGVMIYFDRIEVVNFLIQNAVYDIVKNYTADYDKALIFNKI  120

Query  535  HHEINQFCSGHSLQQVYIDMFDQIDE  612
            HHE+NQFCS H+LQ+VYI++FDQIDE
Sbjct  121  HHELNQFCSVHTLQEVYIELFDQIDE  146



>ref|XP_003984836.1| PREDICTED: erlin-2 [Felis catus]
 ref|XP_006930788.1| PREDICTED: erlin-2 [Felis catus]
 ref|XP_007097149.1| PREDICTED: erlin-2 isoform X1 [Panthera tigris altaica]
 ref|XP_007097150.1| PREDICTED: erlin-2 isoform X2 [Panthera tigris altaica]
Length=337

 Score =   184 bits (466),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 80/146 (55%), Positives = 109/146 (75%), Gaps = 0/146 (0%)
 Frame = +1

Query  175  LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFE  354
            ++ +   V V +     + FS +H++ EGH+GVY+RGGALL++ + PGFHL LPFIT ++
Sbjct  1    MAQLGAVVAVASSFFCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGFHLMLPFITSYK  60

Query  355  PIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKI  534
             +Q TLQTD V+++PCGT GGVMI F++IEVVN L    VYD + NY   YD   I++KI
Sbjct  61   SVQTTLQTDEVKNVPCGTSGGVMIYFDRIEVVNFLVPNAVYDIVKNYTADYDKALIFNKI  120

Query  535  HHEINQFCSGHSLQQVYIDMFDQIDE  612
            HHE+NQFCS H+LQ+VYI++FDQIDE
Sbjct  121  HHELNQFCSVHTLQEVYIELFDQIDE  146



>gb|EYB82447.1| hypothetical protein Y032_0360g3455 [Ancylostoma ceylanicum]
Length=324

 Score =   183 bits (465),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 79/140 (56%), Positives = 107/140 (76%), Gaps = 0/140 (0%)
 Frame = +1

Query  193  FVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFEPIQVTL  372
             ++ V  + S    ++LH + EGHVGVY+RGGALL+ ++ PG+HL +PF+T ++ +QVTL
Sbjct  6    LLLAVFAITSIFMITSLHHIEEGHVGVYFRGGALLTKVSAPGYHLMIPFVTSYKSVQVTL  65

Query  373  QTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKIHHEINQ  552
            QTD  +++PCGT GGVMI F++IEVVN L    VYD + NY V YD   I++K+HHE+NQ
Sbjct  66   QTDEAKNVPCGTSGGVMIYFDRIEVVNILSASSVYDIVKNYTVDYDKPLIFNKVHHEVNQ  125

Query  553  FCSGHSLQQVYIDMFDQIDE  612
            FCS HSLQ+VYID+FDQIDE
Sbjct  126  FCSSHSLQEVYIDLFDQIDE  145



>ref|XP_001512901.1| PREDICTED: erlin-2 [Ornithorhynchus anatinus]
 ref|XP_007668052.1| PREDICTED: erlin-2 [Ornithorhynchus anatinus]
 ref|XP_007668053.1| PREDICTED: erlin-2 [Ornithorhynchus anatinus]
Length=338

 Score =   184 bits (466),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 81/146 (55%), Positives = 108/146 (74%), Gaps = 0/146 (0%)
 Frame = +1

Query  175  LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFE  354
            ++ +   V V T       FS +H++ EGH+GVY+RGGALL++ + PGFHL LPFIT ++
Sbjct  1    MAQLGAVVAVATSFFCAALFSAVHKIEEGHIGVYYRGGALLTSTSGPGFHLMLPFITSYK  60

Query  355  PIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKI  534
             +Q TLQTD V+++PCGT GGVMI F++IEVVN L    VYD + NY   YD   I++KI
Sbjct  61   SVQTTLQTDEVKNVPCGTSGGVMIYFDRIEVVNFLVPNAVYDIVKNYTADYDKALIFNKI  120

Query  535  HHEINQFCSGHSLQQVYIDMFDQIDE  612
            HHE+NQFCS H+LQ+VYI++FDQIDE
Sbjct  121  HHELNQFCSVHTLQEVYIELFDQIDE  146



>ref|XP_005338432.1| PREDICTED: erlin-2 [Ictidomys tridecemlineatus]
Length=339

 Score =   184 bits (466),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 80/146 (55%), Positives = 109/146 (75%), Gaps = 0/146 (0%)
 Frame = +1

Query  175  LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFE  354
            ++ +   V V +     + FS +H++ EGH+GVY+RGGALL++ + PGFHL LPFIT ++
Sbjct  1    MAQLGAVVAVASSFFCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGFHLMLPFITSYK  60

Query  355  PIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKI  534
             +Q TLQTD V+++PCGT GGVMI F++IEVVN L    VYD + NY   YD   I++KI
Sbjct  61   SVQTTLQTDEVKNVPCGTSGGVMIYFDRIEVVNFLVPNAVYDIVKNYTADYDKALIFNKI  120

Query  535  HHEINQFCSGHSLQQVYIDMFDQIDE  612
            HHE+NQFCS H+LQ+VYI++FDQIDE
Sbjct  121  HHELNQFCSVHTLQEVYIELFDQIDE  146



>ref|NP_705820.1| erlin-2 [Mus musculus]
 ref|XP_006509179.1| PREDICTED: erlin-2 isoform X1 [Mus musculus]
 ref|XP_006509180.1| PREDICTED: erlin-2 isoform X1 [Mus musculus]
 sp|Q8BFZ9.1|ERLN2_MOUSE RecName: Full=Erlin-2; AltName: Full=Endoplasmic reticulum lipid 
raft-associated protein 2; AltName: Full=Stomatin-prohibitin-flotillin-HflC/K 
domain-containing protein 2; Short=SPFH 
domain-containing protein 2 [Mus musculus]
 gb|AAH36333.1| ER lipid raft associated 2 [Mus musculus]
 gb|AAH38374.1| ER lipid raft associated 2 [Mus musculus]
 gb|EDL32800.1| SPFH domain family, member 2 [Mus musculus]
Length=340

 Score =   184 bits (466),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 80/146 (55%), Positives = 109/146 (75%), Gaps = 0/146 (0%)
 Frame = +1

Query  175  LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFE  354
            ++ +   V V +     + FS +H++ EGH+GVY+RGGALL++ + PGFHL LPFIT ++
Sbjct  1    MAQLGAVVAVASSFFCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGFHLMLPFITSYK  60

Query  355  PIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKI  534
             +Q TLQTD V+++PCGT GGVMI F++IEVVN L    VYD + NY   YD   I++KI
Sbjct  61   SVQTTLQTDEVKNVPCGTSGGVMIYFDRIEVVNFLVPNAVYDIVKNYTADYDKALIFNKI  120

Query  535  HHEINQFCSGHSLQQVYIDMFDQIDE  612
            HHE+NQFCS H+LQ+VYI++FDQIDE
Sbjct  121  HHELNQFCSVHTLQEVYIELFDQIDE  146



>ref|XP_004469435.1| PREDICTED: erlin-2 [Dasypus novemcinctus]
Length=339

 Score =   184 bits (466),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 80/146 (55%), Positives = 108/146 (74%), Gaps = 0/146 (0%)
 Frame = +1

Query  175  LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFE  354
            ++ +   V V       + FS +H++ EGH+GVY+RGGALL++ + PGFHL LPFIT ++
Sbjct  1    MAQLGAVVAVAASFFCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGFHLMLPFITSYK  60

Query  355  PIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKI  534
             +Q TLQTD V+++PCGT GGVMI F++IEVVN L    VYD + NY   YD   I++KI
Sbjct  61   SVQTTLQTDEVKNVPCGTSGGVMIYFDRIEVVNFLVPNAVYDIVKNYTADYDKALIFNKI  120

Query  535  HHEINQFCSGHSLQQVYIDMFDQIDE  612
            HHE+NQFCS H+LQ+VYI++FDQIDE
Sbjct  121  HHELNQFCSVHTLQEVYIELFDQIDE  146



>dbj|BAC27019.1| unnamed protein product [Mus musculus]
Length=340

 Score =   184 bits (466),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 80/146 (55%), Positives = 109/146 (75%), Gaps = 0/146 (0%)
 Frame = +1

Query  175  LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFE  354
            ++ +   V V +     + FS +H++ EGH+GVY+RGGALL++ + PGFHL LPFIT ++
Sbjct  1    MAQLGAVVAVASSFFCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGFHLMLPFITSYK  60

Query  355  PIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKI  534
             +Q TLQTD V+++PCGT GGVMI F++IEVVN L    VYD + NY   YD   I++KI
Sbjct  61   SVQTTLQTDEVKNVPCGTSGGVMIYFDRIEVVNFLVPNAVYDIVKNYTADYDKALIFNKI  120

Query  535  HHEINQFCSGHSLQQVYIDMFDQIDE  612
            HHE+NQFCS H+LQ+VYI++FDQIDE
Sbjct  121  HHELNQFCSVHTLQEVYIELFDQIDE  146



>ref|XP_004284919.1| PREDICTED: erlin-2 [Orcinus orca]
 ref|XP_007113338.1| PREDICTED: erlin-2 isoform X2 [Physeter catodon]
Length=339

 Score =   184 bits (466),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 80/146 (55%), Positives = 109/146 (75%), Gaps = 0/146 (0%)
 Frame = +1

Query  175  LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFE  354
            ++ +   + V    L  + FS +H++ EGH+GVY+RGGALL++ + PGFHL LPFIT ++
Sbjct  1    MAQLGAVLAVAASFLCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGFHLMLPFITSYK  60

Query  355  PIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKI  534
             +Q TLQTD V+++PCGT GGVMI F++IEVVN L    VYD + NY   YD   I++KI
Sbjct  61   SVQTTLQTDEVKNVPCGTSGGVMIYFDRIEVVNFLVPHAVYDIVKNYTADYDKALIFNKI  120

Query  535  HHEINQFCSGHSLQQVYIDMFDQIDE  612
            HHE+NQFCS H+LQ+VYI++FDQIDE
Sbjct  121  HHELNQFCSVHTLQEVYIELFDQIDE  146



>ref|XP_008684810.1| PREDICTED: erlin-2 isoform X1 [Ursus maritimus]
Length=366

 Score =   184 bits (468),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 81/147 (55%), Positives = 109/147 (74%), Gaps = 0/147 (0%)
 Frame = +1

Query  172  FLSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHF  351
             ++ +   V V T     + FS +H++ EGH+GVY+RGGALL++ + PGFHL LPFIT +
Sbjct  29   LMAQLGAVVAVATSFFCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGFHLMLPFITSY  88

Query  352  EPIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDK  531
            + +Q TLQTD V+++PCGT GGVMI F++IEVVN L    VYD + NY   YD   I++K
Sbjct  89   KSVQTTLQTDEVKNVPCGTSGGVMIYFDRIEVVNFLVPNAVYDIVKNYTADYDKALIFNK  148

Query  532  IHHEINQFCSGHSLQQVYIDMFDQIDE  612
            IHHE+NQFCS H+LQ+VYI++FDQIDE
Sbjct  149  IHHELNQFCSVHTLQEVYIELFDQIDE  175



>gb|ERE89623.1| erlin-2-like protein [Cricetulus griseus]
Length=365

 Score =   184 bits (468),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 80/146 (55%), Positives = 110/146 (75%), Gaps = 0/146 (0%)
 Frame = +1

Query  175  LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFE  354
            ++ +   V V +     + FS++H++ EGH+GVY+RGGALL++ + PGFHL LPFIT ++
Sbjct  1    MAQLGAVVAVASSFFCASLFSSVHKIEEGHIGVYYRGGALLTSTSGPGFHLMLPFITSYK  60

Query  355  PIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKI  534
             +Q TLQTD V+++PCGT GGVMI F++IEVVN L    VYD + NY   YD   I++KI
Sbjct  61   SVQTTLQTDEVKNVPCGTSGGVMIYFDRIEVVNFLVPNAVYDIVKNYTADYDKALIFNKI  120

Query  535  HHEINQFCSGHSLQQVYIDMFDQIDE  612
            HHE+NQFCS H+LQ+VYI++FDQIDE
Sbjct  121  HHELNQFCSVHTLQEVYIELFDQIDE  146



>ref|XP_011370467.1| PREDICTED: erlin-2 isoform X2 [Pteropus vampyrus]
Length=353

 Score =   184 bits (467),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 80/147 (54%), Positives = 108/147 (73%), Gaps = 0/147 (0%)
 Frame = +1

Query  172  FLSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHF  351
             ++ +   V V       + FS +H++ EGH+GVY+RGGALL++ + PGFHL LPFIT +
Sbjct  14   LMAQLGAVVAVAASFFCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGFHLMLPFITSY  73

Query  352  EPIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDK  531
            + +Q TLQTD V+++PCGT GGVMI F++IEVVN L    VYD + NY   YD   I++K
Sbjct  74   KSVQTTLQTDEVKNVPCGTSGGVMIYFDRIEVVNFLVPNAVYDIVKNYTADYDKALIFNK  133

Query  532  IHHEINQFCSGHSLQQVYIDMFDQIDE  612
            IHHE+NQFCS H+LQ+VYI++FDQIDE
Sbjct  134  IHHELNQFCSVHTLQEVYIELFDQIDE  160



>ref|XP_006051017.1| PREDICTED: erlin-2 [Bubalus bubalis]
Length=338

 Score =   184 bits (466),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 80/146 (55%), Positives = 108/146 (74%), Gaps = 0/146 (0%)
 Frame = +1

