BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001N05

Length=558
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

dbj|BAF46304.1|  cysteine proteinase precursor                          332   7e-109   Ipomoea nil [qian niu]
gb|AAK48495.1|AF259983_1  putative cysteine protease                    230   1e-69    Ipomoea batatas [batate]
ref|XP_011069730.1|  PREDICTED: low-temperature-induced cysteine ...    229   3e-69    Sesamum indicum [beniseed]
ref|XP_011074404.1|  PREDICTED: low-temperature-induced cysteine ...    222   1e-66    Sesamum indicum [beniseed]
ref|XP_009769754.1|  PREDICTED: low-temperature-induced cysteine ...    217   1e-64    Nicotiana sylvestris
dbj|BAE80740.1|  cysteine proteinase                                    217   1e-64    Platycodon grandiflorus [balloon-flower]
ref|XP_009613155.1|  PREDICTED: low-temperature-induced cysteine ...    217   1e-64    Nicotiana tomentosiformis
gb|EYU36326.1|  hypothetical protein MIMGU_mgv1a005614mg                217   2e-64    Erythranthe guttata [common monkey flower]
ref|NP_001234324.1|  low-temperature-induced cysteine proteinase ...    214   1e-63    Solanum lycopersicum
dbj|BAD29957.1|  cysteine protease                                      212   6e-63    Daucus carota [carrots]
ref|NP_001274877.1|  low-temperature-induced cysteine proteinase-...    213   7e-63    Solanum tuberosum [potatoes]
ref|XP_004238129.1|  PREDICTED: low-temperature-induced cysteine ...    213   9e-63    Solanum lycopersicum
gb|EPS63305.1|  hypothetical protein M569_11479                         212   1e-62    Genlisea aurea
gb|AAX84673.1|  cysteine protease CP1                                   212   1e-62    Manihot esculenta [manioc]
ref|XP_006473275.1|  PREDICTED: cysteine proteinase RD21a-like          211   3e-62    Citrus sinensis [apfelsine]
gb|ABG33750.1|  cysteine protease                                       211   3e-62    Hevea brasiliensis [jebe]
ref|XP_003550321.1|  PREDICTED: cysteine proteinase RD21a-like          211   5e-62    Glycine max [soybeans]
ref|XP_003589134.1|  Cysteine proteinase                                205   6e-62    
emb|CDP01294.1|  unnamed protein product                                210   8e-62    Coffea canephora [robusta coffee]
gb|AFO83614.1|  papain-like cysteine protease                           210   8e-62    Fagopyrum esculentum
ref|XP_006342644.1|  PREDICTED: low-temperature-induced cysteine ...    209   1e-61    Solanum tuberosum [potatoes]
gb|KDP41692.1|  hypothetical protein JCGZ_16099                         209   1e-61    Jatropha curcas
gb|KHN22488.1|  Cysteine proteinase RD21a                               209   2e-61    Glycine soja [wild soybean]
ref|XP_006354848.1|  PREDICTED: cysteine proteinase RD21a-like          208   4e-61    
gb|AEZ65083.1|  cysteine protease                                       208   4e-61    Carica papaya [mamon]
ref|XP_011029381.1|  PREDICTED: cysteine proteinase RD21a               207   9e-61    Populus euphratica
ref|XP_010059895.1|  PREDICTED: low-temperature-induced cysteine ...    207   1e-60    Eucalyptus grandis [rose gum]
ref|XP_003545327.1|  PREDICTED: cysteine proteinase RD21a-like          206   2e-60    
ref|XP_007160879.1|  hypothetical protein PHAVU_001G024500g             206   3e-60    Phaseolus vulgaris [French bean]
emb|CAB17076.1|  cysteine proteinase precursor                          205   3e-60    Phaseolus vulgaris [French bean]
ref|XP_010270819.1|  PREDICTED: cysteine proteinase RD21a-like          206   4e-60    Nelumbo nucifera [Indian lotus]
gb|KCW66364.1|  hypothetical protein EUGRSUZ_F00184                     205   7e-60    Eucalyptus grandis [rose gum]
ref|XP_009775102.1|  PREDICTED: low-temperature-induced cysteine ...    205   8e-60    Nicotiana sylvestris
emb|CAN61026.1|  hypothetical protein VITISV_001146                     204   1e-59    Vitis vinifera
gb|ABQ10204.1|  cysteine protease Cp6                                   204   1e-59    Actinidia deliciosa [Chinese gooseberry]
ref|XP_003589135.1|  Cysteine proteinase                                204   1e-59    
ref|XP_002510170.1|  cysteine protease, putative                        204   2e-59    Ricinus communis
