BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001N06

Length=452
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006342632.1|  PREDICTED: subtilisin-like protease-like           169   8e-46   Solanum tuberosum [potatoes]
ref|XP_006342631.1|  PREDICTED: subtilisin-like protease-like           166   7e-45   Solanum tuberosum [potatoes]
ref|XP_009790288.1|  PREDICTED: subtilisin-like protease                165   1e-44   Nicotiana sylvestris
ref|XP_009800439.1|  PREDICTED: subtilisin-like protease                165   1e-44   Nicotiana sylvestris
ref|XP_009771086.1|  PREDICTED: subtilisin-like protease                166   1e-44   Nicotiana sylvestris
ref|XP_011069659.1|  PREDICTED: subtilisin-like protease                164   3e-44   Sesamum indicum [beniseed]
ref|XP_004252763.1|  PREDICTED: subtilisin-like protease                164   5e-44   Solanum lycopersicum
ref|XP_009604890.1|  PREDICTED: subtilisin-like protease                160   1e-42   Nicotiana tomentosiformis
ref|XP_010320328.1|  PREDICTED: subtilisin-like protease                156   3e-41   Solanum lycopersicum
ref|XP_010263512.1|  PREDICTED: subtilisin-like protease                152   1e-39   Nelumbo nucifera [Indian lotus]
gb|EYU45081.1|  hypothetical protein MIMGU_mgv1a002217mg                149   8e-39   Erythranthe guttata [common monkey flower]
ref|XP_010263511.1|  PREDICTED: subtilisin-like protease                147   6e-38   Nelumbo nucifera [Indian lotus]
ref|XP_002282841.2|  PREDICTED: uncharacterized protein LOC100259061    147   2e-37   
ref|XP_002267740.1|  PREDICTED: subtilisin-like protease                145   3e-37   Vitis vinifera
gb|KCW66398.1|  hypothetical protein EUGRSUZ_F00212                     144   5e-37   Eucalyptus grandis [rose gum]
ref|XP_010059919.1|  PREDICTED: subtilisin-like protease                144   7e-37   Eucalyptus grandis [rose gum]
ref|XP_003548400.1|  PREDICTED: subtilisin-like protease-like           144   7e-37   Glycine max [soybeans]
ref|XP_009595649.1|  PREDICTED: subtilisin-like protease                144   8e-37   Nicotiana tomentosiformis
gb|KCW62487.1|  hypothetical protein EUGRSUZ_H05125                     144   9e-37   Eucalyptus grandis [rose gum]
gb|ACT34764.1|  subtilisin-like protease preproenzyme                   143   1e-36   Nicotiana tabacum [American tobacco]
gb|KCW66392.1|  hypothetical protein EUGRSUZ_F00206                     142   3e-36   Eucalyptus grandis [rose gum]
ref|XP_010059916.1|  PREDICTED: subtilisin-like protease                142   3e-36   Eucalyptus grandis [rose gum]
ref|XP_002523606.1|  Cucumisin precursor, putative                      142   3e-36   
ref|XP_010059917.1|  PREDICTED: subtilisin-like protease                142   3e-36   Eucalyptus grandis [rose gum]
ref|XP_010112177.1|  Subtilisin-like protease                           142   4e-36   Morus notabilis
ref|XP_010025755.1|  PREDICTED: subtilisin-like protease                142   4e-36   
ref|XP_008351993.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    142   5e-36   
ref|XP_010059918.1|  PREDICTED: subtilisin-like protease                142   5e-36   Eucalyptus grandis [rose gum]
ref|XP_009359804.1|  PREDICTED: subtilisin-like protease                141   7e-36   Pyrus x bretschneideri [bai li]
ref|XP_003548151.1|  PREDICTED: subtilisin-like protease-like           141   8e-36   Glycine max [soybeans]
ref|XP_002310134.2|  subtilase family protein                           140   2e-35   Populus trichocarpa [western balsam poplar]
ref|XP_003529873.2|  PREDICTED: subtilisin-like protease-like           139   3e-35   
ref|XP_010263712.1|  PREDICTED: subtilisin-like protease                137   4e-35   Nelumbo nucifera [Indian lotus]
ref|XP_011043530.1|  PREDICTED: subtilisin-like protease                138   1e-34   Populus euphratica
ref|XP_008393790.1|  PREDICTED: subtilisin-like protease                138   1e-34   
ref|XP_007135315.1|  hypothetical protein PHAVU_010G119000g             137   1e-34   Phaseolus vulgaris [French bean]
ref|XP_007017195.1|  Subtilisin-like serine endopeptidase family ...    137   2e-34   
ref|XP_008241490.1|  PREDICTED: subtilisin-like protease                137   2e-34   Prunus mume [ume]
ref|XP_010028239.1|  PREDICTED: subtilisin-like protease                137   2e-34   Eucalyptus grandis [rose gum]
gb|KCW54937.1|  hypothetical protein EUGRSUZ_I00910                     137   2e-34   Eucalyptus grandis [rose gum]
ref|XP_008785865.1|  PREDICTED: subtilisin-like protease                137   2e-34   Phoenix dactylifera
ref|XP_009610212.1|  PREDICTED: subtilisin-like protease                136   5e-34   Nicotiana tomentosiformis
gb|EYU25437.1|  hypothetical protein MIMGU_mgv1a002005mg                134   2e-33   Erythranthe guttata [common monkey flower]
ref|XP_007204261.1|  hypothetical protein PRUPE_ppa001828mg             134   2e-33   
gb|KJB63881.1|  hypothetical protein B456_010G021600                    134   3e-33   Gossypium raimondii
ref|XP_008785920.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    134   3e-33   
ref|XP_007017194.1|  Subtilisin-like serine endopeptidase family ...    133   7e-33   
gb|KDP41713.1|  hypothetical protein JCGZ_16120                         133   8e-33   Jatropha curcas
ref|XP_008220243.1|  PREDICTED: subtilisin-like protease                132   9e-33   Prunus mume [ume]
gb|KEH18574.1|  subtilisin-like serine protease                         132   1e-32   Medicago truncatula
emb|CDP17956.1|  unnamed protein product                                131   3e-32   Coffea canephora [robusta coffee]
ref|XP_008221259.1|  PREDICTED: subtilisin-like protease                130   5e-32   Prunus mume [ume]
ref|XP_007135313.1|  hypothetical protein PHAVU_010G118800g             130   7e-32   Phaseolus vulgaris [French bean]
ref|XP_008785921.1|  PREDICTED: subtilisin-like protease                130   7e-32   Phoenix dactylifera
ref|XP_008357385.1|  PREDICTED: subtilisin-like protease                130   7e-32   
ref|XP_011029618.1|  PREDICTED: subtilisin-like protease                130   7e-32   Populus euphratica
ref|XP_010540359.1|  PREDICTED: subtilisin-like protease                130   8e-32   Tarenaya hassleriana [spider flower]
ref|XP_007221958.1|  hypothetical protein PRUPE_ppa001770mg             130   8e-32   Prunus persica
ref|XP_009343175.1|  PREDICTED: subtilisin-like protease                130   8e-32   Pyrus x bretschneideri [bai li]
ref|XP_009345959.1|  PREDICTED: subtilisin-like protease                130   9e-32   
ref|XP_002510195.1|  Cucumisin precursor, putative                      130   1e-31   Ricinus communis
ref|XP_004291093.1|  PREDICTED: subtilisin-like protease                129   2e-31   Fragaria vesca subsp. vesca
emb|CDP01316.1|  unnamed protein product                                129   2e-31   Coffea canephora [robusta coffee]
gb|KDO84129.1|  hypothetical protein CISIN_1g004265mg                   129   2e-31   Citrus sinensis [apfelsine]
ref|XP_006434737.1|  hypothetical protein CICLE_v10000364mg             129   2e-31   
ref|XP_008220244.1|  PREDICTED: subtilisin-like protease                129   2e-31   Prunus mume [ume]
gb|EYU36350.1|  hypothetical protein MIMGU_mgv1a001799mg                128   3e-31   Erythranthe guttata [common monkey flower]
gb|KEH18575.1|  subtilisin-like serine protease                         128   4e-31   Medicago truncatula
ref|XP_007147252.1|  hypothetical protein PHAVU_006G108700g             128   4e-31   Phaseolus vulgaris [French bean]
ref|XP_003626594.1|  Subtilisin-like protease                           128   5e-31   Medicago truncatula
ref|XP_006374913.1|  subtilase family protein                           127   7e-31   Populus trichocarpa [western balsam poplar]
gb|KEH18578.1|  subtilisin-like serine protease                         127   8e-31   Medicago truncatula
gb|KHN15890.1|  Subtilisin-like protease                                127   8e-31   Glycine soja [wild soybean]
ref|XP_010912031.1|  PREDICTED: subtilisin-like protease                127   1e-30   Elaeis guineensis
ref|XP_010484555.1|  PREDICTED: subtilisin-like protease                126   1e-30   Camelina sativa [gold-of-pleasure]
gb|EYU36340.1|  hypothetical protein MIMGU_mgv1a001790mg                126   2e-30   Erythranthe guttata [common monkey flower]
ref|XP_006425911.1|  hypothetical protein CICLE_v10024929mg             126   2e-30   Citrus clementina [clementine]
ref|XP_010320327.1|  PREDICTED: subtilisin-like protease                126   2e-30   Solanum lycopersicum
ref|XP_010320531.1|  PREDICTED: subtilisin-like protease                125   3e-30   
ref|NP_569044.1|  Subtilisin-like serine endopeptidase family pro...    125   3e-30   Arabidopsis thaliana [mouse-ear cress]
gb|KJB58523.1|  hypothetical protein B456_009G213500                    125   3e-30   Gossypium raimondii
emb|CDP17236.1|  unnamed protein product                                125   3e-30   Coffea canephora [robusta coffee]
ref|XP_006466594.1|  PREDICTED: subtilisin-like protease-like           125   4e-30   Citrus sinensis [apfelsine]
ref|XP_010093626.1|  Subtilisin-like protease                           125   5e-30   
gb|EYU19442.1|  hypothetical protein MIMGU_mgv1a001731mg                125   5e-30   Erythranthe guttata [common monkey flower]
gb|EYU36342.1|  hypothetical protein MIMGU_mgv1a001789mg                125   6e-30   Erythranthe guttata [common monkey flower]
gb|KEH42928.1|  subtilisin-like serine protease                         124   7e-30   Medicago truncatula
ref|XP_011069661.1|  PREDICTED: subtilisin-like protease                125   7e-30   Sesamum indicum [beniseed]
ref|XP_004514927.1|  PREDICTED: subtilisin-like protease-like           124   7e-30   Cicer arietinum [garbanzo]
gb|EYU36339.1|  hypothetical protein MIMGU_mgv1a001782mg                124   7e-30   Erythranthe guttata [common monkey flower]
ref|XP_004494864.1|  PREDICTED: subtilisin-like protease-like           124   8e-30   
ref|XP_009799242.1|  PREDICTED: subtilisin-like protease                124   9e-30   Nicotiana sylvestris
ref|XP_010547521.1|  PREDICTED: subtilisin-like protease SDD1           124   9e-30   Tarenaya hassleriana [spider flower]
ref|XP_006393907.1|  hypothetical protein EUTSA_v10005646mg             124   1e-29   Eutrema salsugineum [saltwater cress]
ref|XP_010464539.1|  PREDICTED: subtilisin-like protease                124   1e-29   Camelina sativa [gold-of-pleasure]
gb|EYU36336.1|  hypothetical protein MIMGU_mgv1a019012mg                123   2e-29   Erythranthe guttata [common monkey flower]
ref|XP_010320326.1|  PREDICTED: subtilisin-like protease                123   3e-29   
gb|EYU25440.1|  hypothetical protein MIMGU_mgv1a0017511mg               122   3e-29   Erythranthe guttata [common monkey flower]
ref|XP_002865029.1|  subtilase family protein                           122   3e-29   Arabidopsis lyrata subsp. lyrata
ref|XP_011069662.1|  PREDICTED: subtilisin-like protease                122   4e-29   Sesamum indicum [beniseed]
emb|CDY09336.1|  BnaA02g26740D                                          122   4e-29   Brassica napus [oilseed rape]
ref|XP_009608285.1|  PREDICTED: subtilisin-like protease                122   4e-29   Nicotiana tomentosiformis
ref|XP_009769987.1|  PREDICTED: subtilisin-like protease isoform X1     122   5e-29   Nicotiana sylvestris
ref|XP_007207210.1|  hypothetical protein PRUPE_ppa001938mg             122   5e-29   
ref|XP_006280074.1|  hypothetical protein CARUB_v10025957mg             122   5e-29   
ref|XP_010267360.1|  PREDICTED: subtilisin-like protease                122   5e-29   Nelumbo nucifera [Indian lotus]
ref|XP_004249504.1|  PREDICTED: subtilisin-like protease                122   6e-29   Solanum lycopersicum
ref|XP_009343011.1|  PREDICTED: subtilisin-like protease                122   6e-29   Pyrus x bretschneideri [bai li]
ref|XP_002510194.1|  Xylem serine proteinase 1 precursor, putative      121   9e-29   Ricinus communis
emb|CAA59964.1|  subtilisin-like protease                               121   1e-28   Alnus glutinosa
ref|XP_006345404.1|  PREDICTED: subtilisin-like protease-like           121   1e-28   Solanum tuberosum [potatoes]
ref|XP_009129098.1|  PREDICTED: subtilisin-like protease                121   1e-28   Brassica rapa
ref|XP_011069660.1|  PREDICTED: subtilisin-like protease                120   2e-28   Sesamum indicum [beniseed]
ref|XP_002284864.1|  PREDICTED: subtilisin-like protease                120   2e-28   Vitis vinifera
ref|XP_011464036.1|  PREDICTED: subtilisin-like protease                118   2e-28   Fragaria vesca subsp. vesca
ref|XP_007047285.1|  Subtilisin-like serine endopeptidase family ...    120   2e-28   
gb|EPS63009.1|  subtilisin-like protease preproenzyme                   120   2e-28   Genlisea aurea
emb|CAA07062.1|  SBT4E protein                                          120   2e-28   Solanum lycopersicum
ref|XP_009769989.1|  PREDICTED: subtilisin-like protease                120   3e-28   Nicotiana sylvestris
gb|KHN15886.1|  Subtilisin-like protease                                119   4e-28   Glycine soja [wild soybean]
ref|XP_003595551.1|  Subtilisin-like serine protease                    119   4e-28   Medicago truncatula
gb|ABK95622.1|  unknown                                                 119   4e-28   Populus trichocarpa [western balsam poplar]
ref|XP_006374911.1|  subtilase family protein                           119   5e-28   
ref|XP_011074591.1|  PREDICTED: subtilisin-like protease                119   5e-28   Sesamum indicum [beniseed]
gb|KEH18576.1|  subtilisin-like serine protease                         119   6e-28   Medicago truncatula
ref|XP_009797476.1|  PREDICTED: subtilisin-like protease                119   6e-28   Nicotiana sylvestris
ref|XP_004514928.1|  PREDICTED: subtilisin-like protease-like           119   6e-28   
ref|XP_011074394.1|  PREDICTED: subtilisin-like protease                119   7e-28   
ref|XP_002284869.3|  PREDICTED: subtilisin-like protease                119   8e-28   Vitis vinifera
emb|CAN60787.1|  hypothetical protein VITISV_034533                     119   8e-28   Vitis vinifera
ref|XP_008370910.1|  PREDICTED: subtilisin-like protease                118   1e-27   
gb|KDP41714.1|  hypothetical protein JCGZ_16121                         118   1e-27   Jatropha curcas
ref|XP_009342993.1|  PREDICTED: subtilisin-like protease                118   1e-27   Pyrus x bretschneideri [bai li]
ref|XP_009337959.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    118   1e-27   
ref|XP_011074393.1|  PREDICTED: subtilisin-like protease                118   2e-27   Sesamum indicum [beniseed]
emb|CDP01315.1|  unnamed protein product                                118   2e-27   Coffea canephora [robusta coffee]
ref|XP_003590866.1|  Subtilisin-like protease                           118   2e-27   
gb|AES61117.2|  subtilisin-like serine protease                         118   2e-27   Medicago truncatula
gb|EYU36337.1|  hypothetical protein MIMGU_mgv1a020902mg                117   2e-27   Erythranthe guttata [common monkey flower]
gb|KJB43733.1|  hypothetical protein B456_007G214100                    117   2e-27   Gossypium raimondii
ref|XP_003553772.1|  PREDICTED: subtilisin-like protease-like           117   2e-27   Glycine max [soybeans]
ref|XP_009338017.1|  PREDICTED: subtilisin-like protease                117   2e-27   Pyrus x bretschneideri [bai li]
ref|XP_011029640.1|  PREDICTED: subtilisin-like protease                117   4e-27   Populus euphratica
ref|XP_009419397.1|  PREDICTED: subtilisin-like protease                116   5e-27   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008444560.1|  PREDICTED: subtilisin-like protease                116   5e-27   Cucumis melo [Oriental melon]
ref|XP_007139763.1|  hypothetical protein PHAVU_008G057000g             116   5e-27   Phaseolus vulgaris [French bean]
ref|XP_008218400.1|  PREDICTED: subtilisin-like protease                116   5e-27   Prunus mume [ume]
gb|KDO84130.1|  hypothetical protein CISIN_1g004809mg                   116   6e-27   Citrus sinensis [apfelsine]
gb|KHN15887.1|  Subtilisin-like protease                                116   6e-27   Glycine soja [wild soybean]
ref|XP_006434738.1|  hypothetical protein CICLE_v10000411mg             116   6e-27   
ref|XP_004143027.1|  PREDICTED: subtilisin-like protease-like           116   7e-27   
ref|XP_004156411.1|  PREDICTED: subtilisin-like protease-like           116   7e-27   
ref|XP_009608286.1|  PREDICTED: subtilisin-like protease                116   8e-27   Nicotiana tomentosiformis
emb|CAA07059.1|  SBT4B protein                                          116   8e-27   Solanum lycopersicum
ref|XP_004229665.1|  PREDICTED: subtilisin-like protease                115   1e-26   
ref|XP_010446286.1|  PREDICTED: subtilisin-like protease                114   1e-26   
ref|XP_006339058.1|  PREDICTED: subtilisin-like protease-like           115   1e-26   Solanum tuberosum [potatoes]
ref|XP_002277899.1|  PREDICTED: subtilisin-like protease                115   1e-26   Vitis vinifera
ref|XP_003566210.2|  PREDICTED: subtilisin-like protease                115   1e-26   
gb|KHN40450.1|  Subtilisin-like protease                                115   2e-26   Glycine soja [wild soybean]
ref|XP_003552427.1|  PREDICTED: subtilisin-like protease-like           115   2e-26   Glycine max [soybeans]
gb|KHN06360.1|  Subtilisin-like protease                                115   2e-26   Glycine soja [wild soybean]
ref|XP_006345405.1|  PREDICTED: subtilisin-like protease-like           114   2e-26   
ref|XP_006345406.1|  PREDICTED: subtilisin-like protease-like           114   2e-26   Solanum tuberosum [potatoes]
ref|XP_002510196.1|  Cucumisin precursor, putative                      114   3e-26   Ricinus communis
ref|NP_001234780.1|  subtilisin-like protease                           114   3e-26   Solanum lycopersicum
ref|XP_008355893.1|  PREDICTED: subtilisin-like protease                114   3e-26   
ref|XP_009771925.1|  PREDICTED: subtilisin-like protease                114   3e-26   Nicotiana sylvestris
ref|XP_004249505.1|  PREDICTED: subtilisin-like protease                114   3e-26   Solanum lycopersicum
ref|XP_009621569.1|  PREDICTED: subtilisin-like protease                114   4e-26   
gb|ACA64703.1|  subtilase                                               114   4e-26   Nicotiana tabacum [American tobacco]
ref|NP_001234774.1|  subtilisin-like protease precursor                 114   5e-26   Solanum lycopersicum
ref|XP_006345401.1|  PREDICTED: subtilisin-like protease-like           114   5e-26   Solanum tuberosum [potatoes]
ref|XP_004496012.1|  PREDICTED: subtilisin-like protease-like           113   6e-26   Cicer arietinum [garbanzo]
ref|XP_011464023.1|  PREDICTED: subtilisin-like protease                113   6e-26   Fragaria vesca subsp. vesca
ref|XP_007047286.1|  Subtilisin-like serine endopeptidase family ...    113   7e-26   
ref|XP_008370912.1|  PREDICTED: subtilisin-like protease                113   8e-26   
gb|AAO62352.1|  subtilase                                               113   9e-26   Casuarina glauca
ref|XP_003535388.1|  PREDICTED: subtilisin-like protease-like           113   1e-25   Glycine max [soybeans]
ref|XP_004961962.1|  PREDICTED: subtilisin-like protease-like           113   1e-25   Setaria italica
ref|XP_006345494.1|  PREDICTED: subtilisin-like protease-like           112   1e-25   
ref|XP_004492811.1|  PREDICTED: subtilisin-like protease-like           112   1e-25   Cicer arietinum [garbanzo]
ref|XP_006847104.1|  hypothetical protein AMTR_s00017p00218650          112   1e-25   
gb|EYU36338.1|  hypothetical protein MIMGU_mgv1a002690mg                112   1e-25   Erythranthe guttata [common monkey flower]
ref|XP_011468374.1|  PREDICTED: uncharacterized protein LOC101302380    113   2e-25   Fragaria vesca subsp. vesca
ref|XP_011017184.1|  PREDICTED: subtilisin-like protease                112   2e-25   Populus euphratica
ref|XP_004229661.1|  PREDICTED: subtilisin-like protease                112   2e-25   
ref|XP_003624105.1|  Xylem serine proteinase                            112   2e-25   Medicago truncatula
gb|ACA64702.1|  subtilase                                               112   2e-25   Nicotiana tabacum [American tobacco]
ref|XP_009787984.1|  PREDICTED: subtilisin-like protease                112   2e-25   Nicotiana sylvestris
ref|XP_007139760.1|  hypothetical protein PHAVU_008G056700g             111   4e-25   Phaseolus vulgaris [French bean]
ref|XP_006345400.1|  PREDICTED: subtilisin-like protease-like           111   4e-25   Solanum tuberosum [potatoes]
ref|XP_004229664.2|  PREDICTED: subtilisin-like protease                111   4e-25   Solanum lycopersicum
gb|KDO79191.1|  hypothetical protein CISIN_1g004824mg                   110   5e-25   Citrus sinensis [apfelsine]
ref|XP_010687642.1|  PREDICTED: subtilisin-like protease                110   6e-25   
dbj|BAJ87233.1|  predicted protein                                      110   6e-25   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ88882.1|  predicted protein                                      110   7e-25   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009595146.1|  PREDICTED: subtilisin-like protease                110   9e-25   Nicotiana tomentosiformis
ref|XP_004249811.1|  PREDICTED: subtilisin-like protease                109   1e-24   
ref|XP_010647877.1|  PREDICTED: subtilisin-like protease                108   2e-24   
gb|ACA64704.1|  subtilase                                               108   3e-24   Nicotiana tabacum [American tobacco]
ref|XP_002282856.2|  PREDICTED: subtilisin-like protease                108   3e-24   
emb|CAN60788.1|  hypothetical protein VITISV_034534                     108   3e-24   Vitis vinifera
ref|XP_006345402.1|  PREDICTED: subtilisin-like protease-like           108   4e-24   Solanum tuberosum [potatoes]
dbj|BAJ90426.1|  predicted protein                                      108   5e-24   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ88973.1|  predicted protein                                      107   6e-24   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006847097.1|  hypothetical protein AMTR_s00017p00216950          107   6e-24   
emb|CAA07060.1|  SBT4C protein                                          107   8e-24   Solanum lycopersicum
ref|XP_006473885.1|  PREDICTED: subtilisin-like protease-like           107   8e-24   Citrus sinensis [apfelsine]
gb|KDO84128.1|  hypothetical protein CISIN_1g047470mg                   107   9e-24   Citrus sinensis [apfelsine]
gb|ABN05870.1|  Proteinase inhibitor I9, subtilisin propeptide          105   9e-24   Medicago truncatula
gb|KEH23384.1|  subtilisin-like serine protease                         105   1e-23   Medicago truncatula
ref|XP_006386505.1|  hypothetical protein POPTR_0002s12610g             106   1e-23   
ref|XP_006434736.1|  hypothetical protein CICLE_v10003898mg             107   1e-23   Citrus clementina [clementine]
emb|CAN64996.1|  hypothetical protein VITISV_001780                     106   2e-23   Vitis vinifera
ref|XP_007017191.1|  Subtilisin-like serine protease 2, putative        105   3e-23   
gb|EMT29812.1|  hypothetical protein F775_42283                         105   3e-23   
ref|XP_007143987.1|  hypothetical protein PHAVU_007G119500g             105   3e-23   Phaseolus vulgaris [French bean]
gb|EMS48839.1|  Subtilisin-like protease                                106   4e-23   Triticum urartu
ref|NP_001055646.1|  Os05g0435800                                       105   4e-23   
emb|CDP01318.1|  unnamed protein product                                105   7e-23   Coffea canephora [robusta coffee]
gb|ABD28577.1|  Proteinase inhibitor I9, subtilisin propeptide          105   7e-23   Medicago truncatula
ref|XP_003624104.1|  Subtilisin-like protease                           105   7e-23   
ref|XP_006655358.1|  PREDICTED: subtilisin-like protease-like           104   7e-23   
gb|ABR16566.1|  unknown                                                 102   2e-22   Picea sitchensis
gb|EYU45084.1|  hypothetical protein MIMGU_mgv1a001942mg                103   2e-22   Erythranthe guttata [common monkey flower]
gb|KDP41709.1|  hypothetical protein JCGZ_16116                         103   2e-22   Jatropha curcas
emb|CBI32394.3|  unnamed protein product                                103   3e-22   Vitis vinifera
gb|KJB59847.1|  hypothetical protein B456_009G275900                    103   3e-22   Gossypium raimondii
emb|CAN64995.1|  hypothetical protein VITISV_001779                     103   3e-22   Vitis vinifera
emb|CDX97540.1|  BnaA05g25390D                                        99.4    4e-22   
ref|XP_006847087.1|  hypothetical protein AMTR_s00017p00215540          100   4e-22   
ref|XP_003579757.1|  PREDICTED: subtilisin-like protease                102   5e-22   Brachypodium distachyon [annual false brome]
gb|KDP41712.1|  hypothetical protein JCGZ_16119                         102   5e-22   Jatropha curcas
ref|XP_008657904.1|  PREDICTED: subtilisin-like protease                102   8e-22   
ref|XP_002272769.1|  PREDICTED: subtilisin-like protease                101   1e-21   Vitis vinifera
ref|XP_004975630.1|  PREDICTED: subtilisin-like protease-like           101   1e-21   Setaria italica
gb|AFW84453.1|  putative subtilase family protein                       101   1e-21   
ref|XP_007017192.1|  Subtilisin-like serine protease 2, putative        101   1e-21   
ref|XP_010068558.1|  PREDICTED: subtilisin-like protease                101   1e-21   Eucalyptus grandis [rose gum]
gb|KCW63975.1|  hypothetical protein EUGRSUZ_G01657                     100   1e-21   Eucalyptus grandis [rose gum]
ref|XP_006847107.1|  hypothetical protein AMTR_s00017p00219220          100   2e-21   
ref|XP_011000657.1|  PREDICTED: subtilisin-like protease                100   2e-21   Populus euphratica
ref|XP_002313857.1|  hypothetical protein POPTR_0009s10340g             100   2e-21   
ref|XP_008382901.1|  PREDICTED: subtilisin-like protease              99.8    2e-21   
ref|XP_008352138.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...  99.8    3e-21   
ref|XP_008793983.1|  PREDICTED: subtilisin-like protease                100   3e-21   
ref|XP_008357007.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...  99.8    4e-21   
gb|EPS74243.1|  subtilase family protein                              99.8    5e-21   Genlisea aurea
gb|KFK38761.1|  hypothetical protein AALP_AA3G157200                  99.8    5e-21   Arabis alpina [alpine rockcress]
dbj|BAE98521.1|  putative subtilisin-like serine proteinase           99.8    5e-21   Arabidopsis thaliana [mouse-ear cress]
ref|NP_566473.2|  Subtilase family protein                            99.8    5e-21   Arabidopsis thaliana [mouse-ear cress]
emb|CDY33251.1|  BnaC01g37240D                                        99.4    6e-21   Brassica napus [oilseed rape]
ref|XP_008669405.1|  PREDICTED: subtilisin-like protease              99.4    6e-21   Zea mays [maize]
emb|CDM85158.1|  unnamed protein product                              99.4    6e-21   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009416811.1|  PREDICTED: subtilisin-like protease              99.0    7e-21   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002885009.1|  subtilase family protein                         99.4    7e-21   
gb|ABF70004.1|  subtilisin-like serine proteinase, putative           99.0    8e-21   Musa acuminata [banana]
ref|XP_006487074.1|  PREDICTED: subtilisin-like protease-like         98.6    8e-21   
ref|XP_006487072.1|  PREDICTED: subtilisin-like protease-like         99.0    8e-21   Citrus sinensis [apfelsine]
dbj|BAJ99639.1|  predicted protein                                    99.0    9e-21   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006495263.1|  PREDICTED: subtilisin-like protease-like         98.6    1e-20   Citrus sinensis [apfelsine]
ref|XP_009407416.1|  PREDICTED: subtilisin-like protease              98.6    1e-20   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006487124.1|  PREDICTED: subtilisin-like protease-like         98.6    1e-20   Citrus sinensis [apfelsine]
gb|KJB08038.1|  hypothetical protein B456_001G060600                  98.6    1e-20   Gossypium raimondii
ref|XP_006487073.1|  PREDICTED: subtilisin-like protease-like         98.2    1e-20   
ref|XP_011029629.1|  PREDICTED: subtilisin-like protease              98.2    1e-20   Populus euphratica
ref|XP_006422997.1|  hypothetical protein CICLE_v10027850mg           98.2    2e-20   Citrus clementina [clementine]
gb|KDO59723.1|  hypothetical protein CISIN_1g046220mg                 98.2    2e-20   Citrus sinensis [apfelsine]
ref|XP_006374912.1|  hypothetical protein POPTR_0014s02640g           97.8    2e-20   
ref|XP_006407132.1|  hypothetical protein EUTSA_v10022348mg           98.2    3e-20   
ref|XP_004287970.1|  PREDICTED: subtilisin-like protease              97.4    3e-20   Fragaria vesca subsp. vesca
gb|KJB84343.1|  hypothetical protein B456_N019600                     96.3    3e-20   Gossypium raimondii
gb|ACN39811.1|  unknown                                               97.1    4e-20   Picea sitchensis
ref|XP_002441162.1|  hypothetical protein SORBIDRAFT_09g021490        97.1    4e-20   
ref|XP_002982080.1|  hypothetical protein SELMODRAFT_233912           97.1    4e-20   
gb|EYU22359.1|  hypothetical protein MIMGU_mgv1a023284mg              96.7    5e-20   Erythranthe guttata [common monkey flower]
ref|XP_006651839.1|  PREDICTED: subtilisin-like protease-like         96.7    5e-20   
ref|XP_009117189.1|  PREDICTED: subtilisin-like protease              96.7    5e-20   Brassica rapa
emb|CDY39093.1|  BnaA01g29630D                                        96.7    5e-20   
gb|EMT18650.1|  Subtilisin-like protease                              96.3    5e-20   
gb|ABR18065.1|  unknown                                               95.9    9e-20   
ref|XP_009613479.1|  PREDICTED: subtilisin-like protease              95.9    1e-19   
ref|XP_006841679.1|  hypothetical protein AMTR_s00003p00245290        95.9    1e-19   
gb|ACN40199.1|  unknown                                               95.9    1e-19   
ref|XP_010906269.1|  PREDICTED: subtilisin-like protease              95.5    1e-19   
gb|EYU21314.1|  hypothetical protein MIMGU_mgv1a001662mg              95.5    1e-19   
gb|KJB29423.1|  hypothetical protein B456_005G099900                  95.5    2e-19   
ref|XP_002966443.1|  hypothetical protein SELMODRAFT_143697           95.1    2e-19   
ref|XP_006847103.1|  hypothetical protein AMTR_s00017p00218470        92.4    2e-19   
ref|XP_010927456.1|  PREDICTED: subtilisin-like protease              94.7    2e-19   
ref|XP_011099335.1|  PREDICTED: subtilisin-like protease              94.7    2e-19   
dbj|BAD82002.1|  putative subtilase                                   94.7    3e-19   
emb|CAH67004.1|  OSIGBa0160I14.2                                      94.7    3e-19   
ref|NP_001052820.1|  Os04g0430700                                     94.7    3e-19   
gb|KJB58524.1|  hypothetical protein B456_009G213600                  94.4    3e-19   
emb|CAE03027.1|  OSJNBa0084A10.2                                      94.7    3e-19   
ref|XP_009758461.1|  PREDICTED: subtilisin-like protease              94.7    3e-19   
ref|NP_001051353.1|  Os03g0761500                                     94.7    3e-19   
ref|XP_009146419.1|  PREDICTED: subtilisin-like protease              94.4    4e-19   
ref|XP_010105478.1|  Subtilisin-like protease                         94.4    4e-19   
ref|XP_008391410.1|  PREDICTED: subtilisin-like protease              94.4    4e-19   
ref|XP_010487192.1|  PREDICTED: subtilisin-like protease              94.4    4e-19   
ref|XP_010233560.1|  PREDICTED: subtilisin-like protease              94.0    4e-19   
emb|CDY67452.1|  BnaCnng55020D                                        94.0    4e-19   
gb|EYU29562.1|  hypothetical protein MIMGU_mgv1a001898mg              94.0    4e-19   
emb|CDY52259.1|  BnaC05g52030D                                        94.0    4e-19   
ref|XP_002446493.1|  hypothetical protein SORBIDRAFT_06g016860        94.0    4e-19   
ref|XP_004512212.1|  PREDICTED: subtilisin-like protease-like         93.6    6e-19   
gb|EYU28962.1|  hypothetical protein MIMGU_mgv1a019078mg              92.4    6e-19   
ref|XP_006422999.1|  hypothetical protein CICLE_v10027863mg           93.6    7e-19   
ref|XP_010527146.1|  PREDICTED: subtilisin-like protease              93.2    7e-19   
ref|XP_006342924.1|  PREDICTED: subtilisin-like protease-like         93.2    7e-19   
gb|EMT30759.1|  Subtilisin-like protease                              93.2    8e-19   
emb|CAN75239.1|  hypothetical protein VITISV_014205                   93.2    9e-19   
ref|XP_002282304.3|  PREDICTED: subtilisin-like protease              93.2    9e-19   
ref|XP_004981675.1|  PREDICTED: subtilisin-like protease-like         93.2    9e-19   
ref|XP_007160895.1|  hypothetical protein PHAVU_001G026100g           93.2    9e-19   
ref|XP_003636375.1|  Subtilisin-like protease                         93.2    9e-19   
gb|KDO59722.1|  hypothetical protein CISIN_1g037455mg                 93.2    9e-19   
ref|XP_010501588.1|  PREDICTED: subtilisin-like protease              93.2    9e-19   
ref|XP_006374838.1|  hypothetical protein POPTR_0014s01910g           93.2    1e-18   
ref|XP_006433609.1|  hypothetical protein CICLE_v10000363mg           92.8    1e-18   
gb|EYU44466.1|  hypothetical protein MIMGU_mgv1a0020561mg             90.1    1e-18   
ref|XP_006487123.1|  PREDICTED: subtilisin-like protease-like         92.8    1e-18   
ref|XP_003605881.1|  Subtilisin-like protease                         92.8    1e-18   
ref|XP_006652296.1|  PREDICTED: subtilisin-like protease-like         92.8    1e-18   
ref|XP_007208070.1|  hypothetical protein PRUPE_ppa001701mg           92.8    1e-18   
ref|XP_007018544.1|  Xylem serine proteinase 1, putative isoform 2    92.8    1e-18   
emb|CDY63302.1|  BnaCnng41810D                                        92.8    1e-18   
ref|XP_007018543.1|  Xylem serine proteinase 1, putative isoform 1    92.8    1e-18   
ref|XP_006422995.1|  hypothetical protein CICLE_v10030049mg           92.4    1e-18   
ref|XP_006847080.1|  hypothetical protein AMTR_s00017p00213920        89.4    1e-18   
ref|XP_006847082.1|  hypothetical protein AMTR_s00017p00214530        92.4    1e-18   
gb|EYU39029.1|  hypothetical protein MIMGU_mgv1a019332mg              92.4    1e-18   
ref|XP_010432360.1|  PREDICTED: subtilisin-like protease              92.4    1e-18   
ref|XP_004512211.1|  PREDICTED: subtilisin-like protease-like         92.4    2e-18   
ref|XP_004167070.1|  PREDICTED: subtilisin-like protease-like         92.4    2e-18   
ref|XP_010547540.1|  PREDICTED: subtilisin-like protease              92.4    2e-18   
emb|CBI32395.3|  unnamed protein product                              92.0    2e-18   
ref|XP_008238402.1|  PREDICTED: subtilisin-like protease              92.0    2e-18   
ref|XP_009141044.1|  PREDICTED: subtilisin-like protease              92.0    2e-18   
emb|CDY29697.1|  BnaA04g17300D                                        92.0    2e-18   
ref|XP_003550312.1|  PREDICTED: subtilisin-like protease-like         92.0    2e-18   
ref|XP_010654422.1|  PREDICTED: subtilisin-like protease              92.0    2e-18   
ref|XP_008228179.1|  PREDICTED: subtilisin-like protease              92.0    2e-18   
ref|XP_006841997.1|  hypothetical protein AMTR_s00144p00078130        92.0    2e-18   
ref|XP_007217156.1|  hypothetical protein PRUPE_ppa001739mg           92.0    2e-18   
ref|XP_009403290.1|  PREDICTED: subtilisin-like protease              92.0    2e-18   
ref|XP_004141887.1|  PREDICTED: subtilisin-like protease-like         91.7    3e-18   
ref|XP_006472275.1|  PREDICTED: subtilisin-like protease-like         91.7    3e-18   
ref|XP_007224572.1|  hypothetical protein PRUPE_ppa1027224mg          91.7    3e-18   
ref|XP_009758000.1|  PREDICTED: subtilisin-like protease              91.7    3e-18   
ref|NP_001044922.1|  Os01g0868900                                     91.3    3e-18   
ref|XP_010059854.1|  PREDICTED: subtilisin-like protease              91.3    4e-18   
ref|XP_009405278.1|  PREDICTED: subtilisin-like protease              91.3    4e-18   
ref|XP_006298979.1|  hypothetical protein CARUB_v10015104mg           91.3    4e-18   
ref|XP_004305758.1|  PREDICTED: subtilisin-like protease              91.3    4e-18   
ref|XP_010465286.1|  PREDICTED: subtilisin-like protease              91.3    4e-18   
ref|XP_009599383.1|  PREDICTED: subtilisin-like protease              91.3    4e-18   
gb|KDP32042.1|  hypothetical protein JCGZ_12503                       90.9    5e-18   
ref|XP_004142885.1|  PREDICTED: subtilisin-like protease-like iso...  90.5    5e-18   
ref|XP_004142884.1|  PREDICTED: subtilisin-like protease-like iso...  90.9    5e-18   
ref|XP_004972264.1|  PREDICTED: subtilisin-like protease-like         90.9    5e-18   
ref|XP_008220348.1|  PREDICTED: subtilisin-like protease              90.9    5e-18   
ref|XP_010271938.1|  PREDICTED: subtilisin-like protease              90.9    6e-18   
ref|XP_003544482.1|  PREDICTED: subtilisin-like protease-like         90.5    6e-18   
gb|KCW63761.1|  hypothetical protein EUGRSUZ_G01423                   90.5    7e-18   
ref|XP_004290953.1|  PREDICTED: subtilisin-like protease              90.5    7e-18   
emb|CDP02570.1|  unnamed protein product                              90.5    8e-18   
gb|KJB58612.1|  hypothetical protein B456_009G218000                  90.5    8e-18   
ref|XP_006393933.1|  hypothetical protein EUTSA_v10003693mg           90.1    9e-18   
ref|XP_002523602.1|  Cucumisin precursor, putative                    90.1    9e-18   
gb|ABR17987.1|  unknown                                               90.1    9e-18   
ref|XP_008444575.1|  PREDICTED: subtilisin-like protease              90.1    1e-17   
ref|NP_001151463.1|  LOC100285096 precursor                           90.1    1e-17   
tpg|DAA51518.1|  TPA: putative subtilase family protein               90.1    1e-17   
ref|XP_006339823.1|  PREDICTED: subtilisin-like protease-like         89.7    1e-17   
ref|XP_003608462.1|  Subtilisin-like protease                         89.7    1e-17   
gb|EYU37942.1|  hypothetical protein MIMGU_mgv1a001727mg              89.7    2e-17   
ref|XP_006426684.1|  hypothetical protein CICLE_v10024936mg           89.7    2e-17   
ref|XP_010939822.1|  PREDICTED: subtilisin-like protease              89.4    2e-17   
ref|XP_008220305.1|  PREDICTED: subtilisin-like protease              89.4    2e-17   
ref|XP_009336065.1|  PREDICTED: subtilisin-like protease              89.4    2e-17   
ref|XP_010437545.1|  PREDICTED: subtilisin-like protease              89.4    2e-17   
ref|XP_010447014.1|  PREDICTED: subtilisin-like protease              89.4    2e-17   
ref|XP_002304129.2|  hypothetical protein POPTR_0003s06530g           89.4    2e-17   
ref|XP_003547763.1|  PREDICTED: subtilisin-like protease-like         89.4    2e-17   
ref|XP_011092912.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...  89.4    2e-17   
ref|XP_006465903.1|  PREDICTED: subtilisin-like protease-like         89.4    2e-17   
ref|XP_011036446.1|  PREDICTED: subtilisin-like protease              89.4    2e-17   
emb|CDP15538.1|  unnamed protein product                              89.0    2e-17   
gb|EYU39027.1|  hypothetical protein MIMGU_mgv1a019149mg              89.0    2e-17   
ref|XP_010647741.1|  PREDICTED: subtilisin-like protease              89.0    2e-17   
gb|KDP41644.1|  hypothetical protein JCGZ_16051                       89.0    2e-17   
ref|XP_009362303.1|  PREDICTED: subtilisin-like protease              89.0    3e-17   
ref|XP_011028928.1|  PREDICTED: subtilisin-like protease              88.6    3e-17   
ref|XP_007047459.1|  Subtilase family protein                         88.6    3e-17   
emb|CDY18654.1|  BnaA09g07410D                                        88.6    3e-17   
ref|XP_010033727.1|  PREDICTED: subtilisin-like protease              88.6    4e-17   
ref|XP_011071267.1|  PREDICTED: subtilisin-like protease SDD1         88.2    4e-17   
gb|KCW53526.1|  hypothetical protein EUGRSUZ_J02805                   88.2    4e-17   
ref|NP_567972.1|  subtilisin-like serine protease 2                   88.2    5e-17   
gb|KJB43875.1|  hypothetical protein B456_007G221100                  88.2    5e-17   
ref|XP_010088796.1|  Subtilisin-like protease                         88.2    5e-17   
ref|XP_007226995.1|  hypothetical protein PRUPE_ppa001756mg           88.2    5e-17   
ref|XP_002510119.1|  Xylem serine proteinase 1 precursor, putative    87.8    6e-17   
emb|CDY63300.1|  BnaCnng41800D                                        87.8    6e-17   
ref|XP_006583162.1|  PREDICTED: subtilisin-like protease-like iso...  87.8    6e-17   
emb|CAN68827.1|  hypothetical protein VITISV_029978                   87.8    6e-17   
ref|XP_002282333.2|  PREDICTED: subtilisin-like protease              87.8    6e-17   
dbj|BAJ89456.1|  predicted protein                                    87.8    6e-17   
ref|XP_004231903.1|  PREDICTED: subtilisin-like protease              87.8    6e-17   
ref|XP_011071248.1|  PREDICTED: subtilisin-like protease              87.8    7e-17   
ref|XP_008372210.1|  PREDICTED: subtilisin-like protease              87.8    7e-17   
emb|CDY55359.1|  BnaCnng28690D                                        87.4    7e-17   
gb|EYU40429.1|  hypothetical protein MIMGU_mgv1a001733mg              87.4    7e-17   
ref|XP_006343203.1|  PREDICTED: subtilisin-like protease-like         87.4    7e-17   
emb|CDY18653.1|  BnaA09g07420D                                        87.4    7e-17   
ref|XP_009770992.1|  PREDICTED: subtilisin-like protease              87.4    8e-17   
gb|EYU37178.1|  hypothetical protein MIMGU_mgv1a001832mg              87.4    8e-17   
gb|EYU37168.1|  hypothetical protein MIMGU_mgv1a026826mg              87.4    8e-17   
emb|CDY40653.1|  BnaA03g53100D                                        87.4    1e-16   
ref|XP_008440346.1|  PREDICTED: subtilisin-like protease              87.0    1e-16   
ref|XP_006357406.1|  PREDICTED: subtilisin-like protease-like         87.0    1e-16   
ref|XP_010088794.1|  Subtilisin-like protease                         87.0    1e-16   
ref|XP_007156742.1|  hypothetical protein PHAVU_002G013500g           87.0    1e-16   
ref|XP_009112375.1|  PREDICTED: subtilisin-like protease isoform X2   87.0    1e-16   
ref|XP_011071279.1|  PREDICTED: subtilisin-like protease              87.0    1e-16   
ref|XP_003562295.2|  PREDICTED: subtilisin-like protease              86.7    1e-16   
ref|XP_011069783.1|  PREDICTED: subtilisin-like protease              86.7    1e-16   
ref|XP_007135429.1|  hypothetical protein PHAVU_010G128600g           86.7    1e-16   
ref|XP_009613609.1|  PREDICTED: subtilisin-like protease              86.7    1e-16   
ref|XP_002867098.1|  hypothetical protein ARALYDRAFT_491159           86.7    2e-16   
gb|EYU39032.1|  hypothetical protein MIMGU_mgv1a023804mg              86.7    2e-16   
emb|CBI33725.3|  unnamed protein product                              86.3    2e-16   
ref|XP_011088593.1|  PREDICTED: subtilisin-like protease              86.7    2e-16   
emb|CDY12840.1|  BnaC07g15930D                                        86.3    2e-16   
ref|XP_006359680.1|  PREDICTED: subtilisin-like protease-like         86.7    2e-16   
ref|XP_009789823.1|  PREDICTED: subtilisin-like protease              86.3    2e-16   
ref|XP_004234656.1|  PREDICTED: subtilisin-like protease              86.3    2e-16   
ref|XP_006857970.1|  hypothetical protein AMTR_s00069p00178060        86.3    2e-16   
ref|XP_002283279.2|  PREDICTED: subtilisin-like protease              86.3    2e-16   
emb|CDY43570.1|  BnaC02g16670D                                        82.8    2e-16   
ref|XP_008804041.1|  PREDICTED: subtilisin-like protease SDD1         86.3    2e-16   
ref|XP_010927458.1|  PREDICTED: subtilisin-like protease              86.3    2e-16   
ref|XP_009593174.1|  PREDICTED: subtilisin-like protease              86.3    2e-16   
ref|XP_011071709.1|  PREDICTED: subtilisin-like protease              86.7    2e-16   
ref|XP_004958128.1|  PREDICTED: subtilisin-like protease-like         86.3    2e-16   
ref|XP_007155854.1|  hypothetical protein PHAVU_003G237300g           86.3    2e-16   
ref|XP_004308418.2|  PREDICTED: subtilisin-like protease              86.3    2e-16   
gb|KDO79000.1|  hypothetical protein CISIN_1g004301mg                 86.3    2e-16   
ref|XP_002284101.1|  PREDICTED: subtilisin-like protease              86.3    2e-16   
ref|XP_006466502.1|  PREDICTED: subtilisin-like protease-like         86.3    2e-16   
ref|XP_006426043.1|  hypothetical protein CICLE_v10024951mg           86.3    2e-16   
ref|XP_002463844.1|  hypothetical protein SORBIDRAFT_01g007310        86.3    2e-16   
ref|XP_010690381.1|  PREDICTED: subtilisin-like protease              85.9    3e-16   
emb|CDO96926.1|  unnamed protein product                              85.9    3e-16   
ref|XP_008792659.1|  PREDICTED: subtilisin-like protease              85.9    3e-16   
gb|EPS74284.1|  hypothetical protein M569_00464                       85.9    3e-16   
gb|KJB82990.1|  hypothetical protein B456_013G223900                  85.9    3e-16   
ref|XP_002865008.1|  hypothetical protein ARALYDRAFT_496864           85.9    3e-16   
ref|XP_009112374.1|  PREDICTED: subtilisin-like protease isoform X1   85.9    3e-16   
ref|XP_004499011.1|  PREDICTED: subtilisin-like protease-like         85.9    3e-16   
ref|XP_004231902.2|  PREDICTED: subtilisin-like protease              85.9    3e-16   
ref|XP_006383545.1|  hypothetical protein POPTR_0005s18880g           85.9    3e-16   
ref|XP_011010186.1|  PREDICTED: subtilisin-like protease              85.9    3e-16   
ref|XP_009382355.1|  PREDICTED: subtilisin-like protease              85.5    3e-16   
ref|XP_010685295.1|  PREDICTED: subtilisin-like protease              85.9    3e-16   
ref|XP_010070634.1|  PREDICTED: subtilisin-like protease              85.5    4e-16   
ref|XP_009802011.1|  PREDICTED: subtilisin-like protease              85.5    4e-16   
ref|XP_006369129.1|  subtilase family protein                         85.5    4e-16   
ref|XP_009103426.1|  PREDICTED: subtilisin-like protease              85.5    4e-16   
ref|XP_010066012.1|  PREDICTED: subtilisin-like protease              85.5    4e-16   
ref|XP_010277120.1|  PREDICTED: subtilisin-like protease              85.5    4e-16   
ref|XP_009610930.1|  PREDICTED: subtilisin-like protease              85.1    5e-16   
ref|XP_010105479.1|  Subtilisin-like protease                         85.1    5e-16   
emb|CDY57437.1|  BnaAnng14520D                                        85.1    5e-16   
ref|XP_010444660.1|  PREDICTED: subtilisin-like protease              85.1    5e-16   
ref|XP_008377981.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...  85.1    5e-16   
gb|EMS49122.1|  Subtilisin-like protease                              85.1    5e-16   
ref|XP_003589103.1|  Subtilisin-like protease                         85.1    5e-16   
dbj|BAJ88205.1|  predicted protein                                    85.1    5e-16   
ref|XP_010484513.1|  PREDICTED: subtilisin-like protease              85.1    5e-16   
ref|XP_010464171.1|  PREDICTED: subtilisin-like protease              85.1    6e-16   
emb|CBI21415.3|  unnamed protein product                              85.1    6e-16   
dbj|BAJ96698.1|  predicted protein                                    85.1    6e-16   
ref|XP_009404128.1|  PREDICTED: subtilisin-like protease              85.1    6e-16   
dbj|BAJ86110.1|  predicted protein                                    85.1    6e-16   
ref|XP_004244591.1|  PREDICTED: subtilisin-like protease              84.7    6e-16   
ref|XP_010688373.1|  PREDICTED: subtilisin-like protease              84.7    6e-16   
ref|XP_010910929.1|  PREDICTED: subtilisin-like protease SDD1         84.7    7e-16   
gb|ABD33266.1|  Protease-associated PA; Proteinase inhibitor I9, ...  84.7    7e-16   
ref|XP_011017137.1|  PREDICTED: subtilisin-like protease              84.7    7e-16   
emb|CDP10007.1|  unnamed protein product                              84.7    7e-16   
ref|XP_007220042.1|  hypothetical protein PRUPE_ppa027143mg           84.7    7e-16   
ref|XP_003559080.1|  PREDICTED: subtilisin-like protease              84.7    7e-16   
ref|XP_009138332.1|  PREDICTED: subtilisin-like protease              84.3    8e-16   
ref|XP_003597117.1|  Subtilisin-like protease                         84.3    8e-16   
dbj|BAJ99493.1|  predicted protein                                    84.3    9e-16   