Query  175  LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFE  354
            ++ +   V V       + FS +H++ EGH+GVY+RGGALL++ + PGFHL LPFIT ++
Sbjct  1    MAQLGAVVAVAASFFCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGFHLMLPFITSYK  60

Query  355  PIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKI  534
             +Q TLQTD V+++PCGT GGVMI F++IEVVN L    VYD + NY   YD   I++KI
Sbjct  61   SVQTTLQTDEVKNVPCGTSGGVMIYFDRIEVVNFLVPHAVYDIVKNYTADYDKALIFNKI  120

Query  535  HHEINQFCSGHSLQQVYIDMFDQIDE  612
            HHE+NQFCS H+LQ+VYI++FDQIDE
Sbjct  121  HHELNQFCSVHTLQEVYIELFDQIDE  146



>ref|XP_007448372.1| PREDICTED: erlin-2 isoform X2 [Lipotes vexillifer]
Length=339

 Score =   184 bits (466),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 80/146 (55%), Positives = 109/146 (75%), Gaps = 0/146 (0%)
 Frame = +1

Query  175  LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFE  354
            ++ +   + V    L  + FS +H++ EGH+GVY+RGGALL++ + PGFHL LPFIT ++
Sbjct  1    MAQLGAVLAVAASFLCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGFHLMLPFITSYK  60

Query  355  PIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKI  534
             +Q TLQTD V+++PCGT GGVMI F++IEVVN L    VYD + NY   YD   I++KI
Sbjct  61   SVQTTLQTDEVKNVPCGTSGGVMIYFDRIEVVNFLVPHAVYDIVKNYTADYDKALIFNKI  120

Query  535  HHEINQFCSGHSLQQVYIDMFDQIDE  612
            HHE+NQFCS H+LQ+VYI++FDQIDE
Sbjct  121  HHELNQFCSVHTLQEVYIELFDQIDE  146



>ref|XP_010346995.1| PREDICTED: erlin-2 isoform X1 [Saimiri boliviensis boliviensis]
Length=372

 Score =   184 bits (468),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 81/147 (55%), Positives = 110/147 (75%), Gaps = 0/147 (0%)
 Frame = +1

Query  172  FLSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHF  351
             ++ +   V VV+     + FS +H++ EGH+GVY+RGGALL++ + PGFHL LPFIT +
Sbjct  33   LMAQLGAAVAVVSSFFCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGFHLMLPFITSY  92

Query  352  EPIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDK  531
            + +Q TLQTD V+++PCGT GGVMI F++IEVVN L    VYD + NY   YD   I++K
Sbjct  93   KSVQTTLQTDEVKNVPCGTSGGVMIYFDRIEVVNFLVPNAVYDIVKNYTADYDKALIFNK  152

Query  532  IHHEINQFCSGHSLQQVYIDMFDQIDE  612
            IHHE+NQFCS H+LQ+VYI++FDQIDE
Sbjct  153  IHHELNQFCSVHTLQEVYIELFDQIDE  179



>ref|XP_010561073.1| PREDICTED: erlin-2 isoform X2 [Haliaeetus leucocephalus]
Length=283

 Score =   182 bits (461),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 78/132 (59%), Positives = 104/132 (79%), Gaps = 0/132 (0%)
 Frame = +1

Query  217  LSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFEPIQVTLQTDLVRDI  396
            L+    S +H++ EGH+GVY+RGGALL++ + PGFHL LPFIT ++ +Q TLQTD V+++
Sbjct  15   LAAAFLSAIHKIEEGHIGVYYRGGALLTSTSGPGFHLMLPFITSYKSVQTTLQTDEVKNV  74

Query  397  PCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKIHHEINQFCSGHSLQ  576
            PCGT GGVMI F++IEVVN L +  VYD + NY   YD   I++KIHHE+NQFCS H+LQ
Sbjct  75   PCGTSGGVMIYFDRIEVVNFLIQSAVYDIVKNYTADYDKALIFNKIHHELNQFCSVHTLQ  134

Query  577  QVYIDMFDQIDE  612
            +VYI++FDQIDE
Sbjct  135  EVYIELFDQIDE  146



>ref|XP_004606925.1| PREDICTED: erlin-2, partial [Sorex araneus]
Length=344

 Score =   184 bits (466),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 80/146 (55%), Positives = 109/146 (75%), Gaps = 0/146 (0%)
 Frame = +1

Query  175  LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFE  354
            ++ +   V V       + FS++H++ EGH+GVY+RGGALL++ + PGFHL LPFIT ++
Sbjct  1    MAQLGAIVAVAVSFCCASIFSSVHKIEEGHIGVYYRGGALLTSTSGPGFHLMLPFITSYK  60

Query  355  PIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKI  534
             +Q TLQTD V+++PCGT GGVMI F++IEVVN L    VYD + NY   YD   I++KI
Sbjct  61   SVQTTLQTDEVKNVPCGTSGGVMIYFDRIEVVNFLVPNAVYDIVKNYTADYDKALIFNKI  120

Query  535  HHEINQFCSGHSLQQVYIDMFDQIDE  612
            HHE+NQFCS H+LQ+VYI++FDQIDE
Sbjct  121  HHELNQFCSVHTLQEVYIELFDQIDE  146



>gb|KIH61869.1| SPFH/Band 7/PHB domain protein [Ancylostoma duodenale]
Length=335

 Score =   183 bits (465),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 79/140 (56%), Positives = 107/140 (76%), Gaps = 0/140 (0%)
 Frame = +1

Query  193  FVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFEPIQVTL  372
             ++ V  + S    ++LH + EGHVGVY+RGGALL+ ++ PG+HL +PF+T ++ +QVTL
Sbjct  6    LLLAVFAITSIFMITSLHHIEEGHVGVYFRGGALLTKVSAPGYHLMIPFVTSYKSVQVTL  65

Query  373  QTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKIHHEINQ  552
            QTD  +++PCGT GGVMI F++IEVVN L    VYD + NY V YD   I++K+HHE+NQ
Sbjct  66   QTDEAKNVPCGTSGGVMIYFDRIEVVNILSASSVYDIVKNYTVDYDKPLIFNKVHHEVNQ  125

Query  553  FCSGHSLQQVYIDMFDQIDE  612
            FCS HSLQ+VYID+FDQIDE
Sbjct  126  FCSSHSLQEVYIDLFDQIDE  145



>ref|XP_007113337.1| PREDICTED: erlin-2 isoform X1 [Physeter catodon]
Length=355

 Score =   184 bits (467),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 80/147 (54%), Positives = 109/147 (74%), Gaps = 0/147 (0%)
 Frame = +1

Query  172  FLSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHF  351
             ++ +   + V    L  + FS +H++ EGH+GVY+RGGALL++ + PGFHL LPFIT +
Sbjct  16   LMAQLGAVLAVAASFLCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGFHLMLPFITSY  75

Query  352  EPIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDK  531
            + +Q TLQTD V+++PCGT GGVMI F++IEVVN L    VYD + NY   YD   I++K
Sbjct  76   KSVQTTLQTDEVKNVPCGTSGGVMIYFDRIEVVNFLVPHAVYDIVKNYTADYDKALIFNK  135

Query  532  IHHEINQFCSGHSLQQVYIDMFDQIDE  612
            IHHE+NQFCS H+LQ+VYI++FDQIDE
Sbjct  136  IHHELNQFCSVHTLQEVYIELFDQIDE  162



>ref|NP_001099558.1| erlin-2 [Rattus norvegicus]
 ref|XP_008769545.1| PREDICTED: erlin-2 isoform X1 [Rattus norvegicus]
 ref|XP_008769546.1| PREDICTED: erlin-2 isoform X1 [Rattus norvegicus]
 sp|B5DEH2.1|ERLN2_RAT RecName: Full=Erlin-2; AltName: Full=Endoplasmic reticulum lipid 
raft-associated protein 2; AltName: Full=Stomatin-prohibitin-flotillin-HflC/K 
domain-containing protein 2; Short=SPFH 
domain-containing protein 2 [Rattus norvegicus]
 gb|EDM09088.1| SPFH domain family, member 2 (predicted) [Rattus norvegicus]
 gb|AAI68668.1| ER lipid raft associated 2 [Rattus norvegicus]
Length=339

 Score =   183 bits (465),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 80/146 (55%), Positives = 109/146 (75%), Gaps = 0/146 (0%)
 Frame = +1

Query  175  LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFE  354
            ++ +   V V +     + FS +H++ EGH+GVY+RGGALL++ + PGFHL LPFIT ++
Sbjct  1    MAQLGAVVAVASSFFCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGFHLMLPFITSYK  60

Query  355  PIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKI  534
             +Q TLQTD V+++PCGT GGVMI F++IEVVN L    VYD + NY   YD   I++KI
Sbjct  61   SVQTTLQTDEVKNVPCGTSGGVMIYFDRIEVVNFLVPHAVYDIVKNYTADYDKALIFNKI  120

Query  535  HHEINQFCSGHSLQQVYIDMFDQIDE  612
            HHE+NQFCS H+LQ+VYI++FDQIDE
Sbjct  121  HHELNQFCSVHTLQEVYIELFDQIDE  146



>gb|ETE72080.1| Erlin-2 [Ophiophagus hannah]
Length=186

 Score =   179 bits (453),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 78/127 (61%), Positives = 103/127 (81%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  FSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFEPIQVTLQTDLVRDIPCGTK  411
            FS +H++ EGH+GVY+RGGALL++ + PGFHL LPFIT ++ +Q TLQTD V+++PCGT 
Sbjct  20   FSAIHKIEEGHIGVYYRGGALLTSTSGPGFHLMLPFITSYKSVQTTLQTDEVKNVPCGTS  79

Query  412  GGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKIHHEINQFCSGHSLQQVYID  591
            GGVMI F++IEVVN L +  VYD + NY   YD   I++KIHHE+NQFCS H+LQ+VYI+
Sbjct  80   GGVMIYFDRIEVVNFLIQSAVYDIVKNYTADYDKALIFNKIHHELNQFCSVHTLQEVYIE  139

Query  592  MFDQIDE  612
            +FDQIDE
Sbjct  140  LFDQIDE  146



>ref|XP_003462936.1| PREDICTED: erlin-2 isoform X1 [Cavia porcellus]
 ref|XP_005000481.1| PREDICTED: erlin-2 isoform X2 [Cavia porcellus]
Length=339

 Score =   183 bits (465),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 80/146 (55%), Positives = 110/146 (75%), Gaps = 0/146 (0%)
 Frame = +1

Query  175  LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFE  354
            ++ +   V + +  L  + FS +H++ EGH+GVY+RGGALL++ + PGFHL LPFIT ++
Sbjct  1    MAQLGAVVALASGFLCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGFHLMLPFITSYK  60

Query  355  PIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKI  534
             +Q TLQTD V+++PCGT GGVMI F++IEVVN L    VYD + NY   YD   I++KI
Sbjct  61   SVQTTLQTDEVKNVPCGTSGGVMIYFDRIEVVNFLVPNAVYDIVKNYTADYDKALIFNKI  120

Query  535  HHEINQFCSGHSLQQVYIDMFDQIDE  612
            HHE+NQFCS H+LQ+VYI++FDQIDE
Sbjct  121  HHELNQFCSVHTLQEVYIELFDQIDE  146



>ref|XP_001169738.2| PREDICTED: erlin-2 isoform X1 [Pan troglodytes]
Length=380

 Score =   184 bits (468),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 80/147 (54%), Positives = 109/147 (74%), Gaps = 0/147 (0%)
 Frame = +1

Query  172  FLSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHF  351
             ++ +   V V +     + FS +H++ EGH+GVY+RGGALL++ + PGFHL LPFIT +
Sbjct  41   LMAQLGAVVAVASSFFCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGFHLMLPFITSY  100

Query  352  EPIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDK  531
            + +Q TLQTD V+++PCGT GGVMI F++IEVVN L    VYD + NY   YD   I++K
Sbjct  101  KSVQTTLQTDEVKNVPCGTSGGVMIYFDRIEVVNFLVPNAVYDIVKNYTADYDKALIFNK  160

Query  532  IHHEINQFCSGHSLQQVYIDMFDQIDE  612
            IHHE+NQFCS H+LQ+VYI++FDQIDE
Sbjct  161  IHHELNQFCSVHTLQEVYIELFDQIDE  187



>ref|XP_007476402.1| PREDICTED: erlin-2 isoform X5 [Monodelphis domestica]
Length=281

 Score =   182 bits (461),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 78/127 (61%), Positives = 102/127 (80%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  FSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFEPIQVTLQTDLVRDIPCGTK  411
            FS +H++ EGH+GVY+RGGALL++ + PGFHL LPFIT ++ +Q TLQTD V+++PCGT 
Sbjct  20   FSAVHKIEEGHIGVYYRGGALLTSTSGPGFHLMLPFITSYKSVQTTLQTDEVKNVPCGTS  79

Query  412  GGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKIHHEINQFCSGHSLQQVYID  591
            GGVMI F++IEVVN L    VYD + NY   YD   I++KIHHE+NQFCS H+LQ+VYI+
Sbjct  80   GGVMIYFDRIEVVNFLISNAVYDIVKNYTADYDKALIFNKIHHELNQFCSVHTLQEVYIE  139

Query  592  MFDQIDE  612
            +FDQIDE
Sbjct  140  LFDQIDE  146



>ref|XP_005981675.1| PREDICTED: erlin-2 [Pantholops hodgsonii]
Length=338

 Score =   183 bits (465),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 80/146 (55%), Positives = 108/146 (74%), Gaps = 0/146 (0%)
 Frame = +1

Query  175  LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFE  354
            ++ +   V V       + FS +H++ EGH+GVY+RGGALL++ + PGFHL LPFIT ++
Sbjct  1    MAQLGAIVAVAASFFCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGFHLMLPFITSYK  60