ref|XP_006494485.1|  PREDICTED: cysteine proteinase RD21a-like          201   2e-59    Citrus sinensis [apfelsine]
ref|XP_003589133.1|  Cysteine proteinase                                204   2e-59    Medicago truncatula
gb|KDO79088.1|  hypothetical protein CISIN_1g017419mg                   201   2e-59    Citrus sinensis [apfelsine]
gb|KJB14609.1|  hypothetical protein B456_002G133800                    204   2e-59    Gossypium raimondii
ref|XP_007017153.1|  Granulin repeat cysteine protease family pro...    203   2e-59    Theobroma cacao [chocolate]
gb|KJB14610.1|  hypothetical protein B456_002G133800                    203   2e-59    Gossypium raimondii
gb|KHG05637.1|  Cysteinease RD21a -like protein                         202   5e-59    Gossypium arboreum [tree cotton]
ref|XP_006374886.1|  cysteine proteinase                                202   6e-59    Populus trichocarpa [western balsam poplar]
emb|CAA46863.1|  thiolprotease                                          202   7e-59    Pisum sativum [garden pea]
gb|AGV15823.1|  cysteine protease CP15                                  202   9e-59    Nicotiana tabacum [American tobacco]
ref|XP_009604895.1|  PREDICTED: low-temperature-induced cysteine ...    201   2e-58    Nicotiana tomentosiformis
dbj|BAD29958.1|  cysteine protease                                      201   2e-58    Daucus carota [carrots]
dbj|BAD29960.1|  cysteine protease                                      200   3e-58    Daucus carota [carrots]
ref|XP_009772520.1|  PREDICTED: cysteine proteinase RD21a-like          200   4e-58    Nicotiana sylvestris
ref|XP_002284973.1|  PREDICTED: low-temperature-induced cysteine ...    200   5e-58    Vitis vinifera
ref|XP_006425969.1|  hypothetical protein CICLE_v10025887mg             197   8e-58    Citrus clementina [clementine]
gb|KJB48623.1|  hypothetical protein B456_008G078300                    192   1e-57    Gossypium raimondii
ref|XP_009354165.1|  PREDICTED: low-temperature-induced cysteine ...    199   2e-57    Pyrus x bretschneideri [bai li]
ref|XP_006434711.1|  hypothetical protein CICLE_v100010541mg            189   2e-57    
gb|AER60490.1|  cysteine proteases                                      196   2e-57    Gossypium hirsutum [American cotton]
ref|XP_008393776.1|  PREDICTED: low-temperature-induced cysteine ...    198   2e-57    
ref|XP_004499026.1|  PREDICTED: cysteine proteinase RD21a-like          198   2e-57    Cicer arietinum [garbanzo]
gb|KJB48626.1|  hypothetical protein B456_008G078300                    193   3e-57    Gossypium raimondii
gb|AJA74414.1|  cysteine protease                                       198   4e-57    Cicer arietinum [garbanzo]
gb|KJB48624.1|  hypothetical protein B456_008G078300                    193   4e-57    Gossypium raimondii
ref|XP_009359945.1|  PREDICTED: low-temperature-induced cysteine ...    197   5e-57    Pyrus x bretschneideri [bai li]
ref|XP_011097243.1|  PREDICTED: cysteine proteinase COT44               194   9e-57    Sesamum indicum [beniseed]
ref|XP_011088223.1|  PREDICTED: low-temperature-induced cysteine ...    196   1e-56    Sesamum indicum [beniseed]
ref|XP_009591184.1|  PREDICTED: cysteine proteinase RD21a-like          196   1e-56    Nicotiana tomentosiformis
ref|XP_002524912.1|  cysteine protease, putative                        194   1e-56    
gb|KJB48625.1|  hypothetical protein B456_008G078300                    193   3e-56    Gossypium raimondii
gb|KJB48622.1|  hypothetical protein B456_008G078300                    193   3e-56    Gossypium raimondii
ref|XP_009395501.1|  PREDICTED: oryzain alpha chain-like                195   3e-56    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010244238.1|  PREDICTED: cysteine proteinase RD21a-like          195   3e-56    Nelumbo nucifera [Indian lotus]
ref|XP_004291075.1|  PREDICTED: cysteine proteinase RD21a               195   3e-56    Fragaria vesca subsp. vesca
ref|XP_003603086.1|  Cysteine proteinase                                195   4e-56    Medicago truncatula
ref|XP_010549252.1|  PREDICTED: cysteine proteinase RD21a-like          194   7e-56    Tarenaya hassleriana [spider flower]