>ref|XP_006342632.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=749

 Score =   169 bits (427),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 89/141 (63%), Positives = 110/141 (78%), Gaps = 9/141 (6%)
 Frame = +1

Query  40   MANHRALFFHLAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSIS-  216
            MAN+ AL F   F++  F    S   +SETYI+HMDLS MP+AF+SH SW+ +TL+SIS 
Sbjct  1    MANYIALCF--CFLAILFPFTMS---KSETYIIHMDLSAMPKAFSSHHSWYLSTLASISD  55

Query  217  --NRG-LVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSS  387
              N G LVYAYTNAIHGFSA L+P+EL+ IKKS GYL STKD +VK+DT+HT  FLGL+S
Sbjct  56   STNHGSLVYAYTNAIHGFSASLTPSELQVIKKSQGYLSSTKDMTVKIDTTHTSQFLGLNS  115

Query  388  DHGAWPATDYGRDVIIGVIDT  450
            + GAWP +DYGRDVIIG++DT
Sbjct  116  NSGAWPKSDYGRDVIIGLVDT  136



>ref|XP_006342631.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=755

 Score =   166 bits (420),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 88/147 (60%), Positives = 107/147 (73%), Gaps = 15/147 (10%)
 Frame = +1

Query  40   MANHRALFFHLAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISN  219
            MAN  AL   L F S  F    S   QSETYI+HMDLS MP+AF+SH SW+ +TL+S+S+
Sbjct  1    MANCVALC--LWFFSILFPITMS---QSETYIIHMDLSAMPKAFSSHHSWYLSTLASVSD  55

Query  220  ----------RGLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPG  369
                        LVYAYTNAIHGFSA+LSP+EL+ IK S GYL STKD +VK+DT+HT  
Sbjct  56   SSNLDYASNKNSLVYAYTNAIHGFSAILSPSELQVIKNSQGYLSSTKDMTVKIDTTHTSQ  115

Query  370  FLGLSSDHGAWPATDYGRDVIIGVIDT  450
            FLGL+S+ GAWP +DYGRDVIIG++DT
Sbjct  116  FLGLNSNSGAWPKSDYGRDVIIGLVDT  142



>ref|XP_009790288.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=764

 Score =   165 bits (418),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 79/126 (63%), Positives = 98/126 (78%), Gaps = 15/126 (12%)
 Frame = +1

Query  118  QSETYIVHMDLSFMPRAFTSHQSWFSATLSSIS---------NRG------LVYAYTNAI  252
            QSETYI+HMDLS MP+AF+SHQ+W+  TL+S+S         NR       LVYAYTNAI
Sbjct  26   QSETYIIHMDLSAMPKAFSSHQNWYLTTLASVSDSSNLGTASNRNSFSSTKLVYAYTNAI  85

Query  253  HGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVI  432
            HGFSA LSP+ELE +K SPGYL STKD +VK+DT+HT  FLGL+S+ GAWP +DYG+DVI
Sbjct  86   HGFSASLSPSELEVVKNSPGYLTSTKDMTVKIDTTHTSQFLGLNSNSGAWPKSDYGKDVI  145

Query  433  IGVIDT  450
            +G++DT
Sbjct  146  VGLVDT  151



>ref|XP_009800439.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=764

 Score =   165 bits (418),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 79/126 (63%), Positives = 98/126 (78%), Gaps = 15/126 (12%)
 Frame = +1

Query  118  QSETYIVHMDLSFMPRAFTSHQSWFSATLSSIS---------NRG------LVYAYTNAI  252
            QSETYI+HMDLS MP+AF+SHQ+W+  TL+S+S         NR       LVYAYTNAI
Sbjct  26   QSETYIIHMDLSAMPKAFSSHQNWYLTTLASVSDSSNLGTASNRNSFSSTKLVYAYTNAI  85

Query  253  HGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVI  432
            HGFSA LSP+ELE +K SPGYL STKD +VK+DT+HT  FLGL+S+ GAWP +DYG+DVI
Sbjct  86   HGFSASLSPSELEVVKNSPGYLSSTKDMTVKIDTTHTSQFLGLNSNSGAWPKSDYGKDVI  145

Query  433  IGVIDT  450
            +G++DT
Sbjct  146  VGLVDT  151



>ref|XP_009771086.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=772

 Score =   166 bits (419),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 86/154 (56%), Positives = 110/154 (71%), Gaps = 15/154 (10%)
 Frame = +1

Query  19   FSILA*EMANHRALFFHLAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSA  198
            FS+L   MANH  L   L F    F+ I S+  +SETYI+HMD S MP+AF+SH +W+  
Sbjct  8    FSVLL-NMANHITLCIWLLFF---FISIISL-AKSETYIIHMDFSAMPKAFSSHHNWYLT  62

Query  199  TLSSISNRG----------LVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKV  348
            TLSS+S+            LVY+YTNAIHGFSA LSP+ELEAIK SPGY+ S KD SVK+
Sbjct  63   TLSSVSDSSTNYKDFLSSKLVYSYTNAIHGFSASLSPSELEAIKNSPGYVSSIKDISVKI  122

Query  349  DTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDT  450
            DT+HT  FLGL+S+ G WP ++YG+D+IIG++DT
Sbjct  123  DTTHTSQFLGLNSESGVWPTSEYGKDIIIGLVDT  156



>ref|XP_011069659.1| PREDICTED: subtilisin-like protease [Sesamum indicum]
Length=754

 Score =   164 bits (415),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 80/138 (58%), Positives = 105/138 (76%), Gaps = 7/138 (5%)
 Frame = +1

Query  58   LFFHLAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISNRG----  225
            L   L F++ T  Q+ S    S+TYIVHMDL+ MP+AF+SH++W+S TLSS+SN      
Sbjct  7    LCLCLCFLAITVPQLMSTSTDSDTYIVHMDLTAMPKAFSSHRTWYSTTLSSVSNSNKATT  66

Query  226  ---LVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHG  396
               LVYAYT AI+GFSAVLS +EL+AIK S GY+ S +D +VKVDT+ +  FLGL+SD+G
Sbjct  67   TSNLVYAYTTAINGFSAVLSSSELDAIKNSAGYVSSIRDTTVKVDTTQSYRFLGLNSDNG  126

Query  397  AWPATDYGRDVIIGVIDT  450
            AWPA+DYG+DVI+GV+DT
Sbjct  127  AWPASDYGKDVIVGVVDT  144



>ref|XP_004252763.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=775

 Score =   164 bits (415),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 92/152 (61%), Positives = 114/152 (75%), Gaps = 9/152 (6%)
 Frame = +1

Query  7    IPS*FSILA*EMANHRALFFHLAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQS  186
            IP+  S L   MAN+ AL+  L F++  F   FS+  + ETYI+HMDLS MP AF+SH S
Sbjct  16   IPTSISFLQKNMANYIALW--LCFLAILF--PFSMS-KLETYIIHMDLSAMPIAFSSHHS  70

Query  187  WFSATLSSIS---NRG-LVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDT  354
            W+ +TL+SIS   N G LVYAYTNAIHGFSA LS +EL+ IK+  GYL STKD +VK+DT
Sbjct  71   WYLSTLASISDSSNHGSLVYAYTNAIHGFSARLSLSELQVIKRCQGYLSSTKDMTVKIDT  130

Query  355  SHTPGFLGLSSDHGAWPATDYGRDVIIGVIDT  450
            +HT  FLGLSS+ GAWP +DYGRDVIIG++DT
Sbjct  131  THTSQFLGLSSNSGAWPKSDYGRDVIIGLVDT  162



>ref|XP_009604890.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=755

 Score =   160 bits (404),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 84/154 (55%), Positives = 108/154 (70%), Gaps = 15/154 (10%)
 Frame = +1

Query  19   FSILA*EMANHRALFFHLAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSA  198
            F+IL   MA+H  L   L F    F+ I S+  + ETYI+HMDLS MP+AF SH +W+  
Sbjct  8    FNILL-NMASHITLCIWLLFF---FISIISL-AKPETYIIHMDLSAMPKAFASHHNWYLT  62

Query  199  TLSSISNRG----------LVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKV  348
            TL+S+S+            LVYAYTNAI+GFSA LSP+E EAIK SPGY+ S KD SVK+
Sbjct  63   TLASLSDSSTNHKEFLSSKLVYAYTNAINGFSASLSPSEFEAIKNSPGYVSSIKDMSVKI  122

Query  349  DTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDT  450
            DT+HT  FLGL+S+ G WP +DYG+D+IIG++DT
Sbjct  123  DTTHTSQFLGLNSESGVWPTSDYGKDIIIGLVDT  156



>ref|XP_010320328.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=751

 Score =   156 bits (395),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 81/143 (57%), Positives = 103/143 (72%), Gaps = 14/143 (10%)
 Frame = +1

Query  40   MANHRALFFHLAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISN  219
            MAN+ AL   L       L I  +  +SETYI+HMDLS MP+AF+SH +W+  TL S+S+
Sbjct  1    MANYIALCIWL-------LSIIQL-AKSETYIIHMDLSAMPKAFSSHYNWYLTTLFSVSD  52

Query  220  RG------LVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGL  381
                    LVY YTNAI+GFSA LSP+E+EAIK SPGY+ S KD SVKVDT+HT  FLGL
Sbjct  53   SKDLLSSKLVYTYTNAINGFSASLSPSEIEAIKNSPGYVSSIKDMSVKVDTTHTSQFLGL  112

Query  382  SSDHGAWPATDYGRDVIIGVIDT  450
            +S+ G WP +DYG+DVI+G++DT
Sbjct  113  NSESGVWPKSDYGKDVIVGLVDT  135



>ref|XP_010263512.1| PREDICTED: subtilisin-like protease [Nelumbo nucifera]
Length=767

 Score =   152 bits (383),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 74/141 (52%), Positives = 103/141 (73%), Gaps = 15/141 (11%)
 Frame = +1

Query  70   LAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISNR---------  222
            L FI+ T  ++ S   QS+ YI+HMD++ MP+AF+SH +W++ATLSS+SN          
Sbjct  15   LLFIT-TVSRLSSTLAQSDMYIIHMDMAAMPKAFSSHHTWYAATLSSVSNNSVANSNTDA  73

Query  223  -----GLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSS  387
                  LVY YTNAIHGFSA LSP+EL+++KK PGY+ ST+D  V V T+HTP FL L+ 
Sbjct  74   TIPTPNLVYTYTNAIHGFSARLSPSELDSLKKLPGYISSTRDIPVTVHTTHTPEFLDLNP  133

Query  388  DHGAWPATDYGRDVIIGVIDT  450
            ++GAWPA++YG+DVI+G++DT
Sbjct  134  NYGAWPASNYGQDVIVGLVDT  154



>gb|EYU45081.1| hypothetical protein MIMGU_mgv1a002217mg [Erythranthe guttata]
Length=700

 Score =   149 bits (376),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 74/138 (54%), Positives = 101/138 (73%), Gaps = 9/138 (7%)
 Frame = +1

Query  58   LFFHLAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISNRG----  225
            +F    F+S    Q  SI    ETYIVHMD+S MP+ FTSH SW++++L+++++      
Sbjct  8    VFLCFFFLSVASQQ--SISKAYETYIVHMDVSLMPKPFTSHHSWYTSSLATVADSSSPPS  65

Query  226  ---LVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHG  396
               L+Y Y+NAI+GFSA+LS AELEA+K  PGYL STKD  VK+DT+H+  FLGL+ DHG
Sbjct  66   SSRLLYTYSNAINGFSAILSSAELEAVKTLPGYLSSTKDKPVKLDTTHSYRFLGLNHDHG  125

Query  397  AWPATDYGRDVIIGVIDT  450
            AWPA++YG +VIIG++DT
Sbjct  126  AWPASNYGDNVIIGLVDT  143



>ref|XP_010263511.1| PREDICTED: subtilisin-like protease [Nelumbo nucifera]
Length=768

 Score =   147 bits (371),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 76/139 (55%), Positives = 96/139 (69%), Gaps = 14/139 (10%)
 Frame = +1

Query  70   LAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISN----------  219
            L FI  TF  + SI  QS  YIVHMDLS MP  F+SH SW+ A LSS+S           
Sbjct  9    LLFI--TFSCLSSILAQSNVYIVHMDLSAMPETFSSHDSWYMAMLSSVSEATYAVASTTS  66

Query  220  --RGLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDH  393
                L+Y Y+NAIHGF+A LSP+EL+ +K SPGY+ ST+D  +  DT+HT  FLGL+SD+
Sbjct  67   KASKLIYTYSNAIHGFAAALSPSELDLLKSSPGYVSSTQDVPLAADTTHTSEFLGLNSDY  126

Query  394  GAWPATDYGRDVIIGVIDT  450
            GAWPA++YG DVIIG++DT
Sbjct  127  GAWPASNYGADVIIGLVDT  145



>ref|XP_002282841.2| PREDICTED: uncharacterized protein LOC100259061 [Vitis vinifera]
Length=1529

 Score =   147 bits (371),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 71/132 (54%), Positives = 94/132 (71%), Gaps = 14/132 (11%)
 Frame = +1

Query  97   QIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISNR--------------GLVY  234
             + S   QS+TYIVHMDLS MP+AF+ H SW+ ATL+S+S+                L+Y
Sbjct  785  HLVSTLAQSDTYIVHMDLSAMPKAFSGHHSWYMATLASVSDNTAATANPYSSSYSSKLIY  844

Query  235  AYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATD  414
            +YTN IHGFSA+LSP+ELEA+K  PGY+ S  D  VK DT+H+  FLGL+S+ GAWP ++
Sbjct  845  SYTNVIHGFSAILSPSELEALKSFPGYISSFPDLPVKADTTHSAKFLGLNSNSGAWPMSN  904

Query  415  YGRDVIIGVIDT  450
            YG+DVIIG++DT
Sbjct  905  YGKDVIIGLVDT  916


 Score =   121 bits (304),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 59/130 (45%), Positives = 86/130 (66%), Gaps = 12/130 (9%)
 Frame = +1

Query  97   QIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSI------------SNRGLVYAY  240
            Q  S+ G+  TYI+HMD S MP+ F +H  W+S+ L +I            S   L+Y Y
Sbjct  26   QARSMSGERSTYIIHMDKSVMPKVFATHHHWYSSILHAIKTDTPTTSAGLQSTARLIYTY  85

Query  241  TNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYG  420
             +A+HGFSA+LS  ELE++++SPG++ + +D +V +DT+HT  FL L+   G WPA+DYG
Sbjct  86   DHALHGFSALLSSQELESLRESPGFVSAYRDRAVTLDTTHTFEFLKLNPVTGLWPASDYG  145

Query  421  RDVIIGVIDT  450
             DVI+GVID+
Sbjct  146  EDVIVGVIDS  155



>ref|XP_002267740.1| PREDICTED: subtilisin-like protease [Vitis vinifera]
Length=762

 Score =   145 bits (366),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 69/119 (58%), Positives = 92/119 (77%), Gaps = 9/119 (8%)
 Frame = +1

Query  121  SETYIVHMDLSFMPRAFTSHQSWFSATLSSISN---------RGLVYAYTNAIHGFSAVL  273
            ++TYIVHMD S MP+ F+SH +WFSA +S+IS+           L+Y+YT++IHGFSA+L
Sbjct  29   ADTYIVHMDSSAMPKPFSSHHTWFSAIVSAISDDSAPPPTTTNKLIYSYTSSIHGFSAIL  88

Query  274  SPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDT  450
            +P+ELE++K +PGYL ST D  +K+ T+HTP FLGLS DHGAWPA+ YG  VIIGV+DT
Sbjct  89   TPSELESLKNTPGYLSSTPDFPLKLHTTHTPQFLGLSYDHGAWPASSYGDGVIIGVVDT  147



>gb|KCW66398.1| hypothetical protein EUGRSUZ_F00212 [Eucalyptus grandis]
Length=728

 Score =   144 bits (363),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 75/153 (49%), Positives = 99/153 (65%), Gaps = 24/153 (16%)
 Frame = +1

Query  55   ALFFH------LAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSI-  213
            A+F H      LA I   F+       QS+ YI+HMD SFMP+AF+ H SW+ AT+SS+ 
Sbjct  2    AVFVHSFVTGVLALIILCFVPTLE---QSDNYIIHMDSSFMPKAFSDHHSWYLATVSSLA  58

Query  214  --------------SNRGLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVD  351
                          S   L+Y+YT+ I GFSA LSP+ELEA+KK PGY+ S KD  VK D
Sbjct  59   QSRSPNVRARASAASTSRLIYSYTHVIQGFSASLSPSELEALKKRPGYVSSLKDLPVKAD  118

Query  352  TSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDT  450
            T+H+  FLGL+S+ GAWP +DYG+D+IIG++DT
Sbjct  119  TTHSTQFLGLNSNAGAWPTSDYGKDIIIGLVDT  151



>ref|XP_010059919.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
Length=766

 Score =   144 bits (363),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 75/153 (49%), Positives = 99/153 (65%), Gaps = 24/153 (16%)
 Frame = +1

Query  55   ALFFH------LAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSI-  213
            A+F H      LA I   F+       QS+ YI+HMD SFMP+AF+ H SW+ AT+SS+ 
Sbjct  2    AVFVHSFVTGVLALIILCFVPTLE---QSDNYIIHMDSSFMPKAFSDHHSWYLATVSSLA  58

Query  214  --------------SNRGLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVD  351
                          S   L+Y+YT+ I GFSA LSP+ELEA+KK PGY+ S KD  VK D
Sbjct  59   QSRSPNVRARASAASTSRLIYSYTHVIQGFSASLSPSELEALKKRPGYVSSLKDLPVKAD  118

Query  352  TSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDT  450
            T+H+  FLGL+S+ GAWP +DYG+D+IIG++DT
Sbjct  119  TTHSTQFLGLNSNAGAWPTSDYGKDIIIGLVDT  151



>ref|XP_003548400.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=753

 Score =   144 bits (363),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 70/150 (47%), Positives = 99/150 (66%), Gaps = 15/150 (10%)
 Frame = +1

Query  40   MANHRALFFHLAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSS---  210
            MA H  L   L F+  T L + S   QS+ YI+HMD+S MP+ F++  SW+ +TLSS   
Sbjct  1    MATHICL--SLCFLYITTLNLVSTLAQSDNYIIHMDISAMPKTFSTQHSWYLSTLSSALD  58

Query  211  ----------ISNRGLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSH  360
                      +S+  L+Y YTNAI+GFSA LSP ELE++K SPGY+   +D   K DT+H
Sbjct  59   NSKATNNLNSVSSSKLIYTYTNAINGFSANLSPKELESLKTSPGYVSYMRDLPAKRDTTH  118

Query  361  TPGFLGLSSDHGAWPATDYGRDVIIGVIDT  450
            +P FLGL+ + GAWP +++G+DVI+G++DT
Sbjct  119  SPQFLGLNPNEGAWPVSEFGKDVIVGLVDT  148



>ref|XP_009595649.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=763

 Score =   144 bits (363),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 87/152 (57%), Positives = 105/152 (69%), Gaps = 17/152 (11%)
 Frame = +1

Query  40   MANHRALFFHLAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSIS-  216
            MAN   L+F    I  T L  F I  QSETYI+HMDLS MP AF+SHQ+W+  TL+S+S 
Sbjct  1    MANCITLYFLFLAILLT-LNPF-IMAQSETYIIHMDLSAMPTAFSSHQNWYLTTLASVSD  58

Query  217  --------NRG------LVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDT  354
                    NR       +VYAYTNAIHGFSA LS +ELE IK SPGYL STKD +VK DT
Sbjct  59   SSSLGTASNRNSLSSSKIVYAYTNAIHGFSASLSSSELEVIKNSPGYLSSTKDMTVKSDT  118

Query  355  SHTPGFLGLSSDHGAWPATDYGRDVIIGVIDT  450
            +HT  FLGL+S+ G WP +DYG+DVI+G++DT
Sbjct  119  THTSQFLGLNSNSGVWPKSDYGKDVIVGLVDT  150



>gb|KCW62487.1| hypothetical protein EUGRSUZ_H05125 [Eucalyptus grandis]
Length=768

 Score =   144 bits (363),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 73/151 (48%), Positives = 101/151 (67%), Gaps = 19/151 (13%)
 Frame = +1

Query  55   ALFFHLAFISATFLQIF---SIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSI----  213
            A+  H + ++   L +F   S  GQS+ YI+HMDLS MP+AF+ H SWF AT+SS+    
Sbjct  2    AVRVHSSLMTLLILTMFCFASTMGQSDNYIIHMDLSSMPKAFSDHHSWFLATVSSLVQSP  61

Query  214  ------------SNRGLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTS  357
                        ++  L+Y+YT  + GFSA LSP+ELEA+K SPGY+ S KD   KVDT+
Sbjct  62   NPKVRAKATITPTSSKLIYSYTYVMQGFSASLSPSELEALKNSPGYISSMKDLPGKVDTT  121

Query  358  HTPGFLGLSSDHGAWPATDYGRDVIIGVIDT  450
            H+  FLGL+S+ GAWP +DYG+DVI+G++DT
Sbjct  122  HSTQFLGLNSNSGAWPTSDYGKDVIVGLVDT  152



>gb|ACT34764.1| subtilisin-like protease preproenzyme [Nicotiana tabacum]
Length=763

 Score =   143 bits (361),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 86/152 (57%), Positives = 105/152 (69%), Gaps = 17/152 (11%)
 Frame = +1

Query  40   MANHRALFFHLAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSIS-  216
            MAN   L+F    I  T L  F I  QSETY++HMDLS MP AF+SHQ+W+  TL+S+S 
Sbjct  1    MANCITLYFLFLAILLT-LNPF-IMAQSETYVIHMDLSAMPTAFSSHQNWYLTTLASVSD  58

Query  217  --------NRG------LVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDT  354
                    NR       +VYAYTNAIHGFSA LS +ELE IK SPGYL STKD +VK DT
Sbjct  59   SSSLGTASNRNSLSSSKIVYAYTNAIHGFSASLSSSELEVIKNSPGYLSSTKDMTVKSDT  118

Query  355  SHTPGFLGLSSDHGAWPATDYGRDVIIGVIDT  450
            +HT  FLGL+S+ G WP +DYG+DVI+G++DT
Sbjct  119  THTSQFLGLNSNSGVWPKSDYGKDVIVGLVDT  150



>gb|KCW66392.1| hypothetical protein EUGRSUZ_F00206 [Eucalyptus grandis]
Length=756

 Score =   142 bits (359),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 72/147 (49%), Positives = 97/147 (66%), Gaps = 19/147 (13%)
 Frame = +1

Query  67   HLAFISATFLQIF---SIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISNR-----  222
            H + ++   L +F   S  GQS+ YI+HMDLS MP+AF+ H SWF AT+SS+        
Sbjct  6    HSSLMTLLILTMFCFASTTGQSDNYIIHMDLSSMPKAFSDHHSWFLATVSSLVQSPNPKV  65

Query  223  -----------GLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPG  369
                        L+Y+YT+ + GFSA LSP ELEA+K SPGY+ S KD   KVDT+H+  
Sbjct  66   RAKTTATPTFAKLIYSYTHVMQGFSASLSPLELEALKNSPGYISSMKDLPGKVDTTHSTQ  125

Query  370  FLGLSSDHGAWPATDYGRDVIIGVIDT  450
            FLGL+S+ GAWP +DYG+DVI+G++DT
Sbjct  126  FLGLNSNSGAWPTSDYGKDVIVGLVDT  152



>ref|XP_010059916.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
Length=768

 Score =   142 bits (359),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 72/147 (49%), Positives = 97/147 (66%), Gaps = 19/147 (13%)
 Frame = +1

Query  67   HLAFISATFLQIF---SIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISNR-----  222
            H + ++   L +F   S  GQS+ YI+HMDLS MP+AF+ H SWF AT+SS+        
Sbjct  6    HSSLMTLLILTMFCFASTTGQSDNYIIHMDLSSMPKAFSDHHSWFLATVSSLVQSPNPKV  65

Query  223  -----------GLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPG  369
                        L+Y+YT+ + GFSA LSP ELEA+K SPGY+ S KD   KVDT+H+  
Sbjct  66   RAKTTATPTFAKLIYSYTHVMQGFSASLSPLELEALKNSPGYISSMKDLPGKVDTTHSTQ  125

Query  370  FLGLSSDHGAWPATDYGRDVIIGVIDT  450
            FLGL+S+ GAWP +DYG+DVI+G++DT
Sbjct  126  FLGLNSNSGAWPTSDYGKDVIVGLVDT  152



>ref|XP_002523606.1| Cucumisin precursor, putative [Ricinus communis]
 gb|EEF38801.1| Cucumisin precursor, putative [Ricinus communis]
Length=768

 Score =   142 bits (359),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 70/142 (49%), Positives = 101/142 (71%), Gaps = 11/142 (8%)
 Frame = +1

Query  52   RALFFHLAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISNRGL-  228
            +A+  +L  +  +FL   S+  +S+TYI+HMDLS MP+AF+ H +W+ AT+S++S+    
Sbjct  16   KAVLAYLFLLEVSFLN--SVLAKSDTYIIHMDLSAMPKAFSDHHNWYLATISAVSDTSKA  73

Query  229  --------VYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLS  384
                    +Y YT+++HGFSA L+ +ELE++KK PGY+ ST+D  +KV T+HT  FLGLS
Sbjct  74   AVTPASKHIYTYTSSVHGFSASLTNSELESLKKYPGYISSTRDRPLKVHTTHTSQFLGLS  133

Query  385  SDHGAWPATDYGRDVIIGVIDT  450
            S  GAWPAT YG DVIIG++DT
Sbjct  134  SVSGAWPATSYGEDVIIGLVDT  155



>ref|XP_010059917.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
 gb|KCW66393.1| hypothetical protein EUGRSUZ_F00207 [Eucalyptus grandis]
Length=768

 Score =   142 bits (358),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 71/147 (48%), Positives = 100/147 (68%), Gaps = 19/147 (13%)
 Frame = +1

Query  67   HLAFISATFLQIF---SIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSI--------  213
            H + ++   L +F   S  GQS+ YI+HMDLS MP+AF+ H SWF AT+SS+        
Sbjct  6    HSSLMTLLILTMFCFASTMGQSDNYIIHMDLSSMPKAFSDHHSWFLATVSSLVQSPNPKV  65

Query  214  --------SNRGLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPG  369
                    ++  L+Y+YT+ + GFSA LSP+EL+A+K SPGY+ S KD   KVDT+H+  
Sbjct  66   RAKATTTPTSSKLIYSYTHVMQGFSASLSPSELKALKNSPGYISSMKDLPGKVDTTHSTQ  125

Query  370  FLGLSSDHGAWPATDYGRDVIIGVIDT  450
            FLGL+S+ GAWP +DYG+DVI+G++DT
Sbjct  126  FLGLNSNSGAWPTSDYGKDVIVGLVDT  152



>ref|XP_010112177.1| Subtilisin-like protease [Morus notabilis]
 gb|EXC32843.1| Subtilisin-like protease [Morus notabilis]
Length=767

 Score =   142 bits (358),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 75/153 (49%), Positives = 106/153 (69%), Gaps = 18/153 (12%)
 Frame = +1