Query  355  PIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKI  534
             +Q TLQTD V+++PCGT GGVMI F++IEVVN L    VYD + NY   YD   I++KI
Sbjct  61   SVQTTLQTDEVKNVPCGTSGGVMIYFDRIEVVNFLVPHAVYDIVKNYTADYDKALIFNKI  120

Query  535  HHEINQFCSGHSLQQVYIDMFDQIDE  612
            HHE+NQFCS H+LQ+VYI++FDQIDE
Sbjct  121  HHELNQFCSVHTLQEVYIELFDQIDE  146



>ref|NP_001040041.1| erlin-2 precursor [Bos taurus]
 ref|XP_005226183.1| PREDICTED: erlin-2 isoform X1 [Bos taurus]
 ref|XP_005906170.1| PREDICTED: erlin-2 [Bos mutus]
 ref|XP_010837089.1| PREDICTED: erlin-2 isoform X3 [Bison bison bison]
 sp|Q1RMU4.1|ERLN2_BOVIN RecName: Full=Erlin-2; AltName: Full=Endoplasmic reticulum lipid 
raft-associated protein 2; AltName: Full=Stomatin-prohibitin-flotillin-HflC/K 
domain-containing protein 2; Short=SPFH 
domain-containing protein 2 [Bos taurus]
 gb|AAI14708.1| ER lipid raft associated 2 [Bos taurus]
 tpg|DAA14454.1| TPA: erlin-2 [Bos taurus]
 gb|ELR48820.1| Erlin-2 [Bos mutus]
Length=338

 Score =   183 bits (465),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 80/146 (55%), Positives = 108/146 (74%), Gaps = 0/146 (0%)
 Frame = +1

Query  175  LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFE  354
            ++ +   V V       + FS +H++ EGH+GVY+RGGALL++ + PGFHL LPFIT ++
Sbjct  1    MAQLGAVVAVAASFFCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGFHLMLPFITSYK  60

Query  355  PIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKI  534
             +Q TLQTD V+++PCGT GGVMI F++IEVVN L    VYD + NY   YD   I++KI
Sbjct  61   SVQTTLQTDEVKNVPCGTSGGVMIYFDRIEVVNFLVPHAVYDIVKNYTADYDKALIFNKI  120

Query  535  HHEINQFCSGHSLQQVYIDMFDQIDE  612
            HHE+NQFCS H+LQ+VYI++FDQIDE
Sbjct  121  HHELNQFCSVHTLQEVYIELFDQIDE  146



>ref|XP_007170161.1| PREDICTED: erlin-2 isoform X2 [Balaenoptera acutorostrata scammoni]
Length=339

 Score =   183 bits (465),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 80/146 (55%), Positives = 109/146 (75%), Gaps = 0/146 (0%)
 Frame = +1

Query  175  LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFE  354
            ++ +   + V    L  + FS +H++ EGH+GVY+RGGALL++ + PGFHL LPFIT ++
Sbjct  1    MAQLGAVLAVAASFLCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGFHLMLPFITSYK  60

Query  355  PIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKI  534
             +Q TLQTD V+++PCGT GGVMI F++IEVVN L    VYD + NY   YD   I++KI
Sbjct  61   SVQTTLQTDEVKNVPCGTSGGVMIYFDRIEVVNFLVPHAVYDIVKNYTADYDKALIFNKI  120

Query  535  HHEINQFCSGHSLQQVYIDMFDQIDE  612
            HHE+NQFCS H+LQ+VYI++FDQIDE
Sbjct  121  HHELNQFCSVHTLQEVYIELFDQIDE  146



>gb|ELK08766.1| Erlin-2 [Pteropus alecto]
Length=370

 Score =   184 bits (467),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 80/147 (54%), Positives = 108/147 (73%), Gaps = 0/147 (0%)
 Frame = +1

Query  172  FLSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHF  351
             ++ +   V V       + FS +H++ EGH+GVY+RGGALL++ + PGFHL LPFIT +
Sbjct  31   LMAQLGAVVAVAASFFCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGFHLMLPFITSY  90

Query  352  EPIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDK  531
            + +Q TLQTD V+++PCGT GGVMI F++IEVVN L    VYD + NY   YD   I++K
Sbjct  91   KSVQTTLQTDEVKNVPCGTSGGVMIYFDRIEVVNFLVPNAVYDIVKNYTADYDKALIFNK  150

Query  532  IHHEINQFCSGHSLQQVYIDMFDQIDE  612
            IHHE+NQFCS H+LQ+VYI++FDQIDE
Sbjct  151  IHHELNQFCSVHTLQEVYIELFDQIDE  177



>ref|XP_005671838.1| PREDICTED: erlin-2 isoform X2 [Sus scrofa]
 ref|XP_005671839.1| PREDICTED: erlin-2 isoform X3 [Sus scrofa]
Length=339

 Score =   183 bits (465),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 80/146 (55%), Positives = 108/146 (74%), Gaps = 0/146 (0%)
 Frame = +1

Query  175  LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFE  354
            ++ +   V V       + FS +H++ EGH+GVY+RGGALL++ + PGFHL LPFIT ++
Sbjct  1    MAQLGAVVAVAASFFCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGFHLMLPFITSYK  60

Query  355  PIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKI  534
             +Q TLQTD V+++PCGT GGVMI F++IEVVN L    VYD + NY   YD   I++KI
Sbjct  61   SVQTTLQTDEVKNVPCGTSGGVMIYFDRIEVVNFLVPHAVYDIVKNYTADYDKALIFNKI  120

Query  535  HHEINQFCSGHSLQQVYIDMFDQIDE  612
            HHE+NQFCS H+LQ+VYI++FDQIDE
Sbjct  121  HHELNQFCSVHTLQEVYIELFDQIDE  146



>ref|XP_004428905.1| PREDICTED: erlin-2 isoform 1 [Ceratotherium simum simum]
Length=339

 Score =   183 bits (465),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 79/146 (54%), Positives = 107/146 (73%), Gaps = 0/146 (0%)
 Frame = +1

Query  175  LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFE  354
            ++ +     V       + FS +H++ EGH+GVY+RGGALL++ + PGFHL LPFIT ++
Sbjct  1    MAQLGAIAAVAASFFCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGFHLMLPFITSYK  60

Query  355  PIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKI  534
             +Q TLQTD V+++PCGT GGVMI F++IEVVN L    VYD + NY   YD   I++KI
Sbjct  61   SVQTTLQTDEVKNVPCGTSGGVMIYFDRIEVVNFLVPNAVYDIVKNYTADYDKALIFNKI  120

Query  535  HHEINQFCSGHSLQQVYIDMFDQIDE  612
            HHE+NQFCS H+LQ+VYI++FDQIDE
Sbjct  121  HHELNQFCSVHTLQEVYIELFDQIDE  146



>ref|XP_004021822.1| PREDICTED: erlin-2 [Ovis aries]
 ref|XP_005698880.1| PREDICTED: erlin-2 isoform X1 [Capra hircus]
 ref|XP_005698881.1| PREDICTED: erlin-2 isoform X2 [Capra hircus]
Length=338

 Score =   183 bits (464),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 80/146 (55%), Positives = 108/146 (74%), Gaps = 0/146 (0%)
 Frame = +1

Query  175  LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFE  354
            ++ +   V V       + FS +H++ EGH+GVY+RGGALL++ + PGFHL LPFIT ++
Sbjct  1    MAQLGAVVAVAASFFCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGFHLMLPFITSYK  60

Query  355  PIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKI  534
             +Q TLQTD V+++PCGT GGVMI F++IEVVN L    VYD + NY   YD   I++KI
Sbjct  61   SVQTTLQTDEVKNVPCGTSGGVMIYFDRIEVVNFLVPHAVYDIVKNYTADYDKALIFNKI  120

Query  535  HHEINQFCSGHSLQQVYIDMFDQIDE  612
            HHE+NQFCS H+LQ+VYI++FDQIDE
Sbjct  121  HHELNQFCSVHTLQEVYIELFDQIDE  146



>ref|NP_001167060.1| Erlin-2 precursor [Salmo salar]
 gb|ACN10713.1| Erlin-2 precursor [Salmo salar]
Length=330

 Score =   183 bits (464),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 78/127 (61%), Positives = 103/127 (81%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  FSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFEPIQVTLQTDLVRDIPCGTK  411
            FS++H++ EGH GVY+RGGALL+T ++PGFHL +PFIT+F+ +Q TLQTD V+++PCGT 
Sbjct  20   FSSVHKIEEGHTGVYYRGGALLTTTSSPGFHLMMPFITNFKSVQTTLQTDEVKNVPCGTG  79

Query  412  GGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKIHHEINQFCSGHSLQQVYID  591
            GGVMI F++IEVVN L    VYD + N+   YD   I++K+HHE+NQFCS HSLQ+VYI 
Sbjct  80   GGVMIYFDRIEVVNYLVPSAVYDIVKNFTADYDKALIFNKVHHELNQFCSVHSLQEVYIG  139

Query  592  MFDQIDE  612
            +FDQIDE
Sbjct  140  LFDQIDE  146



>ref|XP_006201197.1| PREDICTED: erlin-2 [Vicugna pacos]
Length=339

 Score =   183 bits (464),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 80/146 (55%), Positives = 108/146 (74%), Gaps = 0/146 (0%)
 Frame = +1

Query  175  LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFE  354
            ++ +   V V       + FS +H++ EGH+GVY+RGGALL++ + PGFHL LPFIT ++
Sbjct  1    MAQLGAVVAVAASFFCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGFHLMLPFITSYK  60

Query  355  PIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKI  534
             +Q TLQTD V+++PCGT GGVMI F++IEVVN L    VYD + NY   YD   I++KI
Sbjct  61   SVQTTLQTDEVKNVPCGTSGGVMIYFDRIEVVNFLVPHAVYDIVKNYTADYDKALIFNKI  120

Query  535  HHEINQFCSGHSLQQVYIDMFDQIDE  612
            HHE+NQFCS H+LQ+VYI++FDQIDE
Sbjct  121  HHELNQFCSVHTLQEVYIELFDQIDE  146



>ref|XP_005286570.1| PREDICTED: erlin-2 [Chrysemys picta bellii]
 ref|XP_005286571.1| PREDICTED: erlin-2 [Chrysemys picta bellii]
Length=333

 Score =   183 bits (464),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 82/142 (58%), Positives = 110/142 (77%), Gaps = 1/142 (1%)
 Frame = +1

Query  187  AIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFEPIQV  366
            AI  + V+  L+   FS +H++ EGH+GVY+RGGALL++ + PGFHL LPFIT ++ +Q 
Sbjct  6    AIAALSVS-FLAATLFSAVHKIEEGHIGVYYRGGALLTSTSGPGFHLMLPFITSYKSVQT  64

Query  367  TLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKIHHEI  546
            TLQTD V+++PCGT GGVMI F++IEVVN L +  VYD + NY   YD   I++KIHHE+
Sbjct  65   TLQTDEVKNVPCGTSGGVMIYFDRIEVVNFLIQGAVYDIVKNYTADYDKALIFNKIHHEL  124

Query  547  NQFCSGHSLQQVYIDMFDQIDE  612
            NQFCS H+LQ+VYI++FDQIDE
Sbjct  125  NQFCSVHTLQEVYIELFDQIDE  146



>ref|XP_006183419.1| PREDICTED: erlin-2 [Camelus ferus]
 ref|XP_010947448.1| PREDICTED: erlin-2 [Camelus bactrianus]
Length=339

 Score =   183 bits (464),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 80/146 (55%), Positives = 108/146 (74%), Gaps = 0/146 (0%)
 Frame = +1

Query  175  LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFE  354
            ++ +   V V       + FS +H++ EGH+GVY+RGGALL++ + PGFHL LPFIT ++
Sbjct  1    MAQLGAVVAVAASFFCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGFHLMLPFITSYK  60

Query  355  PIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKI  534
             +Q TLQTD V+++PCGT GGVMI F++IEVVN L    VYD + NY   YD   I++KI
Sbjct  61   SVQTTLQTDEVKNVPCGTSGGVMIYFDRIEVVNFLVPHAVYDIVKNYTADYDKALIFNKI  120

Query  535  HHEINQFCSGHSLQQVYIDMFDQIDE  612
            HHE+NQFCS H+LQ+VYI++FDQIDE
Sbjct  121  HHELNQFCSVHTLQEVYIELFDQIDE  146



>ref|XP_006509177.1| PREDICTED: erlin-2 isoform X2 [Mus musculus]
 ref|XP_006509178.1| PREDICTED: erlin-2 isoform X2 [Mus musculus]
Length=364

 Score =   184 bits (466),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 80/147 (54%), Positives = 109/147 (74%), Gaps = 0/147 (0%)
 Frame = +1

Query  172  FLSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHF  351
             ++ +   V V +     + FS +H++ EGH+GVY+RGGALL++ + PGFHL LPFIT +
Sbjct  24   LMAQLGAVVAVASSFFCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGFHLMLPFITSY  83

Query  352  EPIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDK  531
            + +Q TLQTD V+++PCGT GGVMI F++IEVVN L    VYD + NY   YD   I++K
Sbjct  84   KSVQTTLQTDEVKNVPCGTSGGVMIYFDRIEVVNFLVPNAVYDIVKNYTADYDKALIFNK  143

Query  532  IHHEINQFCSGHSLQQVYIDMFDQIDE  612
            IHHE+NQFCS H+LQ+VYI++FDQIDE
Sbjct  144  IHHELNQFCSVHTLQEVYIELFDQIDE  170