ref|XP_010691718.1|  PREDICTED: cysteine proteinase RD21a-like          194   9e-56    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007042494.1|  Granulin repeat cysteine protease family pro...    195   2e-55    
gb|EYU25464.1|  hypothetical protein MIMGU_mgv1a006201mg                192   3e-55    Erythranthe guttata [common monkey flower]
ref|XP_004230752.1|  PREDICTED: cysteine proteinase RD21a-like          192   3e-55    Solanum lycopersicum
gb|AAQ62999.1|  oil palm polygalacturonase allergen PEST472             193   4e-55    Elaeis guineensis
gb|KJB63901.1|  hypothetical protein B456_010G022700                    192   5e-55    Gossypium raimondii
ref|XP_006346518.1|  PREDICTED: cysteine proteinase RD21a-like          191   9e-55    Solanum tuberosum [potatoes]
ref|XP_010906541.1|  PREDICTED: oryzain alpha chain-like                191   1e-54    Elaeis guineensis
gb|ABR19827.1|  cysteine proteinase                                     191   1e-54    Elaeis guineensis
ref|XP_010928366.1|  PREDICTED: oryzain alpha chain-like                191   1e-54    Elaeis guineensis
dbj|BAC75923.1|  cysteine protease-1                                    191   1e-54    Helianthus annuus
emb|CAE54307.1|  cysteine proteinase                                    189   1e-54    Gossypium hirsutum [American cotton]
ref|XP_010107858.1|  Cysteine proteinase RD21a                          191   1e-54    Morus notabilis
ref|XP_009784112.1|  PREDICTED: cysteine proteinase COT44-like          188   1e-54    Nicotiana sylvestris
ref|XP_008365104.1|  PREDICTED: low-temperature-induced cysteine ...    191   2e-54    
gb|KJB43804.1|  hypothetical protein B456_007G216900                    185   2e-54    Gossypium raimondii
ref|XP_008813817.1|  PREDICTED: low-temperature-induced cysteine ...    190   2e-54    Phoenix dactylifera
gb|ABQ10202.1|  cysteine protease Cp4                                   190   3e-54    Actinidia deliciosa [Chinese gooseberry]
emb|CDO97206.1|  unnamed protein product                                190   3e-54    Coffea canephora [robusta coffee]
gb|KJB58559.1|  hypothetical protein B456_009G214900                    189   3e-54    Gossypium raimondii
gb|AAK07730.1|  CPR1-like cysteine proteinase                           187   4e-54    Nicotiana tabacum [American tobacco]
ref|XP_008342944.1|  PREDICTED: cysteine proteinase RD21a-like          189   5e-54    
gb|KJB58557.1|  hypothetical protein B456_009G214900                    189   6e-54    Gossypium raimondii
ref|XP_008799871.1|  PREDICTED: oryzain alpha chain-like isoform X1     189   7e-54    
emb|CAB16317.1|  cysteine proteinase precursor                          187   7e-54    Nicotiana tabacum [American tobacco]
ref|XP_010070600.1|  PREDICTED: cysteine proteinase COT44-like          187   8e-54    Eucalyptus grandis [rose gum]
ref|XP_008361440.1|  PREDICTED: cysteine proteinase RD21a-like          184   8e-54    
ref|XP_010556436.1|  PREDICTED: cysteine proteinase RD21a-like          188   9e-54    Tarenaya hassleriana [spider flower]
gb|KHG00992.1|  Cysteinease RD21a -like protein                         186   1e-53    Gossypium arboreum [tree cotton]
ref|NP_001242660.1|  uncharacterized protein LOC100807362 precursor     186   2e-53    Glycine max [soybeans]
gb|ABQ10200.1|  cysteine protease Cp2                                   186   2e-53    Actinidia deliciosa [Chinese gooseberry]
gb|KHG12125.1|  Cysteinease RD21a -like protein                         190   2e-53    Gossypium arboreum [tree cotton]
gb|KDP31986.1|  hypothetical protein JCGZ_12447                         185   2e-53    Jatropha curcas
ref|XP_008236565.1|  PREDICTED: cysteine proteinase RD21a-like          187   3e-53    Prunus mume [ume]
ref|XP_008377786.1|  PREDICTED: cysteine proteinase RD21a-like          184   3e-53    
gb|KJB43803.1|  hypothetical protein B456_007G216900                    185   3e-53    Gossypium raimondii
gb|KJB43805.1|  hypothetical protein B456_007G216900                    184   4e-53    Gossypium raimondii
ref|XP_009618803.1|  PREDICTED: cysteine proteinase COT44-like          184   5e-53    Nicotiana tomentosiformis