Query  40   MANHRALF----FHLAFISATFLQIFS-IDGQSETYIVHMDLSFMPRAFTSHQSWFSATL  204
            MA+H A      +HL F+S  FL +   +  Q+E YI+HMDLS MP+AF +H SW+SATL
Sbjct  1    MASHHARTPLHNYHLYFLS--FLALSRLVSAQTENYIIHMDLSTMPKAFANHHSWYSATL  58

Query  205  SSISN-----------RGLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVD  351
            +++S              L+Y+YT+ I+GFSA L+P+ELEA+K SPGY+ S +D  VKVD
Sbjct  59   ATLSKTVPKTISLDLSSKLIYSYTHVINGFSASLTPSELEAVKGSPGYISSMRDLPVKVD  118

Query  352  TSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDT  450
            T+H+  FLGL+S+ GAW  ++YG +VIIG++DT
Sbjct  119  TTHSFKFLGLNSNSGAWRESNYGENVIIGLVDT  151



>ref|XP_010025755.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
Length=759

 Score =   142 bits (358),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 68/128 (53%), Positives = 91/128 (71%), Gaps = 16/128 (13%)
 Frame = +1

Query  115  GQSETYIVHMDLSFMPRAFTSHQSWFSATLSSI----------------SNRGLVYAYTN  246
            GQS+ YI+HMDLS MP+AF+ H SWF AT+SS+                ++  L+Y+YT 
Sbjct  16   GQSDNYIIHMDLSSMPKAFSDHHSWFLATVSSLVQSPNPKVRAKATITPTSSKLIYSYTY  75

Query  247  AIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRD  426
             + GFSA LSP+ELEA+K SPGY+ S KD   KVDT+H+  FLGL+S+ GAWP +DYG+D
Sbjct  76   VMQGFSASLSPSELEALKNSPGYISSMKDLPGKVDTTHSTQFLGLNSNSGAWPTSDYGKD  135

Query  427  VIIGVIDT  450
            VI+G++DT
Sbjct  136  VIVGLVDT  143



>ref|XP_008351993.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease [Malus 
domestica]
Length=764

 Score =   142 bits (357),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 72/149 (48%), Positives = 98/149 (66%), Gaps = 15/149 (10%)
 Frame = +1

Query  49   HRALFFHLAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISNR--  222
            H +L+F L+  + + L I S   QS+ YI+HMD S MP+AF+ H SW+ ATL S   +  
Sbjct  6    HVSLYFWLSIATISHLAIVSTFAQSQNYIIHMDSSVMPKAFSDHHSWYLATLDSTLGKFS  65

Query  223  -------------GLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHT  363
                          L+Y+YT+A++GFSA L+ +ELEA+K SPGY+ S KD  VK DT+HT
Sbjct  66   PNTTATSSSALSSKLIYSYTHAMNGFSASLTASELEALKSSPGYISSVKDLPVKKDTTHT  125

Query  364  PGFLGLSSDHGAWPATDYGRDVIIGVIDT  450
              FLGL+S  GAWP  +YG+DVIIG++DT
Sbjct  126  SQFLGLNSKSGAWPVANYGKDVIIGLVDT  154



>ref|XP_010059918.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
 gb|KCW66394.1| hypothetical protein EUGRSUZ_F00208 [Eucalyptus grandis]
Length=768

 Score =   142 bits (357),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 67/127 (53%), Positives = 90/127 (71%), Gaps = 16/127 (13%)
 Frame = +1

Query  118  QSETYIVHMDLSFMPRAFTSHQSWFSATLSSISNRG----------------LVYAYTNA  249
            Q + YI+HMDLSFMP+AF+ H SW+ AT+SS++                   L+Y+YT+ 
Sbjct  26   QPDNYIIHMDLSFMPKAFSDHHSWYLATVSSLTQSPNPKVRARADATPTSSRLIYSYTHV  85

Query  250  IHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDV  429
            I GFSA LSP+ELEA+K  PGY+ S KD  VKVDT+H+  FLGL+S+ GAWP +DYG+DV
Sbjct  86   IRGFSASLSPSELEALKNYPGYISSMKDLPVKVDTTHSTQFLGLNSNSGAWPISDYGKDV  145

Query  430  IIGVIDT  450
            I+G++DT
Sbjct  146  IVGLVDT  152



>ref|XP_009359804.1| PREDICTED: subtilisin-like protease [Pyrus x bretschneideri]
Length=765

 Score =   141 bits (356),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 72/150 (48%), Positives = 98/150 (65%), Gaps = 16/150 (11%)
 Frame = +1

Query  49   HRALFFHLAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISNR--  222
            H +L+F L+  + + L I S   QS+ YI+HMD S MP+AF+ H SW+ ATL S   +  
Sbjct  6    HVSLYFWLSIATISHLAIVSTFAQSQNYIIHMDSSVMPKAFSDHHSWYLATLDSALGKFT  65

Query  223  --------------GLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSH  360
                           L+Y+YT+A++GFSA L+ +ELEA+K SPGY+ S KD  VK DT+H
Sbjct  66   PSTTATSSSSALSSKLIYSYTHAMNGFSASLTASELEALKSSPGYISSVKDLPVKKDTTH  125

Query  361  TPGFLGLSSDHGAWPATDYGRDVIIGVIDT  450
            T  FLGL+S  GAWP  +YG+DVIIG++DT
Sbjct  126  TSQFLGLNSKSGAWPVANYGKDVIIGLVDT  155



>ref|XP_003548151.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=750

 Score =   141 bits (355),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 68/141 (48%), Positives = 95/141 (67%), Gaps = 14/141 (10%)
 Frame = +1

Query  58   LFFHLAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSIS-------  216
             FF++     T  +  S   QSE YI+HMD+S MP+A++SH +W+ +TLSS         
Sbjct  10   CFFYIT----TLHRTISTLAQSENYIIHMDISAMPKAYSSHHTWYLSTLSSALENSKATT  65

Query  217  ---NRGLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSS  387
               N  L+Y YTN I+GFSA LSP ELEA+K SPGY+ S +D   K DT+H+P FLGL+ 
Sbjct  66   DNLNSKLIYIYTNVINGFSANLSPKELEALKTSPGYVSSMRDLRAKRDTTHSPQFLGLNK  125

Query  388  DHGAWPATDYGRDVIIGVIDT  450
            + GAWPA+ +G+D+I+G++DT
Sbjct  126  NVGAWPASQFGKDIIVGLVDT  146



>ref|XP_002310134.2| subtilase family protein [Populus trichocarpa]
 gb|EEE90584.2| subtilase family protein [Populus trichocarpa]
Length=757

 Score =   140 bits (353),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 68/141 (48%), Positives = 97/141 (69%), Gaps = 16/141 (11%)
 Frame = +1

Query  55   ALFFHLAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISNRGL--  228
            +L F ++ +++T         QS+TYI+HMD S MP+AFT H +W+ AT+SS+S+     
Sbjct  11   SLVFTISLLASTL-------AQSDTYIIHMDRSAMPKAFTDHHNWYLATISSVSDTAKST  63

Query  229  -------VYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSS  387
                   +Y YT+++ GFSA L+ +ELEA+KKSPGY+ ST+D  +KV T+HT  FLGLSS
Sbjct  64   FTRTSKHIYTYTSSVQGFSASLTKSELEALKKSPGYISSTRDRKIKVHTTHTSEFLGLSS  123

Query  388  DHGAWPATDYGRDVIIGVIDT  450
              GAWP  +YG D+IIG++DT
Sbjct  124  SSGAWPTANYGEDMIIGLVDT  144



>ref|XP_003529873.2| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=753

 Score =   139 bits (351),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 70/151 (46%), Positives = 97/151 (64%), Gaps = 15/151 (10%)
 Frame = +1

Query  40   MANHRALFFHLAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSS---  210
            MA H  L     +I+   L I ++  QS+ YI+HMD+S MP+AF+S  +W+ +TLSS   
Sbjct  2    MATHICLSLCFFYITTYHLAISTL-AQSDNYIIHMDISAMPKAFSSQHTWYLSTLSSALD  60

Query  211  -----------ISNRGLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTS  357
                       + N  L+Y YTN I+GFSA LSP ELEA+K SPGY+ S +D   K DT+
Sbjct  61   NSKATSDNLNSVINSKLIYTYTNVINGFSANLSPKELEALKTSPGYVSSMRDLRAKRDTT  120

Query  358  HTPGFLGLSSDHGAWPATDYGRDVIIGVIDT  450
            H+P FLGL+ + GAWP + +G+DVI+G +DT
Sbjct  121  HSPHFLGLNPNVGAWPVSQFGKDVIVGFVDT  151



>ref|XP_010263712.1| PREDICTED: subtilisin-like protease [Nelumbo nucifera]
Length=542

 Score =   137 bits (346),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 69/129 (53%), Positives = 89/129 (69%), Gaps = 14/129 (11%)
 Frame = +1

Query  106  SIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISNRG-------------LVYAYTN  246
            S+  +S+ YIVHMDLS MPRAF  H SW+ ATLSSI + G             L+Y Y N
Sbjct  23   SLLAKSDVYIVHMDLSAMPRAFADHHSWYEATLSSIKDGGNGVATITTTKPSYLIYTYNN  82

Query  247  AIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGL-SSDHGAWPATDYGR  423
            AIHGF+A LSP EL+ +K  PG++ ST D  +K DT+HTP FLGL +S+ G WPA++YG 
Sbjct  83   AIHGFAASLSPLELDLLKHLPGFVSSTLDVLLKADTTHTPDFLGLNNSNSGPWPASNYGE  142

Query  424  DVIIGVIDT  450
            DVIIG++D+
Sbjct  143  DVIIGLVDS  151



>ref|XP_011043530.1| PREDICTED: subtilisin-like protease [Populus euphratica]
Length=757

 Score =   138 bits (347),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 68/141 (48%), Positives = 97/141 (69%), Gaps = 16/141 (11%)
 Frame = +1

Query  55   ALFFHLAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISN-----  219
            +L F ++ +++T         +S+TYI+HMD S MP+AFT H +W+ AT+SSIS+     
Sbjct  11   SLVFTISLLASTL-------AKSDTYIIHMDRSAMPKAFTDHHNWYLATISSISDTVKST  63

Query  220  ----RGLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSS  387
                   +Y YT+++ GFSA L+ +ELEA+KKSPGY+ ST+D  +KV T+HT  FLGLSS
Sbjct  64   FTRSSKHIYTYTSSVQGFSASLTKSELEALKKSPGYISSTRDRKIKVHTTHTSEFLGLSS  123

Query  388  DHGAWPATDYGRDVIIGVIDT  450
              GAWP  +YG D+IIG++DT
Sbjct  124  SSGAWPTANYGEDMIIGLVDT  144



>ref|XP_008393790.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=766

 Score =   138 bits (347),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 71/151 (47%), Positives = 97/151 (64%), Gaps = 16/151 (11%)
 Frame = +1

Query  46   NHRALFFHLAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISNR-  222
            +H +L+F L+  + + L I S   QS+ YI+HMD S MP+AF  H SW+ ATL S   + 
Sbjct  5    DHVSLYFWLSIATISHLAIVSTFAQSQNYIIHMDSSVMPKAFXDHHSWYLATLDSTLGKF  64

Query  223  ---------------GLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTS  357
                            L+Y+YT+A++GFSA L+ +ELEA+K SPGY+ S KD  VK DT+
Sbjct  65   XPXTTATSSSSXLSSXLIYSYTHAMNGFSASLTASELEALKSSPGYISSVKDLPVKKDTT  124

Query  358  HTPGFLGLSSDHGAWPATDYGRDVIIGVIDT  450
            HT  FLGL+S  G WP  +YG+DVIIG++DT
Sbjct  125  HTSQFLGLNSKSGVWPVANYGKDVIIGLVDT  155



>ref|XP_007135315.1| hypothetical protein PHAVU_010G119000g [Phaseolus vulgaris]
 gb|ESW07309.1| hypothetical protein PHAVU_010G119000g [Phaseolus vulgaris]
Length=658

 Score =   137 bits (344),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 70/141 (50%), Positives = 90/141 (64%), Gaps = 14/141 (10%)
 Frame = +1

Query  70   LAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSS-------------  210
            L F S   L +     QS  YI+HMD S MP+AF++  SW  +TLSS             
Sbjct  9    LWFSSIIILNLVHTLAQSRNYIIHMDASAMPKAFSTQHSWHLSTLSSVLDNAHTSNHNNL  68

Query  211  -ISNRGLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSS  387
             I++  L+Y YTNA++GFSA LSP E EA+K SPGY+ ST D   K+DTSH+P FLGL+ 
Sbjct  69   NIASSKLIYTYTNAMNGFSANLSPKEFEALKISPGYVSSTPDLLAKIDTSHSPKFLGLNR  128

Query  388  DHGAWPATDYGRDVIIGVIDT  450
            + GAWPA  +G DVI+GV+DT
Sbjct  129  NTGAWPAAKFGEDVIVGVVDT  149



>ref|XP_007017195.1| Subtilisin-like serine endopeptidase family protein [Theobroma 
cacao]
 gb|EOY14420.1| Subtilisin-like serine endopeptidase family protein [Theobroma 
cacao]
Length=760

 Score =   137 bits (346),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 74/149 (50%), Positives = 102/149 (68%), Gaps = 16/149 (11%)
 Frame = +1

Query  43   ANH-RALFFHLAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSIS-  216
            A+H + LF  L+FI   F  IF+   +++ YIV MDLS  P+AF+  QSW+ ATL+S+S 
Sbjct  3    ADHTKILFVWLSFI-VPF--IFTKLAEADNYIVQMDLSAKPKAFSGQQSWYLATLASLSA  59

Query  217  -----------NRGLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHT  363
                       +  L+Y Y + I GFSA L+PAELEA+K +PGY+ S +D +VKVDT+H+
Sbjct  60   NWRANTNATIPSSKLIYTYNHVIQGFSASLTPAELEALKNAPGYVSSIRDRTVKVDTTHS  119

Query  364  PGFLGLSSDHGAWPATDYGRDVIIGVIDT  450
              FLGL+S  GAWP +++G+DVIIGVIDT
Sbjct  120  FKFLGLNSSTGAWPVSNFGKDVIIGVIDT  148



>ref|XP_008241490.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=745

 Score =   137 bits (345),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 71/150 (47%), Positives = 96/150 (64%), Gaps = 21/150 (14%)
 Frame = +1

Query  64   FHLAFISATFLQIF------------SIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLS  207
             H + ++A  LQI             S+  QS  YI+HMD   MP+AF+ HQSW+ ATL 
Sbjct  3    LHCSSMAALALQILCTALSAITHFISSVSAQSNAYIIHMDSKAMPKAFSGHQSWYLATLL  62

Query  208  SISNR---------GLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSH  360
            SIS+           L++ YTN+IHGFSA+L+ +ELEA+K SPG++  T D  +K+ T+H
Sbjct  63   SISDSPKAYTFGTTKLIHTYTNSIHGFSAILTLSELEALKNSPGFISVTPDGPLKLHTTH  122

Query  361  TPGFLGLSSDHGAWPATDYGRDVIIGVIDT  450
            T  FLGL+S  GAWPA++YG  VIIGV+DT
Sbjct  123  TSQFLGLTSSSGAWPASNYGEGVIIGVLDT  152



>ref|XP_010028239.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
Length=762

 Score =   137 bits (345),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 70/135 (52%), Positives = 92/135 (68%), Gaps = 8/135 (6%)
 Frame = +1

Query  70   LAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISNRG--------  225
            L F+   FL       +SETYIVHMD   MP+ F+  +SW+ ATLSSIS  G        
Sbjct  8    LCFVILQFLPSCWSQTKSETYIVHMDTLSMPKVFSDQRSWYLATLSSISEGGATSTPLDK  67

Query  226  LVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWP  405
            LVY Y++++ GFSA LS  ELE++K+SP Y+ ST+D  +K+ T+HTP FLGL+S  GAWP
Sbjct  68   LVYTYSSSVQGFSATLSRPELESLKRSPHYVSSTRDRPLKLHTTHTPSFLGLNSVSGAWP  127

Query  406  ATDYGRDVIIGVIDT  450
            A++YG DVIIG +DT
Sbjct  128  ASEYGNDVIIGFVDT  142



>gb|KCW54937.1| hypothetical protein EUGRSUZ_I00910, partial [Eucalyptus grandis]
Length=747

 Score =   137 bits (345),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 70/135 (52%), Positives = 92/135 (68%), Gaps = 8/135 (6%)
 Frame = +1

Query  70   LAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISNRG--------  225
            L F+   FL       +SETYIVHMD   MP+ F+  +SW+ ATLSSIS  G        
Sbjct  8    LCFVILQFLPSCWSQTKSETYIVHMDTLSMPKVFSDQRSWYLATLSSISEGGATSTPLDK  67

Query  226  LVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWP  405
            LVY Y++++ GFSA LS  ELE++K+SP Y+ ST+D  +K+ T+HTP FLGL+S  GAWP
Sbjct  68   LVYTYSSSVQGFSATLSRPELESLKRSPHYVSSTRDRPLKLHTTHTPSFLGLNSVSGAWP  127

Query  406  ATDYGRDVIIGVIDT  450
            A++YG DVIIG +DT
Sbjct  128  ASEYGNDVIIGFVDT  142



>ref|XP_008785865.1| PREDICTED: subtilisin-like protease [Phoenix dactylifera]
Length=760

 Score =   137 bits (345),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 68/138 (49%), Positives = 93/138 (67%), Gaps = 9/138 (7%)
 Frame = +1

Query  64   FHLAFISATFL--QIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISNR-----  222
            FH  +++   L  Q+  I  +  TYIVHMDLS MPRAF+ H+SW+++ +S+ +       
Sbjct  7    FHYVWMAIAILTSQMIPISAEVATYIVHMDLSAMPRAFSGHRSWYTSVVSAAATSDSVFA  66

Query  223  --GLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHG  396
               L+Y Y NAIHGFSA LSP +L+ +K+S G+L   +D  V VDT+HTP FL LSS  G
Sbjct  67   ASNLIYIYDNAIHGFSARLSPLQLQQLKRSHGFLSCYRDVPVTVDTTHTPEFLHLSSASG  126

Query  397  AWPATDYGRDVIIGVIDT  450
             WPA++YG DVIIGV+D+
Sbjct  127  LWPASNYGEDVIIGVVDS  144



>ref|XP_009610212.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=756

 Score =   136 bits (342),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 67/122 (55%), Positives = 91/122 (75%), Gaps = 12/122 (10%)
 Frame = +1

Query  121  SETYIVHMDLSFMPRAFTSHQSWFSATLSSI------------SNRGLVYAYTNAIHGFS  264
            S++YI+HMD S MP+AF+S  SW+ ATL+S+            S+  L+Y+YTNAIHGFS
Sbjct  26   SDSYIIHMDASAMPKAFSSPHSWYLATLASVLDSSSVGSRNTLSSSKLIYSYTNAIHGFS  85

Query  265  AVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVI  444
            A LSP+E EAIK SPGY+ ST+D +VK+ T+H+  FLGL+S  G+WP ++YG+ VIIGV+
Sbjct  86   ASLSPSEHEAIKNSPGYVSSTEDMTVKIHTTHSSHFLGLNSMSGSWPKSNYGKGVIIGVV  145

Query  445  DT  450
            DT
Sbjct  146  DT  147



>gb|EYU25437.1| hypothetical protein MIMGU_mgv1a002005mg [Erythranthe guttata]
Length=728

 Score =   134 bits (338),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 64/115 (56%), Positives = 84/115 (73%), Gaps = 12/115 (10%)
 Frame = +1

Query  142  MDLSFMPRAFTSHQSWFSATLSSISNR------------GLVYAYTNAIHGFSAVLSPAE  285
            MDLS MP++F++H SW+  TLSSIS++             L+Y YTNAI GF+A+LSP+E
Sbjct  1    MDLSLMPKSFSTHHSWYLNTLSSISDQVSTTDYSSSSSNKLIYTYTNAISGFTALLSPSE  60

Query  286  LEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDT  450
             EAIK SPGY+ STKD +VK DT+H+  FLGL+  +G WP +DYG DVIIG++DT
Sbjct  61   FEAIKNSPGYISSTKDKTVKTDTTHSYKFLGLNPQNGLWPVSDYGNDVIIGLVDT  115



>ref|XP_007204261.1| hypothetical protein PRUPE_ppa001828mg [Prunus persica]
 gb|EMJ05460.1| hypothetical protein PRUPE_ppa001828mg [Prunus persica]
Length=759

 Score =   134 bits (338),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 69/141 (49%), Positives = 93/141 (66%), Gaps = 9/141 (6%)
 Frame = +1

Query  55   ALFFHLAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISNR----  222
            AL      +SA    I S+  QS  YI+HMD   MP+AF+ HQSW+ ATL SIS+     
Sbjct  5    ALQILCTVLSAITHFISSVSAQSNAYIIHMDSKAMPKAFSGHQSWYLATLLSISDSPKAY  64

Query  223  -----GLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSS  387
                  L++ YTN+I GFSA+L+ +ELE++K SPG++  T D  +K+ T+HT  FLGL+S
Sbjct  65   TFSTTKLIHTYTNSIQGFSAILTLSELESLKNSPGFISVTPDGPLKLHTTHTSQFLGLTS  124

Query  388  DHGAWPATDYGRDVIIGVIDT  450
              GAWPA+ YG DVIIGV+D+
Sbjct  125  SSGAWPASSYGEDVIIGVLDS  145



>gb|KJB63881.1| hypothetical protein B456_010G021600 [Gossypium raimondii]
Length=764

 Score =   134 bits (337),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 67/138 (49%), Positives = 93/138 (67%), Gaps = 12/138 (9%)
 Frame = +1

Query  73   AFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISNRG---------  225
             ++S   L +F    +S+ YIVHMD+S MP+AF++  +W+ ATLSS+S +          
Sbjct  13   CWVSFCVLFMFIKLAKSDNYIVHMDISAMPKAFSNQHTWYLATLSSVSAKSKAETNPTTP  72

Query  226  ---LVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHG  396
               L+Y Y + I GFSA L+PAELE++K SPGY+ S KD  VKVDT+H+  FL L+S  G
Sbjct  73   FSKLIYTYNHVIQGFSASLTPAELESLKNSPGYVSSVKDRVVKVDTTHSFEFLDLNSGTG  132

Query  397  AWPATDYGRDVIIGVIDT  450
            AWP + +G+DVI+GVIDT
Sbjct  133  AWPVSSFGKDVIVGVIDT  150



>ref|XP_008785920.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease [Phoenix 
dactylifera]
Length=764

 Score =   134 bits (337),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 73/139 (53%), Positives = 91/139 (65%), Gaps = 10/139 (7%)
 Frame = +1

Query  64   FHLAFISATFLQIFSIDGQSE--TYIVHMDLSFMPRAFTSHQSWFS-------ATLSSIS  216
            FH  +++   L    I   +E  TYIVHMDLS MPRAF+ H SW++       AT  SIS
Sbjct  7    FHYVWMAVAILTSHMIPTSAEVATYIVHMDLSAMPRAFSGHHSWYTSVVAAATATSDSIS  66

Query  217  -NRGLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDH  393
                L+Y Y NAIHGFSA LSP +L+ +K+S GYL   ++  V VDT+HTP FL LSS  
Sbjct  67   PTSNLIYVYDNAIHGFSARLSPLQLQQLKRSHGYLSCYREMPVTVDTTHTPEFLHLSSGS  126

Query  394  GAWPATDYGRDVIIGVIDT  450
            G WPA++YG DVIIGV+DT
Sbjct  127  GLWPASNYGEDVIIGVVDT  145



>ref|XP_007017194.1| Subtilisin-like serine endopeptidase family protein [Theobroma 
cacao]
 gb|EOY14419.1| Subtilisin-like serine endopeptidase family protein [Theobroma 
cacao]
Length=793

 Score =   133 bits (334),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 64/121 (53%), Positives = 84/121 (69%), Gaps = 12/121 (10%)
 Frame = +1

Query  124  ETYIVHMDLSFMPRAFTSHQSWFSATLSSISNRG------------LVYAYTNAIHGFSA  267
             TYIVHMD SFMP+ F SH SW+S+T+ S+ +R             L+Y+Y +  HGFSA
Sbjct  33   NTYIVHMDKSFMPKIFASHHSWYSSTVDSLKSRNTALSSNPRTSPTLLYSYDSGAHGFSA  92

Query  268  VLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVID  447
            VLSP ELE +KKSPG++ +  D SV +DT+HTP FL L+   G WPA++YG D+IIGVID
Sbjct  93   VLSPDELETLKKSPGFVSAYPDKSVTLDTTHTPEFLSLNPYSGLWPASNYGEDIIIGVID  152

Query  448  T  450
            +
Sbjct  153  S  153



>gb|KDP41713.1| hypothetical protein JCGZ_16120 [Jatropha curcas]
Length=767

 Score =   133 bits (334),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 77/154 (50%), Positives = 102/154 (66%), Gaps = 25/154 (16%)
 Frame = +1

Query  55   ALFFHLAFISATFLQIFSIDGQ--SETYIVHMDLSFMPRAFTSHQSWFSATLSSIS----  216
            A F  L+FIS   + +F I G   S+ YIVHMDLS MP+AF++H SW+ ATLSSIS    
Sbjct  2    ATFLWLSFIS---VSLFIIPGLTLSDNYIVHMDLSAMPKAFSTHHSWYLATLSSISAVSN  58

Query  217  ---------------NRGLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVD  351
                           +  ++Y+YT+ I+GFSA LSP E EA+KKSPGY+ S KD  VK+D
Sbjct  59   NGGGGGGGGSGSAIADSKILYSYTHVINGFSAHLSPFEHEALKKSPGYISSFKDLPVKLD  118

Query  352  TSHTPGFLGLSSDH-GAWPATDYGRDVIIGVIDT  450
            T+ +P FLGL+S+  GAW  ++YG D+IIGV+DT
Sbjct  119  TTRSPTFLGLTSNSGGAWLPSNYGEDIIIGVVDT  152



>ref|XP_008220243.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=767

 Score =   132 bits (333),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 71/150 (47%), Positives = 91/150 (61%), Gaps = 23/150 (15%)
 Frame = +1

Query  49   HRALFFHLAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISNR--  222
            H   +  +A IS T         Q   YI+HMD + MP+AF  H SW+ AT++S  ++  
Sbjct  8    HLCFWLAVAIISTTL-------AQPNNYIIHMDATMMPKAFADHHSWYLATVNSALSKFR  60

Query  223  --------------GLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSH  360
                           L+Y+YT+ I+GFSA LS +ELEAIK SPGY+ S KD  VK DT+H
Sbjct  61   PNTTTTSSSSALSSKLIYSYTHVINGFSASLSLSELEAIKTSPGYISSVKDLPVKPDTTH  120

Query  361  TPGFLGLSSDHGAWPATDYGRDVIIGVIDT  450
            +  FLGLSS  GAWP  DYG+DVIIGV+DT
Sbjct  121  SFQFLGLSSKSGAWPVADYGKDVIIGVVDT  150



>gb|KEH18574.1| subtilisin-like serine protease [Medicago truncatula]
Length=763

 Score =   132 bits (332),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 64/137 (47%), Positives = 91/137 (66%), Gaps = 6/137 (4%)
 Frame = +1

Query  58   LFFHLAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSIS-NRGL--  228
            +  +L F   T L +     +SE YI+HMDLS MP+ F++  SW+ +TLS ++ N  L  
Sbjct  5    ICVNLLFPCITILHLIFTLARSENYIIHMDLSAMPKVFSNQHSWYESTLSKVTANNNLTS  64

Query  229  ---VYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGA  399
               +Y YTN ++GF A LSP E EA+K SPGY+ S  D  +K+ T+H+P FLGL+   GA
Sbjct  65   SKIIYTYTNVMNGFCANLSPKEHEALKTSPGYISSIPDLPLKLHTTHSPQFLGLNPFEGA  124

Query  400  WPATDYGRDVIIGVIDT  450
            WPA+ +G+DVIIG+ID+
Sbjct  125  WPASKFGQDVIIGLIDS  141



>emb|CDP17956.1| unnamed protein product [Coffea canephora]
Length=725

 Score =   131 bits (329),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 61/110 (55%), Positives = 83/110 (75%), Gaps = 12/110 (11%)
 Frame = +1

Query  157  MPRAFTSHQSWFSATLSSISN------------RGLVYAYTNAIHGFSAVLSPAELEAIK  300
            MP+AF+SHQSW+  TL SIS+              L+Y YTNA+HGFSA+LSP+EL A+K
Sbjct  1    MPKAFSSHQSWYLTTLESISDATSEATIDFPPSSKLLYTYTNALHGFSAILSPSELRAMK  60

Query  301  KSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDT  450
             SPG++ + KD SVK+DT+H+  FLGL+S +GAWP +DYG+DVIIG++D+
Sbjct  61   DSPGFVSAIKDKSVKMDTTHSSKFLGLNSKYGAWPNSDYGKDVIIGLVDS  110



>ref|XP_008221259.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=767

 Score =   130 bits (328),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 72/155 (46%), Positives = 94/155 (61%), Gaps = 25/155 (16%)
 Frame = +1

Query  40   MANHRALFFHLAF--ISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSI  213
            + +H  L F LA   IS T         Q   YI+HMD + MP+AF  H SW+ AT++S 
Sbjct  3    IGHHVRLCFGLAIAIISTTL-------AQPNNYIIHMDATMMPKAFADHHSWYLATVNSA  55

Query  214  SNR----------------GLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVK  345
             ++                 L+Y+YT+ I+GFSA LS +ELEA+K SPGY+ S KD  VK
Sbjct  56   LSKFRPNTTTTSSSSALSSKLIYSYTHVINGFSASLSLSELEALKTSPGYISSVKDLPVK  115

Query  346  VDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDT  450
             DT+H+  FLGLSS  GAWP  DYG+DVIIGV+D+
Sbjct  116  PDTTHSSQFLGLSSKSGAWPVADYGKDVIIGVVDS  150



>ref|XP_007135313.1| hypothetical protein PHAVU_010G118800g [Phaseolus vulgaris]
 gb|ESW07307.1| hypothetical protein PHAVU_010G118800g [Phaseolus vulgaris]
Length=744

 Score =   130 bits (327),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 68/141 (48%), Positives = 89/141 (63%), Gaps = 14/141 (10%)
 Frame = +1

Query  70   LAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSS------ISNRG--  225
            L F S   L +     QS  YI+HMD S MP+AF++  +W  +TLSS       SN    
Sbjct  9    LWFSSIIILNLVHTLAQSHNYIIHMDASAMPKAFSTQHAWHLSTLSSALDSAETSNHNNL  68

Query  226  ------LVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSS  387
                  L+Y YTNA++GFSA LSP E EA+K SPGY+ ST D   K+DT+H+PGFLGL+ 
Sbjct  69   DTAYSKLIYTYTNAMNGFSANLSPKEYEALKISPGYVSSTLDLPTKLDTTHSPGFLGLNP  128

Query  388  DHGAWPATDYGRDVIIGVIDT  450
              GAWPA  +G DVI+G++D+
Sbjct  129  STGAWPAAKFGEDVIVGLVDS  149



>ref|XP_008785921.1| PREDICTED: subtilisin-like protease [Phoenix dactylifera]
Length=760

 Score =   130 bits (327),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 69/142 (49%), Positives = 94/142 (66%), Gaps = 11/142 (8%)
 Frame = +1

Query  58   LFFHLAFISATFLQIFSIDGQSE--TYIVHMDLSFMPRAFTSHQSWFSATLS--------  207
            L FH  +++   L    I   +E  TYI+HMDLS +PRAF+ H+SW+++ +S        
Sbjct  5    LSFHYVWMAVAILTSHMIPTSAEVATYIIHMDLSAIPRAFSGHRSWYTSVVSAAATTPSD  64

Query  208  SIS-NRGLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLS  384
            SIS    L+Y Y NAIHGFSA LSP +L+ +K+S GYL   ++  + VDT+HTP FL LS
Sbjct  65   SISATSNLIYVYDNAIHGFSARLSPLQLQQLKRSHGYLSCYREMPMTVDTTHTPEFLHLS  124

Query  385  SDHGAWPATDYGRDVIIGVIDT  450
            S  G WPA++YG DVIIGV+D+
Sbjct  125  SGSGLWPASNYGEDVIIGVVDS  146



>ref|XP_008357385.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=772

 Score =   130 bits (327),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 67/150 (45%), Positives = 95/150 (63%), Gaps = 16/150 (11%)
 Frame = +1

Query  49   HRALFFHLAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISNR--  222
            +  L+F L+  + + L I S   QS+ YI+HMD S MP+AF+ H SW+ ATL S   +  
Sbjct  5    YHVLYFWLSITTISHLAIVSTFAQSQNYIIHMDSSMMPKAFSDHHSWYVATLHSTLGKFT  64

Query  223  --------------GLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSH  360
                           L+Y+YT+ ++GFSA L+ +ELEA+K S GY+ S KD  V  DT+H
Sbjct  65   PITXGTSSSSALSSKLIYSYTHVMNGFSASLTASELEALKSSLGYISSVKDLPVMKDTTH  124

Query  361  TPGFLGLSSDHGAWPATDYGRDVIIGVIDT  450
            +  FLGL+S  GAWP ++YG+DVIIG++DT
Sbjct  125  SSQFLGLNSRSGAWPVSNYGKDVIIGLVDT  154



>ref|XP_011029618.1| PREDICTED: subtilisin-like protease [Populus euphratica]
Length=775

 Score =   130 bits (327),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 67/155 (43%), Positives = 97/155 (63%), Gaps = 18/155 (12%)
 Frame = +1

Query  40   MANHR-ALFFHLAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSIS  216
            MA+HR  L + L     T L       Q++ YIVHMDLS MP++F+    W+ ATL+S+S
Sbjct  1    MASHRNVLLYKLWICFITILYFTETLSQTDNYIVHMDLSVMPKSFSGQHHWYLATLASVS  60

Query  217  N-----------------RGLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVK  345
            +                   L+Y+YT+ ++GFSA L+P+ELEA+K+SPGY+ S KD  VK
Sbjct  61   DVADSSTARASEATLTASSKLLYSYTHVVNGFSASLTPSELEALKRSPGYISSIKDLPVK  120

Query  346  VDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDT  450
             DT+H+P +LGL+    AW A++YG  +IIG++DT
Sbjct  121  HDTTHSPKYLGLTPQSPAWKASNYGDGIIIGLVDT  155



>ref|XP_010540359.1| PREDICTED: subtilisin-like protease [Tarenaya hassleriana]
Length=768

 Score =   130 bits (326),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 67/133 (50%), Positives = 91/133 (68%), Gaps = 6/133 (5%)
 Frame = +1

Query  55   ALFFHLAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISNRGL-V  231
             LFF L FI       FS     + YIVHMDLS MP+AF+S  SW+ +TL+SIS+    +
Sbjct  12   CLFFFLVFICP-----FSRAEDDDVYIVHMDLSEMPKAFSSQHSWYMSTLASISSASDHL  66

Query  232  YAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPAT  411
            Y Y   + GFSAVLSP+ L +++ SPG++Y+T+D  VK+DT+H+  FLGLS   GAW  T
Sbjct  67   YTYNRVLRGFSAVLSPSGLRSLETSPGFVYATRDKPVKLDTTHSFEFLGLSPGSGAWAIT  126

Query  412  DYGRDVIIGVIDT  450
            D+G+ VIIGV+D+
Sbjct  127  DFGKGVIIGVVDS  139



>ref|XP_007221958.1| hypothetical protein PRUPE_ppa001770mg [Prunus persica]
 gb|EMJ23157.1| hypothetical protein PRUPE_ppa001770mg [Prunus persica]
Length=767

 Score =   130 bits (326),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 72/155 (46%), Positives = 94/155 (61%), Gaps = 25/155 (16%)
 Frame = +1

Query  40   MANHRALFFHLAF--ISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSI  213
            + +H  L F LA   IS T         Q   YI+HMD + MP+AF  H SW+ AT++S 
Sbjct  3    IGHHVRLCFWLAIAIISTTL-------AQPNNYIIHMDSTMMPKAFADHHSWYLATVNSA  55

Query  214  SNR----------------GLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVK  345
             ++                 L+Y+YT+ I+GFSA LS +ELEA+K SPGY+ S KD  VK
Sbjct  56   LSKFRPNTTTTTSSSALSSKLIYSYTHVINGFSASLSLSELEALKTSPGYISSVKDLPVK  115

Query  346  VDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDT  450
             DT+H+  FLGLSS  GAWP  DYG+DVIIG++DT
Sbjct  116  PDTTHSSQFLGLSSKSGAWPVADYGKDVIIGLVDT  150



>ref|XP_009343175.1| PREDICTED: subtilisin-like protease [Pyrus x bretschneideri]
Length=761

 Score =   130 bits (326),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 63/132 (48%), Positives = 89/132 (67%), Gaps = 8/132 (6%)
 Frame = +1

Query  79   ISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISNRG--------LVY  234
            I +    + S+  QS  YI+HMD S MP+AF+ H+ W+ ATL SIS+          +++
Sbjct  20   IVSAIAHLNSVSAQSHAYIIHMDSSAMPKAFSGHERWYLATLLSISDSAKSSNSTTKIIH  79

Query  235  AYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATD  414
             YTN+I GFSAVL+ +ELEA+KK PG++    D  +K+ T+HT  FLGL+S  GAWPA++
Sbjct  80   TYTNSIQGFSAVLTLSELEALKKCPGFVSFAHDGPLKLQTTHTSQFLGLTSSSGAWPASN  139

Query  415  YGRDVIIGVIDT  450
            YG  VIIG++DT
Sbjct  140  YGEGVIIGLLDT  151



>ref|XP_009345959.1| PREDICTED: subtilisin-like protease [Pyrus x bretschneideri]
Length=767

 Score =   130 bits (326),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 63/132 (48%), Positives = 89/132 (67%), Gaps = 8/132 (6%)
 Frame = +1

Query  79   ISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISNRG--------LVY  234
            I +    + S+  QS  YI+HMD S MP+AF+ H+ W+ ATL SIS+          +++
Sbjct  20   IVSAIAHLNSVSAQSHAYIIHMDSSAMPKAFSGHERWYLATLLSISDSAKSSNSTTKIIH  79

Query  235  AYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATD  414
             YTN+I GFSAVL+ +ELEA+KK PG++    D  +K+ T+HT  FLGL+S  GAWPA++
Sbjct  80   TYTNSIQGFSAVLTLSELEALKKCPGFVSFAHDGPLKLQTTHTSQFLGLTSSSGAWPASN  139

Query  415  YGRDVIIGVIDT  450
            YG  VIIG++DT
Sbjct  140  YGEGVIIGLLDT  151



>ref|XP_002510195.1| Cucumisin precursor, putative [Ricinus communis]
 gb|EEF52382.1| Cucumisin precursor, putative [Ricinus communis]
Length=768

 Score =   130 bits (326),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 71/147 (48%), Positives = 97/147 (66%), Gaps = 18/147 (12%)
 Frame = +1

Query  61   FFHLAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSS---ISNR---  222
            F  L+FI+  +L I     +++ YIVHMDLS MP  F+SH SW+ ATLSS   +SN    
Sbjct  11   FLWLSFITF-WLFIIPTLAETDNYIVHMDLSAMPEVFSSHHSWYLATLSSAFAVSNSRNT  69

Query  223  -----------GLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPG  369
                        L+Y+YT+ I+GFSA LS +ELEA+K +PGY+ S +D  VK+DT+ +P 
Sbjct  70   INTTPARPFSSKLLYSYTHVINGFSAHLSLSELEALKNTPGYISSIRDLPVKLDTTRSPT  129