>ref|XP_006132694.1| PREDICTED: erlin-2 [Pelodiscus sinensis]
Length=333

 Score =   183 bits (464),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 79/132 (60%), Positives = 105/132 (80%), Gaps = 0/132 (0%)
 Frame = +1

Query  217  LSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFEPIQVTLQTDLVRDI  396
            L+   FS +H++ EGH+GVY+RGGALL++ + PGFHL LPFIT ++ +Q TLQTD V+++
Sbjct  15   LAAALFSAIHKIEEGHIGVYYRGGALLTSTSGPGFHLMLPFITSYKSVQTTLQTDEVKNV  74

Query  397  PCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKIHHEINQFCSGHSLQ  576
            PCGT GGVMI F++IEVVN L +  VYD + NY   YD   I++KIHHE+NQFCS H+LQ
Sbjct  75   PCGTSGGVMIYFDRIEVVNFLIQGAVYDIVKNYTADYDKALIFNKIHHELNQFCSVHTLQ  134

Query  577  QVYIDMFDQIDE  612
            +VYI++FDQIDE
Sbjct  135  EVYIELFDQIDE  146



>ref|XP_005362531.1| PREDICTED: erlin-2 [Microtus ochrogaster]
Length=339

 Score =   183 bits (464),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 80/146 (55%), Positives = 108/146 (74%), Gaps = 0/146 (0%)
 Frame = +1

Query  175  LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFE  354
            ++ +   V V       + FS +H++ EGH+GVY+RGGALL++ + PGFHL LPFIT ++
Sbjct  1    MAQLGAVVAVACSFFCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGFHLMLPFITSYK  60

Query  355  PIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKI  534
             +Q TLQTD V+++PCGT GGVMI F++IEVVN L    VYD + NY   YD   I++KI
Sbjct  61   SVQTTLQTDEVKNVPCGTSGGVMIYFDRIEVVNFLVPNAVYDIVKNYTADYDKALIFNKI  120

Query  535  HHEINQFCSGHSLQQVYIDMFDQIDE  612
            HHE+NQFCS H+LQ+VYI++FDQIDE
Sbjct  121  HHELNQFCSVHTLQEVYIELFDQIDE  146



>ref|XP_004428906.1| PREDICTED: erlin-2 isoform 2 [Ceratotherium simum simum]
Length=356

 Score =   183 bits (465),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 79/147 (54%), Positives = 107/147 (73%), Gaps = 0/147 (0%)
 Frame = +1

Query  172  FLSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHF  351
             ++ +     V       + FS +H++ EGH+GVY+RGGALL++ + PGFHL LPFIT +
Sbjct  17   LMAQLGAIAAVAASFFCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGFHLMLPFITSY  76

Query  352  EPIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDK  531
            + +Q TLQTD V+++PCGT GGVMI F++IEVVN L    VYD + NY   YD   I++K
Sbjct  77   KSVQTTLQTDEVKNVPCGTSGGVMIYFDRIEVVNFLVPNAVYDIVKNYTADYDKALIFNK  136

Query  532  IHHEINQFCSGHSLQQVYIDMFDQIDE  612
            IHHE+NQFCS H+LQ+VYI++FDQIDE
Sbjct  137  IHHELNQFCSVHTLQEVYIELFDQIDE  163



>ref|XP_007053523.1| PREDICTED: erlin-2 [Chelonia mydas]
Length=333

 Score =   182 bits (463),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 82/142 (58%), Positives = 110/142 (77%), Gaps = 1/142 (1%)
 Frame = +1

Query  187  AIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFEPIQV  366
            AI  + V+  L+   FS +H++ EGH+GVY+RGGALL++ + PGFHL LPFIT ++ +Q 
Sbjct  6    AIAALSVS-FLAAALFSAVHKIEEGHIGVYYRGGALLTSTSGPGFHLMLPFITSYKSVQT  64

Query  367  TLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKIHHEI  546
            TLQTD V+++PCGT GGVMI F++IEVVN L +  VYD + NY   YD   I++KIHHE+
Sbjct  65   TLQTDEVKNVPCGTSGGVMIYFDRIEVVNFLIQGAVYDIVKNYTADYDKALIFNKIHHEL  124

Query  547  NQFCSGHSLQQVYIDMFDQIDE  612
            NQFCS H+LQ+VYI++FDQIDE
Sbjct  125  NQFCSVHTLQEVYIELFDQIDE  146



>ref|XP_005226182.1| PREDICTED: erlin-2 isoform X3 [Bos taurus]
 ref|XP_010837088.1| PREDICTED: erlin-2 isoform X2 [Bison bison bison]
Length=352

 Score =   183 bits (464),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 80/146 (55%), Positives = 108/146 (74%), Gaps = 0/146 (0%)
 Frame = +1

Query  175  LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFE  354
            ++ +   V V       + FS +H++ EGH+GVY+RGGALL++ + PGFHL LPFIT ++
Sbjct  15   MAQLGAVVAVAASFFCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGFHLMLPFITSYK  74

Query  355  PIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKI  534
             +Q TLQTD V+++PCGT GGVMI F++IEVVN L    VYD + NY   YD   I++KI
Sbjct  75   SVQTTLQTDEVKNVPCGTSGGVMIYFDRIEVVNFLVPHAVYDIVKNYTADYDKALIFNKI  134

Query  535  HHEINQFCSGHSLQQVYIDMFDQIDE  612
            HHE+NQFCS H+LQ+VYI++FDQIDE
Sbjct  135  HHELNQFCSVHTLQEVYIELFDQIDE  160



>ref|XP_010874935.1| PREDICTED: erlin-2 isoform X1 [Esox lucius]
Length=342

 Score =   182 bits (463),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 77/127 (61%), Positives = 102/127 (80%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  FSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFEPIQVTLQTDLVRDIPCGTK  411
            F+++H++ EGH GVY+RGGALL+T ++PGFHL +PFIT F+ +Q TLQTD V+++PCGT 
Sbjct  32   FASVHKIEEGHTGVYYRGGALLTTTSSPGFHLMMPFITSFKSVQTTLQTDEVKNVPCGTS  91

Query  412  GGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKIHHEINQFCSGHSLQQVYID  591
            GGVMI F++IEVVN L    VYD + N+   YD   I++K+HHE+NQFCS HSLQ+VYI 
Sbjct  92   GGVMIYFDRIEVVNYLVPSAVYDIVRNFTADYDKALIFNKVHHELNQFCSVHSLQEVYIG  151

Query  592  MFDQIDE  612
            +FDQIDE
Sbjct  152  LFDQIDE  158



>ref|NP_001137178.1| erlin-2 precursor [Sus scrofa]
 gb|ACK36978.1| ER lipid raft-associated 2 isoform 2 [Sus scrofa]
Length=339

 Score =   182 bits (463),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 79/146 (54%), Positives = 108/146 (74%), Gaps = 0/146 (0%)
 Frame = +1

Query  175  LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFE  354
            ++ +   V V       + FS +H++ EGH+GVY+RGGALL++ + PGFHL LPFIT ++
Sbjct  1    MAQLGAVVAVAASFFCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGFHLMLPFITSYK  60

Query  355  PIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKI  534
             +Q TLQTD V+++PCGT GGVMI F+++EVVN L    VYD + NY   YD   I++KI
Sbjct  61   SVQTTLQTDEVKNVPCGTSGGVMIYFDRVEVVNFLVPHAVYDIVKNYTADYDKALIFNKI  120

Query  535  HHEINQFCSGHSLQQVYIDMFDQIDE  612
            HHE+NQFCS H+LQ+VYI++FDQIDE
Sbjct  121  HHELNQFCSVHTLQEVYIELFDQIDE  146



>ref|XP_009969602.1| PREDICTED: erlin-1, partial [Tyto alba]
Length=180

 Score =   177 bits (450),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 80/139 (58%), Positives = 107/139 (77%), Gaps = 0/139 (0%)
 Frame = +1

Query  196  VMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFEPIQVTLQ  375
            V   T LL    +S++H+V EGH+ VY+RGGALL++ + PG+H+ LPFIT F+ +Q TLQ
Sbjct  2    VAAATGLLVFFLYSSIHKVEEGHLAVYYRGGALLTSPSGPGYHIMLPFITTFKSVQTTLQ  61

Query  376  TDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKIHHEINQF  555
            TD V+++PCGT GGVMI  ++IEVVN+L    VYD + NY   YD T I++KIHHE+NQF
Sbjct  62   TDEVKNVPCGTSGGVMIYIDRIEVVNKLAPYAVYDIVRNYTADYDKTLIFNKIHHELNQF  121

Query  556  CSGHSLQQVYIDMFDQIDE  612
            CS H+LQ+VYI++FDQIDE
Sbjct  122  CSAHTLQEVYIELFDQIDE  140



>ref|XP_424380.1| PREDICTED: erlin-2 [Gallus gallus]
 ref|XP_010721409.1| PREDICTED: erlin-2 [Meleagris gallopavo]
Length=342

 Score =   182 bits (463),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 79/146 (54%), Positives = 109/146 (75%), Gaps = 0/146 (0%)
 Frame = +1

Query  175  LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFE  354
            ++ +     +V   L+    S +H++ EGH+GVY+RGGALL++ + PGFHL LPFIT ++
Sbjct  1    MAQLGAIAALVLSFLAAAFLSAIHKIEEGHIGVYYRGGALLTSTSGPGFHLMLPFITSYK  60

Query  355  PIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKI  534
             +Q TLQTD V+++PCGT GGVMI F++IEVVN L +  VYD + NY   YD   I++KI
Sbjct  61   SVQTTLQTDEVKNVPCGTSGGVMIYFDRIEVVNFLIQSAVYDIVKNYTADYDKALIFNKI  120

Query  535  HHEINQFCSGHSLQQVYIDMFDQIDE  612
            HHE+NQFCS H+LQ+VYI++FDQIDE
Sbjct  121  HHELNQFCSVHTLQEVYIELFDQIDE  146



>ref|XP_010874936.1| PREDICTED: erlin-2 isoform X2 [Esox lucius]
Length=330

 Score =   182 bits (462),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 77/127 (61%), Positives = 102/127 (80%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  FSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFEPIQVTLQTDLVRDIPCGTK  411
            F+++H++ EGH GVY+RGGALL+T ++PGFHL +PFIT F+ +Q TLQTD V+++PCGT 
Sbjct  20   FASVHKIEEGHTGVYYRGGALLTTTSSPGFHLMMPFITSFKSVQTTLQTDEVKNVPCGTS  79

Query  412  GGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKIHHEINQFCSGHSLQQVYID  591
            GGVMI F++IEVVN L    VYD + N+   YD   I++K+HHE+NQFCS HSLQ+VYI 
Sbjct  80   GGVMIYFDRIEVVNYLVPSAVYDIVRNFTADYDKALIFNKVHHELNQFCSVHSLQEVYIG  139

Query  592  MFDQIDE  612
            +FDQIDE
Sbjct  140  LFDQIDE  146



>ref|XP_010837091.1| PREDICTED: erlin-2 isoform X4 [Bison bison bison]
Length=367

 Score =   183 bits (465),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 80/146 (55%), Positives = 108/146 (74%), Gaps = 0/146 (0%)
 Frame = +1

Query  175  LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFE  354
            ++ +   V V       + FS +H++ EGH+GVY+RGGALL++ + PGFHL LPFIT ++
Sbjct  30   MAQLGAVVAVAASFFCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGFHLMLPFITSYK  89

Query  355  PIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKI  534
             +Q TLQTD V+++PCGT GGVMI F++IEVVN L    VYD + NY   YD   I++KI
Sbjct  90   SVQTTLQTDEVKNVPCGTSGGVMIYFDRIEVVNFLVPHAVYDIVKNYTADYDKALIFNKI  149

Query  535  HHEINQFCSGHSLQQVYIDMFDQIDE  612
            HHE+NQFCS H+LQ+VYI++FDQIDE
Sbjct  150  HHELNQFCSVHTLQEVYIELFDQIDE  175



>ref|XP_011370460.1| PREDICTED: erlin-2 isoform X1 [Pteropus vampyrus]
Length=382

 Score =   184 bits (466),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 80/147 (54%), Positives = 108/147 (73%), Gaps = 0/147 (0%)
 Frame = +1

Query  172  FLSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHF  351
             ++ +   V V       + FS +H++ EGH+GVY+RGGALL++ + PGFHL LPFIT +
Sbjct  43   LMAQLGAVVAVAASFFCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGFHLMLPFITSY  102

Query  352  EPIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDK  531
            + +Q TLQTD V+++PCGT GGVMI F++IEVVN L    VYD + NY   YD   I++K
Sbjct  103  KSVQTTLQTDEVKNVPCGTSGGVMIYFDRIEVVNFLVPNAVYDIVKNYTADYDKALIFNK  162

Query  532  IHHEINQFCSGHSLQQVYIDMFDQIDE  612
            IHHE+NQFCS H+LQ+VYI++FDQIDE
Sbjct  163  IHHELNQFCSVHTLQEVYIELFDQIDE  189



>ref|XP_007448371.1| PREDICTED: erlin-2 isoform X1 [Lipotes vexillifer]
Length=368

 Score =   183 bits (465),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 80/147 (54%), Positives = 109/147 (74%), Gaps = 0/147 (0%)
 Frame = +1

Query  172  FLSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHF  351
             ++ +   + V    L  + FS +H++ EGH+GVY+RGGALL++ + PGFHL LPFIT +
Sbjct  29   LMAQLGAVLAVAASFLCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGFHLMLPFITSY  88

Query  352  EPIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDK  531
            + +Q TLQTD V+++PCGT GGVMI F++IEVVN L    VYD + NY   YD   I++K
Sbjct  89   KSVQTTLQTDEVKNVPCGTSGGVMIYFDRIEVVNFLVPHAVYDIVKNYTADYDKALIFNK  148