gb|KDP47124.1|  hypothetical protein JCGZ_22120                         181   5e-53    Jatropha curcas
ref|XP_011000919.1|  PREDICTED: cysteine proteinase RD21a-like          187   6e-53    Populus euphratica
ref|XP_002518705.1|  cysteine protease, putative                        186   7e-53    Ricinus communis
ref|XP_007199820.1|  hypothetical protein PRUPE_ppa005328mg             186   8e-53    
ref|XP_011000142.1|  PREDICTED: cysteine proteinase RD21a-like          186   9e-53    Populus euphratica
ref|XP_004304028.1|  PREDICTED: cysteine proteinase RD21a-like          186   1e-52    Fragaria vesca subsp. vesca
ref|XP_007047371.1|  Granulin repeat cysteine protease family pro...    184   1e-52    
ref|XP_010094652.1|  Cysteine proteinase RD21a                          186   1e-52    Morus notabilis
gb|AEZ65082.1|  cysteine protease                                       185   2e-52    Carica papaya [mamon]
gb|KHN04480.1|  Cysteine proteinase RD21a                               182   2e-52    Glycine soja [wild soybean]
gb|EYU37647.1|  hypothetical protein MIMGU_mgv1a005905mg                185   2e-52    Erythranthe guttata [common monkey flower]
ref|XP_010061721.1|  PREDICTED: low-temperature-induced cysteine ...    185   2e-52    Eucalyptus grandis [rose gum]
ref|XP_009390984.1|  PREDICTED: oryzain alpha chain-like                185   2e-52    Musa acuminata subsp. malaccensis [pisang utan]
emb|CAQ00115.1|  papain-like cysteine proteinase                        177   3e-52    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002310708.2|  hypothetical protein POPTR_0007s10650g             182   4e-52    Populus trichocarpa [western balsam poplar]
ref|XP_010540378.1|  PREDICTED: cysteine proteinase RD21a-like          184   4e-52    Tarenaya hassleriana [spider flower]
ref|XP_002306486.2|  hypothetical protein POPTR_0005s18520g             182   5e-52    
ref|XP_002313136.2|  hypothetical protein POPTR_0009s10090g             184   6e-52    
ref|XP_008220266.1|  PREDICTED: low-temperature-induced cysteine ...    184   7e-52    Prunus mume [ume]
ref|XP_002298740.2|  hypothetical protein POPTR_0001s30950g             184   9e-52    
ref|XP_006343212.1|  PREDICTED: cysteine proteinase RD21a-like          181   9e-52    
gb|KCW68708.1|  hypothetical protein EUGRSUZ_F02310                     183   1e-51    Eucalyptus grandis [rose gum]
dbj|BAD16614.1|  cysteine proteinase                                    183   1e-51    Dianthus caryophyllus [carnation]
ref|XP_007222885.1|  hypothetical protein PRUPE_ppa005199mg             183   1e-51    Prunus persica
ref|XP_006393620.1|  hypothetical protein EUTSA_v10011464mg             183   1e-51    Eutrema salsugineum [saltwater cress]
ref|XP_002285299.1|  PREDICTED: cysteine proteinase RD21a-like          182   2e-51    Vitis vinifera
gb|EYU34557.1|  hypothetical protein MIMGU_mgv1a007408mg                181   2e-51    Erythranthe guttata [common monkey flower]
gb|ACU13684.1|  unknown                                                 176   3e-51    Glycine max [soybeans]
gb|KHN08598.1|  Cysteine proteinase RD21a                               181   4e-51    Glycine soja [wild soybean]
gb|KHG18408.1|  Cysteinease RD21a -like protein                         179   5e-51    Gossypium arboreum [tree cotton]
ref|XP_009398671.1|  PREDICTED: oryzain alpha chain-like                181   6e-51    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008350332.1|  PREDICTED: LOW QUALITY PROTEIN: cysteine pro...    181   8e-51    
ref|XP_009396268.1|  PREDICTED: oryzain alpha chain-like                181   1e-50    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009335017.1|  PREDICTED: cysteine proteinase RD21a-like is...    181   1e-50    Pyrus x bretschneideri [bai li]
ref|XP_009335016.1|  PREDICTED: cysteine proteinase RD21a-like is...    181   1e-50    Pyrus x bretschneideri [bai li]
ref|XP_009358749.1|  PREDICTED: cysteine proteinase RD21a-like          180   1e-50    Pyrus x bretschneideri [bai li]
dbj|BAD29954.1|  cysteine protease                                      181   1e-50    Daucus carota [carrots]
gb|ABQ10198.1|  actinidin Act4b                                         178   1e-50    Actinidia eriantha