Query  370  FLGLSSDHGAWPATDYGRDVIIGVIDT  450
            FLGL+ + GAW  T++G DVIIGV+DT
Sbjct  130  FLGLTGNSGAWQPTNFGEDVIIGVVDT  156



>ref|XP_004291093.1| PREDICTED: subtilisin-like protease [Fragaria vesca subsp. vesca]
Length=767

 Score =   129 bits (324),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 65/140 (46%), Positives = 96/140 (69%), Gaps = 6/140 (4%)
 Frame = +1

Query  49   HRALFFHLAFISATFLQIFSIDG-QSETYIVHMDLSFMPRAFTSHQSWFSATLSSISNR-  222
            H  L+F L+ ++ ++L I S    +S  YI+HMD SFMP+AF  H SW+ +T+ S+ +  
Sbjct  7    HVPLYFWLSIVTISYLAIVSTFAHESSNYIIHMDSSFMPKAFADHHSWYLSTVDSVLSTS  66

Query  223  ----GLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSD  390
                 L+Y+YT+ ++GFSA LS +ELEA+K SPGY+ S +D   K DT+H+  FLGL+S 
Sbjct  67   SISSKLIYSYTHVLNGFSASLSVSELEALKTSPGYISSVRDLPAKPDTTHSSQFLGLNSK  126

Query  391  HGAWPATDYGRDVIIGVIDT  450
             GAWP ++YG+  IIG++DT
Sbjct  127  TGAWPVSNYGKGTIIGLVDT  146



>emb|CDP01316.1| unnamed protein product [Coffea canephora]
Length=759

 Score =   129 bits (324),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 66/135 (49%), Positives = 88/135 (65%), Gaps = 11/135 (8%)
 Frame = +1

Query  76   FISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISNRG----------  225
            F+ ATFL   +   +  TYIVHMD SFMP+AF SHQ W+S+TL+S+ +            
Sbjct  12   FMFATFLLNLT-SAERSTYIVHMDKSFMPKAFASHQHWYSSTLNSLKSTSPNSDPQKPLE  70

Query  226  LVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWP  405
            L+Y Y N  HGFSAVLS AELEA+ K PG++ +  D    +DT+ +  FLGL+   G WP
Sbjct  71   LLYTYDNVFHGFSAVLSRAELEAVNKLPGFVSACSDRVATLDTTRSTEFLGLNPVTGLWP  130

Query  406  ATDYGRDVIIGVIDT  450
            A +YG+DVI+GV+DT
Sbjct  131  AANYGKDVIVGVLDT  145



>gb|KDO84129.1| hypothetical protein CISIN_1g004265mg [Citrus sinensis]
Length=765

 Score =   129 bits (323),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 68/143 (48%), Positives = 93/143 (65%), Gaps = 13/143 (9%)
 Frame = +1

Query  58   LFFHLAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISNR-----  222
              F L+++   F    S D +S TYIVHMD S MP+AF +H  W+S+ + S+ ++     
Sbjct  11   FLFVLSWLLLAFHANSSSDERS-TYIVHMDKSHMPKAFFNHHHWYSSVVHSLKSKKPAKS  69

Query  223  -------GLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGL  381
                    LVY+Y NA HGFSAVLS  ELE +KKSPG++ +  D +V +DT+HTP FL L
Sbjct  70   NHHRFSPSLVYSYDNAAHGFSAVLSKRELETLKKSPGFISAYADKTVTLDTTHTPEFLSL  129

Query  382  SSDHGAWPATDYGRDVIIGVIDT  450
            ++ +G WPA+ YG DVI+GVIDT
Sbjct  130  NTANGLWPASKYGEDVIVGVIDT  152



>ref|XP_006434737.1| hypothetical protein CICLE_v10000364mg [Citrus clementina]
 gb|ESR47977.1| hypothetical protein CICLE_v10000364mg [Citrus clementina]
Length=765

 Score =   129 bits (323),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 68/143 (48%), Positives = 93/143 (65%), Gaps = 13/143 (9%)
 Frame = +1

Query  58   LFFHLAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISNR-----  222
              F L+++   F    S D +S TYIVHMD S MP+AF +H  W+S+ + S+ ++     
Sbjct  11   FLFVLSWLLLAFHANSSSDERS-TYIVHMDKSHMPKAFFNHHHWYSSVVHSLKSKKPAKS  69

Query  223  -------GLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGL  381
                    LVY+Y NA HGFSAVLS  ELE +KKSPG++ +  D +V +DT+HTP FL L
Sbjct  70   NHHRFSPSLVYSYDNAAHGFSAVLSKRELETLKKSPGFISAYADKTVTLDTTHTPEFLSL  129

Query  382  SSDHGAWPATDYGRDVIIGVIDT  450
            ++ +G WPA+ YG DVI+GVIDT
Sbjct  130  NTANGLWPASKYGEDVIVGVIDT  152



>ref|XP_008220244.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=767

 Score =   129 bits (323),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 73/155 (47%), Positives = 92/155 (59%), Gaps = 25/155 (16%)
 Frame = +1

Query  40   MANHRALFFHL--AFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSI  213
            + +H  L F L  A IS T         Q   YI+HMD + MP+AF  H SW+ AT+ S 
Sbjct  3    IGHHGRLCFWLSIAIISTTL-------AQPNNYIIHMDSTMMPKAFADHHSWYLATVISA  55

Query  214  SNR----------------GLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVK  345
             ++                 L+Y+YT+ I GFSA LS +ELEA+K SPGY+ S KD  VK
Sbjct  56   LSKFRPNTTTTSSSSALSSKLIYSYTHVITGFSASLSLSELEALKTSPGYISSVKDLPVK  115

Query  346  VDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDT  450
             DT+H+  FLGLSS  GAWP  DYG+DVIIGV+DT
Sbjct  116  PDTTHSSQFLGLSSKSGAWPVADYGKDVIIGVVDT  150



>gb|EYU36350.1| hypothetical protein MIMGU_mgv1a001799mg [Erythranthe guttata]
Length=757

 Score =   128 bits (322),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 66/138 (48%), Positives = 88/138 (64%), Gaps = 13/138 (9%)
 Frame = +1

Query  70   LAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISNRG--------  225
            + F+   FL    + G+  +YIVHMD S MP+AF SH  W+S T++S+            
Sbjct  11   VVFLCTMFLS--HVLGERSSYIVHMDKSLMPKAFASHHHWYSFTINSLKKSSKSLHRHRK  68

Query  226  ---LVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHG  396
               LVY Y NA HGFSAVLS  ELE++  SPG++ +  D +V +DT+HT  FL L+ D G
Sbjct  69   PLELVYTYDNAFHGFSAVLSEDELESLGNSPGFVSAYSDRNVTLDTTHTFEFLSLNPDAG  128

Query  397  AWPATDYGRDVIIGVIDT  450
             WPA+DYG+DVI+GVIDT
Sbjct  129  LWPASDYGKDVIVGVIDT  146



>gb|KEH18575.1| subtilisin-like serine protease [Medicago truncatula]
Length=762

 Score =   128 bits (322),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 68/154 (44%), Positives = 98/154 (64%), Gaps = 19/154 (12%)
 Frame = +1

Query  40   MANHRALFFHLAFISATFLQIFSID-GQSETYIVHMDLSFMPRAFTSHQSWFSATLSSI-  213
            M NH +    + F   TFL +  I   QS+ YI+HMD + MP+ FT+H +W+ +TLSS  
Sbjct  1    MTNHISQC--IVFSCITFLHLLFITIAQSDNYIIHMDKAAMPKVFTTHHTWYLSTLSSAL  58

Query  214  --------SNR-------GLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKV  348
                    SN         L+Y YT+ ++GFSA LSP E E++K SPGY+ S KD+ +K+
Sbjct  59   ENPQLTTSSNNLNSLFSSKLIYTYTHVMNGFSANLSPKEHESLKTSPGYISSIKDSHMKL  118

Query  349  DTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDT  450
            DT+H+P FLGL+ + GAW  +++G DVI+G+IDT
Sbjct  119  DTTHSPQFLGLNPNKGAWHDSNFGNDVIVGLIDT  152



>ref|XP_007147252.1| hypothetical protein PHAVU_006G108700g [Phaseolus vulgaris]
 gb|ESW19246.1| hypothetical protein PHAVU_006G108700g [Phaseolus vulgaris]
Length=765

 Score =   128 bits (321),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 54/133 (41%), Positives = 94/133 (71%), Gaps = 5/133 (4%)
 Frame = +1

Query  67   HLAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSIS-----NRGLV  231
            H+    +    ++  + ++ TYIVHMD S+MP+ FTSH+ W+S+TL+S+      N  ++
Sbjct  15   HIIVALSMVCLVWQCNSKAVTYIVHMDKSYMPKVFTSHRHWYSSTLTSLDSTQHVNSSIL  74

Query  232  YAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPAT  411
            Y+Y NA+HGFS  LSP +LE++K++PG++ + +D +  +DT+ +  FL L+  HG WPA+
Sbjct  75   YSYENALHGFSVALSPQQLESLKETPGFISAYRDRATTLDTTASYAFLSLNISHGLWPAS  134

Query  412  DYGRDVIIGVIDT  450
            +YG++V++GV+D+
Sbjct  135  NYGQNVVVGVVDS  147



>ref|XP_003626594.1| Subtilisin-like protease [Medicago truncatula]
 gb|AES82812.1| subtilisin-like serine protease [Medicago truncatula]
Length=765

 Score =   128 bits (321),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 69/153 (45%), Positives = 95/153 (62%), Gaps = 18/153 (12%)
 Frame = +1

Query  40   MANHRALFFHLAFISATFLQIFS---IDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSS  210
            MA+H   +  L+F     L +FS    D     YI+HM+LS MP+ F S QSW+ ATLSS
Sbjct  1    MASHIHHYLLLSF--NIILHLFSSTLCDQNFNNYIIHMNLSAMPKPFLSQQSWYLATLSS  58

Query  211  I----SNR---------GLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVD  351
            +    SN           L Y YTN ++GFSA LSP +LEA+K +PGY+ S +D  +K D
Sbjct  59   LLDITSNNDQLSYIFSPKLTYTYTNVMNGFSASLSPLKLEALKTTPGYISSIRDLPIKPD  118

Query  352  TSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDT  450
            T+H+P F+GL+   G WP T YG+++IIG+ID+
Sbjct  119  TTHSPHFIGLNPVFGTWPTTQYGKNIIIGLIDS  151



>ref|XP_006374913.1| subtilase family protein [Populus trichocarpa]
 gb|ERP52710.1| subtilase family protein [Populus trichocarpa]
Length=775

 Score =   127 bits (320),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 66/155 (43%), Positives = 96/155 (62%), Gaps = 18/155 (12%)
 Frame = +1

Query  40   MANHR-ALFFHLAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSIS  216
            MA+HR  L + L     T L       Q++ YIVHMDLS MP++F+    W+ +TL+S+S
Sbjct  1    MASHRNVLLYKLWVCFITILYFTETLSQTDNYIVHMDLSVMPKSFSGQHHWYLSTLASVS  60

Query  217  N-----------------RGLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVK  345
            +                   L+Y+YT+ ++GFSA L+P+ELEA+K SPGY+ S KD  VK
Sbjct  61   DVADSSTARASEATLTASSKLLYSYTHVVNGFSASLTPSELEALKTSPGYISSIKDLPVK  120

Query  346  VDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDT  450
             DT+H+P +LGL+    AW A++YG  +IIG++DT
Sbjct  121  HDTTHSPKYLGLTPQSPAWKASNYGDGIIIGLVDT  155



>gb|KEH18578.1| subtilisin-like serine protease [Medicago truncatula]
Length=728

 Score =   127 bits (319),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 59/111 (53%), Positives = 79/111 (71%), Gaps = 8/111 (7%)
 Frame = +1

Query  142  MDLSFMPRAFTSHQSWFSATLSSISNRGL--------VYAYTNAIHGFSAVLSPAELEAI  297
            MDLS MP+ F++  SW+ +TLS ++   L        +Y Y N I+GFSA LSP E EA+
Sbjct  1    MDLSAMPKVFSNKNSWYESTLSQVTTNNLNNPTFSKIIYTYNNVINGFSANLSPEEHEAL  60

Query  298  KKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDT  450
            K SPGY+ S  D  +K+DT+H+P FLGL+S  GAWPA+DYG+DVI+G+IDT
Sbjct  61   KTSPGYISSMPDLPLKLDTTHSPQFLGLNSYKGAWPASDYGKDVIVGMIDT  111



>gb|KHN15890.1| Subtilisin-like protease [Glycine soja]
Length=757

 Score =   127 bits (319),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 62/134 (46%), Positives = 87/134 (65%), Gaps = 15/134 (11%)
 Frame = +1

Query  94   LQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSS---------------ISNRGL  228
            L + S   QSE YI+HMD S MP+ F++  +W+ +TLSS                ++  L
Sbjct  16   LHLVSRMAQSENYIIHMDSSSMPKLFSTKHNWYLSTLSSALENTHVTTNDNILNTASSKL  75

Query  229  VYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPA  408
            +Y YTN ++GFSA LSP ELEA+K SPGY+ ST D   K+ T+H+P FLGL+   GAWPA
Sbjct  76   IYTYTNVMNGFSANLSPNELEALKNSPGYISSTLDLQAKLHTTHSPQFLGLNPKIGAWPA  135

Query  409  TDYGRDVIIGVIDT  450
            + +G DVI+G++D+
Sbjct  136  SKFGEDVIVGLVDS  149



>ref|XP_010912031.1| PREDICTED: subtilisin-like protease [Elaeis guineensis]
Length=765

 Score =   127 bits (318),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 65/123 (53%), Positives = 85/123 (69%), Gaps = 17/123 (14%)
 Frame = +1

Query  127  TYIVHMDLSFMPRAFTSHQSWFSA---------------TLSSISNRGLVYAYTNAIHGF  261
            TYIVHMDLS MP+AF+ H SW+++               ++S  SN  L+Y Y +AIHGF
Sbjct  31   TYIVHMDLSAMPKAFSGHHSWYTSVVAAVAATTTATTSDSISLTSN--LIYVYDHAIHGF  88

Query  262  SAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGV  441
            SA LSP++LE +KKS GYL S +D    VDT+HTP FL LS + G WPA+++G+DVIIGV
Sbjct  89   SARLSPSQLEQLKKSHGYLSSYRDTPATVDTTHTPEFLHLSPNSGLWPASNFGKDVIIGV  148

Query  442  IDT  450
            +DT
Sbjct  149  VDT  151



>ref|XP_010484555.1| PREDICTED: subtilisin-like protease [Camelina sativa]
Length=737

 Score =   126 bits (317),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 58/114 (51%), Positives = 82/114 (72%), Gaps = 3/114 (3%)
 Frame = +1

Query  118  QSETYIVHMDLSFMPRAFTSHQSWFSATLSSI---SNRGLVYAYTNAIHGFSAVLSPAEL  288
            ++ TYI+HMDLS  P  F  HQSWFS TL+S+    N  ++YAYT+++HGFSAVL+ +EL
Sbjct  21   ETSTYIIHMDLSAKPLPFPDHQSWFSTTLTSVITDRNPKIIYAYTDSVHGFSAVLTNSEL  80

Query  289  EAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDT  450
            + +K  PGY+  TKD  VK+ T+ +P F+GL+S  G WP ++YG   +IG+IDT
Sbjct  81   QRLKHKPGYVSFTKDLPVKLHTTFSPQFIGLNSTSGTWPVSNYGAGTVIGIIDT  134



>gb|EYU36340.1| hypothetical protein MIMGU_mgv1a001790mg [Erythranthe guttata]
Length=759

 Score =   126 bits (316),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 61/125 (49%), Positives = 86/125 (69%), Gaps = 5/125 (4%)
 Frame = +1

Query  91   FLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSI-----SNRGLVYAYTNAIH  255
            FL    +  +  TYIVH+D S MP+AF+SH  W+S+ L S+     S   ++Y Y NA H
Sbjct  16   FLLAGDVLAERSTYIVHVDKSSMPKAFSSHHHWYSSMLKSVKSIDESESKIIYTYDNAFH  75

Query  256  GFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVII  435
            GFSAV++  ELEA+KKSPG+L + +D  V  DT+H+  FL L++  G WPA++YG+DVII
Sbjct  76   GFSAVMNKHELEALKKSPGFLSAFEDGVVTADTTHSYKFLSLNTATGLWPASNYGKDVII  135

Query  436  GVIDT  450
            G++DT
Sbjct  136  GILDT  140



>ref|XP_006425911.1| hypothetical protein CICLE_v10024929mg [Citrus clementina]
 gb|ESR39151.1| hypothetical protein CICLE_v10024929mg [Citrus clementina]
Length=786

 Score =   126 bits (316),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 67/145 (46%), Positives = 95/145 (66%), Gaps = 14/145 (10%)
 Frame = +1

Query  55   ALFFHLAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWF-------------S  195
            A    L F+  T   + S   +S+TYI+HMD S MP+A++S  +W+             +
Sbjct  30   ATLITLKFLLLTAFHLSSTLAKSDTYIIHMDTSAMPKAYSSLYTWYLFMLCSVSESSKAT  89

Query  196  ATLSSISNRGLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFL  375
            AT ++IS++ L+Y Y N+IHGFSA L+ +ELE +KK PGY+ ST D  + V T+HT  FL
Sbjct  90   ATSTTISSK-LIYTYANSIHGFSATLTVSELETLKKLPGYISSTPDRPLTVHTTHTSQFL  148

Query  376  GLSSDHGAWPATDYGRDVIIGVIDT  450
            GLSS  GAWPA++YG+ VIIG++DT
Sbjct  149  GLSSLSGAWPASNYGKGVIIGLVDT  173



>ref|XP_010320327.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=757

 Score =   126 bits (316),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 63/122 (52%), Positives = 83/122 (68%), Gaps = 11/122 (9%)
 Frame = +1

Query  118  QSETYIVHMDLSFMPRAFTSHQSWFSATL-----------SSISNRGLVYAYTNAIHGFS  264
            +  TYI+HMD SFMP+AFTSH+ W S+ L           SSI+   L+Y+Y NA HGFS
Sbjct  26   KRTTYIIHMDKSFMPKAFTSHEQWHSSILETVKLKDTTSGSSINPTRLLYSYDNAFHGFS  85

Query  265  AVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVI  444
            AV+S  EL+ ++K PG+  +  D  V +DT+HT  FLGLS + G WPA++YG DVI+GVI
Sbjct  86   AVMSEDELKVLEKLPGFASAYADKMVTLDTTHTFEFLGLSPESGLWPASEYGEDVIVGVI  145

Query  445  DT  450
            DT
Sbjct  146  DT  147



>ref|XP_010320531.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=750

 Score =   125 bits (315),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 61/126 (48%), Positives = 85/126 (67%), Gaps = 11/126 (9%)
 Frame = +1

Query  106  SIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISNRG-----------LVYAYTNAI  252
            S  G+  TYI+HMD SFMP+AFTSH+ W S+ L +++ +            L+Y+Y NA 
Sbjct  14   SASGKRTTYIIHMDKSFMPKAFTSHEQWHSSILETVNLKDTASKSSTKPTRLLYSYDNAF  73

Query  253  HGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVI  432
            HGFSAV+S  EL+ ++K PG++ +  D  V +DT+HT  FLGL+ + G WPA+ YG DVI
Sbjct  74   HGFSAVMSEDELQVLEKLPGFVSAYADKMVTLDTTHTFEFLGLNPESGLWPASHYGEDVI  133

Query  433  IGVIDT  450
            +GVIDT
Sbjct  134  VGVIDT  139



>ref|NP_569044.1| Subtilisin-like serine endopeptidase family protein [Arabidopsis 
thaliana]
 dbj|BAB10943.1| subtilisin-type protease-like [Arabidopsis thaliana]
 gb|AAS99721.1| At5g67090 [Arabidopsis thaliana]
 dbj|BAD94613.1| subtilisin-type protease-like [Arabidopsis thaliana]
 gb|AED98299.1| Subtilisin-like serine endopeptidase family protein [Arabidopsis 
thaliana]
Length=736

 Score =   125 bits (315),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 58/117 (50%), Positives = 86/117 (74%), Gaps = 3/117 (3%)
 Frame = +1

Query  109  IDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSS-ISNRG--LVYAYTNAIHGFSAVLSP  279
            +  ++  YI+HMDLS  P  F+ H+SWFS TL+S I+NR   ++YAYT+++HGFSAVL+ 
Sbjct  18   VTAETSPYIIHMDLSAKPLPFSDHRSWFSTTLTSVITNRKPKIIYAYTDSVHGFSAVLTN  77

Query  280  AELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDT  450
            +EL+ +K  PGY+  TKD  VK+ T+ +P F+GL+S  G WP ++YG  ++IG+IDT
Sbjct  78   SELQRLKHKPGYVSFTKDLPVKLHTTFSPKFIGLNSTSGTWPVSNYGAGIVIGIIDT  134



>gb|KJB58523.1| hypothetical protein B456_009G213500 [Gossypium raimondii]
Length=759

 Score =   125 bits (315),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 63/116 (54%), Positives = 81/116 (70%), Gaps = 7/116 (6%)
 Frame = +1

Query  124  ETYIVHMDLSFMPRAFTSHQSWFSATLSSI-------SNRGLVYAYTNAIHGFSAVLSPA  282
             TYIVHMD SFMP+ F SH SW+S+ + S+       S+  L+Y+Y +  HGFSAVLS  
Sbjct  27   NTYIVHMDKSFMPKVFASHHSWYSSIVDSLKSTNIPQSSPSLIYSYDSGAHGFSAVLSGD  86

Query  283  ELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDT  450
            ELE +KKSPG++ +  D +V VDT+HTP FL L+S  G WPA++YG   IIGVIDT
Sbjct  87   ELETLKKSPGFVSAYLDRTVTVDTTHTPEFLSLNSYSGLWPASNYGEGTIIGVIDT  142



>emb|CDP17236.1| unnamed protein product [Coffea canephora]
Length=761

 Score =   125 bits (315),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 63/139 (45%), Positives = 87/139 (63%), Gaps = 9/139 (6%)
 Frame = +1

Query  61   FFHLAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSI---------  213
            F  L +    F     +  +  TYIVHMD S MP+AF+ H  W+S+T+ ++         
Sbjct  12   FLVLTWFLVPFHASLVVSAKRSTYIVHMDKSAMPKAFSGHHMWYSSTVDAVKSVSFDSLR  71

Query  214  SNRGLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDH  393
            +    VY+Y N +HGFSA+LS  ELEA+KKSPG+L +  D  V  DT+HT  FL L+  +
Sbjct  72   NGPKFVYSYDNVLHGFSALLSEDELEALKKSPGFLSAYTDKLVTTDTTHTYNFLSLNPTN  131

Query  394  GAWPATDYGRDVIIGVIDT  450
            G WPA+D+G+DVI+GVIDT
Sbjct  132  GLWPASDFGKDVIVGVIDT  150



>ref|XP_006466594.1| PREDICTED: subtilisin-like protease-like [Citrus sinensis]
Length=786

 Score =   125 bits (315),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 68/145 (47%), Positives = 94/145 (65%), Gaps = 14/145 (10%)
 Frame = +1

Query  55   ALFFHLAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWF-------------S  195
            A    L F+      + S   +S+TYI+HMD S MP+A++S  +W+             +
Sbjct  30   ATLITLKFLLLAAFHLSSTLAKSDTYIIHMDTSAMPKAYSSLYTWYLFMLCSVSESSKAT  89

Query  196  ATLSSISNRGLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFL  375
            AT S+IS++ LVY Y N+IHGFSA L+ +ELE +KK PGY+ ST D  + V T+HT  FL
Sbjct  90   ATSSTISSK-LVYTYANSIHGFSATLTVSELETLKKLPGYISSTPDRPLAVHTTHTSEFL  148

Query  376  GLSSDHGAWPATDYGRDVIIGVIDT  450
            GLSS  GAWPA++YG+ VIIG++DT
Sbjct  149  GLSSLSGAWPASNYGKGVIIGLVDT  173



>ref|XP_010093626.1| Subtilisin-like protease [Morus notabilis]
 gb|EXB54387.1| Subtilisin-like protease [Morus notabilis]
Length=724

 Score =   125 bits (313),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 60/110 (55%), Positives = 78/110 (71%), Gaps = 7/110 (6%)
 Frame = +1

Query  142  MDLSFMPRAFTSHQSWFSATLSSISNRG-------LVYAYTNAIHGFSAVLSPAELEAIK  300
            MD S MPRAF++HQSWF +T SS+S          L++ Y N+IHGFSA L+ +EL+A+K
Sbjct  1    MDKSAMPRAFSAHQSWFESTFSSVSENSQEPITSKLIHTYKNSIHGFSATLTLSELQALK  60

Query  301  KSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDT  450
             SPGY++ST D  +K  T+HT  FLGLS + G WPA+ YG  VIIGV+DT
Sbjct  61   NSPGYIHSTPDRMLKPHTTHTSKFLGLSQNSGVWPASSYGEGVIIGVVDT  110



>gb|EYU19442.1| hypothetical protein MIMGU_mgv1a001731mg [Erythranthe guttata]
Length=768

 Score =   125 bits (313),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 64/126 (51%), Positives = 84/126 (67%), Gaps = 15/126 (12%)
 Frame = +1

Query  118  QSETYIVHMDLSFMPRAFTSHQSWFSATL------SSI---------SNRGLVYAYTNAI  252
            +  TYIVHMD S+MP+AF+SH  W+S+ L      SS+             L+Y Y NA 
Sbjct  26   KRSTYIVHMDKSYMPKAFSSHHHWYSSILLHSTAKSSLPNNNKVNNKVKTNLIYTYDNAF  85

Query  253  HGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVI  432
            HGFSAV+S +ELEA+KKSPG++ S  D  +  DT+H+  FL L++  G WPA+DYG+DVI
Sbjct  86   HGFSAVMSESELEALKKSPGFISSYPDDVITADTTHSTQFLSLNTAAGLWPASDYGKDVI  145

Query  433  IGVIDT  450
            IGVIDT
Sbjct  146  IGVIDT  151



>gb|EYU36342.1| hypothetical protein MIMGU_mgv1a001789mg [Erythranthe guttata]
Length=759

 Score =   125 bits (313),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 60/125 (48%), Positives = 84/125 (67%), Gaps = 5/125 (4%)
 Frame = +1

Query  91   FLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSI-----SNRGLVYAYTNAIH  255
            FL    +  +  TYIVHMD S MP+AF+SH  W+S+ L+S      S   ++Y Y NA H
Sbjct  16   FLLAGDVSAERSTYIVHMDKSSMPKAFSSHHHWYSSMLTSAKSLDESESKIIYTYDNAFH  75

Query  256  GFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVII  435
            GFS V++  ELEA+KK PG+L + +D  V  DT+H+  FL L++  G WPA++YG+DVII
Sbjct  76   GFSVVMNKQELEALKKLPGFLSAFEDGVVTADTTHSYKFLSLNTASGLWPASNYGKDVII  135

Query  436  GVIDT  450
            G++DT
Sbjct  136  GILDT  140



>gb|KEH42928.1| subtilisin-like serine protease [Medicago truncatula]
Length=760

 Score =   124 bits (312),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 63/147 (43%), Positives = 97/147 (66%), Gaps = 21/147 (14%)
 Frame = +1

Query  58   LFFHLAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSS---------  210
            LF ++ F+   F+ +     Q + YI+HM+LS MP+AF++H +W+ +TLSS         
Sbjct  10   LFSYITFLHLIFITL----AQYDNYIIHMNLSAMPKAFSTHHTWYHSTLSSALENPQLTA  65

Query  211  -------ISNRGLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPG  369
                   IS++ L+Y YT+ I+GFSA LSP E E++K +PGY+ S +D  +K+DT+H+P 
Sbjct  66   TNNLNSPISSK-LIYTYTHVINGFSANLSPKEHESLKNAPGYISSIRDLHMKMDTTHSPQ  124

Query  370  FLGLSSDHGAWPATDYGRDVIIGVIDT  450
            FLGL+ + GAW  + +G D+I+GVIDT
Sbjct  125  FLGLNPNIGAWHDSKFGEDIIVGVIDT  151



>ref|XP_011069661.1| PREDICTED: subtilisin-like protease [Sesamum indicum]
Length=781

 Score =   125 bits (313),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 64/123 (52%), Positives = 80/123 (65%), Gaps = 12/123 (10%)
 Frame = +1

Query  118  QSETYIVHMDLSFMPRAFTSHQSWFSATLSSISNRG------------LVYAYTNAIHGF  261
            +  TYIVHMD SFMP AF+SH  W+S+ L S  +              LVY Y NA HGF
Sbjct  45   ERSTYIVHMDKSFMPLAFSSHHYWYSSVLQSAKSVAQTSLDRDNLEPKLVYTYDNAFHGF  104

Query  262  SAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGV  441
            SAV+S  ELEA++KSPG+L +  D  V  DT+HT  FL L++  G WPA+ YG+DVIIGV
Sbjct  105  SAVMSKPELEAVQKSPGFLSAYPDGVVIPDTTHTYKFLSLNTATGLWPASQYGKDVIIGV  164

Query  442  IDT  450
            +DT
Sbjct  165  VDT  167



>ref|XP_004514927.1| PREDICTED: subtilisin-like protease-like [Cicer arietinum]
Length=762

 Score =   124 bits (312),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 68/156 (44%), Positives = 100/156 (64%), Gaps = 22/156 (14%)
 Frame = +1

Query  40   MANHRALFFHLAFISATFLQ-IFSI-DGQSETYIVHMDLSFMPRAFTSHQSWFSATLSS-  210
            MA H  ++  + F   TFL  IF++ D QS+ YI+HMDLS MP+ F++  +W+ +TLSS 
Sbjct  1    MATH--IYLSIFFSYVTFLHLIFTLADDQSDNYIIHMDLSAMPKPFSTQHTWYLSTLSSA  58

Query  211  ----------------ISNRGLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASV  342
                            IS++ L+Y YT+ ++GFSA LSP E E +K SPGY+ S +D   
Sbjct  59   LENPLELSTNNLNQSLISSK-LIYTYTHVMNGFSASLSPKEHETLKNSPGYISSIRDLHA  117

Query  343  KVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDT  450
            K+DT+H+P FLGL+   GAW  + +G+DVI+G++DT
Sbjct  118  KLDTTHSPEFLGLNPYKGAWHDSKFGKDVIVGLVDT  153



>gb|EYU36339.1| hypothetical protein MIMGU_mgv1a001782mg [Erythranthe guttata]
Length=760

 Score =   124 bits (312),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 61/124 (49%), Positives = 86/124 (69%), Gaps = 5/124 (4%)
 Frame = +1

Query  91   FLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSS---ISNRGL--VYAYTNAIH  255
            FL    +  +  TYIVHMD S MP+AF+SH  W+S+ L+S   +  RGL  +Y Y NA H
Sbjct  17   FLLADDVSAERSTYIVHMDKSSMPKAFSSHHHWYSSMLNSAKSLDERGLKIIYTYDNAFH  76

Query  256  GFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVII  435
            GFS V++  ELEA+KKSPG+L + +D +V   T+H+  FL L++  G WPA++YG+DVII
Sbjct  77   GFSVVMNKHELEALKKSPGFLSAFEDGAVTAATTHSYKFLSLNTASGLWPASNYGKDVII  136

Query  436  GVID  447
            G++D
Sbjct  137  GILD  140



>ref|XP_004494864.1| PREDICTED: subtilisin-like protease-like [Cicer arietinum]
Length=777

 Score =   124 bits (312),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 64/151 (42%), Positives = 90/151 (60%), Gaps = 19/151 (13%)
 Frame = +1

Query  52   RALFFHLAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSI------  213
            R L F    I+   +    +D  S  YI+HM+LS MP  F++ QSW+ + +SS+      
Sbjct  12   RYLLFSF-IITTHLVSSILVDQNSNNYIIHMNLSAMPTPFSNQQSWYLSIISSLLQITSD  70

Query  214  ------------SNRGLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTS  357
                        S+  LVY YTN ++GF A LSP ELEA+K SP Y+ S KD  +K+DT+
Sbjct  71   QVTINNHQLNHLSSSKLVYTYTNVMNGFCANLSPLELEALKTSPEYISSIKDLPIKLDTT  130

Query  358  HTPGFLGLSSDHGAWPATDYGRDVIIGVIDT  450
            H+P  +GL+   GAWP T YG++VIIG+ID+
Sbjct  131  HSPQSIGLNPVSGAWPTTQYGKNVIIGLIDS  161



>ref|XP_009799242.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=757

 Score =   124 bits (311),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 60/123 (49%), Positives = 90/123 (73%), Gaps = 12/123 (10%)
 Frame = +1

Query  118  QSETYIVHMDLSFMPRAFTSHQSWFSATLSSI------------SNRGLVYAYTNAIHGF  261
            +S++YI+HMD S MP+AF+S  SW+ ATL+S+            ++  L+Y+Y NA+HGF
Sbjct  25   ESDSYIIHMDTSAMPKAFSSPHSWYLATLASVLDSSSAGSKNTLASSKLIYSYKNAMHGF  84

Query  262  SAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGV  441
            SA LS +E +A+K SPGY+ S++D +VK+ T+H+  FLGL+S  G+WP ++YG+ VIIGV
Sbjct  85   SASLSSSEYKAMKNSPGYVSSSEDMTVKLHTTHSSHFLGLNSMSGSWPKSNYGKYVIIGV  144

Query  442  IDT  450
            +DT
Sbjct  145  VDT  147



>ref|XP_010547521.1| PREDICTED: subtilisin-like protease SDD1 [Tarenaya hassleriana]
Length=755

 Score =   124 bits (311),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 57/114 (50%), Positives = 86/114 (75%), Gaps = 2/114 (2%)
 Frame = +1

Query  115  GQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISNRG--LVYAYTNAIHGFSAVLSPAEL  288
             ++ +YIVHMDLS MP  F+ H SWFSATLSS+S R   ++Y+YT++IHGFSA+L+ +EL
Sbjct  21   AETGSYIVHMDLSAMPSPFSDHHSWFSATLSSVSGRKPEIIYSYTDSIHGFSALLTISEL  80

Query  289  EAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDT  450
            E++K+  GY+  T+D  V++ T+ +P F+GL+ + G WP ++YG  V+IG +DT
Sbjct  81   ESLKRQTGYVSFTRDFPVQLHTTLSPQFIGLNPNSGIWPVSNYGDGVVIGFVDT  134



>ref|XP_006393907.1| hypothetical protein EUTSA_v10005646mg [Eutrema salsugineum]
 gb|ESQ31193.1| hypothetical protein EUTSA_v10005646mg [Eutrema salsugineum]
Length=734

 Score =   124 bits (310),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 60/130 (46%), Positives = 90/130 (69%), Gaps = 5/130 (4%)
 Frame = +1

Query  70   LAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSI---SNRGLVYAY  240
            +  I++ F+   + D  + TYI+HMDLS  P  F++HQSWFS TL+S+       ++YAY
Sbjct  7    ILLITSFFMATATTD--TSTYIIHMDLSAKPLPFSNHQSWFSTTLTSVITGRKPKILYAY  64

Query  241  TNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYG  420
            T++IHGFSAVL+ +EL+ ++  PGY+  TKD  VK+ T+ +P F+GL S+ G WP ++YG
Sbjct  65   TDSIHGFSAVLTDSELQRLQHKPGYVSFTKDLPVKLHTTFSPQFIGLDSNSGTWPVSNYG  124

Query  421  RDVIIGVIDT  450
               +IG+IDT
Sbjct  125  VGTVIGIIDT  134



>ref|XP_010464539.1| PREDICTED: subtilisin-like protease [Camelina sativa]
Length=738

 Score =   124 bits (310),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 57/114 (50%), Positives = 80/114 (70%), Gaps = 3/114 (3%)
 Frame = +1

Query  118  QSETYIVHMDLSFMPRAFTSHQSWFSATLSSI---SNRGLVYAYTNAIHGFSAVLSPAEL  288
            ++ TYI+HMDLS  P  F  HQSWFS TL+S+       ++YAYT+++HGFSAVL+ +EL
Sbjct  23   ETSTYIIHMDLSVKPLPFPDHQSWFSTTLTSVITGRKPKIIYAYTDSVHGFSAVLTNSEL  82

Query  289  EAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDT  450
            + +K  PGY+  TKD  VK+ T+ +P F+GL+S  G WP ++YG    IG+IDT
Sbjct  83   QRLKDKPGYVSFTKDLPVKLHTTFSPQFIGLNSTSGTWPVSNYGAGTFIGIIDT  136



>gb|EYU36336.1| hypothetical protein MIMGU_mgv1a019012mg, partial [Erythranthe 
guttata]
Length=733

 Score =   123 bits (308),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 62/113 (55%), Positives = 79/113 (70%), Gaps = 5/113 (4%)
 Frame = +1

Query  127  TYIVHMDLSFMPRAFTSHQSWFSATLSSISN-----RGLVYAYTNAIHGFSAVLSPAELE  291
            TYIVHMD   MP+AF+SH  W+S+ L S  +       ++Y Y NA HGFSAVLS  ELE
Sbjct  3    TYIVHMDKFSMPKAFSSHHHWYSSMLKSAKSLDEPESKIIYTYDNAFHGFSAVLSEDELE  62

Query  292  AIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDT  450
            A+KKS G+L + +D  V  DT+H+  FL L+S  G WPA++YG+DVIIGVIDT
Sbjct  63   AVKKSQGFLSAFEDGVVTADTTHSSKFLSLNSATGLWPASNYGKDVIIGVIDT  115



>ref|XP_010320326.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=749

 Score =   123 bits (308),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 60/126 (48%), Positives = 84/126 (67%), Gaps = 11/126 (9%)
 Frame = +1

Query  106  SIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISNRG-----------LVYAYTNAI  252
            S  G+  TYI+HMD SFMP+AFTSH+ W S+ L +++ +            ++Y+Y NA 
Sbjct  14   SASGKRTTYIIHMDKSFMPKAFTSHEQWHSSILETVNLKDTASKSSTKPTRILYSYDNAF  73

Query  253  HGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVI  432
            HGFSAV+S  EL+ ++K PG++    D  V +DT+HT  FLGL+ + G WPA+ YG DVI
Sbjct  74   HGFSAVMSEDELKVLEKLPGFVSVYADKMVTLDTTHTFEFLGLNPESGLWPASHYGEDVI  133

Query  433  IGVIDT  450
            +GVIDT
Sbjct  134  VGVIDT  139



>gb|EYU25440.1| hypothetical protein MIMGU_mgv1a0017511mg, partial [Erythranthe 
guttata]
Length=650

 Score =   122 bits (306),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 59/123 (48%), Positives = 84/123 (68%), Gaps = 12/123 (10%)
 Frame = +1

Query  118  QSETYIVHMDLSFMPRAFTSHQSWFSATLSSISNR------------GLVYAYTNAIHGF  261
            Q  TYI+HMD S MP+AF+SH+ W+S+ L S+ +              LVY Y NA HGF
Sbjct  22   QRSTYIIHMDKSLMPKAFSSHRYWYSSILHSVQSPTSFAGGGEKLRPKLVYTYDNAFHGF  81

Query  262  SAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGV  441
            +AV+S  +++A++KSPG+L +  D  V  DT+H+  FLGL++  G WPA++YG+DVIIGV
Sbjct  82   TAVMSEDDVDAVRKSPGFLSAYPDDVVTPDTTHSYKFLGLNTAAGIWPASEYGKDVIIGV  141

Query  442  IDT  450
            +DT
Sbjct  142  VDT  144



>ref|XP_002865029.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH41288.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
Length=736