Query  532  IHHEINQFCSGHSLQQVYIDMFDQIDE  612
            IHHE+NQFCS H+LQ+VYI++FDQIDE
Sbjct  149  IHHELNQFCSVHTLQEVYIELFDQIDE  175



>ref|XP_009010827.1| hypothetical protein HELRODRAFT_190088 [Helobdella robusta]
 gb|ESO10558.1| hypothetical protein HELRODRAFT_190088 [Helobdella robusta]
Length=323

 Score =   181 bits (460),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 79/125 (63%), Positives = 102/125 (82%), Gaps = 0/125 (0%)
 Frame = +1

Query  238  TLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFEPIQVTLQTDLVRDIPCGTKGG  417
            +LH++ EGHVGVY+RGGALL+T ++PG+H+ +PFIT F  +Q TLQTD V+++PCGT GG
Sbjct  25   SLHKIEEGHVGVYYRGGALLTTTSSPGYHIMIPFITTFRSVQTTLQTDEVKNVPCGTSGG  84

Query  418  VMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKIHHEINQFCSGHSLQQVYIDMF  597
            VMI F++IEVVN L    VYD + NY   YD T IY+KIHHE+NQFCS H+LQ+VYI++F
Sbjct  85   VMIYFDRIEVVNVLSPSAVYDIVKNYTADYDKTLIYNKIHHELNQFCSVHNLQEVYINLF  144

Query  598  DQIDE  612
            DQIDE
Sbjct  145  DQIDE  149



>ref|XP_011444952.1| PREDICTED: erlin-2-like [Crassostrea gigas]
 ref|XP_011444961.1| PREDICTED: erlin-2-like [Crassostrea gigas]
Length=327

 Score =   182 bits (461),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 77/125 (62%), Positives = 101/125 (81%), Gaps = 0/125 (0%)
 Frame = +1

Query  238  TLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFEPIQVTLQTDLVRDIPCGTKGG  417
            ++H++ EGHVGVY+RGGALLST ++PG+H  +P IT F  +Q TLQTD V+++PCGT GG
Sbjct  23   SIHKIEEGHVGVYYRGGALLSTTSSPGYHFMVPIITSFRSVQTTLQTDEVKNVPCGTSGG  82

Query  418  VMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKIHHEINQFCSGHSLQQVYIDMF  597
            VMI F+++EVVN+L    V+D + NY   YD T IY+KIHHE+NQFCS H+LQ+VYID+F
Sbjct  83   VMIYFDRVEVVNKLDSYAVFDIVRNYTADYDKTLIYNKIHHELNQFCSVHNLQEVYIDLF  142

Query  598  DQIDE  612
            DQIDE
Sbjct  143  DQIDE  147



>ref|XP_005671837.1| PREDICTED: erlin-2 isoform X1 [Sus scrofa]
Length=368

 Score =   182 bits (463),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 80/147 (54%), Positives = 108/147 (73%), Gaps = 0/147 (0%)
 Frame = +1

Query  172  FLSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHF  351
             ++ +   V V       + FS +H++ EGH+GVY+RGGALL++ + PGFHL LPFIT +
Sbjct  29   LMAQLGAVVAVAASFFCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGFHLMLPFITSY  88

Query  352  EPIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDK  531
            + +Q TLQTD V+++PCGT GGVMI F++IEVVN L    VYD + NY   YD   I++K
Sbjct  89   KSVQTTLQTDEVKNVPCGTSGGVMIYFDRIEVVNFLVPHAVYDIVKNYTADYDKALIFNK  148

Query  532  IHHEINQFCSGHSLQQVYIDMFDQIDE  612
            IHHE+NQFCS H+LQ+VYI++FDQIDE
Sbjct  149  IHHELNQFCSVHTLQEVYIELFDQIDE  175



>ref|XP_007170160.1| PREDICTED: erlin-2 isoform X1 [Balaenoptera acutorostrata scammoni]
Length=368

 Score =   182 bits (463),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 80/146 (55%), Positives = 109/146 (75%), Gaps = 0/146 (0%)
 Frame = +1

Query  175  LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFE  354
            ++ +   + V    L  + FS +H++ EGH+GVY+RGGALL++ + PGFHL LPFIT ++
Sbjct  30   MAQLGAVLAVAASFLCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGFHLMLPFITSYK  89

Query  355  PIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKI  534
             +Q TLQTD V+++PCGT GGVMI F++IEVVN L    VYD + NY   YD   I++KI
Sbjct  90   SVQTTLQTDEVKNVPCGTSGGVMIYFDRIEVVNFLVPHAVYDIVKNYTADYDKALIFNKI  149

Query  535  HHEINQFCSGHSLQQVYIDMFDQIDE  612
            HHE+NQFCS H+LQ+VYI++FDQIDE
Sbjct  150  HHELNQFCSVHTLQEVYIELFDQIDE  175



>ref|XP_004696558.1| PREDICTED: erlin-2 [Echinops telfairi]
Length=357

 Score =   182 bits (462),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 79/146 (54%), Positives = 109/146 (75%), Gaps = 0/146 (0%)
 Frame = +1

Query  175  LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFE  354
            ++ +   V +      ++ FS +H++ EGH+GVY+RGGALL++ + PGFHL LPFIT ++
Sbjct  1    MAQLGAVVALAAGFFCSSLFSAVHKIEEGHIGVYYRGGALLTSTSGPGFHLMLPFITSYK  60

Query  355  PIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKI  534
             +Q TLQTD V+++PCGT GGVMI F++IEVVN L    VYD + NY   YD   I++KI
Sbjct  61   SVQTTLQTDEVKNVPCGTSGGVMIYFDRIEVVNFLVPNAVYDIVKNYTADYDKALIFNKI  120

Query  535  HHEINQFCSGHSLQQVYIDMFDQIDE  612
            HHE+NQFCS H+LQ+VYI++FDQIDE
Sbjct  121  HHELNQFCSVHTLQEVYIELFDQIDE  146



>ref|XP_010561072.1| PREDICTED: erlin-2 isoform X1 [Haliaeetus leucocephalus]
Length=342

 Score =   182 bits (461),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 78/132 (59%), Positives = 104/132 (79%), Gaps = 0/132 (0%)
 Frame = +1

Query  217  LSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFEPIQVTLQTDLVRDI  396
            L+    S +H++ EGH+GVY+RGGALL++ + PGFHL LPFIT ++ +Q TLQTD V+++
Sbjct  15   LAAAFLSAIHKIEEGHIGVYYRGGALLTSTSGPGFHLMLPFITSYKSVQTTLQTDEVKNV  74

Query  397  PCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKIHHEINQFCSGHSLQ  576
            PCGT GGVMI F++IEVVN L +  VYD + NY   YD   I++KIHHE+NQFCS H+LQ
Sbjct  75   PCGTSGGVMIYFDRIEVVNFLIQSAVYDIVKNYTADYDKALIFNKIHHELNQFCSVHTLQ  134

Query  577  QVYIDMFDQIDE  612
            +VYI++FDQIDE
Sbjct  135  EVYIELFDQIDE  146



>ref|XP_007436946.1| PREDICTED: erlin-2 [Python bivittatus]
Length=335

 Score =   181 bits (460),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 78/127 (61%), Positives = 103/127 (81%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  FSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFEPIQVTLQTDLVRDIPCGTK  411
            FS +H++ EGH+GVY+RGGALL++ + PGFHL LPFIT ++ +Q TLQTD V+++PCGT 
Sbjct  20   FSAVHKIEEGHIGVYYRGGALLTSTSGPGFHLMLPFITSYKSVQTTLQTDEVKNVPCGTS  79

Query  412  GGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKIHHEINQFCSGHSLQQVYID  591
            GGVMI F++IEVVN L +  VYD + NY   YD   I++KIHHE+NQFCS H+LQ+VYI+
Sbjct  80   GGVMIYFDRIEVVNFLIQSAVYDIVKNYTADYDKALIFNKIHHELNQFCSVHTLQEVYIE  139

Query  592  MFDQIDE  612
            +FDQIDE
Sbjct  140  LFDQIDE  146



>ref|XP_010979431.1| PREDICTED: erlin-2 [Camelus dromedarius]
Length=368

 Score =   182 bits (463),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 80/147 (54%), Positives = 108/147 (73%), Gaps = 0/147 (0%)
 Frame = +1

Query  172  FLSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHF  351
             ++ +   V V       + FS +H++ EGH+GVY+RGGALL++ + PGFHL LPFIT +
Sbjct  29   LMAQLGAVVAVAASFFCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGFHLMLPFITSY  88

Query  352  EPIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDK  531
            + +Q TLQTD V+++PCGT GGVMI F++IEVVN L    VYD + NY   YD   I++K
Sbjct  89   KSVQTTLQTDEVKNVPCGTSGGVMIYFDRIEVVNFLVPHAVYDIVKNYTADYDKALIFNK  148

Query  532  IHHEINQFCSGHSLQQVYIDMFDQIDE  612
            IHHE+NQFCS H+LQ+VYI++FDQIDE
Sbjct  149  IHHELNQFCSVHTLQEVYIELFDQIDE  175



>ref|XP_005142523.1| PREDICTED: erlin-2 [Melopsittacus undulatus]
Length=342

 Score =   181 bits (460),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 78/132 (59%), Positives = 104/132 (79%), Gaps = 0/132 (0%)
 Frame = +1

Query  217  LSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFEPIQVTLQTDLVRDI  396
            L+    S +H++ EGH+GVY+RGGALL++ + PGFHL LPFIT ++ +Q TLQTD V+++
Sbjct  15   LAAAFLSAIHKIEEGHIGVYYRGGALLTSTSGPGFHLMLPFITSYKSVQTTLQTDEVKNV  74

Query  397  PCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKIHHEINQFCSGHSLQ  576
            PCGT GGVMI F++IEVVN L +  VYD + NY   YD   I++KIHHE+NQFCS H+LQ
Sbjct  75   PCGTSGGVMIYFDRIEVVNFLIQSAVYDIVKNYTADYDKALIFNKIHHELNQFCSVHTLQ  134

Query  577  QVYIDMFDQIDE  612
            +VYI++FDQIDE
Sbjct  135  EVYIELFDQIDE  146



>ref|XP_001381844.1| PREDICTED: erlin-2 isoform X1 [Monodelphis domestica]
 ref|XP_007476399.1| PREDICTED: erlin-2 isoform X2 [Monodelphis domestica]
Length=338

 Score =   181 bits (460),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 78/127 (61%), Positives = 102/127 (80%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  FSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFEPIQVTLQTDLVRDIPCGTK  411
            FS +H++ EGH+GVY+RGGALL++ + PGFHL LPFIT ++ +Q TLQTD V+++PCGT 
Sbjct  20   FSAVHKIEEGHIGVYYRGGALLTSTSGPGFHLMLPFITSYKSVQTTLQTDEVKNVPCGTS  79

Query  412  GGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKIHHEINQFCSGHSLQQVYID  591
            GGVMI F++IEVVN L    VYD + NY   YD   I++KIHHE+NQFCS H+LQ+VYI+
Sbjct  80   GGVMIYFDRIEVVNFLISNAVYDIVKNYTADYDKALIFNKIHHELNQFCSVHTLQEVYIE  139

Query  592  MFDQIDE  612
            +FDQIDE
Sbjct  140  LFDQIDE  146



>gb|ELU09244.1| hypothetical protein CAPTEDRAFT_175010 [Capitella teleta]
Length=323

 Score =   181 bits (458),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 84/146 (58%), Positives = 110/146 (75%), Gaps = 4/146 (3%)
 Frame = +1

Query  175  LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFE  354
            + FIA  + +   LL+   FS LH++ EGHVGVY+RGGALLS+ + PG+H+ LP IT + 
Sbjct  6    VGFIAAGMALTAVLLN---FS-LHKIDEGHVGVYYRGGALLSSTSGPGYHVMLPLITTYR  61

Query  355  PIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKI  534
             +Q T+QTD V+++PCGT GGVMI F++IEVVN LR   V+D + NY   YD   IY+KI
Sbjct  62   TVQTTMQTDEVKNVPCGTSGGVMIYFDRIEVVNMLRPSQVFDIVKNYTADYDRALIYNKI  121

Query  535  HHEINQFCSGHSLQQVYIDMFDQIDE  612
            HHE+NQFCS H+LQ+VYID+FDQIDE
Sbjct  122  HHELNQFCSIHNLQEVYIDLFDQIDE  147



>ref|XP_010154781.1| PREDICTED: erlin-1 [Eurypyga helias]
Length=347

 Score =   181 bits (459),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 77/127 (61%), Positives = 103/127 (81%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  FSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFEPIQVTLQTDLVRDIPCGTK  411
            +S++H+V EGH+ VY+RGGALLS+ + PG+H+ LPFIT F+ +Q TLQTD V+++PCGT 
Sbjct  22   YSSIHRVEEGHLAVYYRGGALLSSPSGPGYHIMLPFITTFKSVQTTLQTDEVKNVPCGTS  81

Query  412  GGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKIHHEINQFCSGHSLQQVYID  591
            GGVMI  ++IEVVN+L    VYD + NY   YD T I++KIHHE+NQFCS H+LQ+VYI+
Sbjct  82   GGVMIYIDRIEVVNKLAPYAVYDIVRNYTADYDKTLIFNKIHHELNQFCSAHTLQEVYIE  141