gb|KEH44128.1|  papain family cysteine protease                         180   2e-50    Medicago truncatula
ref|XP_002283263.1|  PREDICTED: cysteine proteinase COT44               177   2e-50    Vitis vinifera
gb|KFK44641.1|  hypothetical protein AALP_AA1G285100                    179   2e-50    Arabis alpina [alpine rockcress]
gb|AAC49455.1|  Pseudotzain                                             179   3e-50    Pseudotsuga menziesii
gb|AHY28813.1|  cysteine protease                                       171   4e-50    Pinus elliottii [American pitch pine]
gb|ACB87490.1|  mucunain                                                178   4e-50    Mucuna pruriens
gb|KHN27075.1|  Cysteine proteinase RD21a                               177   4e-50    Glycine soja [wild soybean]
emb|CAB17074.1|  cysteine proteinase precursor                          176   5e-50    Phaseolus vulgaris [French bean]
gb|AHY28814.1|  cysteine protease                                       171   5e-50    Pinus palustris [longleaf pine]
gb|AAL60579.1|AF454957_1  senescence-associated cysteine protease       178   6e-50    Brassica oleracea
emb|CDX71540.1|  BnaC04g17750D                                          178   6e-50    
ref|XP_006595983.1|  PREDICTED: cysteine proteinase RD21a-like          173   6e-50    
ref|XP_003550041.1|  PREDICTED: cysteine proteinase RD21a-like          176   6e-50    Glycine max [soybeans]
gb|AAW66796.1|  cysteine protease                                       171   7e-50    Pinus taeda
ref|XP_011008779.1|  PREDICTED: cysteine proteinase COT44               176   7e-50    Populus euphratica
ref|XP_010028205.1|  PREDICTED: cysteine proteinase COT44-like          176   8e-50    Eucalyptus grandis [rose gum]
ref|XP_006403303.1|  hypothetical protein EUTSA_v10003205mg             178   9e-50    Eutrema salsugineum [saltwater cress]
gb|KEH31479.1|  papain family cysteine protease                         175   1e-49    Medicago truncatula
gb|KHN30007.1|  Cysteine proteinase RD21a                               176   1e-49    Glycine soja [wild soybean]
gb|AFO83613.1|  papain-like cysteine protease                           175   1e-49    Fagopyrum esculentum
gb|AAL14614.1|AF417109_1  cysteine proteinase precursor                 170   1e-49    Vasconcellea cundinamarcensis
ref|XP_010548429.1|  PREDICTED: germination-specific cysteine pro...    175   2e-49    Tarenaya hassleriana [spider flower]
ref|XP_006422960.1|  hypothetical protein CICLE_v10028338mg             177   2e-49    Citrus clementina [clementine]
ref|XP_003547817.1|  PREDICTED: cysteine proteinase RD21a               175   2e-49    Glycine max [soybeans]
gb|AAB68374.1|  cysteine endopeptidase 1                                174   2e-49    Phaseolus vulgaris [French bean]
gb|ACU18172.1|  unknown                                                 174   3e-49    Glycine max [soybeans]
emb|CDY22370.1|  BnaA06g36920D                                          177   3e-49    Brassica napus [oilseed rape]
gb|AIF75887.1|  cysteine protease                                       169   3e-49    Pinus massoniana [Chinese red pine]
gb|AIF75886.1|  cysteine protease                                       169   3e-49    Pinus massoniana [Chinese red pine]
gb|AFK47737.1|  unknown                                                 174   3e-49    Medicago truncatula
gb|ABZ69059.1|  cysteine protease                                       169   3e-49    Pinus radiata
ref|XP_009101816.1|  PREDICTED: cysteine proteinase RD21a               177   3e-49    Brassica rapa
gb|AAW66804.1|  cysteine protease                                       169   3e-49    Pinus taeda
gb|AAW66801.1|  cysteine protease                                       169   4e-49    Pinus taeda
gb|AAW66794.1|  cysteine protease                                       169   4e-49    Pinus taeda
emb|CAA53377.1|  cysteine protease                                      174   4e-49    Vicia sativa [spring vetch]
ref|XP_004141903.1|  PREDICTED: germination-specific cysteine pro...    174   4e-49    Cucumis sativus [cucumbers]