 Score =   122 bits (307),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 57/114 (50%), Positives = 85/114 (75%), Gaps = 3/114 (3%)
 Frame = +1

Query  118  QSETYIVHMDLSFMPRAFTSHQSWFSATLSS-ISNRG--LVYAYTNAIHGFSAVLSPAEL  288
            ++ TYI+HMDLS  P  F++H++WFS TL+S I++R   ++YAYT+++HGFSAVL+  EL
Sbjct  21   ETSTYIIHMDLSAKPLPFSNHRNWFSTTLTSVITDRKPKIIYAYTDSVHGFSAVLTTLEL  80

Query  289  EAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDT  450
            + +K  PGY+  TKD  VK+ T+ +P F+GL+S  G WP ++YG   +IG+IDT
Sbjct  81   QRLKHKPGYVSFTKDLPVKLHTTFSPQFIGLNSTSGTWPVSNYGDGTVIGIIDT  134



>ref|XP_011069662.1| PREDICTED: subtilisin-like protease [Sesamum indicum]
Length=769

 Score =   122 bits (307),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 63/129 (49%), Positives = 82/129 (64%), Gaps = 12/129 (9%)
 Frame = +1

Query  100  IFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISN------------RGLVYAYT  243
            +     +  T+IVHMD SFMP+AF+SH  W+S+ L S+ +              LVY Y 
Sbjct  23   VLQASAERSTFIVHMDKSFMPKAFSSHHYWYSSMLQSVKSVAQTSFDRDNLESKLVYTYD  82

Query  244  NAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGR  423
            +A HGFSAV+S  ELEA+KK PG+L +  D  V  DT+HT  FL L++  G WPA+ YG+
Sbjct  83   SAFHGFSAVMSKPELEALKKLPGFLSAYPDGVVIPDTTHTYKFLSLNTAIGLWPASQYGK  142

Query  424  DVIIGVIDT  450
            DVIIGVIDT
Sbjct  143  DVIIGVIDT  151



>emb|CDY09336.1| BnaA02g26740D [Brassica napus]
Length=727

 Score =   122 bits (306),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 55/114 (48%), Positives = 82/114 (72%), Gaps = 3/114 (3%)
 Frame = +1

Query  118  QSETYIVHMDLSFMPRAFTSHQSWFSATLSSIS---NRGLVYAYTNAIHGFSAVLSPAEL  288
            ++  YI+HMDLS  P  FT HQSWFS TL+S++      ++YAYT+++HGFSAVL+ +EL
Sbjct  21   ETSIYIIHMDLSAKPAPFTDHQSWFSTTLTSVTTGRKPKILYAYTDSVHGFSAVLTNSEL  80

Query  289  EAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDT  450
            + ++  PGY+  TKD  VK+ T+ +P F+GL+S+ G WP + YG   +IG++DT
Sbjct  81   KRLQHKPGYVSFTKDLPVKLQTTFSPQFIGLASNSGTWPVSSYGAGTVIGIVDT  134



>ref|XP_009608285.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=771

 Score =   122 bits (307),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 61/128 (48%), Positives = 83/128 (65%), Gaps = 12/128 (9%)
 Frame = +1

Query  103  FSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSIS------------NRGLVYAYTN  246
              I  Q  TYIVH+D SFMP+ F SHQ+W S+ + +I                L+Y+Y N
Sbjct  21   LGISAQRSTYIVHLDKSFMPKIFASHQNWHSSIIDTIKIDVPTTPNNHHLTPKLLYSYDN  80

Query  247  AIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRD  426
             IHGFSAVLS  ELEA+KKSPG+L + KD +V+  T++T  FL L+   G WPA+ +G+D
Sbjct  81   VIHGFSAVLSKDELEALKKSPGFLSAYKDRTVEAHTTYTSEFLKLNPASGLWPASGFGQD  140

Query  427  VIIGVIDT  450
            +IIGV+D+
Sbjct  141  IIIGVLDS  148



>ref|XP_009769987.1| PREDICTED: subtilisin-like protease isoform X1 [Nicotiana sylvestris]
 ref|XP_009769988.1| PREDICTED: subtilisin-like protease isoform X2 [Nicotiana sylvestris]
Length=765

 Score =   122 bits (306),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 62/128 (48%), Positives = 83/128 (65%), Gaps = 12/128 (9%)
 Frame = +1

Query  103  FSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISNR------------GLVYAYTN  246
              I  Q  TYIVH+D SFMP+ F SHQ+W S+ +++I                +VY+Y N
Sbjct  20   LGISAQRSTYIVHLDKSFMPKIFASHQNWHSSIINNIKIEVPTTPNDHHPVPKIVYSYDN  79

Query  247  AIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRD  426
             IHGFSAVLS  ELEA+KKS G+L + KD +V+  T+HT  FL L+   G WPA+ +G+D
Sbjct  80   VIHGFSAVLSKDELEALKKSSGFLSAYKDRTVEAHTTHTSEFLKLNPASGLWPASGFGQD  139

Query  427  VIIGVIDT  450
            VIIGV+D+
Sbjct  140  VIIGVLDS  147



>ref|XP_007207210.1| hypothetical protein PRUPE_ppa001938mg [Prunus persica]
 gb|EMJ08409.1| hypothetical protein PRUPE_ppa001938mg [Prunus persica]
Length=739

 Score =   122 bits (306),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 59/123 (48%), Positives = 79/123 (64%), Gaps = 12/123 (10%)
 Frame = +1

Query  118  QSETYIVHMDLSFMPRAFTSHQSWFSATLSSISNR------------GLVYAYTNAIHGF  261
            +  TYIVHMD S MP+++ SHQ W+S+ + S   +             L+Y Y NA HGF
Sbjct  6    ERSTYIVHMDKSLMPKSYASHQHWYSSIVDSFKAQIPTSSDGHKISPSLLYTYDNAFHGF  65

Query  262  SAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGV  441
            SAVLS  ELE +K SPG++ +  D S+ +DT+HT  FL L+   G WPA++YG D+IIGV
Sbjct  66   SAVLSAEELETLKNSPGFVSAYSDKSITLDTTHTTQFLSLNPSTGLWPASNYGEDIIIGV  125

Query  442  IDT  450
            IDT
Sbjct  126  IDT  128



>ref|XP_006280074.1| hypothetical protein CARUB_v10025957mg [Capsella rubella]
 gb|EOA12972.1| hypothetical protein CARUB_v10025957mg [Capsella rubella]
Length=730

 Score =   122 bits (306),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 56/114 (49%), Positives = 81/114 (71%), Gaps = 3/114 (3%)
 Frame = +1

Query  118  QSETYIVHMDLSFMPRAFTSHQSWFSATLSSI---SNRGLVYAYTNAIHGFSAVLSPAEL  288
            ++ TYI+HMDLS  P  F  H+SWFS TL+S+       ++YAYT+++HGFSAVL+ +EL
Sbjct  14   KTSTYIIHMDLSAKPLPFPDHRSWFSTTLTSVITDKKPRIIYAYTDSVHGFSAVLTNSEL  73

Query  289  EAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDT  450
            + +K  PGY+  TKD  VK+ T+ +P F+GL+S  G WP ++YG   +IG+IDT
Sbjct  74   QRLKDKPGYVSFTKDLPVKLHTTFSPQFIGLNSASGTWPVSNYGAGTVIGIIDT  127



>ref|XP_010267360.1| PREDICTED: subtilisin-like protease [Nelumbo nucifera]
Length=772

 Score =   122 bits (306),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 63/128 (49%), Positives = 86/128 (67%), Gaps = 11/128 (9%)
 Frame = +1

Query  100  IFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISN-----------RGLVYAYTN  246
            I S+  + + YIVHMDLS MP  F  H SW+ ATLSSI +             L+Y Y++
Sbjct  20   ITSLVAKPDVYIVHMDLSAMPTPFRDHHSWYEATLSSIKDGMAGVATTTKASNLIYTYSS  79

Query  247  AIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRD  426
            AIHGF+A LSP ELE +++SPG++ ST+D  +K  T+ TP FLGL+   GAWP ++YG D
Sbjct  80   AIHGFAARLSPLELELLEQSPGFVSSTRDVPLKAHTTRTPDFLGLNPSFGAWPVSNYGED  139

Query  427  VIIGVIDT  450
            VIIG++D+
Sbjct  140  VIIGLVDS  147



>ref|XP_004249504.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=771

 Score =   122 bits (306),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 61/126 (48%), Positives = 80/126 (63%), Gaps = 12/126 (10%)
 Frame = +1

Query  109  IDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISNRG------------LVYAYTNAI  252
            I  +  TYIVH+D SFMP+ F +HQ+W S  + +I                L+Y+Y N  
Sbjct  20   ISAERSTYIVHLDKSFMPKIFATHQNWHSYIIDTIKIEAPTTQNTHHPLPKLLYSYDNVF  79

Query  253  HGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVI  432
            HGFSAVLS  ELEA+KKSPG+L + KD  V+  T+H+P FL L+   G WPA+ +G DVI
Sbjct  80   HGFSAVLSKDELEALKKSPGFLSAYKDRPVEAHTTHSPEFLKLNPASGLWPASGFGEDVI  139

Query  433  IGVIDT  450
            IGV+DT
Sbjct  140  IGVLDT  145



>ref|XP_009343011.1| PREDICTED: subtilisin-like protease [Pyrus x bretschneideri]
Length=764

 Score =   122 bits (306),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 64/143 (45%), Positives = 85/143 (59%), Gaps = 12/143 (8%)
 Frame = +1

Query  58   LFFHLAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISNRG----  225
              F L  +    LQ+        TYIVHMD S MP+++TSH  W+S+ + S  +      
Sbjct  11   FIFSLVALFLLALQVNVSFADRSTYIVHMDKSLMPKSYTSHDHWYSSIVDSFKSENPTSF  70

Query  226  --------LVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGL  381
                    ++Y Y NA HGFSAVLSP EL  +KKSPG++ +  D S+ +DT+HT  FL L
Sbjct  71   DGNKIWPSILYTYDNAFHGFSAVLSPDELVTLKKSPGFVSAYADKSITLDTTHTTQFLNL  130

Query  382  SSDHGAWPATDYGRDVIIGVIDT  450
            +   G WPA+DYG D+IIGVIDT
Sbjct  131  NPFAGLWPASDYGDDIIIGVIDT  153



>ref|XP_002510194.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
 gb|EEF52381.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
Length=766

 Score =   121 bits (304),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 67/146 (46%), Positives = 90/146 (62%), Gaps = 19/146 (13%)
 Frame = +1

Query  58   LFF--HLAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISNRGL-  228
            LFF  H+ FI    L   S   +  TYIVHMD S MP+ FT+HQ W+++TL S+ +  L 
Sbjct  8    LFFAWHVFFI----LSATSTSVERATYIVHMDKSLMPKIFTTHQDWYTSTLISLQSTNLA  63

Query  229  ------------VYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGF  372
                        +Y+Y N  HGFSAVLSP EL+A++  PG++ + KD  V VDT+HT  F
Sbjct  64   FSNNDLKLSPSFIYSYDNVAHGFSAVLSPEELQALRNYPGFVSAYKDKMVTVDTTHTHEF  123

Query  373  LGLSSDHGAWPATDYGRDVIIGVIDT  450
            L L+   G WPA+ +G +VIIGVID+
Sbjct  124  LSLNPFTGLWPASSFGENVIIGVIDS  149



>emb|CAA59964.1| subtilisin-like protease [Alnus glutinosa]
Length=761

 Score =   121 bits (303),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 61/145 (42%), Positives = 91/145 (63%), Gaps = 7/145 (5%)
 Frame = +1

Query  37   EMANHRALFFHLAFISATFLQIF--SIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSS  210
            ++ N   L +   F S   L +   S   +  TYIVHMD S MP+AFTSH +W+S+ +  
Sbjct  2    KLYNGICLPYLFLFASCICLALHASSTSMEKSTYIVHMDKSHMPKAFTSHHNWYSSIVDC  61

Query  211  ISNR-----GLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFL  375
            +++        VY Y + +HGFSA LS  EL+ +++SPG++ + +D +  +DT+HTP FL
Sbjct  62   LNSEKPTTSSFVYTYNHVLHGFSASLSHQELDTLRESPGFVSAYRDRNATLDTTHTPRFL  121

Query  376  GLSSDHGAWPATDYGRDVIIGVIDT  450
             L+   G WPA++YG DVIIGVID+
Sbjct  122  SLNPTGGLWPASNYGEDVIIGVIDS  146



>ref|XP_006345404.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=782

 Score =   121 bits (304),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 62/142 (44%), Positives = 87/142 (61%), Gaps = 16/142 (11%)
 Frame = +1

Query  61   FFHLAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSIS--------  216
            F    F+ A  L +     +  TYIVH+D S MP+ F +H  W S+T+ SI         
Sbjct  9    FLVFFFLFAPLLCL----AERSTYIVHLDKSLMPKIFATHHHWHSSTIESIKIITPASLN  64

Query  217  ----NRGLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLS  384
                   L+Y+Y N  HGFSAVLS  ELEA+KKSPG++ + KD  +++ T+HTP FL L+
Sbjct  65   SHHPAPKLLYSYDNVFHGFSAVLSQNELEALKKSPGFVSAHKDVPIELHTTHTPEFLKLN  124

Query  385  SDHGAWPATDYGRDVIIGVIDT  450
               G WPA+++G+DVIIG++DT
Sbjct  125  PSSGLWPASNFGQDVIIGLVDT  146



>ref|XP_009129098.1| PREDICTED: subtilisin-like protease [Brassica rapa]
Length=727

 Score =   121 bits (303),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 54/114 (47%), Positives = 82/114 (72%), Gaps = 3/114 (3%)
 Frame = +1

Query  118  QSETYIVHMDLSFMPRAFTSHQSWFSATLSSIS---NRGLVYAYTNAIHGFSAVLSPAEL  288
            ++  +I+HMDLS  P  FT HQSWFS TL+S++      ++YAYT+++HGFSAVL+ +EL
Sbjct  21   ETSIFIIHMDLSAKPAPFTDHQSWFSTTLTSVTTGRKPKILYAYTDSVHGFSAVLTNSEL  80

Query  289  EAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDT  450
            + ++  PGY+  TKD  VK+ T+ +P F+GL+S+ G WP + YG   +IG++DT
Sbjct  81   KRLQHKPGYVSFTKDLPVKLQTTFSPQFIGLASNSGTWPVSSYGAGTVIGIVDT  134



>ref|XP_011069660.1| PREDICTED: subtilisin-like protease [Sesamum indicum]
Length=762

 Score =   120 bits (302),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 64/132 (48%), Positives = 83/132 (63%), Gaps = 12/132 (9%)
 Frame = +1

Query  91   FLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISNRGL------------VY  234
            FL       Q  TYIVHMD S MP+AF+    W+S+ L SI + GL            V+
Sbjct  15   FLLAHHASAQRSTYIVHMDKSSMPKAFSGGHHWYSSILGSIKSVGLKSSDGDQPGPKLVH  74

Query  235  AYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATD  414
            +Y NA HGFSAV+S  ELE+++KSPG L +  D  V  DT+HT  FLGL++  G WPA+ 
Sbjct  75   SYDNAFHGFSAVMSKDELESLRKSPGLLSAHVDRPVTPDTTHTYKFLGLNTASGIWPASQ  134

Query  415  YGRDVIIGVIDT  450
            YG+DVIIGV+D+
Sbjct  135  YGKDVIIGVVDS  146



>ref|XP_002284864.1| PREDICTED: subtilisin-like protease [Vitis vinifera]
Length=763

 Score =   120 bits (302),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 65/147 (44%), Positives = 91/147 (62%), Gaps = 14/147 (10%)
 Frame = +1

Query  49   HRALFFHLAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSI-----  213
            HR     +A+IS T L   S  G+  TYI+HMD S MPRAF +H  W+++T+ S+     
Sbjct  8    HRLYLIFIAWISFT-LHFRSASGERSTYIIHMDKSLMPRAFATHHHWYASTVDSLTTAAS  66

Query  214  -------SNRGLVYAYTNAIHGFSAVLSPAELEAIKKS-PGYLYSTKDASVKVDTSHTPG  369
                   S   L+Y Y + +HGF AVLS  ELE ++KS  G++ +  D +V +DT+HT  
Sbjct  67   TRSNAVQSTPKLIYTYDHVLHGFCAVLSKDELEKLRKSTAGFVSAYSDRTVTLDTTHTLE  126

Query  370  FLGLSSDHGAWPATDYGRDVIIGVIDT  450
            FL L+   G WPA+D+G+DVI+GVIDT
Sbjct  127  FLKLNQISGLWPASDFGKDVIVGVIDT  153



>ref|XP_011464036.1| PREDICTED: subtilisin-like protease [Fragaria vesca subsp. vesca]
Length=474

 Score =   118 bits (296),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 61/139 (44%), Positives = 85/139 (61%), Gaps = 14/139 (10%)
 Frame = +1

Query  76   FISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISN------------  219
             +  + L   ++   S TYI+HMD S MP+AF  HQ W+ ATLSS+S             
Sbjct  7    LVLCSILFSITVSAISHTYIIHMDSSAMPKAFLDHQKWYLATLSSLSEGLLEADEATSSA  66

Query  220  --RGLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDH  393
                L+Y YTNAI GFSA L+ +ELE++K SPG++   +D  +K+ T+ +  F GL+   
Sbjct  67   SITKLIYTYTNAIQGFSATLTLSELESLKSSPGFISYIRDRPLKLHTTRSSQFHGLTPLS  126

Query  394  GAWPATDYGRDVIIGVIDT  450
            GAWPA++YG +V IGVIDT
Sbjct  127  GAWPASNYGENVTIGVIDT  145



>ref|XP_007047285.1| Subtilisin-like serine endopeptidase family protein [Theobroma 
cacao]
 gb|EOX91442.1| Subtilisin-like serine endopeptidase family protein [Theobroma 
cacao]
Length=779

 Score =   120 bits (302),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 63/135 (47%), Positives = 93/135 (69%), Gaps = 13/135 (10%)
 Frame = +1

Query  79   ISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISNRG-----------  225
            ++ +FL    I  + ++YI++MD S MP+AF+S+ SW+ + LSSIS+             
Sbjct  68   LAVSFLSF--ILAKPDSYIIYMDSSAMPKAFSSYHSWYLSMLSSISDTSDTESGSAATSK  125

Query  226  LVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWP  405
            L+Y Y+N+I+GFSA+L+ +ELEA+K S GY+ ST+D  +K  T+HTP FLGLSS  GAW 
Sbjct  126  LLYTYSNSINGFSAILTLSELEALKNSFGYISSTRDVPLKAHTTHTPQFLGLSSTLGAWT  185

Query  406  ATDYGRDVIIGVIDT  450
            A + G DVIIG++D+
Sbjct  186  APNMGEDVIIGILDS  200



>gb|EPS63009.1| subtilisin-like protease preproenzyme [Genlisea aurea]
Length=716

 Score =   120 bits (301),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 58/114 (51%), Positives = 79/114 (69%), Gaps = 11/114 (10%)
 Frame = +1

Query  142  MDLSFMPRAFTSHQSWFSATLSSISNR-----------GLVYAYTNAIHGFSAVLSPAEL  288
            MD S MP+ F++H  W+  TL+  ++             LVY+Y NAI+GF+A LSP+EL
Sbjct  1    MDTSAMPKPFSTHHDWYLNTLAVAADETISSSSSWASSRLVYSYGNAINGFAATLSPSEL  60

Query  289  EAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDT  450
            EA+++SPGYL S KD  V++DT+H+  FLGL SDHGAW  +D G DVI+GV+DT
Sbjct  61   EAVRRSPGYLSSVKDREVQLDTTHSYRFLGLDSDHGAWSESDSGSDVIVGVVDT  114



>emb|CAA07062.1| SBT4E protein [Solanum lycopersicum]
Length=777

 Score =   120 bits (301),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 68/142 (48%), Positives = 89/142 (63%), Gaps = 13/142 (9%)
 Frame = +1

Query  58   LFFHLAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSIS-------  216
            LFF   F+SA  L   +I  Q  TYIVH+D S MP  FT H  W S+T+ SI        
Sbjct  9    LFFLSWFLSAHLLCYLAI-AQRSTYIVHLDKSLMPNVFTDHHHWHSSTIDSIKASVPSSL  67

Query  217  NR-----GLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGL  381
            NR      LVY+Y +  HGFSAVLS  EL+A+KKSPG++ + KD +V+ DT++T  +L L
Sbjct  68   NRFHSVPKLVYSYDHVFHGFSAVLSKDELKALKKSPGFISAYKDRTVEPDTTYTSDYLKL  127

Query  382  SSDHGAWPATDYGRDVIIGVID  447
            +   G WPA+  G+DVIIGV+D
Sbjct  128  NPSSGLWPASGLGQDVIIGVLD  149



>ref|XP_009769989.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=771

 Score =   120 bits (300),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 62/128 (48%), Positives = 81/128 (63%), Gaps = 12/128 (9%)
 Frame = +1

Query  103  FSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSIS------------NRGLVYAYTN  246
              I  Q  TYIVH+D SFMP  F SHQ+W S+ + +I                L+Y+Y N
Sbjct  21   LGISAQRSTYIVHLDKSFMPTIFASHQNWHSSIIDAIKIDVSTTPNDHHLTPKLLYSYDN  80

Query  247  AIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRD  426
             IHGFSAVLS  ELEA+KKS G+L + KD +V+  T+HT  FL L+   G WPA+ +G+D
Sbjct  81   VIHGFSAVLSKDELEALKKSSGFLSAYKDRTVEAHTTHTSEFLKLNPASGLWPASGFGQD  140

Query  427  VIIGVIDT  450
            VIIGV+D+
Sbjct  141  VIIGVLDS  148



>gb|KHN15886.1| Subtilisin-like protease [Glycine soja]
Length=712

 Score =   119 bits (299),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 55/108 (51%), Positives = 77/108 (71%), Gaps = 10/108 (9%)
 Frame = +1

Query  157  MPRAFTSHQSWFSATLSSIS----------NRGLVYAYTNAIHGFSAVLSPAELEAIKKS  306
            MP+A++SH +W+ +TLSS            N  L+Y YTN I+GFSA LSP ELEA+K S
Sbjct  1    MPKAYSSHHTWYLSTLSSALENSKATTDNLNSKLIYIYTNVINGFSANLSPKELEALKTS  60

Query  307  PGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDT  450
            PGY+ S +D   K DT+H+P FLGL+ + GAWPA+ +G+D+I+G++DT
Sbjct  61   PGYVSSMRDLRAKRDTTHSPQFLGLNKNVGAWPASQFGKDIIVGLVDT  108



>ref|XP_003595551.1| Subtilisin-like serine protease [Medicago truncatula]
 gb|AES65802.1| subtilisin-like serine protease [Medicago truncatula]
Length=762

 Score =   119 bits (299),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 59/147 (40%), Positives = 98/147 (67%), Gaps = 12/147 (8%)
 Frame = +1

Query  40   MANHRALFFHLAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISN  219
            MA++  L+   ++I++  + IF++   S+ YI+HM+LS MP++F++  SW+ +TL+ ++ 
Sbjct  1    MASNICLWLWFSYITSLHV-IFTL-ALSDNYIIHMNLSDMPKSFSNQHSWYESTLAQVTT  58

Query  220  R----------GLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPG  369
                        + Y YTN ++GFSA LSP E E++K   G++ S  D  +K+DT+H+P 
Sbjct  59   TNNNLNNSTSSKIFYTYTNVMNGFSANLSPEEHESLKTFSGFISSIPDLPLKLDTTHSPQ  118

Query  370  FLGLSSDHGAWPATDYGRDVIIGVIDT  450
            FLGL+   GAWP +D+G+D+I+GVIDT
Sbjct  119  FLGLNPYRGAWPTSDFGKDIIVGVIDT  145



>gb|ABK95622.1| unknown [Populus trichocarpa]
Length=778

 Score =   119 bits (299),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 67/156 (43%), Positives = 94/156 (60%), Gaps = 19/156 (12%)
 Frame = +1

Query  40   MANHRA-LFFHLAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSI-  213
            MA  R  L   L   S T L       Q++ YIVHMDLS MP++F+    W+ +TL+S+ 
Sbjct  1    MATRREFLLSKLWICSITILHFTGTLSQTDNYIVHMDLSAMPKSFSGQHHWYLSTLASVF  60

Query  214  --SNRG---------------LVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASV  342
              S+R                L+Y+YT+ I+GFSA L+P+ELEA+KKSPGY+ S KD  V
Sbjct  61   DVSDRSTARASPATYLTASSKLLYSYTHVINGFSASLTPSELEALKKSPGYISSIKDLPV  120

Query  343  KVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDT  450
            K DT+H+  FLGL+    AW A++ G  +IIG++D+
Sbjct  121  KHDTTHSTKFLGLAPQSPAWKASNLGDGIIIGLVDS  156



>ref|XP_006374911.1| subtilase family protein [Populus trichocarpa]
 gb|ERP52708.1| subtilase family protein [Populus trichocarpa]
Length=778

 Score =   119 bits (299),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 67/156 (43%), Positives = 94/156 (60%), Gaps = 19/156 (12%)
 Frame = +1

Query  40   MANHRA-LFFHLAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSI-  213
            MA  R  L   L   S T L       Q++ YIVHMDLS MP++F+    W+ +TL+S+ 
Sbjct  1    MATRREFLLSKLWICSITILHFTGTLSQTDNYIVHMDLSAMPKSFSGQHHWYLSTLASVF  60

Query  214  --SNRG---------------LVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASV  342
              S+R                L+Y+YT+ I+GFSA L+P+ELEA+KKSPGY+ S KD  V
Sbjct  61   DVSDRSTARASPATYLTASSKLLYSYTHVINGFSASLTPSELEALKKSPGYISSIKDLPV  120

Query  343  KVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDT  450
            K DT+H+  FLGL+    AW A++ G  +IIG++D+
Sbjct  121  KHDTTHSTKFLGLAPQSPAWKASNLGDGIIIGLVDS  156



>ref|XP_011074591.1| PREDICTED: subtilisin-like protease [Sesamum indicum]
Length=758

 Score =   119 bits (299),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 62/124 (50%), Positives = 82/124 (66%), Gaps = 12/124 (10%)
 Frame = +1

Query  115  GQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISNR------------GLVYAYTNAIHG  258
            G+  +YIVHMD SFMP+AF SH  W+S T+ S+ +              LVY Y N  HG
Sbjct  26   GERSSYIVHMDKSFMPKAFASHNHWYSFTIKSLKSVSSKSLDHHRKPLKLVYTYDNVFHG  85

Query  259  FSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIG  438
            FSA+LS  ELEA+KKSPG++ +  D +V +DT+HT  FL L+   G WPA++YG+ VI+G
Sbjct  86   FSALLSNDELEALKKSPGFVSAYSDRNVTLDTTHTFEFLSLNPVTGLWPASEYGKGVIVG  145

Query  439  VIDT  450
            VIDT
Sbjct  146  VIDT  149



>gb|KEH18576.1| subtilisin-like serine protease [Medicago truncatula]
Length=767

 Score =   119 bits (298),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 59/119 (50%), Positives = 83/119 (70%), Gaps = 12/119 (10%)
 Frame = +1

Query  127  TYIVHMDLSFMPRAFTSHQSWFSATL-----------SSISNRGLVYAYTNAIHGFSAVL  273
             YI+HMDLS MP+A+++  SW+ +TL           SS S++ ++Y YTN ++GFSA L
Sbjct  28   NYIIHMDLSAMPKAYSNQHSWYKSTLYRVTTTNNNLESSTSSK-IIYTYTNVMNGFSASL  86

Query  274  SPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDT  450
            SP E EA+K S GY+ S  D  +K+DT+++P FLGL+   G W A+DYG+DVI+GVIDT
Sbjct  87   SPKEHEALKTSHGYISSIPDLPLKLDTTYSPQFLGLNPYKGVWLASDYGKDVIVGVIDT  145



>ref|XP_009797476.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=766

 Score =   119 bits (298),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 65/145 (45%), Positives = 86/145 (59%), Gaps = 15/145 (10%)
 Frame = +1

Query  61   FFHLAFIS---ATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSI------  213
            +FHL F+S   +  +       Q  TYIVH+D S MP  F  H  W S+T+ SI      
Sbjct  5    YFHLLFLSWFLSALVFCLLATAQRSTYIVHLDKSLMPNIFADHHHWHSSTIDSIKAAVPS  64

Query  214  ------SNRGLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFL  375
                  S   LVY+Y N  HGFSAVLS  EL+A+KKSPG++ + KD +V+  T+HT  FL
Sbjct  65   SVDRFHSAPKLVYSYDNVFHGFSAVLSKDELQALKKSPGFVSAYKDRTVEPQTTHTSDFL  124

Query  376  GLSSDHGAWPATDYGRDVIIGVIDT  450
             L+   G WPA+  G+DVIIGV+D+
Sbjct  125  KLNPSSGLWPASGLGQDVIIGVLDS  149



>ref|XP_004514928.1| PREDICTED: subtilisin-like protease-like [Cicer arietinum]
Length=712

 Score =   119 bits (298),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 58/114 (51%), Positives = 79/114 (69%), Gaps = 11/114 (10%)
 Frame = +1

Query  142  MDLSFMPRAFTSHQSWFSATLSSI-----------SNRGLVYAYTNAIHGFSAVLSPAEL  288
            MDLS MP+AFT+  SW+ +TLS +           ++  ++Y YTN I+GFSA LSP E 
Sbjct  1    MDLSAMPKAFTNQHSWYHSTLSQVISTTNNNILKSTSSKIIYTYTNVINGFSANLSPEEH  60

Query  289  EAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDT  450
            EA+KKSPGY+ S  D  V +DT+H+P FLGL+   GAW  ++YG+DVIIG++DT
Sbjct  61   EALKKSPGYISSMPDLPVTLDTTHSPEFLGLNPYKGAWHDSNYGKDVIIGMVDT  114



>ref|XP_011074394.1| PREDICTED: subtilisin-like protease [Sesamum indicum]
Length=761

 Score =   119 bits (297),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 58/126 (46%), Positives = 82/126 (65%), Gaps = 12/126 (10%)
 Frame = +1

Query  109  IDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISNR------------GLVYAYTNAI  252
            +  +   YIVHMD S MP+AF+SH  W+S+ L S+ +              L+Y Y NA 
Sbjct  20   VSAERSVYIVHMDKSSMPKAFSSHHYWYSSMLKSVKSEPQASFNSLKAEPKLIYTYDNAF  79

Query  253  HGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVI  432
            HGFSA++S AELEA+KKSPG++ +  D  +  DT+H+  FL L++  G WPA+ YG+DVI
Sbjct  80   HGFSALVSKAELEALKKSPGFISAYSDHILTPDTTHSYKFLSLNTATGLWPASKYGKDVI  139

Query  433  IGVIDT  450
            IGV+D+
Sbjct  140  IGVVDS  145



>ref|XP_002284869.3| PREDICTED: subtilisin-like protease [Vitis vinifera]
Length=778

 Score =   119 bits (297),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 64/147 (44%), Positives = 92/147 (63%), Gaps = 14/147 (10%)
 Frame = +1

Query  49   HRALFFHLAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSI-----  213
            HR     LA+I  T L   S  G+  TYI+HMD S MP+AF +H  W+++T+ S+     
Sbjct  23   HRLYLIFLAWILFT-LHFRSASGERSTYIIHMDKSLMPKAFATHHHWYASTVDSLMTAAS  81

Query  214  -------SNRGLVYAYTNAIHGFSAVLSPAELEAIKKS-PGYLYSTKDASVKVDTSHTPG  369
                   S   L+Y Y + +HGFSAVLS  ELE +++S  G++ +  D++V +DT+HT  
Sbjct  82   TTSIAVQSTPKLIYIYDHVLHGFSAVLSKGELEKLRRSTAGFVSAYSDSTVTLDTTHTLE  141

Query  370  FLGLSSDHGAWPATDYGRDVIIGVIDT  450
            FL L+   G WPA+D+G+DVI+GVIDT
Sbjct  142  FLKLNQISGLWPASDFGKDVIVGVIDT  168



>emb|CAN60787.1| hypothetical protein VITISV_034533 [Vitis vinifera]
Length=763

 Score =   119 bits (297),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 64/147 (44%), Positives = 92/147 (63%), Gaps = 14/147 (10%)
 Frame = +1

Query  49   HRALFFHLAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSI-----  213
            HR     LA+I  T L   S  G+  TYI+HMD S MP+AF +H  W+++T+ S+     
Sbjct  8    HRLYLIFLAWILFT-LHFRSASGERSTYIIHMDKSLMPKAFATHHHWYASTVDSLMTAAS  66

Query  214  -------SNRGLVYAYTNAIHGFSAVLSPAELEAIKKS-PGYLYSTKDASVKVDTSHTPG  369
                   S   L+Y Y + +HGFSAVLS  ELE +++S  G++ +  D++V +DT+HT  
Sbjct  67   TTSIAVQSTPKLIYIYDHVLHGFSAVLSKGELEKLRRSTAGFVSAYSDSTVTLDTTHTLE  126

Query  370  FLGLSSDHGAWPATDYGRDVIIGVIDT  450
            FL L+   G WPA+D+G+DVI+GVIDT
Sbjct  127  FLKLNQISGLWPASDFGKDVIVGVIDT  153



>ref|XP_008370910.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=651

 Score =   118 bits (295),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 59/120 (49%), Positives = 78/120 (65%), Gaps = 12/120 (10%)
 Frame = +1

Query  127  TYIVHMDLSFMPRAFTSHQSWFSATLSSISNR------------GLVYAYTNAIHGFSAV  270
            TYIVHMD S MP+++TSH  W+S+ + S  +              ++Y Y NA HGFSAV
Sbjct  34   TYIVHMDKSLMPKSYTSHDHWYSSIVDSFKSEYPTSFDGNKILPSILYTYDNAFHGFSAV  93

Query  271  LSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDT  450
            LS  EL  +KKSPG++ +  D S+ +DT+HT  FL L+   G WPA+DYG D+IIGVIDT
Sbjct  94   LSADELVTLKKSPGFVSAYADKSITLDTTHTTQFLNLNPFAGLWPASDYGDDLIIGVIDT  153



>gb|KDP41714.1| hypothetical protein JCGZ_16121 [Jatropha curcas]
Length=724

 Score =   118 bits (295),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 58/106 (55%), Positives = 78/106 (74%), Gaps = 8/106 (8%)
 Frame = +1

Query  157  MPRAFTSHQSWFSATLSSI--------SNRGLVYAYTNAIHGFSAVLSPAELEAIKKSPG  312
            MP+AF++  SW  ATLSS+        SN  L+Y+YT+ ++GFSA LS +ELEA+K SPG
Sbjct  1    MPKAFSTQHSWHLATLSSVFADSKAASSNSKLLYSYTHVMNGFSAHLSSSELEALKNSPG  60

Query  313  YLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDT  450
            Y+ STKD  VK DT+ +P FLGL+S+ GAW  ++YG D+IIGV+DT
Sbjct  61   YISSTKDRPVKPDTTRSPTFLGLTSNSGAWKVSNYGEDIIIGVVDT  106



>ref|XP_009342993.1| PREDICTED: subtilisin-like protease [Pyrus x bretschneideri]
Length=764

 Score =   118 bits (295),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 58/120 (48%), Positives = 78/120 (65%), Gaps = 12/120 (10%)
 Frame = +1

Query  127  TYIVHMDLSFMPRAFTSHQSWFSATLSSISNRG------------LVYAYTNAIHGFSAV  270
            TYIVHMD S MP++++SH  W+S+ + S  +              ++Y Y  A HGFSAV
Sbjct  34   TYIVHMDKSLMPKSYSSHDHWYSSIVDSFKSENPTSFDGNKILPSILYTYDTAFHGFSAV  93

Query  271  LSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDT  450
            LSP EL  +KKSPG++ +  D S+ +DT+HT  FL L+   G WPA+DYG D+IIGVIDT
Sbjct  94   LSPDELVTLKKSPGFVSAYADKSITLDTTHTTQFLNLNPFAGLWPASDYGDDIIIGVIDT  153



>ref|XP_009337959.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease [Pyrus 
x bretschneideri]
Length=798

 Score =   118 bits (296),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 58/120 (48%), Positives = 78/120 (65%), Gaps = 12/120 (10%)
 Frame = +1

Query  127  TYIVHMDLSFMPRAFTSHQSWFSATLSSISNRG------------LVYAYTNAIHGFSAV  270
            TYIVHMD S MP++++SH  W+S+ + S  +              ++Y Y  A HGFSAV
Sbjct  68   TYIVHMDKSLMPKSYSSHDHWYSSIVDSFKSENPTSFDGNKILPSILYTYDTAFHGFSAV  127

Query  271  LSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDT  450
            LSP EL  +KKSPG++ +  D S+ +DT+HT  FL L+   G WPA+DYG D+IIGVIDT
Sbjct  128  LSPDELVTLKKSPGFVSAYADKSITLDTTHTTQFLNLNPFAGLWPASDYGDDIIIGVIDT  187



>ref|XP_011074393.1| PREDICTED: subtilisin-like protease [Sesamum indicum]
Length=767

 Score =   118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 59/123 (48%), Positives = 81/123 (66%), Gaps = 12/123 (10%)
 Frame = +1

Query  118  QSETYIVHMDLSFMPRAFTSHQSWFSATLSSI------------SNRGLVYAYTNAIHGF  261
            +   YIVH D S MP+AF+SH  W+S+ L S+            S   ++Y Y NA HGF
Sbjct  27   ERSVYIVHTDKSSMPKAFSSHTYWYSSMLKSLKSVAQTSLEGQNSEPKIIYTYDNAFHGF  86

Query  262  SAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGV  441
            SAV++ AEL+A+KKSPG++ +  D  V  DT+H+  FL L++  G WPA++YG+DVIIGV
Sbjct  87   SAVMTKAELQALKKSPGFISAYADDVVTPDTTHSYKFLSLNTATGLWPASNYGKDVIIGV  146

Query  442  IDT  450
            IDT
Sbjct  147  IDT  149



>emb|CDP01315.1| unnamed protein product [Coffea canephora]
Length=764

 Score =   118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 60/141 (43%), Positives = 88/141 (62%), Gaps = 12/141 (9%)
 Frame = +1

Query  55   ALFFHLAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISNRG---  225
            +  F + F+S++   I     +   YIVH+D S MP+ F SH  W+++ + SI N G   
Sbjct  8    SFLFLVWFLSSS--HILGALAERSIYIVHIDKSLMPKVFASHIYWYTSMIDSIGNVGQTS  65

Query  226  -------LVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLS  384
                   ++Y Y  A HGFSA++S   L+A+KKSPG++ +  D S  +DT+HTP FL L+
Sbjct  66   DHGFAPKILYTYDAAFHGFSALMSKDHLQALKKSPGFVSAHPDRSPTIDTTHTPDFLSLN  125

Query  385  SDHGAWPATDYGRDVIIGVID  447
            +  G WPA+DYG+DVIIGV+D
Sbjct  126  TATGLWPASDYGKDVIIGVVD  146



>ref|XP_003590866.1| Subtilisin-like protease [Medicago truncatula]
Length=752

 Score =   118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 59/129 (46%), Positives = 83/129 (64%), Gaps = 9/129 (7%)
 Frame = +1

Query  91   FLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSIS---------NRGLVYAYT  243
             L + + D  S TYIVHMD S MP+ FTSH +W+ +TL S +         ++ LVY Y 
Sbjct  21   LLPLHAKDETSSTYIVHMDKSLMPQVFTSHHNWYESTLHSTTTQSDDHVHPSKKLVYTYN  80