Query  592  MFDQIDE  612
            +FDQIDE
Sbjct  142  LFDQIDE  148



>gb|KFQ73480.1| Erlin-1 [Phoenicopterus ruber ruber]
Length=188

 Score =   176 bits (447),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 76/127 (60%), Positives = 103/127 (81%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  FSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFEPIQVTLQTDLVRDIPCGTK  411
            +S++H+V EGH+ VY+RGGALL++ + PG+H+ LPFIT F+ +Q TLQTD V+++PCGT 
Sbjct  22   YSSIHKVEEGHLAVYYRGGALLTSPSGPGYHIMLPFITTFKSVQTTLQTDEVKNVPCGTS  81

Query  412  GGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKIHHEINQFCSGHSLQQVYID  591
            GGVMI  ++IEVVN+L    VYD + NY   YD T I++KIHHE+NQFCS H+LQ+VYI+
Sbjct  82   GGVMIYIDRIEVVNKLAPYAVYDIVRNYTADYDKTLIFNKIHHELNQFCSAHTLQEVYIE  141

Query  592  MFDQIDE  612
            +FDQIDE
Sbjct  142  LFDQIDE  148



>ref|XP_003758037.1| PREDICTED: erlin-2 [Sarcophilus harrisii]
Length=338

 Score =   181 bits (458),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 78/127 (61%), Positives = 102/127 (80%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  FSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFEPIQVTLQTDLVRDIPCGTK  411
            FS +H++ EGH+GVY+RGGALL++ + PGFHL LPFIT ++ +Q TLQTD V+++PCGT 
Sbjct  20   FSAVHKIEEGHIGVYYRGGALLTSTSGPGFHLMLPFITSYKSVQTTLQTDEVKNVPCGTS  79

Query  412  GGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKIHHEINQFCSGHSLQQVYID  591
            GGVMI F++IEVVN L    VYD + NY   YD   I++KIHHE+NQFCS H+LQ+VYI+
Sbjct  80   GGVMIYFDRIEVVNFLIPNAVYDIVKNYTADYDKALIFNKIHHELNQFCSVHTLQEVYIE  139

Query  592  MFDQIDE  612
            +FDQIDE
Sbjct  140  LFDQIDE  146



>ref|XP_009879907.1| PREDICTED: erlin-1 [Charadrius vociferus]
Length=347

 Score =   181 bits (458),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 77/127 (61%), Positives = 103/127 (81%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  FSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFEPIQVTLQTDLVRDIPCGTK  411
            +S++H+V EGH+ VY+RGGALLS+ + PG+H+ LPFIT F+ +Q TLQTD V+++PCGT 
Sbjct  22   YSSIHKVEEGHLAVYYRGGALLSSPSGPGYHIMLPFITTFKSVQTTLQTDEVKNVPCGTS  81

Query  412  GGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKIHHEINQFCSGHSLQQVYID  591
            GGVMI  ++IEVVN+L    VYD + NY   YD T I++KIHHE+NQFCS H+LQ+VYI+
Sbjct  82   GGVMIYIDRIEVVNKLAPYAVYDIVRNYTADYDKTLIFNKIHHELNQFCSAHTLQEVYIE  141

Query  592  MFDQIDE  612
            +FDQIDE
Sbjct  142  LFDQIDE  148



>ref|XP_005273448.1| PREDICTED: erlin-2 isoform X1 [Homo sapiens]
Length=451

 Score =   183 bits (465),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 80/147 (54%), Positives = 109/147 (74%), Gaps = 0/147 (0%)
 Frame = +1

Query  172  FLSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHF  351
             ++ +   V V +     + FS +H++ EGH+GVY+RGGALL++ + PGFHL LPFIT +
Sbjct  112  LMAQLGAVVAVASSFFCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGFHLMLPFITSY  171

Query  352  EPIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDK  531
            + +Q TLQTD V+++PCGT GGVMI F++IEVVN L    VYD + NY   YD   I++K
Sbjct  172  KSVQTTLQTDEVKNVPCGTSGGVMIYFDRIEVVNFLVPNAVYDIVKNYTADYDKALIFNK  231

Query  532  IHHEINQFCSGHSLQQVYIDMFDQIDE  612
            IHHE+NQFCS H+LQ+VYI++FDQIDE
Sbjct  232  IHHELNQFCSVHTLQEVYIELFDQIDE  258



>gb|EJW75533.1| erlin-2 [Wuchereria bancrofti]
Length=218

 Score =   177 bits (448),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 77/125 (62%), Positives = 98/125 (78%), Gaps = 0/125 (0%)
 Frame = +1

Query  238  TLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFEPIQVTLQTDLVRDIPCGTKGG  417
             LH + EGHVGVY+RGGALLS ++ PG+HL  PF T ++ +QVTLQTD  +++PCGT GG
Sbjct  21   ALHHIEEGHVGVYYRGGALLSRVSQPGYHLMFPFFTTYKSVQVTLQTDEAKNVPCGTSGG  80

Query  418  VMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKIHHEINQFCSGHSLQQVYIDMF  597
            VMI F++IEVVN L    VYD + NY V YD   I++K+HHE+NQFCS H+LQ+VYID+F
Sbjct  81   VMIYFDRIEVVNILSSSSVYDIVKNYTVDYDRPLIFNKVHHEVNQFCSSHTLQEVYIDLF  140

Query  598  DQIDE  612
            DQIDE
Sbjct  141  DQIDE  145



>ref|XP_002186753.1| PREDICTED: erlin-1 [Taeniopygia guttata]
Length=188

 Score =   176 bits (445),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 76/127 (60%), Positives = 102/127 (80%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  FSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFEPIQVTLQTDLVRDIPCGTK  411
            +S +H+V EGH+ VY+RGGALL++ + PG+H+ LPFIT F+ +Q TLQTD V+++PCGT 
Sbjct  22   YSAIHRVEEGHLAVYYRGGALLTSPSGPGYHIMLPFITTFKSVQTTLQTDEVKNVPCGTS  81

Query  412  GGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKIHHEINQFCSGHSLQQVYID  591
            GGVMI  ++IEVVN+L    VYD + NY   YD T I++KIHHE+NQFCS H+LQ+VYI+
Sbjct  82   GGVMIYIDRIEVVNKLAPYAVYDIVRNYTADYDKTLIFNKIHHELNQFCSAHTLQEVYIE  141

Query  592  MFDQIDE  612
            +FDQIDE
Sbjct  142  LFDQIDE  148



>ref|XP_009511928.1| PREDICTED: erlin-1, partial [Phalacrocorax carbo]
Length=166

 Score =   175 bits (443),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 76/127 (60%), Positives = 102/127 (80%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  FSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFEPIQVTLQTDLVRDIPCGTK  411
            +S++H+V EGH+ VY+RGGALL+  + PG+H+ LPFIT F+ +Q TLQTD V+++PCGT 
Sbjct  20   YSSIHKVEEGHLAVYYRGGALLTNPSGPGYHIMLPFITTFKSVQTTLQTDEVKNVPCGTS  79

Query  412  GGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKIHHEINQFCSGHSLQQVYID  591
            GGVMI  ++IEVVN+L    VYD + NY   YD T I++KIHHE+NQFCS H+LQ+VYI+
Sbjct  80   GGVMIYIDRIEVVNKLAPYAVYDIVRNYTADYDKTLIFNKIHHELNQFCSAHTLQEVYIE  139

Query  592  MFDQIDE  612
            +FDQIDE
Sbjct  140  LFDQIDE  146



>ref|XP_005226181.1| PREDICTED: erlin-2 isoform X2 [Bos taurus]
Length=418

 Score =   182 bits (462),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 80/146 (55%), Positives = 108/146 (74%), Gaps = 0/146 (0%)
 Frame = +1

Query  175  LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFE  354
            ++ +   V V       + FS +H++ EGH+GVY+RGGALL++ + PGFHL LPFIT ++
Sbjct  81   MAQLGAVVAVAASFFCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGFHLMLPFITSYK  140

Query  355  PIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKI  534
             +Q TLQTD V+++PCGT GGVMI F++IEVVN L    VYD + NY   YD   I++KI
Sbjct  141  SVQTTLQTDEVKNVPCGTSGGVMIYFDRIEVVNFLVPHAVYDIVKNYTADYDKALIFNKI  200

Query  535  HHEINQFCSGHSLQQVYIDMFDQIDE  612
            HHE+NQFCS H+LQ+VYI++FDQIDE
Sbjct  201  HHELNQFCSVHTLQEVYIELFDQIDE  226



>ref|XP_010837087.1| PREDICTED: erlin-2 isoform X1 [Bison bison bison]
Length=418

 Score =   182 bits (462),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 80/146 (55%), Positives = 108/146 (74%), Gaps = 0/146 (0%)
 Frame = +1

Query  175  LSFIAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFE  354
            ++ +   V V       + FS +H++ EGH+GVY+RGGALL++ + PGFHL LPFIT ++
Sbjct  81   MAQLGAVVAVAASFFCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGFHLMLPFITSYK  140

Query  355  PIQVTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKI  534
             +Q TLQTD V+++PCGT GGVMI F++IEVVN L    VYD + NY   YD   I++KI
Sbjct  141  SVQTTLQTDEVKNVPCGTSGGVMIYFDRIEVVNFLVPHAVYDIVKNYTADYDKALIFNKI  200

Query  535  HHEINQFCSGHSLQQVYIDMFDQIDE  612
            HHE+NQFCS H+LQ+VYI++FDQIDE
Sbjct  201  HHELNQFCSVHTLQEVYIELFDQIDE  226



>ref|XP_005089259.1| PREDICTED: erlin-1-like isoform X1 [Aplysia californica]
 ref|XP_005089260.1| PREDICTED: erlin-1-like isoform X2 [Aplysia californica]
Length=331

 Score =   180 bits (456),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 77/125 (62%), Positives = 99/125 (79%), Gaps = 0/125 (0%)
 Frame = +1

Query  238  TLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFEPIQVTLQTDLVRDIPCGTKGG  417
            ++H++ EGHVGVY+RGGALLS  + PG+H  LP +T F  +Q TLQTD V+++PCGT GG
Sbjct  23   SIHKIEEGHVGVYYRGGALLSKTSEPGYHFMLPALTSFRSVQTTLQTDEVKNVPCGTSGG  82

Query  418  VMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKIHHEINQFCSGHSLQQVYIDMF  597
            V+I FE+IEVVN+L    V+D + NY   YD T IY+KIHHE+NQFCS H+LQ+VYID+F
Sbjct  83   VIIYFERIEVVNKLDINAVFDIVKNYTADYDKTLIYNKIHHELNQFCSAHNLQEVYIDLF  142

Query  598  DQIDE  612
            DQIDE
Sbjct  143  DQIDE  147



>ref|XP_005017337.1| PREDICTED: erlin-1 isoform X1 [Anas platyrhynchos]
Length=347

 Score =   180 bits (457),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 76/127 (60%), Positives = 103/127 (81%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  FSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFEPIQVTLQTDLVRDIPCGTK  411
            ++++H+V EGH+ VY+RGGALLS+ + PG+H+ LPFIT F+ +Q TLQTD V+++PCGT 
Sbjct  22   YASIHKVEEGHLAVYYRGGALLSSPSGPGYHIMLPFITTFKSVQTTLQTDEVKNVPCGTS  81

Query  412  GGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKIHHEINQFCSGHSLQQVYID  591
            GGVMI  ++IEVVN+L    VYD + NY   YD T I++KIHHE+NQFCS H+LQ+VYI+
Sbjct  82   GGVMIYIDRIEVVNKLAPYAVYDIVKNYTADYDKTLIFNKIHHELNQFCSAHTLQEVYIE  141

Query  592  MFDQIDE  612
            +FDQIDE
Sbjct  142  LFDQIDE  148



>ref|XP_004622491.1| PREDICTED: erlin-2-like [Sorex araneus]
Length=319

 Score =   179 bits (455),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 78/123 (63%), Positives = 101/123 (82%), Gaps = 0/123 (0%)
 Frame = +1

Query  244  HQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFEPIQVTLQTDLVRDIPCGTKGGVM  423
            H++ EGHVGVY+RGGALL  I+ PGFHL +PF+T   P+QVT+QTD V+++PCGT GGV+
Sbjct  24   HRIDEGHVGVYYRGGALLKIISHPGFHLMVPFLTSVRPVQVTMQTDEVKNVPCGTSGGVI  83

Query  424  INFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKIHHEINQFCSGHSLQQVYIDMFDQ  603
            + F++IEVVN L   +VYD + NY V YD T I+DK+HHE+NQFCS H+LQ+VYID+FDQ
Sbjct  84   VYFDRIEVVNILDIRYVYDIVKNYTVEYDKTLIFDKVHHEVNQFCSVHTLQEVYIDLFDQ  143

Query  604  IDE  612
            IDE
Sbjct  144  IDE  146



>ref|XP_009577783.1| PREDICTED: erlin-1 [Fulmarus glacialis]
Length=347

 Score =   180 bits (457),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 76/127 (60%), Positives = 102/127 (80%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  FSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFEPIQVTLQTDLVRDIPCGTK  411
            +S++H+V EGH+ VY+RGGALLS+ + PG+H+ LPF+T F  +Q TLQTD V+++PCGT 
Sbjct  22   YSSIHKVEEGHLAVYYRGGALLSSPSGPGYHIMLPFVTTFRSVQTTLQTDEVKNVPCGTS  81

Query  412  GGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKIHHEINQFCSGHSLQQVYID  591
            GGVMI  ++IEVVN+L    VYD + NY   YD T I++KIHHE+NQFCS H+LQ+VYI+
Sbjct  82   GGVMIYIDRIEVVNKLAPYAVYDIVRNYTADYDKTLIFNKIHHELNQFCSAHTLQEVYIE  141