dbj|BAD95392.1|  cysteine proteinase RD21A                              176   4e-49    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006487026.1|  PREDICTED: cysteine proteinase RD21a-like          176   5e-49    Citrus sinensis [apfelsine]
ref|XP_008238897.1|  PREDICTED: cysteine proteinase COT44               174   5e-49    Prunus mume [ume]
gb|KDO59789.1|  hypothetical protein CISIN_1g012022mg                   176   5e-49    Citrus sinensis [apfelsine]
ref|XP_009367558.1|  PREDICTED: cysteine proteinase COT44-like          174   6e-49    
gb|AAW66797.1|  cysteine protease                                       168   7e-49    Pinus taeda
ref|NP_564497.1|  cysteine proteinase RD21a                             176   7e-49    Arabidopsis thaliana [mouse-ear cress]
gb|AAK62661.1|  F2G19.31/F2G19.31                                       176   7e-49    Arabidopsis thaliana [mouse-ear cress]
gb|ABK24233.1|  unknown                                                 175   9e-49    Picea sitchensis
gb|ABS83496.1|  cysteine protease                                       168   1e-48    Pinus pinaster [cluster pine]
gb|ABZ69061.1|  cysteine protease                                       169   1e-48    Pinus sylvestris [Scotch pine]
ref|XP_010494270.1|  PREDICTED: cysteine proteinase RD21a-like          175   1e-48    Camelina sativa [gold-of-pleasure]
gb|AIF75890.1|  cysteine protease                                       167   1e-48    Pinus massoniana [Chinese red pine]
gb|AAW66799.1|  cysteine protease                                       167   1e-48    Pinus taeda
ref|XP_007205396.1|  hypothetical protein PRUPE_ppa007467mg             172   1e-48    Prunus persica
gb|KHN22490.1|  Cysteine proteinase RD21a                               172   1e-48    Glycine soja [wild soybean]
ref|XP_004496965.1|  PREDICTED: cysteine proteinase RD21a-like is...    175   2e-48    Cicer arietinum [garbanzo]
dbj|BAH20463.1|  cysteine protease                                      175   2e-48    Spinacia oleracea
ref|XP_004496966.1|  PREDICTED: cysteine proteinase RD21a-like is...    175   2e-48    
ref|XP_010093524.1|  Germination-specific cysteine protease 1           172   2e-48    
ref|XP_006280322.1|  hypothetical protein CARUB_v10026245mg             175   2e-48    
gb|ABQ10192.1|  actinidin Act2a                                         172   2e-48    Actinidia deliciosa [Chinese gooseberry]
ref|XP_009400290.1|  PREDICTED: oryzain alpha chain-like                174   2e-48    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010481911.1|  PREDICTED: cysteine proteinase RD21a               174   3e-48    Camelina sativa [gold-of-pleasure]
gb|ABQ10197.1|  actinidin Act4a                                         172   3e-48    Actinidia eriantha
gb|ABQ10191.1|  actinidin Act1c                                         172   3e-48    Actinidia eriantha
ref|XP_004234718.1|  PREDICTED: cysteine proteinase COT44-like          172   3e-48    
ref|XP_008454976.1|  PREDICTED: low-temperature-induced cysteine ...    174   3e-48    Cucumis melo [Oriental melon]
ref|XP_004231872.1|  PREDICTED: zingipain-2-like                        172   3e-48    Solanum lycopersicum
ref|XP_008340386.1|  PREDICTED: cysteine proteinase COT44-like          172   3e-48    
ref|NP_568620.1|  Granulin repeat cysteine protease family protein      173   5e-48    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007155893.1|  hypothetical protein PHAVU_003G240800g             171   5e-48    Phaseolus vulgaris [French bean]
gb|KFK31760.1|  hypothetical protein AALP_AA6G155800                    173   5e-48    Arabis alpina [alpine rockcress]
ref|XP_008440309.1|  PREDICTED: cysteine proteinase COT44-like          171   6e-48    Cucumis melo [Oriental melon]
ref|XP_010028191.1|  PREDICTED: cysteine proteinase COT44-like          171   6e-48    Eucalyptus grandis [rose gum]
gb|KHN12823.1|  Cysteine proteinase RD21a                               171   7e-48    Glycine soja [wild soybean]
ref|XP_004136967.1|  PREDICTED: cysteine proteinase RD21a-like          173   8e-48    Cucumis sativus [cucumbers]
ref|XP_010442084.1|  PREDICTED: cysteine proteinase RD21a-like          172   1e-47    Camelina sativa [gold-of-pleasure]