Query  244  NAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGR  423
            +A+HGFSAVLSP EL+ +KKS G++ +  D +  +DT+HT  FL L    G W A++ G 
Sbjct  81   HAMHGFSAVLSPKELDNLKKSHGFVTAYPDRTATIDTTHTFEFLSLDPSKGLWNASNLGE  140

Query  424  DVIIGVIDT  450
            +VI+GVID+
Sbjct  141  NVIVGVIDS  149



>gb|AES61117.2| subtilisin-like serine protease [Medicago truncatula]
Length=766

 Score =   118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 59/129 (46%), Positives = 83/129 (64%), Gaps = 9/129 (7%)
 Frame = +1

Query  91   FLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSIS---------NRGLVYAYT  243
             L + + D  S TYIVHMD S MP+ FTSH +W+ +TL S +         ++ LVY Y 
Sbjct  21   LLPLHAKDETSSTYIVHMDKSLMPQVFTSHHNWYESTLHSTTTQSDDHVHPSKKLVYTYN  80

Query  244  NAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGR  423
            +A+HGFSAVLSP EL+ +KKS G++ +  D +  +DT+HT  FL L    G W A++ G 
Sbjct  81   HAMHGFSAVLSPKELDNLKKSHGFVTAYPDRTATIDTTHTFEFLSLDPSKGLWNASNLGE  140

Query  424  DVIIGVIDT  450
            +VI+GVID+
Sbjct  141  NVIVGVIDS  149



>gb|EYU36337.1| hypothetical protein MIMGU_mgv1a020902mg, partial [Erythranthe 
guttata]
Length=734

 Score =   117 bits (294),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 61/116 (53%), Positives = 77/116 (66%), Gaps = 5/116 (4%)
 Frame = +1

Query  118  QSETYIVHMDLSFMPRAFTSHQSWFSATLS-----SISNRGLVYAYTNAIHGFSAVLSPA  282
            +  TYIVHMD S MP+AF+SH  W+S+ LS           L+Y Y NA HGFSAVLS  
Sbjct  1    KRSTYIVHMDKSSMPKAFSSHHHWYSSMLSFGKPLDEPESKLIYTYDNAFHGFSAVLSED  60

Query  283  ELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDT  450
            ELEA+KKSPG++ S  D  +   T+ +  FL L+S  G WPA++ G+DVIIGVIDT
Sbjct  61   ELEALKKSPGFISSYADDVITTHTTRSTQFLSLNSATGLWPASNSGKDVIIGVIDT  116



>gb|KJB43733.1| hypothetical protein B456_007G214100 [Gossypium raimondii]
Length=758

 Score =   117 bits (294),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 66/138 (48%), Positives = 91/138 (66%), Gaps = 16/138 (12%)
 Frame = +1

Query  85   ATFLQIFSI----DGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISNRGL--------  228
            +T L I SI      + +TYI+HMD S MP+AF+SH SW+ + LSSIS+           
Sbjct  8    STVLFIVSIHPFTRAKPDTYIIHMDPSAMPKAFSSHHSWYFSMLSSISDTSEAASASSTV  67

Query  229  ----VYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHG  396
                +Y YT++I+GFSA L+ +ELE++KKS GYL  T+D  + V T+HT  FLGL+S  G
Sbjct  68   TSKHLYTYTHSINGFSATLTLSELESLKKSFGYLSFTRDRPLTVHTTHTSQFLGLNSVSG  127

Query  397  AWPATDYGRDVIIGVIDT  450
            AW A +YG DVIIG++D+
Sbjct  128  AWTAPNYGEDVIIGIVDS  145



>ref|XP_003553772.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=763

 Score =   117 bits (294),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/121 (43%), Positives = 83/121 (69%), Gaps = 1/121 (1%)
 Frame = +1

Query  91   FLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATL-SSISNRGLVYAYTNAIHGFSA  267
            FL +  +     TYIVHMD S MP+ FTS+ +W+S+TL  S +   ++Y+Y NA+HGFS 
Sbjct  20   FLPVLCLCNSKATYIVHMDKSHMPKVFTSYHNWYSSTLIDSAATPSILYSYDNALHGFSV  79

Query  268  VLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVID  447
             LS  +LE +K++PG++ + +D    +DT+ +  FL L+  HG WPA++Y ++V++GVID
Sbjct  80   SLSQEQLETLKQTPGFISAYRDRETTLDTTQSYTFLSLNHSHGLWPASNYAQNVVVGVID  139

Query  448  T  450
            +
Sbjct  140  S  140



>ref|XP_009338017.1| PREDICTED: subtilisin-like protease [Pyrus x bretschneideri]
Length=764

 Score =   117 bits (293),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 63/143 (44%), Positives = 83/143 (58%), Gaps = 12/143 (8%)
 Frame = +1

Query  58   LFFHLAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISNRG----  225
              F L  +    LQ+        TYIVHMD S MP+++TSH  W+S+ + S  +      
Sbjct  11   FIFSLVALFLLALQVNVSFADRSTYIVHMDKSLMPKSYTSHDHWYSSIVDSFKSENPTSF  70

Query  226  --------LVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGL  381
                    ++Y Y NA HGFSAVLS  EL  +KKSPG++ +  D S+  DT+HT  FL L
Sbjct  71   DGNKIWPSILYTYDNAFHGFSAVLSADELVTLKKSPGFVSAYADKSITPDTTHTTQFLNL  130

Query  382  SSDHGAWPATDYGRDVIIGVIDT  450
            +   G WPA+DYG D+IIGVIDT
Sbjct  131  NPFAGLWPASDYGDDIIIGVIDT  153



>ref|XP_011029640.1| PREDICTED: subtilisin-like protease [Populus euphratica]
Length=779

 Score =   117 bits (292),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 63/156 (40%), Positives = 92/156 (59%), Gaps = 19/156 (12%)
 Frame = +1

Query  40   MANHRA-LFFHLAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSI-  213
            MA  R  L + L     T L       Q++ YIVHMDLS MP+ F+    W+ +TL+S+ 
Sbjct  1    MATRREFLLYKLWICLITVLHFTGTLSQTDNYIVHMDLSAMPKPFSDQHHWYLSTLASVF  60

Query  214  -----------------SNRGLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASV  342
                             ++  L+Y+YT+ ++GFSA L+P+ELEA+KKSPGY+ S KD  V
Sbjct  61   DVSDSSTARASPATYLTTSSELLYSYTHVLNGFSASLTPSELEALKKSPGYISSIKDLPV  120

Query  343  KVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDT  450
            K DT+H+  FLGL+    AW A++ G  +IIG++D+
Sbjct  121  KHDTTHSTKFLGLAPQSPAWKASNLGDGIIIGLVDS  156



>ref|XP_009419397.1| PREDICTED: subtilisin-like protease [Musa acuminata subsp. malaccensis]
Length=761

 Score =   116 bits (291),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 62/117 (53%), Positives = 84/117 (72%), Gaps = 8/117 (7%)
 Frame = +1

Query  124  ETYIVHMDLSFMPRAFTSHQSWFSATLSSI--------SNRGLVYAYTNAIHGFSAVLSP  279
            +TYIVHMD + MP AF+  +SW++ATL++         ++  +VY Y +AIHGFSA LS 
Sbjct  31   DTYIVHMDSAAMPSAFSGRRSWYAATLAATADASDAIPADEKIVYVYDHAIHGFSARLSS  90

Query  280  AELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDT  450
            A+LE +KKS G+L  ++DA VK DT+HT  FL LS+  G WPA++YG DVIIGV+DT
Sbjct  91   AQLEQLKKSHGFLSCSRDAPVKKDTTHTSDFLELSASAGLWPASNYGDDVIIGVLDT  147



>ref|XP_008444560.1| PREDICTED: subtilisin-like protease [Cucumis melo]
Length=764

 Score =   116 bits (291),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 60/128 (47%), Positives = 82/128 (64%), Gaps = 17/128 (13%)
 Frame = +1

Query  118  QSETYIVHMDLSFMPRAFTSHQSWFSATLSSISNR-----------------GLVYAYTN  246
            ++  YIVHM+ + MP+ F S  SW+SAT+SS+ +                   L++ Y +
Sbjct  23   ETHNYIVHMNSAAMPKPFASRHSWYSATISSVLHSSSSSSSSSSSSSSSFPSKLIHTYNH  82

Query  247  AIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRD  426
            AI GF A L+P++LEA+K SPGYL S  D+SV VDT+H+  FLGLSS+HG  P + YG D
Sbjct  83   AISGFCASLTPSQLEALKNSPGYLSSVLDSSVHVDTTHSSHFLGLSSNHGLLPISKYGSD  142

Query  427  VIIGVIDT  450
            VIIG +DT
Sbjct  143  VIIGFVDT  150



>ref|XP_007139763.1| hypothetical protein PHAVU_008G057000g [Phaseolus vulgaris]
 gb|ESW11757.1| hypothetical protein PHAVU_008G057000g [Phaseolus vulgaris]
Length=739

 Score =   116 bits (291),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 59/122 (48%), Positives = 81/122 (66%), Gaps = 11/122 (9%)
 Frame = +1

Query  118  QSETYIVHMDLSFMPRAFTSHQSWFSATLSSISNRGL-----------VYAYTNAIHGFS  264
            +S TYI+HMD S  P  FT+H  WF +T+ SI +  L           VY+Y +A++GFS
Sbjct  29   ESSTYIIHMDRSLFPTVFTTHHDWFESTVHSIKSATLGHSFKQSQNLTVYSYNHAMYGFS  88

Query  265  AVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVI  444
            AVLS  ELEA+K SPG++ +  D +V +DT+HT  FL L+S  G W A+++G DVI+GVI
Sbjct  89   AVLSSEELEAVKNSPGFVAAYPDRNVTIDTTHTFEFLSLASSSGLWHASNFGEDVIVGVI  148

Query  445  DT  450
            DT
Sbjct  149  DT  150



>ref|XP_008218400.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=766

 Score =   116 bits (291),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 57/123 (46%), Positives = 78/123 (63%), Gaps = 12/123 (10%)
 Frame = +1

Query  118  QSETYIVHMDLSFMPRAFTSHQSWFSATLSSISNR------------GLVYAYTNAIHGF  261
            +  T+IVHMD S MP+++ SHQ W+S+ + S   +             L+Y Y NA HGF
Sbjct  33   ERSTHIVHMDKSLMPKSYASHQHWYSSIVDSFKAQIPTSSDGHKISPSLLYTYDNAFHGF  92

Query  262  SAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGV  441
            SAVLS  ELE +K S G++ +  D S+ +DT+HT  FL L+   G WPA++YG D+IIGV
Sbjct  93   SAVLSAEELETLKNSAGFVSAYSDKSITLDTTHTTQFLSLNPSTGLWPASNYGEDIIIGV  152

Query  442  IDT  450
            IDT
Sbjct  153  IDT  155



>gb|KDO84130.1| hypothetical protein CISIN_1g004809mg [Citrus sinensis]
Length=729

 Score =   116 bits (291),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 57/117 (49%), Positives = 77/117 (66%), Gaps = 14/117 (12%)
 Frame = +1

Query  142  MDLSFMPRAFTSHQSWFSATLSS--------------ISNRGLVYAYTNAIHGFSAVLSP  279
            MDLS MP+AF     W+SATL S              IS+  L+Y Y++ ++GFSA L+P
Sbjct  1    MDLSAMPKAFRGQHGWYSATLQSVSGNVEANTNIFNNISSSKLLYTYSHVLNGFSASLTP  60

Query  280  AELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDT  450
            AELEA+K SPGY+ S +D  VK  T+H+  FLGL+   GAWP + +G+D+IIGV+DT
Sbjct  61   AELEALKSSPGYISSIRDLPVKPHTTHSSQFLGLNPKSGAWPVSKFGKDIIIGVVDT  117



>gb|KHN15887.1| Subtilisin-like protease [Glycine soja]
Length=716

 Score =   116 bits (290),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 53/111 (48%), Positives = 77/111 (69%), Gaps = 13/111 (12%)
 Frame = +1

Query  157  MPRAFTSHQSWFSATLSS-------------ISNRGLVYAYTNAIHGFSAVLSPAELEAI  297
            MP+ F++  SW+ +TLSS             +S+  L+Y YTNAI+GFSA LSP ELE++
Sbjct  1    MPKTFSTQHSWYLSTLSSALDNSKATNNLNSVSSSKLIYTYTNAINGFSANLSPKELESL  60

Query  298  KKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDT  450
            K SPGY+   +D   K DT+H+P FLGL+ + GAWP +++G+DVI+G++DT
Sbjct  61   KTSPGYVSYMRDLPAKRDTTHSPQFLGLNPNEGAWPVSEFGKDVIVGLVDT  111



>ref|XP_006434738.1| hypothetical protein CICLE_v10000411mg [Citrus clementina]
 gb|ESR47978.1| hypothetical protein CICLE_v10000411mg [Citrus clementina]
Length=729

 Score =   116 bits (290),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 57/117 (49%), Positives = 77/117 (66%), Gaps = 14/117 (12%)
 Frame = +1

Query  142  MDLSFMPRAFTSHQSWFSATLSS--------------ISNRGLVYAYTNAIHGFSAVLSP  279
            MDLS MP+AF     W+SATL S              IS+  L+Y Y++ ++GFSA L+P
Sbjct  1    MDLSAMPKAFRGQHGWYSATLQSVSGNVEANTNIFNNISSSKLLYTYSHVLNGFSASLTP  60

Query  280  AELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDT  450
            AELEA+K SPGY+ S +D  VK  T+H+  FLGL+   GAWP + +G+D+IIGV+DT
Sbjct  61   AELEALKSSPGYISSIRDLPVKPHTTHSSQFLGLNPKSGAWPVSKFGKDIIIGVVDT  117



>ref|XP_004143027.1| PREDICTED: subtilisin-like protease-like [Cucumis sativus]
 gb|KGN62450.1| hypothetical protein Csa_2G354760 [Cucumis sativus]
Length=757

 Score =   116 bits (290),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 65/141 (46%), Positives = 90/141 (64%), Gaps = 12/141 (9%)
 Frame = +1

Query  58   LFFHLAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISNR-----  222
            L+F  + I   +L    I  ++  YIVHM+ + MP+ F S  SW+SAT+SS+ +      
Sbjct  5    LYFWFSLIPIFWL--CPILTETRNYIVHMNSAAMPKPFASRHSWYSATISSLLHSSSSSS  62

Query  223  -----GLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSS  387
                  L++ Y +AI GF A L+P++LEA+K SPGYL S  D+SV VDT+H+  FLGLSS
Sbjct  63   SSFPSKLIHTYNHAISGFCASLTPSQLEALKNSPGYLSSVLDSSVHVDTTHSSHFLGLSS  122

Query  388  DHGAWPATDYGRDVIIGVIDT  450
            +HG  P + YG DVIIG +DT
Sbjct  123  NHGLLPISKYGSDVIIGFVDT  143



>ref|XP_004156411.1| PREDICTED: subtilisin-like protease-like [Cucumis sativus]
Length=757

 Score =   116 bits (290),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 65/141 (46%), Positives = 90/141 (64%), Gaps = 12/141 (9%)
 Frame = +1

Query  58   LFFHLAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISNR-----  222
            L+F  + I   +L    I  ++  YIVHM+ + MP+ F S  SW+SAT+SS+ +      
Sbjct  5    LYFWFSLIPIFWL--CPILTETRNYIVHMNSAAMPKPFASRHSWYSATISSLLHSSSSSS  62

Query  223  -----GLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSS  387
                  L++ Y +AI GF A L+P++LEA+K SPGYL S  D+SV VDT+H+  FLGLSS
Sbjct  63   SSFPSKLIHTYNHAISGFCASLTPSQLEALKNSPGYLSSVLDSSVHVDTTHSSHFLGLSS  122

Query  388  DHGAWPATDYGRDVIIGVIDT  450
            +HG  P + YG DVIIG +DT
Sbjct  123  NHGLLPISKYGSDVIIGFVDT  143



>ref|XP_009608286.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=765

 Score =   116 bits (290),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 58/129 (45%), Positives = 82/129 (64%), Gaps = 12/129 (9%)
 Frame = +1

Query  100  IFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISNR------------GLVYAYT  243
            +     +  TYIVH+D S MP+ F SH++W S+ +++I                +VY+Y 
Sbjct  19   LLGTSAKRSTYIVHLDKSVMPKIFASHENWHSSIINNIKIEVPTTPNDHHPVPKIVYSYD  78

Query  244  NAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGR  423
            N IHGFSAVLS  EL A+KKSPG+L + KD +V+  T+HT  FL L+   G WPA+ +G+
Sbjct  79   NVIHGFSAVLSKDELVALKKSPGFLSAYKDRTVEAHTTHTSEFLKLNPASGMWPASGFGQ  138

Query  424  DVIIGVIDT  450
            DVIIGV+D+
Sbjct  139  DVIIGVLDS  147



>emb|CAA07059.1| SBT4B protein [Solanum lycopersicum]
Length=777

 Score =   116 bits (290),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 64/141 (45%), Positives = 82/141 (58%), Gaps = 13/141 (9%)
 Frame = +1

Query  61   FFHLAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSI---------  213
            F HL F+S       +I  Q  TYIVH+D S MP  FT H  W S+T+ SI         
Sbjct  10   FLHLLFLSTHMFCFLTI-AQRSTYIVHLDKSLMPNVFTDHHHWHSSTIDSIKASVPSSVD  68

Query  214  ---SNRGLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLS  384
               S   LVY+Y N  HGFSAVLS  EL A+KK PG++ + +D +V+  T+HT  FL L+
Sbjct  69   RFHSAPKLVYSYDNVFHGFSAVLSQNELAALKKLPGFVSAYEDRTVEPHTTHTSDFLKLN  128

Query  385  SDHGAWPATDYGRDVIIGVID  447
               G WPA+  G+DVII V+D
Sbjct  129  PSSGLWPASGLGQDVIIAVLD  149



>ref|XP_004229665.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=776

 Score =   115 bits (289),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 65/141 (46%), Positives = 83/141 (59%), Gaps = 13/141 (9%)
 Frame = +1

Query  64   FHLAFIS-ATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSI---------  213
             HL  +S A F  +F    Q  TYIVH+D SFMP  F  H  W S+TL SI         
Sbjct  12   LHLVLLSWAFFAHLFLALAQRSTYIVHLDKSFMPNVFAHHHHWHSSTLDSIKAVVPSSVD  71

Query  214  ---SNRGLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLS  384
               S   LVY+Y N  HGFSA+LS  EL A++KSPG++ + KD +V+  T+HT  FL L+
Sbjct  72   RFHSAPKLVYSYDNVFHGFSAILSKHELAALRKSPGFISAYKDRTVEPHTTHTSDFLKLT  131

Query  385  SDHGAWPATDYGRDVIIGVID  447
               G W A+  G+DVIIGV+D
Sbjct  132  PSSGLWQASGLGQDVIIGVLD  152



>ref|XP_010446286.1| PREDICTED: subtilisin-like protease [Camelina sativa]
Length=504

 Score =   114 bits (284),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 55/114 (48%), Positives = 81/114 (71%), Gaps = 3/114 (3%)
 Frame = +1

Query  118  QSETYIVHMDLSFMPRAFTSHQSWFSATLSS-ISNRG--LVYAYTNAIHGFSAVLSPAEL  288
            ++ TYI+HMDLS  P  F+ HQSWFS TL+S I++R   ++YAYT+++HGFSAVL+ +EL
Sbjct  22   ETSTYIIHMDLSAKPLPFSDHQSWFSTTLTSVITDRKPKIIYAYTDSVHGFSAVLTNSEL  81

Query  289  EAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDT  450
            + +K  PG +  TKD  VK+ T+ +P F+ L+   G WP ++ G   +IG+IDT
Sbjct  82   QRLKHKPGNVSFTKDLPVKLHTTFSPQFIDLNLTSGTWPVSNCGAGTVIGIIDT  135



>ref|XP_006339058.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=765

 Score =   115 bits (289),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 61/143 (43%), Positives = 84/143 (59%), Gaps = 14/143 (10%)
 Frame = +1

Query  58   LFFHLAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISNRG----  225
            L F       + L       +  TYIVH+D SFMP+ F +HQ+W S+ + +I        
Sbjct  7    LLFSWCLFGPSLL--LGTSAERSTYIVHLDKSFMPKIFATHQNWHSSIIDTIKIEAPTTQ  64

Query  226  --------LVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGL  381
                    L+Y+Y N IHGFSAVLS  ELE ++KS G+L + KD SV+  T+HT  FL L
Sbjct  65   NGHHPVPKLLYSYDNVIHGFSAVLSKHELELLEKSAGFLSAYKDRSVEAHTTHTSEFLKL  124

Query  382  SSDHGAWPATDYGRDVIIGVIDT  450
            +   G WPA+ +G+DVIIGV+D+
Sbjct  125  NPASGLWPASGFGQDVIIGVLDS  147



>ref|XP_002277899.1| PREDICTED: subtilisin-like protease [Vitis vinifera]
Length=769

 Score =   115 bits (289),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 62/127 (49%), Positives = 84/127 (66%), Gaps = 15/127 (12%)
 Frame = +1

Query  115  GQS-ETYIVHMDLSFMPRAFTSHQSWFSATLSSISNRG--------------LVYAYTNA  249
            GQS +TYIVHMD S MP+ F+ H  W+S+ LSS+S+                L+Y Y+N+
Sbjct  28   GQSADTYIVHMDSSAMPKPFSGHHGWYSSMLSSVSDASTPTGAAVTPSTTAKLIYTYSNS  87

Query  250  IHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDV  429
            I+GFSA L+ +ELEA+KKSPGYL ST D  V+  T+ +  FLGL    GAW A++YG  V
Sbjct  88   INGFSASLTLSELEALKKSPGYLSSTPDQFVQPHTTRSHEFLGLRRGSGAWTASNYGNGV  147

Query  430  IIGVIDT  450
            IIG++D+
Sbjct  148  IIGLVDS  154



>ref|XP_003566210.2| PREDICTED: subtilisin-like protease [Brachypodium distachyon]
Length=754

 Score =   115 bits (288),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 56/110 (51%), Positives = 78/110 (71%), Gaps = 3/110 (3%)
 Frame = +1

Query  130  YIVHMDLSFMPRAFTSHQSWFSATLS-SISNRGLVYAYTNAIHGFSAVLSPAELEAIKKS  306
            YIVHMD S MPRAF+SH SW+ +TL+ +     + Y Y +A+HGF+A L   +LE +++S
Sbjct  32   YIVHMDKSAMPRAFSSHLSWYESTLAVAAPGADMFYVYDHAMHGFAARLPAEDLEKLRRS  91

Query  307  PGYLYSTKDASVKV--DTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDT  450
            PG++ S +D +  V  DT+HTP FLG+S+  G W AT YG DVI+GV+DT
Sbjct  92   PGFVSSYRDDATAVTRDTTHTPEFLGVSAPGGVWEATQYGEDVIVGVVDT  141



>gb|KHN40450.1| Subtilisin-like protease [Glycine soja]
Length=765

 Score =   115 bits (287),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 61/140 (44%), Positives = 86/140 (61%), Gaps = 10/140 (7%)
 Frame = +1

Query  61   FFHLAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISN-------  219
            F  +  I+  FL       ++ TYIVHMD S  P  FT+H  WF +T+ SI +       
Sbjct  12   FPFMLLITHWFLLALHGSAETSTYIVHMDKSLFPHVFTTHHDWFESTIDSIKSAKLGHSS  71

Query  220  ---RGLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSD  390
               + LVY+Y +A++GFSAVL+  ELEA+K S G++ +  D +V +DT+HT  FL L S 
Sbjct  72   NQSQKLVYSYNHAMYGFSAVLTLEELEAVKNSHGFVAAYPDRNVTIDTTHTSEFLSLDSS  131

Query  391  HGAWPATDYGRDVIIGVIDT  450
             G W A+++G DVI+GVIDT
Sbjct  132  SGLWHASNFGEDVIVGVIDT  151



>ref|XP_003552427.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=764

 Score =   115 bits (287),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 61/140 (44%), Positives = 86/140 (61%), Gaps = 10/140 (7%)
 Frame = +1

Query  61   FFHLAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISN-------  219
            F  +  I+  FL       ++ TYIVHMD S  P  FT+H  WF +T+ SI +       
Sbjct  12   FPFMLLITHWFLLALHGSAETSTYIVHMDKSLFPHVFTTHHDWFESTIDSIKSAKLGHSS  71

Query  220  ---RGLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSD  390
               + LVY+Y +A++GFSAVL+  ELEA+K S G++ +  D +V +DT+HT  FL L S 
Sbjct  72   NQSQKLVYSYNHAMYGFSAVLTLEELEAVKNSHGFVAAYPDRNVTIDTTHTSEFLSLDSS  131

Query  391  HGAWPATDYGRDVIIGVIDT  450
             G W A+++G DVI+GVIDT
Sbjct  132  SGLWHASNFGEDVIVGVIDT  151



>gb|KHN06360.1| Subtilisin-like protease [Glycine soja]
Length=902

 Score =   115 bits (288),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 56/118 (47%), Positives = 78/118 (66%), Gaps = 15/118 (13%)
 Frame = +1

Query  142  MDLSFMPRAFTSHQSWFSATLSS------ISNR---------GLVYAYTNAIHGFSAVLS  276
            MD S MP+ F+S  +W+ +TLSS      ++N           L+Y Y N ++GFSA LS
Sbjct  1    MDTSSMPKPFSSKHNWYLSTLSSALENTHVTNNDNILNTASSKLIYTYANVMNGFSANLS  60

Query  277  PAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDT  450
            P ELEA+K SPGY+ ST D   K+DT+H+P FLGL+ + GAWPA+ +G DVI+G +D+
Sbjct  61   PKELEALKTSPGYISSTPDLQAKLDTTHSPQFLGLNPNKGAWPASKFGEDVIVGFVDS  118



>ref|XP_006345405.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=779

 Score =   114 bits (286),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 64/142 (45%), Positives = 85/142 (60%), Gaps = 16/142 (11%)
 Frame = +1

Query  58   LFFHLAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSI--------  213
            + F  A  +  FL I     Q  TYIVH+D S MP  FT H  W S+T+ SI        
Sbjct  15   VLFSWALSAHLFLAI----AQRSTYIVHLDKSLMPNVFTDHHHWHSSTIDSIKASVPSSV  70

Query  214  ----SNRGLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGL  381
                S   LVY+Y +  HGFSAVLS  EL+A+KKSPG++ + KD +V+ DT++T  +L L
Sbjct  71   DRFHSAPKLVYSYDHVFHGFSAVLSKDELKALKKSPGFISAYKDRTVEPDTTYTSDYLKL  130

Query  382  SSDHGAWPATDYGRDVIIGVID  447
            +   G WPA+  G+DVIIGV+D
Sbjct  131  NPSSGLWPASGLGQDVIIGVLD  152



>ref|XP_006345406.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=777

 Score =   114 bits (286),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 65/142 (46%), Positives = 83/142 (58%), Gaps = 16/142 (11%)
 Frame = +1

Query  58   LFFHLAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSI--------  213
            L    AF++  FL +     Q  TYIVH+D SFMP  F  H  W S+TL SI        
Sbjct  15   LLLPWAFLAHLFLAL----AQRSTYIVHLDKSFMPNVFAHHHHWHSSTLDSIKAVVPSSV  70

Query  214  ----SNRGLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGL  381
                S   LVY+Y N  HGFSAVLS  EL A++KSPG++ + KD +V+  T+HT  FL L
Sbjct  71   DRFHSAPKLVYSYDNVFHGFSAVLSKDELAALRKSPGFISAYKDRTVEPHTTHTSDFLKL  130

Query  382  SSDHGAWPATDYGRDVIIGVID  447
            +   G W A+  G+DVIIGV+D
Sbjct  131  TPSSGLWQASGLGQDVIIGVLD  152



>ref|XP_002510196.1| Cucumisin precursor, putative [Ricinus communis]
 gb|EEF52383.1| Cucumisin precursor, putative [Ricinus communis]
Length=777

 Score =   114 bits (286),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 67/158 (42%), Positives = 95/158 (60%), Gaps = 21/158 (13%)
 Frame = +1

Query  40   MANHRALFFH--LAFISATFLQ-IFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSS  210
            MA   ++ F+  L F ++TFL  + ++  + + YIV MD S MP+AF++H SW  ATLSS
Sbjct  1    MAKQYSIPFYERLFFATSTFLLFVPTLLAEKDNYIVRMDSSAMPKAFSAHHSWHLATLSS  60

Query  211  I------------------SNRGLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDA  336
            +                      L+Y+YT+ I GFSA LSPAE E +K S GY+ S KD 
Sbjct  61   VFEVSKSRSSVSTATTAAAKPSKLLYSYTHVIDGFSAHLSPAEHEILKNSTGYISSIKDL  120

Query  337  SVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDT  450
             VK DT+ +P +LGL+S+  AW  ++YG  +IIGVID+
Sbjct  121  PVKPDTTRSPSYLGLTSNSEAWKLSNYGESIIIGVIDS  158



>ref|NP_001234780.1| subtilisin-like protease [Solanum lycopersicum]
 emb|CAA06998.1| subtilisin-like protease [Solanum lycopersicum]
Length=779

 Score =   114 bits (286),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 63/143 (44%), Positives = 87/143 (61%), Gaps = 16/143 (11%)
 Frame = +1

Query  58   LFFHLAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSI--------  213
            + F  A  +  +L I     Q  TYIVH+D S MP  FT H  W S+T+ SI        
Sbjct  15   VLFSWALSAHLYLAI----AQRSTYIVHLDKSLMPNVFTDHHHWHSSTIDSIKASVPSSV  70

Query  214  ----SNRGLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGL  381
                S   LVY+Y +  HGFSAVLS  EL A+KKSPG++ + KD +V+ DT++T G+L L
Sbjct  71   DRFHSAPKLVYSYDHVFHGFSAVLSKDELAALKKSPGFISAYKDRTVEPDTTYTFGYLKL  130

Query  382  SSDHGAWPATDYGRDVIIGVIDT  450
            +  +G WPA+  G+D+IIGV+D+
Sbjct  131  NPSYGLWPASGLGQDMIIGVLDS  153



>ref|XP_008355893.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=764

 Score =   114 bits (285),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 57/120 (48%), Positives = 77/120 (64%), Gaps = 12/120 (10%)
 Frame = +1

Query  127  TYIVHMDLSFMPRAFTSHQSWFSATLSSISNRG------------LVYAYTNAIHGFSAV  270
            TYIVHMD S MP++++SH  W+ + + S  +              ++Y Y NA HGFSAV
Sbjct  34   TYIVHMDKSLMPKSYSSHGHWYXSIVDSFKSGNPTSFDGNKILPSILYTYDNAFHGFSAV  93

Query  271  LSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDT  450
            LS  EL  +KKSPG++ +  D S+ +DT+HT  FL L+   G WPA+DYG D+IIGVIDT
Sbjct  94   LSADELVTLKKSPGFISAYADKSITLDTTHTTQFLNLNPFAGLWPASDYGDDIIIGVIDT  153



>ref|XP_009771925.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=781

 Score =   114 bits (285),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 65/143 (45%), Positives = 84/143 (59%), Gaps = 13/143 (9%)
 Frame = +1

Query  58   LFFHLAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSI--------  213
            L F   F+SA      ++  Q  TYIVH+D S MP  F  H  W S+T+ SI        
Sbjct  13   LLFLSWFLSAHVFCFLAV-AQRSTYIVHLDKSLMPSIFADHHHWHSSTIDSIKAAVPSSV  71

Query  214  ----SNRGLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGL  381
                S   LVY+Y N  HGFSAVLS  ELEA+KK PG++ + KD +V+  T++T  FL L
Sbjct  72   DRFHSAPKLVYSYDNVFHGFSAVLSKDELEALKKLPGFVSAYKDTTVEPHTTYTSDFLKL  131

Query  382  SSDHGAWPATDYGRDVIIGVIDT  450
            +   G WPA+  G+DVIIGV+DT
Sbjct  132  NPSSGLWPASGLGQDVIIGVLDT  154



>ref|XP_004249505.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=765

 Score =   114 bits (285),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 61/143 (43%), Positives = 86/143 (60%), Gaps = 14/143 (10%)
 Frame = +1

Query  58   LFFHLAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISNRG----  225
            L F     S + L       +  TYIVH+D SFMP+ F +HQ+W S+ + +I        
Sbjct  7    LLFSWFLFSTSLL--LGTSAERSTYIVHLDKSFMPKIFATHQNWHSSIIDTIKIEAPTTQ  64

Query  226  --------LVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGL  381
                    L+Y+Y N IHGFSAVLS  EL++++KS G+L + KD SV+  T+HT  FL L
Sbjct  65   NDYHPLPKLLYSYDNVIHGFSAVLSKDELKSLEKSAGFLSAYKDRSVESHTTHTSEFLKL  124

Query  382  SSDHGAWPATDYGRDVIIGVIDT  450
            +   G WPA+ +G+DVIIGV+D+
Sbjct  125  NPASGLWPASGFGQDVIIGVLDS  147



>ref|XP_009621569.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=766

 Score =   114 bits (284),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 67/146 (46%), Positives = 87/146 (60%), Gaps = 17/146 (12%)
 Frame = +1

Query  61   FFHLAFISATFL--QIFSI--DGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSI-----  213
            +FHL F+S  FL   +F +    Q  TYIVH+D S MP  F  H  W S+T+ SI     
Sbjct  5    YFHLLFLS-WFLSAHVFCLLATAQRSTYIVHLDKSLMPNIFADHHHWHSSTIDSIKAAVP  63

Query  214  -------SNRGLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGF  372
                   S   LVY+Y    HGFSAVLS  ELEA+KK PG++ + KD +V+  T+HT  F
Sbjct  64   SSVDRFHSAPKLVYSYDYVFHGFSAVLSQDELEALKKLPGFVSAYKDRTVEPQTTHTSDF  123

Query  373  LGLSSDHGAWPATDYGRDVIIGVIDT  450
            L L+   G WPA+  G+DVIIGV+D+
Sbjct  124  LKLNPSSGLWPASGLGQDVIIGVLDS  149



>gb|ACA64703.1| subtilase [Nicotiana tabacum]
Length=766

 Score =   114 bits (284),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 67/146 (46%), Positives = 87/146 (60%), Gaps = 17/146 (12%)
 Frame = +1

Query  61   FFHLAFISATFL--QIFSI--DGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSI-----  213
            +FHL F+S  FL   +F +    Q  TYIVH+D S MP  F  H  W S+T+ SI     
Sbjct  5    YFHLLFLS-WFLSAHVFCLLATAQRSTYIVHLDKSLMPNIFADHHHWHSSTIDSIKAAVP  63

Query  214  -------SNRGLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGF  372
                   S   LVY+Y    HGFSAVLS  ELEA+KK PG++ + KD +V+  T+HT  F
Sbjct  64   SSVDRFHSAPKLVYSYDYVFHGFSAVLSQDELEALKKLPGFVSAYKDRTVEPQTTHTSDF  123

Query  373  LGLSSDHGAWPATDYGRDVIIGVIDT  450
            L L+   G WPA+  G+DVIIGV+D+
Sbjct  124  LKLNPSSGLWPASGLGQDVIIGVLDS  149



>ref|NP_001234774.1| subtilisin-like protease precursor [Solanum lycopersicum]
 emb|CAA06997.1| subtilisin-like protease [Solanum lycopersicum]
 emb|CAA07001.1| subtilisin-like protease [Solanum lycopersicum]
Length=761

 Score =   114 bits (284),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 63/143 (44%), Positives = 83/143 (58%), Gaps = 16/143 (11%)
 Frame = +1

Query  58   LFFHLAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSI--------  213
            L F  A  +  FL +     Q  TYIVH+D S MP  FT H  W S+T+ SI        
Sbjct  7    LLFSWALSAHLFLAL----AQRSTYIVHLDKSLMPNVFTDHHHWHSSTIDSIKASVPSSV  62

Query  214  ----SNRGLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGL  381
                S   LVY+Y N +HGFSAVLS  EL A+KK PG++ + KD +V+  T+HT  FL L
Sbjct  63   DRFHSAPKLVYSYDNVLHGFSAVLSKDELAALKKLPGFISAYKDRTVEPHTTHTSDFLKL  122

Query  382  SSDHGAWPATDYGRDVIIGVIDT  450
            +   G WPA+  G+DVI+ V+D+
Sbjct  123  NPSSGLWPASGLGQDVIVAVLDS  145



>ref|XP_006345401.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=761

 Score =   114 bits (284),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 64/143 (45%), Positives = 82/143 (57%), Gaps = 16/143 (11%)
 Frame = +1

Query  58   LFFHLAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSI--------  213
            L F  A  +  FL I     Q  TYIVH D S MP  FT H  W S+T+ SI        
Sbjct  7    LLFSWALSAHLFLAI----AQRSTYIVHFDKSLMPNVFTDHHHWHSSTIDSIKASVPSSV  62

Query  214  ----SNRGLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGL  381
                S   LVY+Y N +HGFSAVLS  EL A+KK PG++ + KD +V+  T+HT  FL L
Sbjct  63   DRFHSAPKLVYSYDNVLHGFSAVLSKDELAALKKLPGFISAYKDRTVEPHTTHTSDFLKL  122

Query  382  SSDHGAWPATDYGRDVIIGVIDT  450
            +   G WPA+  G+DVI+ V+D+
Sbjct  123  NPSSGLWPASGLGQDVIVAVLDS  145



>ref|XP_004496012.1| PREDICTED: subtilisin-like protease-like [Cicer arietinum]
Length=761

 Score =   113 bits (283),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 58/132 (44%), Positives = 82/132 (62%), Gaps = 5/132 (4%)
 Frame = +1

Query  70   LAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISN-----RGLVY  234
            L  I+   L       +S TYIVHMD S MP+ FT+HQ+W+ +TL S ++     + L+Y
Sbjct  14   LNIITPFVLLSLHAKAESSTYIVHMDKSLMPQVFTTHQNWYESTLQSTNSEVDQSKKLLY  73

Query  235  AYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATD  414
             Y +A+HGFSAVLS  +L  +KKS G++ +  D +  +DT+HT  FL L    G W A++
Sbjct  74   TYNHAMHGFSAVLSSNDLNTLKKSHGFVSAYPDRTATIDTTHTFEFLSLDPSKGLWNASN  133

Query  415  YGRDVIIGVIDT  450
             G  VI+GVIDT
Sbjct  134  LGEGVIVGVIDT  145



>ref|XP_011464023.1| PREDICTED: subtilisin-like protease [Fragaria vesca subsp. vesca]
Length=739

 Score =   113 bits (283),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 54/126 (43%), Positives = 85/126 (67%), Gaps = 2/126 (2%)
 Frame = +1

Query  79   ISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISN--RGLVYAYTNAI  252
            + A FL    +  +S +Y V+MD S  P  F+ H +W+ ATLSS+S     L++ YT AI
Sbjct  32   VIALFLLPIMVSPESHSYTVYMDPSLKPTPFSDHHTWYLATLSSLSQGETKLIHTYTEAI  91

Query  253  HGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVI  432
             GFSA+L+P+EL+A+  +PG +  +++  +K+ T+H+  FLGL+  +GAWP + YG +VI
Sbjct  92   QGFSAILTPSELQALPSTPGLVSYSRNRPLKLLTTHSSEFLGLTPKYGAWPISGYGENVI  151

Query  433  IGVIDT  450
            IG++DT
Sbjct  152  IGLLDT  157



>ref|XP_007047286.1| Subtilisin-like serine endopeptidase family protein [Theobroma 
cacao]
 gb|EOX91443.1| Subtilisin-like serine endopeptidase family protein [Theobroma 
cacao]
Length=767