Query  592  MFDQIDE  612
            +FDQIDE
Sbjct  142  LFDQIDE  148



>gb|EUB55643.1| Erlin-1 [Echinococcus granulosus]
 emb|CDS23713.1| erlin 1 [Echinococcus granulosus]
Length=379

 Score =   181 bits (458),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 76/126 (60%), Positives = 100/126 (79%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  STLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFEPIQVTLQTDLVRDIPCGTKG  414
            +++H++ EGHVGVY+RGGALL   + PGFHL +P IT F+ +Q TLQTD V+++PCGT G
Sbjct  24   ASIHKIEEGHVGVYYRGGALLKETSPPGFHLMIPLITTFKAVQTTLQTDEVKNVPCGTSG  83

Query  415  GVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKIHHEINQFCSGHSLQQVYIDM  594
            GV+I F++IEVVN L  E  Y+ + NY   YD T IY+K+HHE+NQFCS H+LQ+VYID+
Sbjct  84   GVVIYFDRIEVVNLLSAESAYEIVKNYSAEYDKTLIYNKVHHELNQFCSSHTLQEVYIDL  143

Query  595  FDQIDE  612
            FDQIDE
Sbjct  144  FDQIDE  149



>ref|XP_009681498.1| PREDICTED: erlin-1 [Struthio camelus australis]
Length=347

 Score =   180 bits (456),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 76/127 (60%), Positives = 103/127 (81%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  FSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFEPIQVTLQTDLVRDIPCGTK  411
            +S++H+V EGH+ VY+RGGALL++ + PG+H+ LPFIT F+ +Q TLQTD V+++PCGT 
Sbjct  22   YSSIHKVEEGHLAVYYRGGALLTSPSGPGYHIMLPFITTFKSVQTTLQTDEVKNVPCGTS  81

Query  412  GGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKIHHEINQFCSGHSLQQVYID  591
            GGVMI  ++IEVVN+L    VYD + NY   YD T I++KIHHE+NQFCS H+LQ+VYI+
Sbjct  82   GGVMIYIDRIEVVNKLAPYAVYDIVRNYTADYDKTLIFNKIHHELNQFCSAHTLQEVYIE  141

Query  592  MFDQIDE  612
            +FDQIDE
Sbjct  142  LFDQIDE  148



>ref|XP_009273335.1| PREDICTED: erlin-1 [Aptenodytes forsteri]
Length=347

 Score =   180 bits (456),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 76/127 (60%), Positives = 103/127 (81%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  FSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFEPIQVTLQTDLVRDIPCGTK  411
            +S++H+V EGH+ VY+RGGALL++ + PG+H+ LPFIT F+ +Q TLQTD V+++PCGT 
Sbjct  22   YSSIHKVEEGHLAVYYRGGALLTSPSGPGYHIMLPFITMFKSVQTTLQTDEVKNVPCGTS  81

Query  412  GGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKIHHEINQFCSGHSLQQVYID  591
            GGVMI  ++IEVVN+L    VYD + NY   YD T I++KIHHE+NQFCS H+LQ+VYI+
Sbjct  82   GGVMIYIDRIEVVNKLAPYAVYDIVRNYTADYDKTLIFNKIHHELNQFCSAHTLQEVYIE  141

Query  592  MFDQIDE  612
            +FDQIDE
Sbjct  142  LFDQIDE  148



>emb|CDJ04352.1| erlin 1 [Echinococcus multilocularis]
 emb|CDS41634.1| erlin 1 [Echinococcus multilocularis]
Length=379

 Score =   181 bits (458),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 76/126 (60%), Positives = 100/126 (79%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  STLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFEPIQVTLQTDLVRDIPCGTKG  414
            +++H++ EGHVGVY+RGGALL   + PGFHL +P IT F+ +Q TLQTD V+++PCGT G
Sbjct  24   ASIHKIEEGHVGVYYRGGALLKETSPPGFHLMIPLITTFKAVQTTLQTDEVKNVPCGTSG  83

Query  415  GVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKIHHEINQFCSGHSLQQVYIDM  594
            GV+I F++IEVVN L  E  Y+ + NY   YD T IY+K+HHE+NQFCS H+LQ+VYID+
Sbjct  84   GVVIYFDRIEVVNLLSAESAYEIVKNYSAEYDKTLIYNKVHHELNQFCSSHTLQEVYIDL  143

Query  595  FDQIDE  612
            FDQIDE
Sbjct  144  FDQIDE  149



>ref|XP_010298285.1| PREDICTED: erlin-1, partial [Balearica regulorum gibbericeps]
Length=168

 Score =   174 bits (442),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 75/127 (59%), Positives = 103/127 (81%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  FSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFEPIQVTLQTDLVRDIPCGTK  411
            +S++H+V EGH+ VY+RGGALL++ + PG+H+ LPFIT F+ +Q TLQTD V+++PCGT 
Sbjct  22   YSSIHKVEEGHLAVYYRGGALLTSPSGPGYHIMLPFITTFKSVQTTLQTDEVKNVPCGTS  81

Query  412  GGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKIHHEINQFCSGHSLQQVYID  591
            GGVMI  ++IEVVN+L    VY+ + NY   YD T I++KIHHE+NQFCS H+LQ+VYI+
Sbjct  82   GGVMIYIDRIEVVNKLAPYAVYNIVRNYTADYDKTLIFNKIHHELNQFCSAHTLQEVYIE  141

Query  592  MFDQIDE  612
            +FDQIDE
Sbjct  142  LFDQIDE  148



>ref|XP_009491710.1| PREDICTED: erlin-1 [Pelecanus crispus]
Length=347

 Score =   180 bits (456),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 76/127 (60%), Positives = 103/127 (81%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  FSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFEPIQVTLQTDLVRDIPCGTK  411
            +S++H+V EGH+ VY+RGGALL++ + PG+H+ LPFIT F+ +Q TLQTD V+++PCGT 
Sbjct  22   YSSIHKVEEGHLAVYYRGGALLTSPSGPGYHIMLPFITTFKSVQTTLQTDEVKNVPCGTS  81

Query  412  GGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKIHHEINQFCSGHSLQQVYID  591
            GGVMI  ++IEVVN+L    VYD + NY   YD T I++KIHHE+NQFCS H+LQ+VYI+
Sbjct  82   GGVMIYIDRIEVVNKLAPYAVYDIVRNYTADYDKTLIFNKIHHELNQFCSAHTLQEVYIE  141

Query  592  MFDQIDE  612
            +FDQIDE
Sbjct  142  LFDQIDE  148



>ref|XP_010116335.1| PREDICTED: erlin-1 [Chlamydotis macqueenii]
Length=347

 Score =   180 bits (456),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 76/127 (60%), Positives = 103/127 (81%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  FSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFEPIQVTLQTDLVRDIPCGTK  411
            +S++H+V EGH+ VY+RGGALL++ + PG+H+ LPFIT F+ +Q TLQTD V+++PCGT 
Sbjct  22   YSSIHKVEEGHLAVYYRGGALLTSPSGPGYHIMLPFITTFKSVQTTLQTDEVKNVPCGTS  81

Query  412  GGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKIHHEINQFCSGHSLQQVYID  591
            GGVMI  ++IEVVN+L    VYD + NY   YD T I++KIHHE+NQFCS H+LQ+VYI+
Sbjct  82   GGVMIYIDRIEVVNKLAPYAVYDIVKNYTADYDKTLIFNKIHHELNQFCSAHTLQEVYIE  141

Query  592  MFDQIDE  612
            +FDQIDE
Sbjct  142  LFDQIDE  148



>ref|XP_009635828.1| PREDICTED: LOW QUALITY PROTEIN: erlin-1 [Egretta garzetta]
Length=363

 Score =   180 bits (457),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 76/127 (60%), Positives = 103/127 (81%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  FSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFEPIQVTLQTDLVRDIPCGTK  411
            +S++H+V EGH+ VY+RGGALL++ + PG+H+ LPFIT F+ +Q TLQTD V+++PCGT 
Sbjct  22   YSSIHKVEEGHLAVYYRGGALLTSPSGPGYHIMLPFITTFKSVQTTLQTDEVKNVPCGTS  81

Query  412  GGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKIHHEINQFCSGHSLQQVYID  591
            GGVMI  ++IEVVN+L    VYD + NY   YD T I++KIHHE+NQFCS H+LQ+VYI+
Sbjct  82   GGVMIYIDRIEVVNKLAPYAVYDIVRNYTADYDKTLIFNKIHHELNQFCSAHTLQEVYIE  141

Query  592  MFDQIDE  612
            +FDQIDE
Sbjct  142  LFDQIDE  148



>ref|XP_003379790.1| erlin-2 [Trichinella spiralis]
 gb|EFV60601.1| erlin-2 [Trichinella spiralis]
Length=329

 Score =   179 bits (454),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 83/143 (58%), Positives = 108/143 (76%), Gaps = 3/143 (2%)
 Frame = +1

Query  184  IAIFVMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFEPIQ  363
            +A  +MVV  ++   S   LH++ EGHVGVY+RGGALL +I+ PG+HL  P +T    +Q
Sbjct  6    VAATIMVVCGIMLQLS---LHRIEEGHVGVYYRGGALLRSISYPGYHLMFPVLTSVRSVQ  62

Query  364  VTLQTDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKIHHE  543
            VT+QTD V ++PCGT GGV+I FE+IEVVN L  + VYD + NY V YD T I++K+HHE
Sbjct  63   VTMQTDKVTNVPCGTSGGVIIYFERIEVVNILDVDRVYDIVKNYTVDYDKTLIFNKVHHE  122

Query  544  INQFCSGHSLQQVYIDMFDQIDE  612
            +NQFCS HSLQ+VYID+FDQIDE
Sbjct  123  VNQFCSVHSLQEVYIDLFDQIDE  145



>gb|KFP07218.1| Erlin-1, partial [Calypte anna]
Length=335

 Score =   179 bits (454),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 76/127 (60%), Positives = 102/127 (80%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  FSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFEPIQVTLQTDLVRDIPCGTK  411
            + ++H+V EGH+ VY+RGGALLS+ + PG+H+ LPFIT F+ +Q TLQTD V+++PCGT 
Sbjct  22   YCSIHKVEEGHLAVYYRGGALLSSPSGPGYHIMLPFITTFKSVQTTLQTDEVKNVPCGTS  81

Query  412  GGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKIHHEINQFCSGHSLQQVYID  591
            GGVMI  ++IEVVN+L    VYD + NY   YD T I++KIHHE+NQFCS H+LQ+VYI+
Sbjct  82   GGVMIYIDRIEVVNKLAPYAVYDIVRNYTADYDKTLIFNKIHHELNQFCSAHTLQEVYIE  141

Query  592  MFDQIDE  612
            +FDQIDE
Sbjct  142  LFDQIDE  148



>ref|XP_009464323.1| PREDICTED: erlin-1 [Nipponia nippon]
Length=347

 Score =   179 bits (455),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 76/127 (60%), Positives = 103/127 (81%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  FSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFEPIQVTLQTDLVRDIPCGTK  411
            +S++H+V EGH+ VY+RGGALL++ + PG+H+ LPFIT F+ +Q TLQTD V+++PCGT 
Sbjct  22   YSSIHKVEEGHLAVYYRGGALLTSPSGPGYHIMLPFITTFKSVQTTLQTDEVKNVPCGTS  81

Query  412  GGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKIHHEINQFCSGHSLQQVYID  591
            GGVMI  ++IEVVN+L    VYD + NY   YD T I++KIHHE+NQFCS H+LQ+VYI+
Sbjct  82   GGVMIYIDRIEVVNKLAPYAVYDIVRNYTADYDKTLIFNKIHHELNQFCSAHTLQEVYIE  141

Query  592  MFDQIDE  612
            +FDQIDE
Sbjct  142  LFDQIDE  148



>gb|EHJ65120.1| putative SPFH domain family, member 1 [Danaus plexippus]
Length=324

 Score =   179 bits (454),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 76/125 (61%), Positives = 99/125 (79%), Gaps = 0/125 (0%)
 Frame = +1

Query  238  TLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFEPIQVTLQTDLVRDIPCGTKGG  417
            +LH+V EGHVGVY+RGGALL   + PGFH+ +P +T F+PIQ TLQTD V+++PCGT GG
Sbjct  22   SLHKVEEGHVGVYYRGGALLPVTSQPGFHMMIPLLTTFKPIQTTLQTDEVKNVPCGTSGG  81

Query  418  VMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKIHHEINQFCSGHSLQQVYIDMF  597
            VMI FE+IEVVN+L    V+D + N+   YD T I++K+HHE+NQFCS H+L +VYI +F
Sbjct  82   VMIYFERIEVVNKLDSNSVFDVVRNFTADYDKTLIFNKVHHELNQFCSAHTLHEVYIALF  141

Query  598  DQIDE  612
            DQIDE
Sbjct  142  DQIDE  146



>ref|XP_011505896.1| PREDICTED: erlin-1-like [Ceratosolen solmsi marchali]
Length=329

 Score =   179 bits (454),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 77/125 (62%), Positives = 102/125 (82%), Gaps = 0/125 (0%)
 Frame = +1

Query  238  TLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFEPIQVTLQTDLVRDIPCGTKGG  417
            +LH++ EGHVGVY+RGGALL  ++ PGFH+ +P +T F P+QVTLQTD V+++PCGT GG
Sbjct  22   SLHRIEEGHVGVYFRGGALLPEVSIPGFHMMIPILTIFRPVQVTLQTDEVKNVPCGTSGG  81

Query  418  VMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKIHHEINQFCSGHSLQQVYIDMF  597
            VMI+F++IEVVN L    VY+ + NY V YD + I++KIHHE+NQFCS H+L +VYID+F
Sbjct  82   VMIDFDRIEVVNMLDANSVYNIVRNYTVDYDRSLIFNKIHHELNQFCSVHTLHEVYIDLF  141