ref|XP_006339859.1|  PREDICTED: cysteine proteinase RD21a-like          170   1e-47    Solanum tuberosum [potatoes]
ref|NP_001242584.1|  uncharacterized protein LOC100804015 precursor     170   1e-47    Glycine max [soybeans]
ref|XP_010688590.1|  PREDICTED: low-temperature-induced cysteine ...    172   1e-47    Beta vulgaris subsp. vulgaris [field beet]
dbj|BAG16371.1|  cysteine protease                                      172   1e-47    Brassica oleracea var. italica [asparagus broccoli]
dbj|BAJ92693.1|  predicted protein                                      168   1e-47    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002863697.1|  hypothetical protein ARALYDRAFT_917391             172   2e-47    Arabidopsis lyrata subsp. lyrata
emb|CDY17093.1|  BnaC06g00260D                                          172   2e-47    Brassica napus [oilseed rape]
ref|XP_010906543.1|  PREDICTED: ervatamin-B-like                        169   2e-47    Elaeis guineensis
ref|XP_007136708.1|  hypothetical protein PHAVU_009G067300g             169   2e-47    Phaseolus vulgaris [French bean]
ref|XP_008338342.1|  PREDICTED: cysteine proteinase COT44-like          169   2e-47    
gb|AAL60580.1|AF454958_1  senescence-associated cysteine protease       172   3e-47    Brassica oleracea
ref|XP_002894032.1|  F2G19.31/F2G19.31                                  171   3e-47    
dbj|BAG16377.1|  cysteine protease                                      170   4e-47    Brassica rapa var. perviridis [kabuna]
ref|XP_009123448.1|  PREDICTED: LOW QUALITY PROTEIN: cysteine pro...    171   4e-47    
emb|CDY06760.1|  BnaA10g05390D                                          170   7e-47    
dbj|BAJ85145.1|  predicted protein                                      169   1e-46    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ACR34204.1|  unknown                                                 170   1e-46    Zea mays [maize]
ref|XP_008668054.1|  PREDICTED: cysteine protease 1 isoform X1          169   1e-46    Zea mays [maize]
ref|XP_004289205.2|  PREDICTED: cysteine proteinase COT44               167   1e-46    Fragaria vesca subsp. vesca
ref|XP_010487882.1|  PREDICTED: probable cysteine proteinase At3g...    165   1e-46    Camelina sativa [gold-of-pleasure]
tpg|DAA35450.1|  TPA: cysteine protease 1                               170   2e-46    
ref|NP_001150266.1|  cysteine protease 1 precursor                      169   2e-46    
gb|EPS71857.1|  senescence-associated cysteine protease                 166   3e-46    Genlisea aurea
ref|XP_009372437.1|  PREDICTED: cysteine proteinase COT44-like          166   3e-46    Pyrus x bretschneideri [bai li]
gb|ABQ10194.1|  actinidin Act2c                                         167   4e-46    Actinidia arguta
gb|ABK24495.1|  unknown                                                 168   4e-46    Picea sitchensis
dbj|BAC75927.1|  cysteine protease-5                                    166   5e-46    Helianthus annuus
emb|CDY17044.1|  BnaA08g04080D                                          168   5e-46    Brassica napus [oilseed rape]
emb|CDY63586.1|  BnaCnng42340D                                          167   1e-45    Brassica napus [oilseed rape]
ref|XP_004960237.1|  PREDICTED: oryzain beta chain-like isoform X2      167   1e-45    Setaria italica
emb|CAQ00105.1|  papain-like cysteine proteinase                        167   1e-45    Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDY46179.1|  BnaA05g20660D                                          167   1e-45    Brassica napus [oilseed rape]
ref|XP_004960236.1|  PREDICTED: oryzain beta chain-like isoform X1      167   1e-45    
ref|XP_009145796.1|  PREDICTED: probable cysteine proteinase At3g...    166   2e-45    Brassica rapa
ref|XP_010555986.1|  PREDICTED: LOW QUALITY PROTEIN: probable cys...    166   2e-45    Tarenaya hassleriana [spider flower]
gb|AAL60578.1|AF454956_1  senescence-associated cysteine protease       166   2e-45    Brassica oleracea
ref|XP_009396437.1|  PREDICTED: oryzain alpha chain-like                166   3e-45    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008796470.1|  PREDICTED: oryzain alpha chain-like                166   4e-45    Phoenix dactylifera