 Score =   113 bits (283),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 61/123 (50%), Positives = 82/123 (67%), Gaps = 11/123 (9%)
 Frame = +1

Query  115  GQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISNRGL-----------VYAYTNAIHGF  261
             +S TYI+HMD S MP+AF+SH SW+ + LSSI +              +Y YT++I+GF
Sbjct  31   AKSGTYIIHMDSSAMPKAFSSHHSWYLSMLSSILDPSEAAAASTTISKHLYTYTDSINGF  90

Query  262  SAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGV  441
            SA L+ +ELEA+K S GY+  T+D  + V T+HT  FLGLSS  GAW A + G DVIIG+
Sbjct  91   SASLTSSELEALKNSFGYISFTRDLPLTVHTTHTSQFLGLSSVSGAWTAPNNGEDVIIGI  150

Query  442  IDT  450
            +DT
Sbjct  151  VDT  153



>ref|XP_008370912.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=764

 Score =   113 bits (282),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 57/120 (48%), Positives = 76/120 (63%), Gaps = 12/120 (10%)
 Frame = +1

Query  127  TYIVHMDLSFMPRAFTSHQSWFSATLSSISNRG------------LVYAYTNAIHGFSAV  270
            TYIVHMD S MP++++SH  W+ + + S  +              ++Y Y NA HGFSAV
Sbjct  34   TYIVHMDKSLMPKSYSSHGHWYXSIVDSFKSGNPTSFDGNKILPSILYTYDNAFHGFSAV  93

Query  271  LSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDT  450
            LS  EL  +KKSPG+  +  D S+ +DT+HT  FL L+   G WPA+DYG D+IIGVIDT
Sbjct  94   LSADELVTLKKSPGFXSAYADKSITLDTTHTTQFLNLNPFAGLWPASDYGDDIIIGVIDT  153



>gb|AAO62352.1| subtilase [Casuarina glauca]
Length=764

 Score =   113 bits (282),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 52/123 (42%), Positives = 78/123 (63%), Gaps = 12/123 (10%)
 Frame = +1

Query  118  QSETYIVHMDLSFMPRAFTSHQSWFSATLSSISNR------------GLVYAYTNAIHGF  261
            +  TYIVHMD S MP+AFTSH SW+ + + S+++               +Y Y + +HGF
Sbjct  31   EKSTYIVHMDKSHMPKAFTSHHSWYLSIIDSLNSERPTSTEELKSASSFLYTYNHVLHGF  90

Query  262  SAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGV  441
            S  L   ++E++K +PG++ + +D +  +DT+HTP FL LS   G WP ++YG DVIIGV
Sbjct  91   SVALCQEDVESLKNTPGFISAYQDRNATLDTTHTPEFLSLSPSWGLWPTSNYGEDVIIGV  150

Query  442  IDT  450
            ID+
Sbjct  151  IDS  153



>ref|XP_003535388.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=769

 Score =   113 bits (282),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 61/153 (40%), Positives = 90/153 (59%), Gaps = 16/153 (10%)
 Frame = +1

Query  40   MANHRALFFHLAFISATFLQI----FSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLS  207
            M  H  +   L F+   +L +     + + +S TYIVHMD S MP+ F SH  W+ +T+ 
Sbjct  1    MEPHFVVRLPLMFLITLWLSLSHHHANAETESSTYIVHMDKSLMPQVFASHHDWYESTIH  60

Query  208  SIS------------NRGLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVD  351
            SI+            ++ LVY Y +A+HGFSAVLSP ELE +K + G++ +  D S  +D
Sbjct  61   SINLATADDPSEQQQSQKLVYTYDDAMHGFSAVLSPEELETLKNTQGFVTAYPDRSATID  120

Query  352  TSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDT  450
            T+HT  FL L S +G W A++ G  VI+G+ID+
Sbjct  121  TTHTFEFLSLDSSNGLWNASNLGEGVIVGMIDS  153



>ref|XP_004961962.1| PREDICTED: subtilisin-like protease-like [Setaria italica]
Length=762

 Score =   113 bits (282),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 55/123 (45%), Positives = 82/123 (67%), Gaps = 3/123 (2%)
 Frame = +1

Query  91   FLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSIS-NRGLVYAYTNAIHGFSA  267
             L++ +   ++E+YIVHMD S MPRAF+SHQ W+ +TLS+ +    + Y Y +A HGF+A
Sbjct  25   MLRVPAASAETESYIVHMDKSAMPRAFSSHQRWYESTLSAAAPGADMYYVYDHAAHGFAA  84

Query  268  VLSPAELEAIKKSPGYLYSTKD--ASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGV  441
             L   ELE++++S G++   +D   +V  DT+HTP FLG+S+  G W    YG  VI+GV
Sbjct  85   RLRTEELESLRRSRGFVSCYRDDPRAVTRDTTHTPEFLGVSAQGGLWEEAGYGDGVIVGV  144

Query  442  IDT  450
            +DT
Sbjct  145  VDT  147



>ref|XP_006345494.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=754

 Score =   112 bits (281),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 61/137 (45%), Positives = 83/137 (61%), Gaps = 13/137 (9%)
 Frame = +1

Query  76   FISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSIS------------N  219
            F+ A F  +  I  +  TYIVH+D S MP  F SH  W S+T+ SI              
Sbjct  15   FLFAHFFCLVVI-AERSTYIVHLDKSLMPNMFASHHHWHSSTIESIKIVNPALLNSHHPV  73

Query  220  RGLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGA  399
              L+Y+Y N  HGFSAVLS  ELEA+KKS G++ + KD SV+  T+HT  +L L+   G 
Sbjct  74   PKLLYSYDNVFHGFSAVLSKDELEALKKSTGFISAYKDRSVEAHTTHTSEYLKLNPSSGL  133

Query  400  WPATDYGRDVIIGVIDT  450
            WPA+ +G+DV+IGV+D+
Sbjct  134  WPASGFGQDVVIGVLDS  150



>ref|XP_004492811.1| PREDICTED: subtilisin-like protease-like [Cicer arietinum]
Length=758

 Score =   112 bits (281),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 55/142 (39%), Positives = 89/142 (63%), Gaps = 15/142 (11%)
 Frame = +1

Query  70   LAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISNR---------  222
            + FI+  F   F ++ ++ TYIVHMD SF P+ FT+H  WF +T+ S++++         
Sbjct  13   MLFITPWFQLTFHVNAETSTYIVHMDKSFFPQVFTTHHDWFQSTVHSLNSKTELLDLDQP  72

Query  223  ------GLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLS  384
                   +VY Y +A++GFSAVL+  ELE +K   G++ + +D +  +DT+HT  FL L 
Sbjct  73   SKQQSKKVVYTYDHAMYGFSAVLTSNELETLKNIHGFIAAYQDRTAIIDTTHTFQFLSLD  132

Query  385  SDHGAWPATDYGRDVIIGVIDT  450
            S +G W A+++G D+I+GVID+
Sbjct  133  SPNGLWHASNFGEDIIVGVIDS  154



>ref|XP_006847104.1| hypothetical protein AMTR_s00017p00218650 [Amborella trichopoda]
 gb|ERN08685.1| hypothetical protein AMTR_s00017p00218650 [Amborella trichopoda]
Length=755

 Score =   112 bits (281),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 56/124 (45%), Positives = 83/124 (67%), Gaps = 4/124 (3%)
 Frame = +1

Query  91   FLQIFSIDGQSE---TYIVHMDLSFMPRAFTSHQSWFSATLSSISNR-GLVYAYTNAIHG  258
             LQ+ S    S+   TYI+HMDLS  P +F++H+ W  + L+S+S   G +Y Y++ +HG
Sbjct  17   ILQLVSASPTSDDYGTYIIHMDLSSKPMSFSTHEQWHKSLLASVSAEAGHLYTYSHVMHG  76

Query  259  FSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIG  438
            FSA LS A+L  +++ PG+  + +DA  K+ T+HTP FLGL   +G WP   +GRDVI+G
Sbjct  77   FSARLSRAQLARLEQLPGHRATRRDAYAKLFTTHTPRFLGLRKRNGIWPVASFGRDVIVG  136

Query  439  VIDT  450
            +IDT
Sbjct  137  IIDT  140



>gb|EYU36338.1| hypothetical protein MIMGU_mgv1a002690mg [Erythranthe guttata]
Length=646

 Score =   112 bits (280),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 54/108 (50%), Positives = 76/108 (70%), Gaps = 5/108 (5%)
 Frame = +1

Query  142  MDLSFMPRAFTSHQSWFSATLSSI-----SNRGLVYAYTNAIHGFSAVLSPAELEAIKKS  306
            MD S MP+AF+SH  W+S+ L+S      S   ++Y Y NA HGFS V++  ELEA+KKS
Sbjct  1    MDKSSMPKAFSSHHHWYSSMLNSAKSLYESEPKIIYTYDNAFHGFSVVMNKHELEALKKS  60

Query  307  PGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDT  450
            PG+L + +D  V  DT+H+  FL L++  G WPA++YG+DVIIG++DT
Sbjct  61   PGFLSAFEDGVVTTDTTHSYKFLSLNTATGLWPASNYGKDVIIGILDT  108



>ref|XP_011468374.1| PREDICTED: uncharacterized protein LOC101302380 [Fragaria vesca 
subsp. vesca]
Length=1517

 Score =   113 bits (282),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 59/141 (42%), Positives = 84/141 (60%), Gaps = 13/141 (9%)
 Frame = +1

Query  67   HLAFISATFLQIFSID---GQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISNR-----  222
            ++ ++  TFL     +    +  TYIVHMD S MP+ FTSHQ W+S+ + S         
Sbjct  759  YILYVLQTFLLALHFNTSLAERSTYIVHMDKSLMPKFFTSHQHWYSSIVDSFKTETQTDS  818

Query  223  -----GLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSS  387
                  ++Y Y NA HGFSAVLS  ELE +KKSPG++ +  D +  +DT+HT  FL L+ 
Sbjct  819  HSFSPSILYTYDNAFHGFSAVLSIDELETLKKSPGFVSAYNDKTFTLDTTHTSDFLSLNP  878

Query  388  DHGAWPATDYGRDVIIGVIDT  450
              G  PA+++  D++IGVIDT
Sbjct  879  SAGLLPASNHEEDIVIGVIDT  899


 Score =   101 bits (252),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 59/123 (48%), Positives = 77/123 (63%), Gaps = 12/123 (10%)
 Frame = +1

Query  118  QSETYIVHMDLSFMPRAFTSHQSWFSATLSSISNR------------GLVYAYTNAIHGF  261
            +  TYIVHMD S MP++FTSH  W+S+ + S                 L+Y Y NA HGF
Sbjct  5    ERSTYIVHMDKSLMPKSFTSHHHWYSSIVDSFKTDLHTSSDPHRLTPSLLYTYDNAFHGF  64

Query  262  SAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGV  441
            SAVLS  ELE + KSP ++ + KD +V VDT+HT  FL L+   G  PA++YG D+I+GV
Sbjct  65   SAVLSTDELETLGKSPAFVSAYKDKTVTVDTTHTTTFLSLNPSTGLLPASNYGEDIIVGV  124

Query  442  IDT  450
            IDT
Sbjct  125  IDT  127



>ref|XP_011017184.1| PREDICTED: subtilisin-like protease [Populus euphratica]
Length=772

 Score =   112 bits (280),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 59/137 (43%), Positives = 83/137 (61%), Gaps = 20/137 (15%)
 Frame = +1

Query  91   FLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSI-----------------SN  219
            F Q  S   Q+E YIVHMDL  MP+AF+    W+ + L+SI                 ++
Sbjct  22   FTQTLS---QTENYIVHMDLLVMPKAFSGQHQWYLSALASIFDVSDSSTTRATAATLTAS  78

Query  220  RGLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGA  399
              L+Y+YT+ I+GFSA L+P+ELE +K SPGY+ S KD  VK DT+ +  FLGL+    A
Sbjct  79   SKLLYSYTHVINGFSASLTPSELEVLKNSPGYISSIKDLPVKHDTTRSSKFLGLTPQSLA  138

Query  400  WPATDYGRDVIIGVIDT  450
            W  ++YG  +IIG++DT
Sbjct  139  WKVSNYGEGIIIGLVDT  155



>ref|XP_004229661.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=769

 Score =   112 bits (280),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 56/124 (45%), Positives = 77/124 (62%), Gaps = 12/124 (10%)
 Frame = +1

Query  115  GQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISNRG------------LVYAYTNAIHG  258
             +  TYIVH+D S MP+ F +H  W S+T+ SI                L+Y+Y N  HG
Sbjct  27   AERSTYIVHLDKSLMPKIFATHHHWHSSTVESIKIVNPALLNSHHPVPKLLYSYDNVFHG  86

Query  259  FSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIG  438
            FSAVLS  ELE +KK  G++ + KD SV+  T+HTP FL L+   G WPA+ +G+DV+IG
Sbjct  87   FSAVLSKDELEVLKKFTGFISAYKDRSVEAHTTHTPEFLKLNPSSGLWPASGFGQDVVIG  146

Query  439  VIDT  450
            V+D+
Sbjct  147  VLDS  150



>ref|XP_003624105.1| Xylem serine proteinase [Medicago truncatula]
 gb|ABD28576.1| Protease-associated PA; Proteinase inhibitor I9, subtilisin propeptide 
[Medicago truncatula]
 gb|AES80323.1| subtilisin-like serine protease [Medicago truncatula]
Length=769

 Score =   112 bits (279),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 60/147 (41%), Positives = 87/147 (59%), Gaps = 16/147 (11%)
 Frame = +1

Query  58   LFFHLAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSI--------  213
            +F  L  IS  FL  F  + ++ TYI+HM+ SF P+ FT+H  WF +T+ S+        
Sbjct  6    VFSLLLIISLWFLLTFHSNAETSTYIIHMNKSFFPQVFTTHHDWFKSTIHSLKSKTLVPD  65

Query  214  --------SNRGLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPG  369
                    S + LVY Y +A++GFSAVLS  ELE +K   G++ + +D +  +DT+HT  
Sbjct  66   DYDQASKQSQKKLVYTYDHAMYGFSAVLSSNELEILKNIDGFVSAYQDRTATIDTTHTFE  125

Query  370  FLGLSSDHGAWPATDYGRDVIIGVIDT  450
            FL L S  G W  +D+G DV++GVIDT
Sbjct  126  FLSLDSPSGLWHTSDFGDDVVVGVIDT  152



>gb|ACA64702.1| subtilase [Nicotiana tabacum]
Length=773

 Score =   112 bits (279),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 61/139 (44%), Positives = 83/139 (60%), Gaps = 12/139 (9%)
 Frame = +1

Query  70   LAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSI------------  213
            L+++ +  L  F    +  TYIVH+D S MP  F  HQ W S+T+ SI            
Sbjct  16   LSWLLSVHLFCFLAVARRSTYIVHLDKSLMPNIFADHQHWHSSTIDSIKAAVPSSVDRFH  75

Query  214  SNRGLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDH  393
            S   LVY+Y N  HGFSAVLS  ELEA+KK PG++ + KD + +  T++T  FL L+   
Sbjct  76   SAPKLVYSYDNVFHGFSAVLSKDELEALKKLPGFVSAYKDTTAEPHTTYTSDFLKLNPSS  135

Query  394  GAWPATDYGRDVIIGVIDT  450
            G WPA+  G+DVIIGV+D+
Sbjct  136  GLWPASGLGQDVIIGVLDS  154



>ref|XP_009787984.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=773

 Score =   112 bits (279),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 61/139 (44%), Positives = 83/139 (60%), Gaps = 12/139 (9%)
 Frame = +1

Query  70   LAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSI------------  213
            L+++ +  L  F    +  TYIVH+D S MP  F  HQ W S+T+ SI            
Sbjct  16   LSWLLSVHLFCFLAVARRSTYIVHLDKSLMPNIFADHQHWHSSTIDSIKAAVPSSVDRFH  75

Query  214  SNRGLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDH  393
            S   LVY+Y N  HGFSAVLS  ELEA+KK PG++ + KD + +  T++T  FL L+   
Sbjct  76   SAPKLVYSYDNVFHGFSAVLSKDELEALKKLPGFVSAYKDTTAEPHTTYTSDFLKLNPSS  135

Query  394  GAWPATDYGRDVIIGVIDT  450
            G WPA+  G+DVIIGV+D+
Sbjct  136  GLWPASGLGQDVIIGVLDS  154



>ref|XP_007139760.1| hypothetical protein PHAVU_008G056700g [Phaseolus vulgaris]
 gb|ESW11754.1| hypothetical protein PHAVU_008G056700g [Phaseolus vulgaris]
Length=765

 Score =   111 bits (277),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 60/121 (50%), Positives = 81/121 (67%), Gaps = 10/121 (8%)
 Frame = +1

Query  118  QSETYIVHMDLSFMPRAFTSHQSWF--------SATL--SSISNRGLVYAYTNAIHGFSA  267
            +S TYIVHMD S  P  FT+H  WF        SATL  SSI ++ LVY+Y+ A++GFSA
Sbjct  32   ESSTYIVHMDKSLFPHVFTTHHDWFESIMDSTKSATLGHSSIQSQKLVYSYSIAMYGFSA  91

Query  268  VLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVID  447
            VL+  ELEA+K S G++ +  D +  +DT+HT  FL L S  G W A+++G DVI+GVID
Sbjct  92   VLTSEELEAVKNSLGFVAAYPDRTATIDTTHTFEFLSLDSSSGLWHASNFGEDVIVGVID  151

Query  448  T  450
            +
Sbjct  152  S  152



>ref|XP_006345400.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=777

 Score =   111 bits (277),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 64/142 (45%), Positives = 82/142 (58%), Gaps = 13/142 (9%)
 Frame = +1

Query  58   LFFHLAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSI--------  213
            L F   FIS       +I  Q  TYIVH+D S MP  F  H  W S+T+ SI        
Sbjct  9    LLFLSWFISVHLFCYLAI-AQRSTYIVHLDKSLMPNVFPDHHHWHSSTIDSIKASVPSSV  67

Query  214  ----SNRGLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGL  381
                S   LVY+Y N  HGFSAVLS  EL+A+KK PG++ + KD +V+  T++T  FL L
Sbjct  68   DRFHSAPKLVYSYDNVFHGFSAVLSKDELKALKKLPGFVSAYKDRTVEPHTTYTSDFLKL  127

Query  382  SSDHGAWPATDYGRDVIIGVID  447
            +   G WPA+  G+DVIIGV+D
Sbjct  128  NPSSGLWPASGLGQDVIIGVLD  149



>ref|XP_004229664.2| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=781

 Score =   111 bits (277),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 61/136 (45%), Positives = 82/136 (60%), Gaps = 15/136 (11%)
 Frame = +1

Query  76   FISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSI------------SN  219
            F+SA    IF    Q  TYIVH+D S MP  F  H  W S+T+ SI            S 
Sbjct  21   FLSA---HIFLAMAQRSTYIVHLDKSLMPNVFADHHHWHSSTIESIKASVPSSEDRFHSA  77

Query  220  RGLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGA  399
              LVY+Y N  HGFSAVLS  EL+A+KKSPG++ + KD +V+  T++T  FL L+  +G 
Sbjct  78   PKLVYSYDNVFHGFSAVLSKDELKALKKSPGFISAYKDRTVEPHTTYTSDFLKLNPSYGL  137

Query  400  WPATDYGRDVIIGVID  447
            WPA+  G+D+I+ V+D
Sbjct  138  WPASGLGQDMIVAVLD  153



>gb|KDO79191.1| hypothetical protein CISIN_1g004824mg [Citrus sinensis]
Length=728

 Score =   110 bits (276),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 59/116 (51%), Positives = 80/116 (69%), Gaps = 14/116 (12%)
 Frame = +1

Query  142  MDLSFMPRAFTSHQSWF-------------SATLSSISNRGLVYAYTNAIHGFSAVLSPA  282
            MD S MP+A++S  +W+             +AT S+IS++ LVY Y N+IHGFSA L+ +
Sbjct  1    MDTSAMPKAYSSLYTWYLFMLCSVSESSKATATSSTISSK-LVYTYANSIHGFSATLTVS  59

Query  283  ELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDT  450
            ELE +KK PGY+ ST D  + V T+HT  FLGLSS  GAWPA++YG+ VIIG++DT
Sbjct  60   ELETLKKLPGYISSTPDRPLAVHTTHTSEFLGLSSLSGAWPASNYGKGVIIGLVDT  115



>ref|XP_010687642.1| PREDICTED: subtilisin-like protease [Beta vulgaris subsp. vulgaris]
Length=782

 Score =   110 bits (276),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 57/127 (45%), Positives = 79/127 (62%), Gaps = 16/127 (13%)
 Frame = +1

Query  118  QSETYIVHMDLSFMPRAFTSHQSWFSAT---LSSISNRGL-------------VYAYTNA  249
            Q  TYI+HMD S MP  FTSH  W+++T   L+S ++ GL             +Y Y NA
Sbjct  35   QRSTYIIHMDKSLMPNVFTSHHHWYTSTVDSLNSATSNGLKSPNYSSPSSPSVLYTYDNA  94

Query  250  IHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDV  429
            +HGFSA+LS  EL+ ++  P ++ + K+A   +DT+ T  FL L+   G WPA++YG DV
Sbjct  95   LHGFSALLSQNELQKLENHPSFITAYKEAKATLDTTRTIDFLSLNPYTGLWPASNYGHDV  154

Query  430  IIGVIDT  450
            IIGVIDT
Sbjct  155  IIGVIDT  161



>dbj|BAJ87233.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=747

 Score =   110 bits (275),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 55/112 (49%), Positives = 77/112 (69%), Gaps = 2/112 (2%)
 Frame = +1

Query  121  SETYIVHMDLSFMPRAFTSHQSWFSATLSSIS-NRGLVYAYTNAIHGFSAVLSPAELEAI  297
            S +YIVHMD S MP  F SH SW+ +TL++ +    + Y Y +A+HGF+A L   EL+ +
Sbjct  27   SSSYIVHMDKSAMPTGFASHLSWYESTLAAAAPGADMFYVYDHAMHGFAARLPAEELDRL  86

Query  298  KKSPGYLYSTKD-ASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDT  450
            ++SPG++   +D A V  DT+HTP FLG+S+  G W A+ YG DVIIGV+DT
Sbjct  87   RRSPGFVSCYRDDARVVRDTTHTPEFLGVSAAGGIWEASKYGEDVIIGVVDT  138



>dbj|BAJ88882.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=747

 Score =   110 bits (275),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 55/112 (49%), Positives = 77/112 (69%), Gaps = 2/112 (2%)
 Frame = +1

Query  121  SETYIVHMDLSFMPRAFTSHQSWFSATLSSIS-NRGLVYAYTNAIHGFSAVLSPAELEAI  297
            S +YIVHMD S MP  F SH SW+ +TL++ +    + Y Y +A+HGF+A L   EL+ +
Sbjct  27   SSSYIVHMDKSAMPTGFASHLSWYESTLAAAAPGADMFYVYDHAMHGFAARLPAEELDRL  86

Query  298  KKSPGYLYSTKD-ASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDT  450
            ++SPG++   +D A V  DT+HTP FLG+S+  G W A+ YG DVIIGV+DT
Sbjct  87   RRSPGFVSCYRDDARVVRDTTHTPEFLGVSAAGGIWEASKYGEDVIIGVVDT  138



>ref|XP_009595146.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=781

 Score =   110 bits (275),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 62/136 (46%), Positives = 81/136 (60%), Gaps = 13/136 (10%)
 Frame = +1

Query  76   FISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSI------------SN  219
            F+SA      +I  Q  TYIVH+D S MP  F  +  W S+T+ SI            S 
Sbjct  19   FLSAHVFCFLAI-AQRSTYIVHLDKSLMPNIFADYHHWHSSTIDSIKAAVPSSVDRFHSA  77

Query  220  RGLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGA  399
              LVY+Y N  HGFSAVLS  ELEA+KK PG++ + KD +V+  T++T  FL L+   G 
Sbjct  78   PKLVYSYDNVFHGFSAVLSKDELEALKKLPGFVSAYKDRTVEPHTTYTSDFLKLNPSSGL  137

Query  400  WPATDYGRDVIIGVID  447
            WPA+  G+DVIIGV+D
Sbjct  138  WPASGLGQDVIIGVLD  153



>ref|XP_004249811.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=683

 Score =   109 bits (273),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 53/123 (43%), Positives = 78/123 (63%), Gaps = 12/123 (10%)
 Frame = +1

Query  118  QSETYIVHMDLSFMPRAFTSHQSWFSATLSSISNRG------------LVYAYTNAIHGF  261
            +  TYIVH+D SFMP+   +HQ+W S  + ++                L+Y+Y + +HGF
Sbjct  74   ERSTYIVHLDKSFMPKILATHQNWHSYIIDTVKIEAPTTRNTHHPLPKLLYSYDSVLHGF  133

Query  262  SAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGV  441
            SAVLS  E+EA++KSPG++ + KD  V+  T+H+P FL L+   G WPA+ +G DVII V
Sbjct  134  SAVLSKDEIEALEKSPGFVSAYKDRPVEAHTTHSPEFLKLNPASGLWPASGFGEDVIIRV  193

Query  442  IDT  450
            +DT
Sbjct  194  LDT  196



>ref|XP_010647877.1| PREDICTED: subtilisin-like protease [Vitis vinifera]
Length=693

 Score =   108 bits (271),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 54/117 (46%), Positives = 77/117 (66%), Gaps = 5/117 (4%)
 Frame = +1

Query  115  GQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISNRG-----LVYAYTNAIHGFSAVLSP  279
            G   +YI+HMD S MP  F+SH  W+ +TLSSIS+        +Y Y + + GFSAVLS 
Sbjct  26   GDVGSYIIHMDKSAMPMTFSSHHDWYMSTLSSISSPDGSLPTHLYTYNHVLDGFSAVLSK  85

Query  280  AELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDT  450
            A L+ ++K PG+L +  D+  K+ T+H+P FLGL  + GAWP   +G D+IIG++DT
Sbjct  86   AHLDQLEKMPGHLATYPDSFGKLHTTHSPKFLGLEKNSGAWPEGKFGEDMIIGILDT  142



>gb|ACA64704.1| subtilase [Nicotiana tabacum]
Length=781

 Score =   108 bits (271),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 61/136 (45%), Positives = 81/136 (60%), Gaps = 13/136 (10%)
 Frame = +1

Query  76   FISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSI------------SN  219
            F+SA      +I  Q  TYIVH+D S MP  F  +  W S+T+ SI            S 
Sbjct  19   FLSAHVFCFLAI-AQRSTYIVHLDKSLMPNIFADYHHWHSSTIDSIKAAVPSSVDRFHSA  77

Query  220  RGLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGA  399
              LVY+Y N  HGFSAVLS  ELEA+KK PG++ + KD +V+  T++T  FL L+   G 
Sbjct  78   PKLVYSYDNVFHGFSAVLSKDELEALKKLPGFVSAYKDRTVEPHTTYTSDFLKLNPSSGL  137

Query  400  WPATDYGRDVIIGVID  447
            WPA+  G++VIIGV+D
Sbjct  138  WPASGLGQEVIIGVLD  153



>ref|XP_002282856.2| PREDICTED: subtilisin-like protease [Vitis vinifera]
 emb|CBI19500.3| unnamed protein product [Vitis vinifera]
Length=766

 Score =   108 bits (271),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 59/145 (41%), Positives = 90/145 (62%), Gaps = 12/145 (8%)
 Frame = +1

Query  52   RALFFHLAFISATFLQIFSIDG------QSETYIVHMDLSFMPRAFTSHQSWFSATLSSI  213
            R+LF H A +S   L +  I+       + +TYI+HMD S+ P +F++H+SW  +TL S+
Sbjct  8    RSLFSHHAVLSWLLLLLLGINNAMSELEERQTYIIHMDHSYKPDSFSTHESWHLSTLKSV  67

Query  214  S------NRGLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFL  375
            S         L+Y+Y++ + GFSA L+P+EL  ++KSP +  + ++   K+ T+HT  FL
Sbjct  68   STSPVNHKEMLLYSYSHVMQGFSARLTPSELSQLEKSPAHRATYRETFGKLFTTHTTKFL  127

Query  376  GLSSDHGAWPATDYGRDVIIGVIDT  450
            GL  + G WPA  YG  VIIG+IDT
Sbjct  128  GLKPNSGIWPAASYGDGVIIGIIDT  152



>emb|CAN60788.1| hypothetical protein VITISV_034534 [Vitis vinifera]
Length=766

 Score =   108 bits (270),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 59/145 (41%), Positives = 90/145 (62%), Gaps = 12/145 (8%)
 Frame = +1

Query  52   RALFFHLAFISATFLQIFSIDG------QSETYIVHMDLSFMPRAFTSHQSWFSATLSSI  213
            R+LF H A +S   L +  I+       + +TYI+HMD S+ P +F++H+SW  +TL S+
Sbjct  8    RSLFSHHAVLSWLLLLLLGINNAMSELEERQTYIIHMDHSYKPDSFSTHESWHLSTLKSV  67

Query  214  S------NRGLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFL  375
            S         L+Y+Y++ + GFSA L+P+EL  ++KSP +  + ++   K+ T+HT  FL
Sbjct  68   STSPVNHKEMLLYSYSHVMQGFSARLTPSELSQLEKSPAHRATYRETFGKLFTTHTTKFL  127

Query  376  GLSSDHGAWPATDYGRDVIIGVIDT  450
            GL  + G WPA  YG  VIIG+IDT
Sbjct  128  GLKPNSGIWPAASYGDGVIIGIIDT  152



>ref|XP_006345402.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=760

 Score =   108 bits (270),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 63/143 (44%), Positives = 81/143 (57%), Gaps = 16/143 (11%)
 Frame = +1

Query  58   LFFHLAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSI--------  213
            L F   F+SA  L I     Q  TYIVHMD + MP  F  H  W S+T+ SI        
Sbjct  9    LLFISWFLSAHMLAI----AQRSTYIVHMDKTLMPNVFPDHHHWHSSTIDSIKASVPSSV  64

Query  214  ----SNRGLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGL  381
                S   LVY+Y N +HGFSAVLS  E+ A+K  PG++ + KD +V+  T+HT  FL L
Sbjct  65   DRFHSAPKLVYSYDNVLHGFSAVLSQDEVAALKNLPGFISAYKDRTVEPHTTHTSDFLKL  124

Query  382  SSDHGAWPATDYGRDVIIGVIDT  450
            +   G W A+  G+DVIIGV D+
Sbjct  125  NPSSGLWQASGLGQDVIIGVFDS  147



>dbj|BAJ90426.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=737

 Score =   108 bits (269),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 53/119 (45%), Positives = 79/119 (66%), Gaps = 2/119 (2%)
 Frame = +1

Query  100  IFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSIS-NRGLVYAYTNAIHGFSAVLS  276
            + S+D  + +YIVHMD S MP  F+SH  W+ + L++ +    + Y Y +A+HGF+A L 
Sbjct  10   VASVDAPAASYIVHMDKSAMPSGFSSHLRWYESMLAAAAPGADMFYVYDHAMHGFAARLP  69

Query  277  PAELEAIKKSPGYLYSTKD-ASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDT  450
              EL  +++SPG++   +D A V  DT+HTP FLG+S+  G W A+ YG +VIIGV+DT
Sbjct  70   EEELVRLRRSPGFVSCYRDDARVVRDTTHTPEFLGVSAAGGIWEASKYGENVIIGVVDT  128



>dbj|BAJ88973.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=757

 Score =   107 bits (268),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 55/138 (40%), Positives = 86/138 (62%), Gaps = 4/138 (3%)
 Frame = +1

Query  49   HRALF--FHLAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSIS-N  219
            HR ++    L  ++     + S+D  + +YIVHMD S +P  F+SH  W+ + L++ +  
Sbjct  11   HRTMWPWVALVLVALWVRPVASVDAPAASYIVHMDKSAIPSGFSSHLRWYESMLAAAAPG  70

Query  220  RGLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKD-ASVKVDTSHTPGFLGLSSDHG  396
              + Y Y +A+HGF+A L   EL  +++SPG++   +D A V  DT+HTP FLG+S+  G
Sbjct  71   ADMFYVYDHAMHGFAARLPEEELVRLRRSPGFVSCYRDDARVVRDTTHTPEFLGVSAAGG  130

Query  397  AWPATDYGRDVIIGVIDT  450
             W A+ YG +VIIGV+DT
Sbjct  131  IWEASKYGENVIIGVVDT  148



>ref|XP_006847097.1| hypothetical protein AMTR_s00017p00216950 [Amborella trichopoda]
 gb|ERN08678.1| hypothetical protein AMTR_s00017p00216950 [Amborella trichopoda]
Length=754

 Score =   107 bits (268),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 50/109 (46%), Positives = 74/109 (68%), Gaps = 1/109 (1%)
 Frame = +1

Query  127  TYIVHMDLSFMPRAFTSHQSWFSATLSSISNR-GLVYAYTNAIHGFSAVLSPAELEAIKK  303
             YI+H+D S  P +F SH+ W  + L+S+S   G +Y Y++ +HGFSA LS A+L  +++
Sbjct  31   NYIIHVDNSHKPNSFFSHEEWHKSMLASVSAEAGHLYTYSHVMHGFSARLSRAQLAQLEQ  90

Query  304  SPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDT  450
             PG+  + +DA  K+ T+HTP FLGL   +G WP   +GRDVI+G+IDT
Sbjct  91   LPGHRATRRDAYAKLFTTHTPRFLGLRKKNGIWPVASFGRDVIVGIIDT  139



>emb|CAA07060.1| SBT4C protein [Solanum lycopersicum]
Length=779

 Score =   107 bits (267),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 58/128 (45%), Positives = 77/128 (60%), Gaps = 12/128 (9%)
 Frame = +1

Query  100  IFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSI------------SNRGLVYAYT  243
            +F    Q  TYIVH+D S MP  F     W S+T+ SI            S   LVY+Y 
Sbjct  25   LFLAIAQRSTYIVHLDKSLMPNVFLDDHHWHSSTIESIKAAVPSSADRFHSAPKLVYSYD  84

Query  244  NAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGR  423
            +  HGFSAVLS  EL A+KKSPG++ + KD +V+ DT++T  +L L+   G WPA+  G+
Sbjct  85   HVFHGFSAVLSKDELAALKKSPGFISAYKDRTVEPDTTYTSDYLKLNPSSGLWPASGLGQ  144

Query  424  DVIIGVID  447
            DVIIGV+D
Sbjct  145  DVIIGVLD  152



>ref|XP_006473885.1| PREDICTED: subtilisin-like protease-like [Citrus sinensis]
Length=757

 Score =   107 bits (267),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 53/114 (46%), Positives = 76/114 (67%), Gaps = 5/114 (4%)
 Frame = +1

Query  124  ETYIVHMDLSFMPRAFTSHQSWFSATLSSIS-----NRGLVYAYTNAIHGFSAVLSPAEL  288
            +TYI+HMD S  P AF +H+SW  + L S S     N  L+Y+Y + I GFSA L+P++L
Sbjct  37   QTYIIHMDHSHKPSAFLTHESWHLSILKSASYPADRNNMLLYSYNHVIQGFSARLTPSQL  96

Query  289  EAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDT  450
              I+KSP +L +  ++  K+ T+H+P FLGL  + G WP+  YG+ VIIG+IDT
Sbjct  97   SEIEKSPAHLATYPESFGKLFTTHSPNFLGLKPNSGLWPSARYGQGVIIGIIDT  150



>gb|KDO84128.1| hypothetical protein CISIN_1g047470mg [Citrus sinensis]
Length=757

 Score =   107 bits (267),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 53/114 (46%), Positives = 76/114 (67%), Gaps = 5/114 (4%)
 Frame = +1

Query  124  ETYIVHMDLSFMPRAFTSHQSWFSATLSSIS-----NRGLVYAYTNAIHGFSAVLSPAEL  288
            +TYI+HMD S  P AF +H+SW  + L S S     N  L+Y+Y + I GFSA L+P++L
Sbjct  37   QTYIIHMDHSHKPSAFLTHESWHLSILKSASYPADRNNMLLYSYNHVIQGFSARLTPSQL  96

Query  289  EAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDT  450
              I+KSP +L +  ++  K+ T+H+P FLGL  + G WP+  YG+ VIIG+IDT
Sbjct  97   SEIEKSPAHLATYPESFGKLFTTHSPNFLGLKPNSGLWPSARYGQGVIIGIIDT  150



>gb|ABN05870.1| Proteinase inhibitor I9, subtilisin propeptide [Medicago truncatula]
Length=511

 Score =   105 bits (263),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 53/134 (40%), Positives = 80/134 (60%), Gaps = 18/134 (13%)
 Frame = +1

Query  103  FSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSI------------------SNRGL  228
            F  + ++ TYI+HM+ SF P+ FT+H  WF +T+ S+                  S + L
Sbjct  21   FHSNAETSTYIIHMNKSFFPQVFTNHHDWFKSTIHSLKSKTLVLDDHDQQEASKQSQKKL  80

Query  229  VYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPA  408
            VY Y NA++GF A+LS  ELE IK   G++ + +D +  +DT+HT  FL L S  G W A
Sbjct  81   VYTYDNAMYGFCAMLSSNELEIIKNIDGFVSAYQDRTATIDTTHTFEFLSLDSPSGLWHA  140

Query  409  TDYGRDVIIGVIDT  450
            +++G D+I+GVID+
Sbjct  141  SNFGDDIIVGVIDS  154



>gb|KEH23384.1| subtilisin-like serine protease [Medicago truncatula]
Length=515

 Score =   105 bits (263),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 53/134 (40%), Positives = 80/134 (60%), Gaps = 18/134 (13%)
 Frame = +1

Query  103  FSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSI------------------SNRGL  228
            F  + ++ TYI+HM+ SF P+ FT+H  WF +T+ S+                  S + L
Sbjct  21   FHSNAETSTYIIHMNKSFFPQVFTNHHDWFKSTIHSLKSKTLVLDDHDQQEASKQSQKKL  80

Query  229  VYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPA  408
            VY Y NA++GF A+LS  ELE IK   G++ + +D +  +DT+HT  FL L S  G W A
Sbjct  81   VYTYDNAMYGFCAMLSSNELEIIKNIDGFVSAYQDRTATIDTTHTFEFLSLDSPSGLWHA  140

Query  409  TDYGRDVIIGVIDT  450
            +++G D+I+GVID+
Sbjct  141  SNFGDDIIVGVIDS  154



>ref|XP_006386505.1| hypothetical protein POPTR_0002s12610g [Populus trichocarpa]
 gb|ERP64302.1| hypothetical protein POPTR_0002s12610g [Populus trichocarpa]
Length=739

 Score =   106 bits (265),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 58/138 (42%), Positives = 80/138 (58%), Gaps = 17/138 (12%)
 Frame = +1

Query  40   MANHRALFFHLAFISA-TFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSIS  216
            MA   ++  +  +IS  T L       Q E YIVHMDLS MP+AF+              
Sbjct  1    MATRDSVSLYKLWISVITILPFTQTLSQPENYIVHMDLSVMPKAFS--------------  46

Query  217  NRGLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHG  396
              G  + YT+ I+GFSA L+P+ELE +K SPGY+ S KD  VK DT+H+  FLGL+    
Sbjct  47   --GQYHCYTHVINGFSASLTPSELEVLKNSPGYISSIKDLPVKQDTTHSSKFLGLTPQSL  104

Query  397  AWPATDYGRDVIIGVIDT  450
            AW  ++YG  +IIG++D+
Sbjct  105  AWKVSNYGEGIIIGLVDS  122



>ref|XP_006434736.1| hypothetical protein CICLE_v10003898mg [Citrus clementina]
 gb|ESR47976.1| hypothetical protein CICLE_v10003898mg [Citrus clementina]
Length=757