Query  598  DQIDE  612
            DQIDE
Sbjct  142  DQIDE  146



>ref|XP_010204333.1| PREDICTED: LOW QUALITY PROTEIN: erlin-1-like [Colius striatus]
Length=363

 Score =   180 bits (456),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 76/127 (60%), Positives = 103/127 (81%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  FSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFEPIQVTLQTDLVRDIPCGTK  411
            +S++H+V EGH+ VY+RGGALL++ + PG+H+ LPFIT F+ +Q TLQTD V+++PCGT 
Sbjct  22   YSSIHKVEEGHLAVYYRGGALLTSPSGPGYHIMLPFITTFKSVQTTLQTDEVKNVPCGTS  81

Query  412  GGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKIHHEINQFCSGHSLQQVYID  591
            GGVMI  ++IEVVN+L    VYD + NY   YD T I++KIHHE+NQFCS H+LQ+VYI+
Sbjct  82   GGVMIYIDRIEVVNKLAPYAVYDIVRNYTADYDKTLIFNKIHHELNQFCSAHTLQEVYIE  141

Query  592  MFDQIDE  612
            +FDQIDE
Sbjct  142  LFDQIDE  148



>ref|XP_001892051.1| hypothetical protein [Brugia malayi]
 emb|CDQ04957.1| Protein BM-ERL-1 [Brugia malayi]
Length=318

 Score =   179 bits (453),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 77/125 (62%), Positives = 98/125 (78%), Gaps = 0/125 (0%)
 Frame = +1

Query  238  TLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFEPIQVTLQTDLVRDIPCGTKGG  417
             LH + EGHVGVY+RGGALLS ++ PG+HL  PF T ++ +QVTLQTD  +++PCGT GG
Sbjct  21   ALHHIEEGHVGVYYRGGALLSRVSQPGYHLMFPFFTTYKSVQVTLQTDEAKNVPCGTSGG  80

Query  418  VMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKIHHEINQFCSGHSLQQVYIDMF  597
            VMI F++IEVVN L    VYD + NY V YD   I++K+HHE+NQFCS H+LQ+VYID+F
Sbjct  81   VMIYFDRIEVVNILSSSSVYDIVKNYTVDYDRPLIFNKVHHEVNQFCSSHTLQEVYIDLF  140

Query  598  DQIDE  612
            DQIDE
Sbjct  141  DQIDE  145



>ref|XP_007883614.1| PREDICTED: erlin-2-B-like [Callorhinchus milii]
Length=339

 Score =   179 bits (454),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 80/127 (63%), Positives = 100/127 (79%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  FSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFEPIQVTLQTDLVRDIPCGTK  411
            FS++H+V EGH+ VY+RGGALL   + PGFHL LPFIT F+ +Q TLQTD V+++PCGT 
Sbjct  20   FSSVHKVEEGHIAVYYRGGALLKATSGPGFHLMLPFITTFKAVQNTLQTDEVKNVPCGTS  79

Query  412  GGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKIHHEINQFCSGHSLQQVYID  591
            GGVMI F++IEVVN L    VYD + NY   YD T I++KIHHE+NQFCS H+LQ+VYI 
Sbjct  80   GGVMIYFDRIEVVNFLVPNAVYDIVKNYTADYDKTLIFNKIHHELNQFCSVHTLQEVYIQ  139

Query  592  MFDQIDE  612
            +FDQIDE
Sbjct  140  LFDQIDE  146



>ref|XP_002115838.1| hypothetical protein TRIADDRAFT_38143 [Trichoplax adhaerens]
 gb|EDV21690.1| hypothetical protein TRIADDRAFT_38143 [Trichoplax adhaerens]
Length=323

 Score =   179 bits (453),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 77/125 (62%), Positives = 102/125 (82%), Gaps = 0/125 (0%)
 Frame = +1

Query  238  TLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFEPIQVTLQTDLVRDIPCGTKGG  417
            ++H++ EGHVGVY+RGGALL+  + PGFH+ +PF+T +  +Q TLQTD V+++PCGT GG
Sbjct  21   SIHKIDEGHVGVYYRGGALLTRTSGPGFHVMIPFLTTYRLVQTTLQTDEVKNVPCGTSGG  80

Query  418  VMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKIHHEINQFCSGHSLQQVYIDMF  597
            VMI F++IEVVN L   HVYD + NY   YDNT I++KIHHE+NQFCS H+LQ+VYID+F
Sbjct  81   VMIYFDRIEVVNILSSNHVYDIVKNYTADYDNTLIFNKIHHELNQFCSVHNLQEVYIDLF  140

Query  598  DQIDE  612
            D+IDE
Sbjct  141  DKIDE  145



>ref|XP_003141777.1| hypothetical protein LOAG_06193 [Loa loa]
 gb|EFO22295.1| hypothetical protein LOAG_06193 [Loa loa]
Length=318

 Score =   179 bits (453),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 77/125 (62%), Positives = 98/125 (78%), Gaps = 0/125 (0%)
 Frame = +1

Query  238  TLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFEPIQVTLQTDLVRDIPCGTKGG  417
             LH + EGHVGVY+RGGALLS ++ PG+HL  PF T ++ +QVTLQTD  +++PCGT GG
Sbjct  21   ALHHIEEGHVGVYYRGGALLSRVSQPGYHLMFPFFTTYKSVQVTLQTDEAKNVPCGTSGG  80

Query  418  VMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKIHHEINQFCSGHSLQQVYIDMF  597
            VMI F++IEVVN L    VYD + NY V YD   I++K+HHE+NQFCS H+LQ+VYID+F
Sbjct  81   VMIYFDRIEVVNILSSSSVYDIVKNYTVDYDKPLIFNKVHHEVNQFCSSHTLQEVYIDLF  140

Query  598  DQIDE  612
            DQIDE
Sbjct  141  DQIDE  145



>ref|XP_010406982.1| PREDICTED: erlin-1, partial [Corvus cornix cornix]
Length=333

 Score =   179 bits (454),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 76/127 (60%), Positives = 102/127 (80%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  FSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFEPIQVTLQTDLVRDIPCGTK  411
            +S +H+V EGH+ VY+RGGALL++ + PG+H+ LPFIT F+ +Q TLQTD V+++PCGT 
Sbjct  8    YSAIHRVEEGHLAVYYRGGALLTSPSGPGYHIMLPFITTFKSVQTTLQTDEVKNVPCGTS  67

Query  412  GGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKIHHEINQFCSGHSLQQVYID  591
            GGVMI  ++IEVVN+L    VYD + NY   YD T I++KIHHE+NQFCS H+LQ+VYI+
Sbjct  68   GGVMIYIDRIEVVNKLAPYAVYDIVRNYTADYDKTLIFNKIHHELNQFCSAHTLQEVYIE  127

Query  592  MFDQIDE  612
            +FDQIDE
Sbjct  128  LFDQIDE  134



>ref|XP_003226774.2| PREDICTED: erlin-2 [Anolis carolinensis]
Length=381

 Score =   180 bits (457),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 78/127 (61%), Positives = 103/127 (81%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  FSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFEPIQVTLQTDLVRDIPCGTK  411
            FS +H++ EGH+GVY+RGGALL++ + PGFHL LPFIT F+ +Q TLQTD V+++PCGT 
Sbjct  66   FSAIHKIEEGHIGVYYRGGALLTSTSGPGFHLMLPFITSFKSVQTTLQTDEVKNVPCGTS  125

Query  412  GGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKIHHEINQFCSGHSLQQVYID  591
            GGVMI F++IEVVN L +  VYD + N+   YD   I++KIHHE+NQFCS H+LQ+VYI+
Sbjct  126  GGVMIYFDRIEVVNFLIQSAVYDIVKNFTADYDKALIFNKIHHELNQFCSVHTLQEVYIE  185

Query  592  MFDQIDE  612
            +FDQIDE
Sbjct  186  LFDQIDE  192



>ref|XP_010006086.1| PREDICTED: erlin-1, partial [Chaetura pelagica]
Length=337

 Score =   179 bits (454),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 77/127 (61%), Positives = 101/127 (80%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  FSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFEPIQVTLQTDLVRDIPCGTK  411
            F  +H+V EGH+ VY+RGGALLS+ + PG+H+ LPFIT F+ +Q TLQTD V+++PCGT 
Sbjct  12   FCAIHRVEEGHLAVYYRGGALLSSPSGPGYHIMLPFITTFKSVQTTLQTDEVKNVPCGTS  71

Query  412  GGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKIHHEINQFCSGHSLQQVYID  591
            GGVMI  ++IEVVN+L    VYD + NY   YD T I++KIHHE+NQFCS H+LQ+VYI+
Sbjct  72   GGVMIYIDRIEVVNKLAPYAVYDIVRNYTADYDKTLIFNKIHHELNQFCSAHTLQEVYIE  131

Query  592  MFDQIDE  612
            +FDQIDE
Sbjct  132  LFDQIDE  138



>ref|XP_010014816.1| PREDICTED: erlin-1, partial [Nestor notabilis]
Length=341

 Score =   179 bits (454),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 80/139 (58%), Positives = 106/139 (76%), Gaps = 0/139 (0%)
 Frame = +1

Query  196  VMVVTPLLSTNSFSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFEPIQVTLQ  375
            V   T LL    +S++H+V EGH+ VY+RGGALL++ + PG+H+ LPFIT F+ +Q TLQ
Sbjct  4    VAAATGLLVFFLYSSIHKVEEGHLAVYYRGGALLTSPSGPGYHIMLPFITTFKSVQTTLQ  63

Query  376  TDLVRDIPCGTKGGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKIHHEINQF  555
            TD V+++PCGT GGVMI  ++IEVVN+L    VYD + NY   YD T I++KIHHE+NQF
Sbjct  64   TDEVKNVPCGTSGGVMIYIDRIEVVNKLAPYAVYDIVRNYTADYDKTLIFNKIHHELNQF  123

Query  556  CSGHSLQQVYIDMFDQIDE  612
            CS H+LQ+VYI +FDQIDE
Sbjct  124  CSAHTLQEVYIQLFDQIDE  142



>ref|XP_010568434.1| PREDICTED: LOW QUALITY PROTEIN: erlin-1 [Haliaeetus leucocephalus]
Length=363

 Score =   179 bits (455),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 76/127 (60%), Positives = 103/127 (81%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  FSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFEPIQVTLQTDLVRDIPCGTK  411
            +S++H+V EGH+ VY+RGGALL++ + PG+H+ LPFIT F+ +Q TLQTD V+++PCGT 
Sbjct  22   YSSIHKVEEGHLAVYYRGGALLTSPSGPGYHIMLPFITTFKSVQTTLQTDEVKNVPCGTS  81

Query  412  GGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKIHHEINQFCSGHSLQQVYID  591
            GGVMI  ++IEVVN+L    VYD + NY   YD T I++KIHHE+NQFCS H+LQ+VYI+
Sbjct  82   GGVMIYIDRIEVVNKLAPYAVYDIVRNYTADYDKTLIFNKIHHELNQFCSAHTLQEVYIE  141

Query  592  MFDQIDE  612
            +FDQIDE
Sbjct  142  LFDQIDE  148



>ref|XP_005242641.1| PREDICTED: LOW QUALITY PROTEIN: erlin-1 [Falco peregrinus]
 ref|XP_005446307.1| PREDICTED: LOW QUALITY PROTEIN: erlin-1 [Falco cherrug]
Length=363

 Score =   179 bits (455),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 76/127 (60%), Positives = 103/127 (81%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  FSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFEPIQVTLQTDLVRDIPCGTK  411
            +S++H+V EGH+ VY+RGGALL++ + PG+H+ LPFIT F+ +Q TLQTD V+++PCGT 
Sbjct  22   YSSIHRVEEGHLAVYYRGGALLTSPSGPGYHIMLPFITTFKSVQTTLQTDEVKNVPCGTS  81

Query  412  GGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKIHHEINQFCSGHSLQQVYID  591
            GGVMI  ++IEVVN+L    VYD + NY   YD T I++KIHHE+NQFCS H+LQ+VYI+
Sbjct  82   GGVMIYIDRIEVVNKLAPYAVYDIVRNYTADYDKTLIFNKIHHELNQFCSAHTLQEVYIE  141

Query  592  MFDQIDE  612
            +FDQIDE
Sbjct  142  LFDQIDE  148



>ref|XP_009331047.1| PREDICTED: LOW QUALITY PROTEIN: erlin-1 [Pygoscelis adeliae]
Length=363

 Score =   179 bits (455),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 76/127 (60%), Positives = 103/127 (81%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  FSTLHQVPEGHVGVYWRGGALLSTITTPGFHLKLPFITHFEPIQVTLQTDLVRDIPCGTK  411
            +S++H+V EGH+ VY+RGGALL++ + PG+H+ LPFIT F+ +Q TLQTD V+++PCGT 
Sbjct  22   YSSIHKVDEGHLAVYYRGGALLTSPSGPGYHIMLPFITMFKSVQTTLQTDEVKNVPCGTS  81

Query  412  GGVMINFEKIEVVNRLRKEHVYDTLLNYGVHYDNTWIYDKIHHEINQFCSGHSLQQVYID  591
            GGVMI  ++IEVVN+L    VYD + NY   YD T I++KIHHE+NQFCS H+LQ+VYI+
Sbjct  82   GGVMIYIDRIEVVNKLAPYAVYDIVRNYTADYDKTLIFNKIHHELNQFCSAHTLQEVYIE  141

Query  592  MFDQIDE  612
            +FDQIDE
Sbjct  142  LFDQIDE  148



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 842962938660