 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 52/114 (46%), Positives = 76/114 (67%), Gaps = 5/114 (4%)
 Frame = +1

Query  124  ETYIVHMDLSFMPRAFTSHQSWFSATLSSIS-----NRGLVYAYTNAIHGFSAVLSPAEL  288
            +TYI+HMD S  P AF +H+SW  + L S S     N  L+Y+Y + I GFSA L+P++L
Sbjct  37   QTYIIHMDHSHKPSAFLTHESWHLSILKSASYPADRNNMLLYSYNHVIQGFSARLTPSQL  96

Query  289  EAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDT  450
              I+KSP +L +  ++  K+ T+H+P FLGL  + G WP+  YG+ VI+G+IDT
Sbjct  97   SEIEKSPAHLATYPESFGKLFTTHSPNFLGLKPNSGLWPSARYGQGVIVGIIDT  150



>emb|CAN64996.1| hypothetical protein VITISV_001780 [Vitis vinifera]
Length=769

 Score =   106 bits (264),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 52/117 (44%), Positives = 76/117 (65%), Gaps = 5/117 (4%)
 Frame = +1

Query  115  GQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISNRG-----LVYAYTNAIHGFSAVLSP  279
            G   +YI+HMD S MP  F+SH  W+ +TLSSIS+        +Y Y + + GFSAV+S 
Sbjct  26   GDVGSYIIHMDKSAMPMTFSSHHDWYMSTLSSISSPDGSLPTHLYTYNHVLDGFSAVMSK  85

Query  280  AELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDT  450
            A L+ ++K PG+L +  D+  K+ T+H+P FLGL  + GAWP   +G D+II ++DT
Sbjct  86   AHLDQLEKMPGHLATYPDSFGKLHTTHSPKFLGLEKNSGAWPEGKFGEDMIIAILDT  142



>ref|XP_007017191.1| Subtilisin-like serine protease 2, putative [Theobroma cacao]
 gb|EOY14416.1| Subtilisin-like serine protease 2, putative [Theobroma cacao]
Length=761

 Score =   105 bits (263),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 52/114 (46%), Positives = 77/114 (68%), Gaps = 5/114 (4%)
 Frame = +1

Query  124  ETYIVHMDLSFMPRAFTSHQSWFSATLSSISN-----RGLVYAYTNAIHGFSAVLSPAEL  288
            +TY+VHM+ S  P +F++H+ W  +TL S+SN       L+Y+Y + IHGFSA L+ ++L
Sbjct  37   KTYVVHMNHSHKPTSFSTHELWHRSTLRSLSNPVDDEEKLLYSYNHIIHGFSARLTSSQL  96

Query  289  EAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDT  450
              I+KSP +L + +++  K+ T+H+P FLGL  + G WPA  YG  VIIGV DT
Sbjct  97   SEIEKSPAHLATYQESLGKLFTTHSPEFLGLEHNSGLWPAASYGEGVIIGVFDT  150



>gb|EMT29812.1| hypothetical protein F775_42283 [Aegilops tauschii]
Length=702

 Score =   105 bits (263),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 52/110 (47%), Positives = 75/110 (68%), Gaps = 2/110 (2%)
 Frame = +1

Query  127  TYIVHMDLSFMPRAFTSHQSWFSATLS-SISNRGLVYAYTNAIHGFSAVLSPAELEAIKK  303
            +YIVHMD S MP  F+SH  W+ +TL+ +     + Y Y +A+HGF+A L   EL+ +++
Sbjct  27   SYIVHMDKSAMPSGFSSHLRWYESTLAVAAPGAEMFYVYDHAMHGFAARLPEDELDRLRR  86

Query  304  SPGYLYSTKD-ASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDT  450
            SPG++   +D A V  DT+HTP FLG+S+  G W A+ YG +VIIGV+DT
Sbjct  87   SPGFVSCYRDDARVVRDTTHTPEFLGVSAAGGIWEASKYGENVIIGVVDT  136



>ref|XP_007143987.1| hypothetical protein PHAVU_007G119500g [Phaseolus vulgaris]
 gb|ESW15981.1| hypothetical protein PHAVU_007G119500g [Phaseolus vulgaris]
Length=763

 Score =   105 bits (263),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 58/149 (39%), Positives = 86/149 (58%), Gaps = 12/149 (8%)
 Frame = +1

Query  40   MANHRALFFHLAF-ISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSIS  216
            M +H  +   L F I+   L     + +S TY+VHMD + MP+ F +H  W+ + + SI 
Sbjct  1    MESHFVVPLPLMFLITLWLLLAHHANAESSTYVVHMDKTLMPQVFATHHDWYQSIIHSID  60

Query  217  NR-----------GLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHT  363
                          LVY+Y +A+HGFSAVLS  ELE +KK  G++ +  D S  +DT+HT
Sbjct  61   LETADDPSKQQVLKLVYSYDDAMHGFSAVLSSEELETVKKVDGFVTAYPDRSATIDTTHT  120

Query  364  PGFLGLSSDHGAWPATDYGRDVIIGVIDT  450
              FL L + +G W A+++G  VI+G+IDT
Sbjct  121  FEFLSLDTPNGLWNASNFGEGVIVGLIDT  149



>gb|EMS48839.1| Subtilisin-like protease [Triticum urartu]
Length=1050

 Score =   106 bits (264),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 52/109 (48%), Positives = 76/109 (70%), Gaps = 2/109 (2%)
 Frame = +1

Query  130  YIVHMDLSFMPRAFTSHQSWFSATLSSISNRG-LVYAYTNAIHGFSAVLSPAELEAIKKS  306
            YIVHMD S MP  F+SH  W+ +TL++ +    + Y Y +A+HGF+A L   EL+ +++S
Sbjct  28   YIVHMDKSAMPSGFSSHLRWYESTLAAAAPAAEMFYVYDHAMHGFAARLPEEELDRLRRS  87

Query  307  PGYLYSTKD-ASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDT  450
            PG++   +D A V  DT+HTP FLG+S+  G W A++YG +VIIGV+DT
Sbjct  88   PGFVSCYRDDARVVRDTTHTPEFLGVSAAGGIWEASNYGENVIIGVVDT  136



>ref|NP_001055646.1| Os05g0435800 [Oryza sativa Japonica Group]
 gb|AAT58881.1| putative subtilisin-like proteinase [Oryza sativa Japonica Group]
 dbj|BAF17560.1| Os05g0435800 [Oryza sativa Japonica Group]
 gb|EEE63841.1| hypothetical protein OsJ_18665 [Oryza sativa Japonica Group]
Length=761

 Score =   105 bits (262),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 54/111 (49%), Positives = 76/111 (68%), Gaps = 4/111 (4%)
 Frame = +1

Query  130  YIVHMDLSFMPRAFTSHQSWFSATLSSIS-NRGLVYAYTNAIHGFSAVLSPAELEAIKKS  306
            YIVHMD S MPRAF S  SW+ +TL++ +    + Y Y NA+HGF+A ++  ELE ++ S
Sbjct  38   YIVHMDKSAMPRAFASQASWYESTLAAAAPGADMFYVYDNAMHGFAARVTADELEKLRGS  97

Query  307  PGYL--YSTKDASVKVDTSHTPGFLGLS-SDHGAWPATDYGRDVIIGVIDT  450
             G++  Y     +V+ DT+HTP FLG+S S  G W A++YG DVI+GV+DT
Sbjct  98   RGFVSCYPDDARAVRRDTTHTPEFLGVSASSGGLWEASEYGEDVIVGVVDT  148



>emb|CDP01318.1| unnamed protein product [Coffea canephora]
Length=769

 Score =   105 bits (261),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 60/147 (41%), Positives = 86/147 (59%), Gaps = 20/147 (14%)
 Frame = +1

Query  58   LFFHLAFI----SATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSI----  213
            LF H   +    SAT L+      +  ++I+HMD S MP  F++ + W+   +S++    
Sbjct  11   LFTHFLAVAVLSSATALE----SAERSSFIIHMDHSLMPLVFSNQEQWYLNAMSNLKSMN  66

Query  214  --------SNRGLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPG  369
                    S   L+Y Y +AIHGFSA+LS  ELE +KK PG+L + KD    +DT++T  
Sbjct  67   HPNPHRHQSQPKLLYTYRHAIHGFSAMLSTNELEYLKKLPGFLSAYKDKVGTLDTTYTYK  126

Query  370  FLGLSSDHGAWPATDYGRDVIIGVIDT  450
            FL L+   G WPA+D+G DVI+GVIDT
Sbjct  127  FLQLNHADGLWPASDFGNDVIVGVIDT  153



>gb|ABD28577.1| Proteinase inhibitor I9, subtilisin propeptide [Medicago truncatula]
 gb|AES80322.2| subtilisin-like serine protease [Medicago truncatula]
Length=771

 Score =   105 bits (261),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 53/135 (39%), Positives = 81/135 (60%), Gaps = 19/135 (14%)
 Frame = +1

Query  103  FSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSI-------------------SNRG  225
            F  + ++ TYI+HM+ SF P+ FT+H  WF +T+ S+                   S + 
Sbjct  21   FHSNAETSTYIIHMNKSFFPQVFTNHHDWFKSTIHSLKSKTLVLDDHDQQEEASMQSQKQ  80

Query  226  LVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWP  405
            LVY Y NA++GFSA+LS  ELE +  + G++ + +D +  +DT+HT  FL L S  G W 
Sbjct  81   LVYTYDNAMYGFSALLSSNELETLNNTDGFVAAYQDRTATMDTTHTFEFLSLDSPSGLWH  140

Query  406  ATDYGRDVIIGVIDT  450
            A+++G D+IIGVID+
Sbjct  141  ASNFGDDIIIGVIDS  155



>ref|XP_003624104.1| Subtilisin-like protease [Medicago truncatula]
Length=1278

 Score =   105 bits (262),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 53/134 (40%), Positives = 80/134 (60%), Gaps = 18/134 (13%)
 Frame = +1

Query  103  FSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSI------------------SNRGL  228
            F  + ++ TYI+HM+ SF P+ FT+H  WF +T+ S+                  S + L
Sbjct  784  FHSNAETSTYIIHMNKSFFPQVFTNHHDWFKSTIHSLKSKTLVLDDHDQQEASKQSQKKL  843

Query  229  VYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPA  408
            VY Y NA++GF A+LS  ELE IK   G++ + +D +  +DT+HT  FL L S  G W A
Sbjct  844  VYTYDNAMYGFCAMLSSNELEIIKNIDGFVSAYQDRTATIDTTHTFEFLSLDSPSGLWHA  903

Query  409  TDYGRDVIIGVIDT  450
            +++G D+I+GVID+
Sbjct  904  SNFGDDIIVGVIDS  917


 Score =   105 bits (261),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 53/135 (39%), Positives = 81/135 (60%), Gaps = 19/135 (14%)
 Frame = +1

Query  103  FSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSI-------------------SNRG  225
            F  + ++ TYI+HM+ SF P+ FT+H  WF +T+ S+                   S + 
Sbjct  21   FHSNAETSTYIIHMNKSFFPQVFTNHHDWFKSTIHSLKSKTLVLDDHDQQEEASMQSQKQ  80

Query  226  LVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWP  405
            LVY Y NA++GFSA+LS  ELE +  + G++ + +D +  +DT+HT  FL L S  G W 
Sbjct  81   LVYTYDNAMYGFSALLSSNELETLNNTDGFVAAYQDRTATMDTTHTFEFLSLDSPSGLWH  140

Query  406  ATDYGRDVIIGVIDT  450
            A+++G D+IIGVID+
Sbjct  141  ASNFGDDIIIGVIDS  155



>ref|XP_006655358.1| PREDICTED: subtilisin-like protease-like [Oryza brachyantha]
Length=761

 Score =   104 bits (260),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 51/114 (45%), Positives = 76/114 (67%), Gaps = 3/114 (3%)
 Frame = +1

Query  118  QSETYIVHMDLSFMPRAFTSHQSWF-SATLSSISNRGLVYAYTNAIHGFSAVLSPAELEA  294
            + E YIVHMD S MPRAF S  SW+ S   ++     ++Y Y +A+HGF+A ++  E+E 
Sbjct  35   EKEGYIVHMDKSAMPRAFASQASWYESPPAAAAPGADMLYVYDHAMHGFAAGVTAEEMER  94

Query  295  IKKSPGYLYSTKD--ASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDT  450
            ++ S G++   +D   +V+ DT+HTP FLG+S+  G W A+ YG DVI+GV+DT
Sbjct  95   LRASRGFVSCYRDDGRAVRRDTTHTPEFLGVSASGGLWEASRYGEDVIVGVVDT  148



>gb|ABR16566.1| unknown [Picea sitchensis]
Length=522

 Score =   102 bits (255),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 55/139 (40%), Positives = 83/139 (60%), Gaps = 10/139 (7%)
 Frame = +1

Query  55   ALFFHLAFISATFLQIFSID--GQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISNRG-  225
            ALFF +  ++   L + S D  G  ++YI++MD S MP  F+ HQ W+S+ +  +S    
Sbjct  13   ALFFMIVSLA---LWVPSSDALGARQSYIIYMDKSMMPDHFSLHQHWYSSMIKEVSGSNS  69

Query  226  ----LVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDH  393
                L+Y Y    HGF+A L+  E +A++   G L   +D++  + T+ TP FLGLSS H
Sbjct  70   DPTALLYTYDTVTHGFAACLTSTEAQAMENMDGCLSVFQDSTYGLHTTRTPDFLGLSSSH  129

Query  394  GAWPATDYGRDVIIGVIDT  450
            G WP + YG D+I+GV+DT
Sbjct  130  GLWPLSRYGDDIIVGVLDT  148



>gb|EYU45084.1| hypothetical protein MIMGU_mgv1a001942mg [Erythranthe guttata]
Length=736

 Score =   103 bits (257),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 58/138 (42%), Positives = 86/138 (62%), Gaps = 8/138 (6%)
 Frame = +1

Query  61   FFHLAFISATFLQIFSIDGQSE--TYIVHMDLSFMPRAFTSHQSWFSATLSSISNR----  222
            + H   + +  + ++S  GQ E  TYIVHMD   MP  F SH  W+S+T+SSI +     
Sbjct  3    YIHFLMLFSCLMLVYSNLGQCERSTYIVHMDKEAMPMIFPSHGHWYSSTISSIKSTHVQQ  62

Query  223  --GLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHG  396
               ++Y Y N +HGFSA LS  EL +++ SPG+L +  D ++ +DT+HT  FL L+   G
Sbjct  63   PPEIIYTYDNVVHGFSAQLSEDELHSLENSPGFLTAYIDRNLTLDTTHTYKFLSLNHVTG  122

Query  397  AWPATDYGRDVIIGVIDT  450
             WP ++YG D+I+GVID+
Sbjct  123  LWPTSNYGEDIIVGVIDS  140



>gb|KDP41709.1| hypothetical protein JCGZ_16116 [Jatropha curcas]
Length=764

 Score =   103 bits (257),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 51/121 (42%), Positives = 77/121 (64%), Gaps = 5/121 (4%)
 Frame = +1

Query  103  FSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISN-----RGLVYAYTNAIHGFSA  267
            FS   + ETYI+HMD S  P AF + +SW    L S+SN        +Y+Y + +HGFSA
Sbjct  30   FSGSEELETYIIHMDHSHKPAAFLTDESWHRQILKSLSNPVDKKERFLYSYNHVMHGFSA  89

Query  268  VLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVID  447
             L+ +++  ++KSP +L S +++  K+ ++++P FLGL   HG WPA  YG  VIIG++D
Sbjct  90   RLTRSQISELEKSPAHLASYQESFGKLFSTYSPKFLGLKHKHGLWPAASYGEGVIIGILD  149

Query  448  T  450
            T
Sbjct  150  T  150



>emb|CBI32394.3| unnamed protein product [Vitis vinifera]
Length=1135

 Score =   103 bits (258),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 52/114 (46%), Positives = 74/114 (65%), Gaps = 5/114 (4%)
 Frame = +1

Query  115  GQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISNRG-----LVYAYTNAIHGFSAVLSP  279
            G   +YI+HMD S MP  F+SH  W+ +TLSSIS+        +Y Y + + GFSAVLS 
Sbjct  3    GDVGSYIIHMDKSAMPMTFSSHHDWYMSTLSSISSPDGSLPTHLYTYNHVLDGFSAVLSK  62

Query  280  AELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGV  441
            A L+ ++K PG+L +  D+  K+ T+H+P FLGL  + GAWP   +G D+IIG+
Sbjct  63   AHLDQLEKMPGHLATYPDSFGKLHTTHSPKFLGLEKNSGAWPEGKFGEDMIIGL  116


 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 48/85 (56%), Gaps = 12/85 (14%)
 Frame = +1

Query  37   EMANHRALFFHLAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSIS  216
            E   ++ LF  LA  +       S+     TYI+HMD S MP  F+SH  W+ +TLSS+S
Sbjct  664  ECIPYKLLFLFLALST-------SVAEDLGTYIIHMDKSAMPMTFSSHHDWYRSTLSSMS  716

Query  217  N-RGL----VYAYTNAIHGFSAVLS  276
            +  G+    +Y Y + + GFSAVLS
Sbjct  717  SPDGILPTHLYTYNHVLDGFSAVLS  741



>gb|KJB59847.1| hypothetical protein B456_009G275900 [Gossypium raimondii]
Length=746

 Score =   103 bits (256),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 63/141 (45%), Positives = 88/141 (62%), Gaps = 15/141 (11%)
 Frame = +1

Query  43   ANHRALFFHLAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISNR  222
            A+H  L F   + S +F  IF+   Q++ YI+HMD S MP+AF   QSW+ ATLSS+S  
Sbjct  3    AHHINLLFICLYFSLSF--IFTKQVQADNYIIHMDHSAMPKAFAGRQSWYLATLSSLSAN  60

Query  223  GLVYAYTNAIHGFSAVLSPAEL-----EAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSS  387
              + A TN+       +  AEL      A+K S GY+ S +D +VK+DT+++  FL LSS
Sbjct  61   --LRANTNS------TIPTAELLYSYNHALKNSRGYVSSIRDKTVKLDTTYSFKFLRLSS  112

Query  388  DHGAWPATDYGRDVIIGVIDT  450
            D G WPA+ +G+DVIIG+I T
Sbjct  113  DAGLWPASGFGKDVIIGLIGT  133



>emb|CAN64995.1| hypothetical protein VITISV_001779 [Vitis vinifera]
Length=766

 Score =   103 bits (256),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 51/114 (45%), Positives = 76/114 (67%), Gaps = 5/114 (4%)
 Frame = +1

Query  124  ETYIVHMDLSFMPRAFTSHQSWFSATLSSI-SNRGLV----YAYTNAIHGFSAVLSPAEL  288
             TYIVHMD S MP  F+SH  W+ +TLSS  S  G++    Y Y + + GFSAVLS + L
Sbjct  29   RTYIVHMDKSAMPIPFSSHHDWYLSTLSSFYSPDGILPTHLYTYNHVLDGFSAVLSQSHL  88

Query  289  EAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDT  450
            + ++K PG+L +  +    + T+HTP FLGL ++ G+WP  ++G D++IG++DT
Sbjct  89   DQLEKMPGHLATYPETFGTIHTTHTPKFLGLENNFGSWPGGNFGEDMVIGILDT  142



>emb|CDX97540.1| BnaA05g25390D [Brassica napus]
Length=261

 Score = 99.4 bits (246),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 52/136 (38%), Positives = 80/136 (59%), Gaps = 5/136 (4%)
 Frame = +1

Query  55   ALFFHLAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISNRG---  225
            ++FF        F  + S DG  E+YIVH+  S  P  F+SH  W ++ L S+ +     
Sbjct  8    SVFFVFPLFLCFFSSLSSWDGL-ESYIVHVQSSHKPSLFSSHDHWHNSLLRSLPSSPQPA  66

Query  226  -LVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAW  402
             L+Y+Y+ A+ GFSA LSP +  A+++ P  +    D + ++ T+HTP FLG S + G W
Sbjct  67   TLLYSYSRAVQGFSARLSPTQTAALRRHPSVISVITDQAREIHTTHTPAFLGFSDNSGLW  126

Query  403  PATDYGRDVIIGVIDT  450
              ++YG DVI+GV+DT
Sbjct  127  SNSNYGEDVIVGVLDT  142



>ref|XP_006847087.1| hypothetical protein AMTR_s00017p00215540 [Amborella trichopoda]
 gb|ERN08668.1| hypothetical protein AMTR_s00017p00215540 [Amborella trichopoda]
Length=409

 Score =   100 bits (249),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 59/136 (43%), Positives = 80/136 (59%), Gaps = 8/136 (6%)
 Frame = +1

Query  61   FFHLAFISATFLQIFSI-DGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSI-SNRG---  225
            FF L F   T +   SI D   + YI+HMD+  MP  F++HQ W+ + LSS+ S RG   
Sbjct  6    FFFLVF--TTIIATSSIADDVHKPYIIHMDILAMPALFSTHQHWYDSLLSSLDSPRGKSP  63

Query  226  -LVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAW  402
             L+Y Y + I GFSA+LS + L+ ++  P +L    D+   + TS TP FLGL    G W
Sbjct  64   RLLYVYRHVIKGFSAMLSGSHLQQLQAMPAHLGMYPDSYGTLHTSRTPNFLGLRKQTGIW  123

Query  403  PATDYGRDVIIGVIDT  450
            P T +G D IIG+IDT
Sbjct  124  PVTKFGNDTIIGIIDT  139



>ref|XP_003579757.1| PREDICTED: subtilisin-like protease [Brachypodium distachyon]
Length=775

 Score =   102 bits (254),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 57/149 (38%), Positives = 90/149 (60%), Gaps = 16/149 (11%)
 Frame = +1

Query  46   NHRALFFHLAFISATFLQI---FSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSIS  216
            NHRA   H+  +S  FL +    +  G    YIV MD+S MP  FT+H+ W+++ LSS+ 
Sbjct  2    NHRA--SHMLSVSFFFLLVAYTCAAGGDRRPYIVQMDVSAMPAPFTTHEGWYTSVLSSLG  59

Query  217  NRGL----VYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGL-  381
            N+      +Y Y +A++GFSAVL+P +L AI++   ++ +  +   ++ T+ TP FLGL 
Sbjct  60   NKEAAPEHLYTYAHAMNGFSAVLTPRQLSAIQRMSAHVAAFPETYARLHTTRTPEFLGLI  119

Query  382  ------SSDHGAWPATDYGRDVIIGVIDT  450
                  +   G WPA++YG DVI+G++DT
Sbjct  120  NGAGGSAPAGGVWPASNYGDDVIVGIVDT  148



>gb|KDP41712.1| hypothetical protein JCGZ_16119 [Jatropha curcas]
Length=732

 Score =   102 bits (254),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 51/118 (43%), Positives = 71/118 (60%), Gaps = 15/118 (13%)
 Frame = +1

Query  142  MDLSFMPRAFTSHQSWFSATLSSISNRGL---------------VYAYTNAIHGFSAVLS  276
            MD S MPR F  H+ W+ +  +S+    L               VY+Y N  HGF+AVLS
Sbjct  1    MDKSLMPRTFNDHKDWYFSITNSLKFTKLSSSETAHRSSPVHPFVYSYENVAHGFAAVLS  60

Query  277  PAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDT  450
            P+ELE ++ S G++ + +D    +DT+HT  FL L+S  G WPA+++G DVIIGVIDT
Sbjct  61   PSELETLRNSTGFVSAYRDRMATIDTTHTFEFLSLNSTTGLWPASNFGEDVIIGVIDT  118



>ref|XP_008657904.1| PREDICTED: subtilisin-like protease [Zea mays]
Length=825

 Score =   102 bits (253),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 51/117 (44%), Positives = 76/117 (65%), Gaps = 10/117 (9%)
 Frame = +1

Query  130  YIVHMDLSFMPRAFTSHQSWFSATLSSISNRG--------LVYAYTNAIHGFSAVLSPAE  285
            YIVHMD S MPR  + H+ W++AT++S+++          L+Y Y  A+HGF+A LS +E
Sbjct  62   YIVHMDKSAMPRHHSDHRDWYAATVASVTDASAGVRTKPQLLYTYDEALHGFAATLSASE  121

Query  286  LEAIKKSPGYL--YSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDT  450
            L A++  PG++  Y  + A+   DT+H+  FL L+S  G WPA+ +G  VIIG+IDT
Sbjct  122  LRALRGQPGFVSVYPDRRATTLHDTTHSMEFLNLNSASGLWPASKFGEGVIIGMIDT  178



>ref|XP_002272769.1| PREDICTED: subtilisin-like protease [Vitis vinifera]
Length=771

 Score =   101 bits (251),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 52/136 (38%), Positives = 87/136 (64%), Gaps = 9/136 (7%)
 Frame = +1

Query  55   ALFFHLAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISNRG---  225
            +L   L+ +SAT     S+D +S+T++VH+  S  P A+ +H  W+S+ + S+++ G   
Sbjct  9    SLILCLSLVSATL----SLD-ESQTFVVHVSKSHKPSAYATHHHWYSSIVRSLASSGQPS  63

Query  226  -LVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAW  402
             ++Y+Y  A +GFSA L+ A+   +++ PG L    D + ++ T+ TP FLGL+ ++G W
Sbjct  64   KILYSYERAANGFSARLTAAQASELRRVPGVLSVLPDRAHQIHTTRTPHFLGLADNYGLW  123

Query  403  PATDYGRDVIIGVIDT  450
            P +DY  DVIIGV+DT
Sbjct  124  PNSDYADDVIIGVLDT  139



>ref|XP_004975630.1| PREDICTED: subtilisin-like protease-like [Setaria italica]
Length=773

 Score =   101 bits (251),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 50/124 (40%), Positives = 76/124 (61%), Gaps = 12/124 (10%)
 Frame = +1

Query  115  GQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISNRGL------------VYAYTNAIHG  258
            G+  +YIV MD+  MP  F  H+ W+ + LSS+++               +Y YT+ +HG
Sbjct  24   GERRSYIVQMDVEKMPAPFVEHEGWYLSVLSSLASATTTAAGESAPPPVHLYTYTHVMHG  83

Query  259  FSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIG  438
            FSA L+ A+LEA+K   G++ +  +   ++ T+ TP FLGLS+  G WPA+ YG DVIIG
Sbjct  84   FSAALTTAQLEALKAVDGHVAAFPETYGRLHTTRTPEFLGLSAGAGLWPASKYGDDVIIG  143

Query  439  VIDT  450
            ++DT
Sbjct  144  IVDT  147



>gb|AFW84453.1| putative subtilase family protein [Zea mays]
Length=770

 Score =   101 bits (251),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 51/117 (44%), Positives = 76/117 (65%), Gaps = 10/117 (9%)
 Frame = +1

Query  130  YIVHMDLSFMPRAFTSHQSWFSATLSSISNRG--------LVYAYTNAIHGFSAVLSPAE  285
            YIVHMD S MPR  + H+ W++AT++S+++          L+Y Y  A+HGF+A LS +E
Sbjct  38   YIVHMDKSAMPRHHSDHRDWYAATVASVTDASAGVRTKPQLLYTYDEALHGFAATLSASE  97

Query  286  LEAIKKSPGYL--YSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDT  450
            L A++  PG++  Y  + A+   DT+H+  FL L+S  G WPA+ +G  VIIG+IDT
Sbjct  98   LRALRGQPGFVSVYPDRRATTLHDTTHSMEFLNLNSASGLWPASKFGEGVIIGMIDT  154



>ref|XP_007017192.1| Subtilisin-like serine protease 2, putative [Theobroma cacao]
 gb|EOY14417.1| Subtilisin-like serine protease 2, putative [Theobroma cacao]
Length=1160

 Score =   101 bits (252),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 51/114 (45%), Positives = 76/114 (67%), Gaps = 5/114 (4%)
 Frame = +1

Query  124  ETYIVHMDLSFMPRAFTSHQSWFSATLSSISNR-----GLVYAYTNAIHGFSAVLSPAEL  288
            +TYIVHMD S  P +F +H+SW  ATL S+S        L+Y+Y + +HGFSA L+P+++
Sbjct  439  KTYIVHMDHSRKPSSFLTHESWHRATLRSLSKPVDDKDMLLYSYNHVMHGFSARLTPSQV  498

Query  289  EAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDT  450
              +KKSP ++ + ++A  K+ T+H+P FLGL    G W A+ YG  VII +ID+
Sbjct  499  SELKKSPAHVATREEAFGKLFTTHSPEFLGLRHSFGLWNASSYGEGVIIALIDS  552



>ref|XP_010068558.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
Length=765

 Score =   101 bits (251),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 53/139 (38%), Positives = 80/139 (58%), Gaps = 6/139 (4%)
 Frame = +1

Query  52   RALFFHLAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSIS-----  216
            R     L  +S     + S   + +TYI+HMD S  P +F +H++W  AT+ SIS     
Sbjct  14   RNAILWLLLLSTVTSFVMSESEERQTYIIHMDHSQKPASFPTHETWHRATVDSISPSLSD  73

Query  217  -NRGLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDH  393
                 +Y+Y +  HGFSA L+P+EL  I++SP +  + K++  K+ T+H+  FLGL    
Sbjct  74   GEDKFLYSYNHVTHGFSARLTPSELAKIEESPAHRATIKESFGKLFTTHSSKFLGLKHSS  133

Query  394  GAWPATDYGRDVIIGVIDT  450
            G WP + YG  VIIG++DT
Sbjct  134  GLWPNSSYGEGVIIGILDT  152



>gb|KCW63975.1| hypothetical protein EUGRSUZ_G01657, partial [Eucalyptus grandis]
Length=743

 Score =   100 bits (250),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 53/139 (38%), Positives = 80/139 (58%), Gaps = 6/139 (4%)
 Frame = +1

Query  52   RALFFHLAFISATFLQIFSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSIS-----  216
            R     L  +S     + S   + +TYI+HMD S  P +F +H++W  AT+ SIS     
Sbjct  9    RNAILWLLLLSTVTSFVMSESEERQTYIIHMDHSQKPASFPTHETWHRATVDSISPSLSD  68

Query  217  -NRGLVYAYTNAIHGFSAVLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDH  393
                 +Y+Y +  HGFSA L+P+EL  I++SP +  + K++  K+ T+H+  FLGL    
Sbjct  69   GEDKFLYSYNHVTHGFSARLTPSELAKIEESPAHRATIKESFGKLFTTHSSKFLGLKHSS  128

Query  394  GAWPATDYGRDVIIGVIDT  450
            G WP + YG  VIIG++DT
Sbjct  129  GLWPNSSYGEGVIIGILDT  147



>ref|XP_006847107.1| hypothetical protein AMTR_s00017p00219220 [Amborella trichopoda]
 gb|ERN08688.1| hypothetical protein AMTR_s00017p00219220 [Amborella trichopoda]
Length=757

 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 51/114 (45%), Positives = 73/114 (64%), Gaps = 3/114 (3%)
 Frame = +1

Query  118  QSETYIVHMDLSFMPRAFTSHQSWFSA---TLSSISNRGLVYAYTNAIHGFSAVLSPAEL  288
            +  TYI+HMD S MP A  +HQ W  A    LS +     +Y+Y +A+HGFSA LSP+EL
Sbjct  26   ERSTYIIHMDDSAMPSAHKTHQQWHQAILVALSPVDPPPHLYSYDHALHGFSASLSPSEL  85

Query  289  EAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDT  450
            + + +S G++ + +D    +DT+HT  F+GL SD G  P + YG  VIIG++DT
Sbjct  86   DELSRSHGFVSAYRDVQATLDTTHTFEFIGLGSDTGLGPKSGYGSGVIIGMVDT  139



>ref|XP_011000657.1| PREDICTED: subtilisin-like protease [Populus euphratica]
Length=783

 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 51/121 (42%), Positives = 77/121 (64%), Gaps = 5/121 (4%)
 Frame = +1

Query  103  FSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISNRGLV-----YAYTNAIHGFSA  267
            FS     +TYI+HMD + MP  F++   W+ +TLSS+S+   +     Y+Y + + GFSA
Sbjct  27   FSTSNDRKTYIIHMDKTGMPSTFSTQHDWYVSTLSSLSSPDDIPPIHLYSYKHVMDGFSA  86

Query  268  VLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVID  447
            VLS   L+ ++  PG++ +  ++   + T+HTP FLGL+   GAWPA  +G DVIIGV+D
Sbjct  87   VLSQTHLDQLESLPGHVATFPESIGHLHTTHTPKFLGLNKRAGAWPAGKFGDDVIIGVLD  146

Query  448  T  450
            T
Sbjct  147  T  147



>ref|XP_002313857.1| hypothetical protein POPTR_0009s10340g [Populus trichocarpa]
 gb|EEE87812.1| hypothetical protein POPTR_0009s10340g [Populus trichocarpa]
Length=758

 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 51/121 (42%), Positives = 77/121 (64%), Gaps = 5/121 (4%)
 Frame = +1

Query  103  FSIDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISNRGLV-----YAYTNAIHGFSA  267
            FS     +TYI+HMD + MP  F++   W+ +TLSS+S+   +     Y+Y + + GFSA
Sbjct  23   FSTSNDRKTYIIHMDKTGMPSTFSTQHDWYVSTLSSLSSPDDIPPIHLYSYKHVMDGFSA  82

Query  268  VLSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVID  447
            VLS   L+ ++  PG++ +  ++   + T+HTP FLGL+   GAWPA  +G DVIIGV+D
Sbjct  83   VLSQTHLDQLESLPGHVATFPESIGHLHTTHTPKFLGLNKRAGAWPAGKFGDDVIIGVLD  142

Query  448  T  450
            T
Sbjct  143  T  143



>ref|XP_008382901.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=543

 Score = 99.8 bits (247),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 48/119 (40%), Positives = 80/119 (67%), Gaps = 10/119 (8%)
 Frame = +1

Query  124  ETYIVHMDLSFMPRAFTSHQSWFSATLSSIS----------NRGLVYAYTNAIHGFSAVL  273
            +TYI+HMD S  P +F +H++W  +T+ S+S          +  L+Y+Y++ +HGFSA L
Sbjct  28   QTYIIHMDHSHKPESFLTHEAWHKSTVKSLSSSSPXENGDGSEMLLYSYSHVMHGFSARL  87

Query  274  SPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDT  450
            +P++L  ++KSP ++ +  ++  K+ T+H+P FLGL  + G WP   +G+DVIIG+IDT
Sbjct  88   TPSQLSRLEKSPAHVATYXESFGKMFTTHSPKFLGLRQNLGLWPNASFGQDVIIGIIDT  146



>ref|XP_008352138.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease [Malus 
domestica]
Length=620

 Score = 99.8 bits (247),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 48/119 (40%), Positives = 80/119 (67%), Gaps = 10/119 (8%)
 Frame = +1

Query  124  ETYIVHMDLSFMPRAFTSHQSWFSATLSSIS----------NRGLVYAYTNAIHGFSAVL  273
            +TYI+HMD S  P +F +H++W  +T+ S+S          +  L+Y+Y++ +HGFSA L
Sbjct  28   QTYIIHMDHSHKPESFLTHEAWHKSTVKSLSSSSPXENGDGSEMLLYSYSHVMHGFSARL  87

Query  274  SPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDT  450
            +P++L  ++KSP ++ +  ++  K+ T+H+P FLGL  + G WP   +G+DVIIG+IDT
Sbjct  88   TPSQLSRLEKSPAHVATYXESFGKMFTTHSPKFLGLRQNLGLWPNASFGQDVIIGIIDT  146



>ref|XP_008793983.1| PREDICTED: subtilisin-like protease [Phoenix dactylifera]
Length=769

 Score =   100 bits (248),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 51/120 (43%), Positives = 78/120 (65%), Gaps = 6/120 (5%)
 Frame = +1

Query  109  IDGQSETYIVHMDLSFMPRAFTSHQSWFSATLSSI-SNRGL-----VYAYTNAIHGFSAV  270
            +D     YI+HMD S MP  F++H+SW ++ LSS+ S  G      +Y Y++ +HGFSAV
Sbjct  27   LDDDRRPYIIHMDPSAMPVPFSTHESWHTSILSSLPSPPGAAPPDHLYTYSHVMHGFSAV  86

Query  271  LSPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDT  450
            LS A +E + + PG++    D+  ++ T+HTP FLGLS   G WP + +G D+IIG++D+
Sbjct  87   LSSAHVEHLARRPGHVAIHPDSYGRLHTTHTPKFLGLSRHSGLWPMSGFGDDMIIGLVDS  146



>ref|XP_008357007.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease, partial 
[Malus domestica]
Length=662

 Score = 99.8 bits (247),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 47/119 (39%), Positives = 79/119 (66%), Gaps = 10/119 (8%)
 Frame = +1

Query  124  ETYIVHMDLSFMPRAFTSHQSWFSATLSSI----------SNRGLVYAYTNAIHGFSAVL  273
            +TYI+HMD S  P +F +H++W  +T+ S+           +  L+Y+Y++ +HGFSA L
Sbjct  28   QTYIIHMDHSHKPESFLTHEAWHKSTVKSLSSSSPAENGDGSEMLLYSYSHVMHGFSARL  87

Query  274  SPAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDT  450
            +P++L  ++KSP ++ +  ++  K+ T+H+P FLGL  + G WP   +G+DVIIG+IDT
Sbjct  88   TPSQLSRLEKSPAHVATYPESFGKMFTTHSPKFLGLRQNLGLWPNASFGQDVIIGIIDT  146



>gb|EPS74243.1| subtilase family protein, partial [Genlisea aurea]
Length=751

 Score = 99.8 bits (247),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 49/118 (42%), Positives = 71/118 (60%), Gaps = 6/118 (5%)
 Frame = +1

Query  115  GQSETYIVHMDLSFMPRAFTSHQSWFSATLSSISNR------GLVYAYTNAIHGFSAVLS  276
            G+  TYIVH+  S  PR F+SH  W+S+ + S+  R       L+Y+Y  A+ GFSA LS
Sbjct  1    GERRTYIVHVSKSHKPRVFSSHHHWYSSVVESLPRRRGEGPAKLLYSYDRAVRGFSAHLS  60

Query  277  PAELEAIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDT  450
              + +A+++ PG +    D    + T+ TP FLGL+   G WP +DY  DVI+GV+DT
Sbjct  61   GDQADALRRVPGVISLVPDERRVLHTTRTPQFLGLADSFGLWPNSDYADDVIVGVLDT  118



>gb|KFK38761.1| hypothetical protein AALP_AA3G157200 [Arabis alpina]
Length=775

 Score = 99.8 bits (247),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 47/113 (42%), Positives = 72/113 (64%), Gaps = 4/113 (4%)
 Frame = +1

Query  124  ETYIVHMDLSFMPRAFTSHQSWFSATLSSISNRG----LVYAYTNAIHGFSAVLSPAELE  291
            E+YIVH+  S  P  F+SH+ W ++ L S+ +      L+Y+Y+ A+HGFSA LSP +  
Sbjct  28   ESYIVHVQRSHKPSLFSSHKHWHNSLLRSLPSSPKPATLLYSYSRAVHGFSAQLSPIQTA  87

Query  292  AIKKSPGYLYSTKDASVKVDTSHTPGFLGLSSDHGAWPATDYGRDVIIGVIDT  450
             + ++P  +    D + ++ T+HTP FLG S + G W  +DYG DVI+GV+DT
Sbjct  88   VLLRNPAVISVIPDQAREIHTTHTPAFLGFSDNSGLWSNSDYGEDVIVGVLDT  140



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 553272586920