gb|AFR11773.1|  cysteine protease                                       163   4e-45    Fragaria x ananassa
emb|CDX99227.1|  BnaC05g33420D                                          166   4e-45    
ref|XP_010507701.1|  PREDICTED: probable cysteine proteinase At3g...    165   4e-45    Camelina sativa [gold-of-pleasure]
emb|CDY25228.1|  BnaC02g30040D                                          166   4e-45    Brassica napus [oilseed rape]
ref|XP_010466086.1|  PREDICTED: probable cysteine proteinase At3g...    163   5e-45    Camelina sativa [gold-of-pleasure]
ref|XP_008796668.1|  PREDICTED: oryzain alpha chain-like                166   5e-45    Phoenix dactylifera
ref|XP_010919166.1|  PREDICTED: oryzain alpha chain-like                159   6e-45    
gb|ABQ10193.1|  actinidin Act2b                                         163   7e-45    Actinidia eriantha
ref|XP_010487883.1|  PREDICTED: probable cysteine proteinase At3g...    164   7e-45    Camelina sativa [gold-of-pleasure]
emb|CDY17193.1|  BnaA05g09950D                                          161   9e-45    Brassica napus [oilseed rape]
gb|ABQ10195.1|  actinidin Act2d                                         163   9e-45    Actinidia eriantha
gb|AFW59667.1|  hypothetical protein ZEAMMB73_680472                    162   1e-44    
gb|EPS62067.1|  cysteine proteinase                                     160   1e-44    Genlisea aurea
ref|NP_974341.1|  putative cysteine proteinase                          160   2e-44    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006855225.1|  hypothetical protein AMTR_s00051p00208220          164   3e-44    
ref|XP_010500237.1|  PREDICTED: cysteine proteinase RD21a-like          163   5e-44    Camelina sativa [gold-of-pleasure]
ref|XP_009420643.1|  PREDICTED: oryzain alpha chain-like                163   5e-44    
ref|XP_010932205.1|  PREDICTED: oryzain alpha chain-like                162   6e-44    
dbj|BAG50406.1|  peptidase                                              154   7e-44    
ref|XP_010466085.1|  PREDICTED: probable cysteine proteinase At3g...    162   8e-44    
ref|XP_010466084.1|  PREDICTED: probable cysteine proteinase At3g...    162   9e-44    
gb|ABQ10196.1|  actinidin Act3a                                         160   9e-44    
ref|XP_003580684.2|  PREDICTED: oryzain alpha chain-like                162   9e-44    
ref|XP_006307278.1|  hypothetical protein CARUB_v10008893mg             162   1e-43    
ref|NP_566633.1|  Granulin repeat cysteine protease family protein      161   2e-43    
dbj|BAF02546.1|  triticain alpha                                        161   2e-43    
gb|ABU51882.1|  ervatamin-C precursor                                   159   2e-43    
gb|EMT10408.1|  Oryzain alpha chain                                     161   2e-43    
sp|P25776.2|ORYA_ORYSJ  RecName: Full=Oryzain alpha chain; Flags:...    161   2e-43    
gb|KJB58558.1|  hypothetical protein B456_009G214900                    160   2e-43    
dbj|BAC43113.1|  putative cysteine proteinase RD21A precursor           159   2e-43    
ref|XP_009412959.1|  PREDICTED: oryzain alpha chain-like                159   3e-43    
dbj|BAA14402.1|  oryzain alpha precursor                                160   3e-43    
ref|NP_566634.2|  putative cysteine proteinase                          159   3e-43    
gb|EEE61807.1|  hypothetical protein OsJ_16426                          160   3e-43    
ref|XP_010479116.1|  PREDICTED: cysteine proteinase RD21a               160   3e-43    
gb|AFW59668.1|  LOW QUALITY PROTEIN: cysteine protease 1                160   3e-43    
ref|NP_567686.2|  putative cysteine proteinase                          158   3e-43    
emb|CAA20473.1|  cysteine proteinase-like protein                       158   3e-43    
ref|XP_010461511.1|  PREDICTED: cysteine proteinase RD21a-like          160   3e-43    
ref|XP_007145379.1|  hypothetical protein PHAVU_007G234100g             160   3e-43    
tpg|DAA35682.1|  TPA: cysteine proteinase Mir3                          160   3e-43    
ref|XP_009388208.1|  PREDICTED: oryzain alpha chain-like                158   4e-43    
pir||TAGB  actinidain (EC 3.4.22.14) precursor - kiwi fruit             159   4e-43 
dbj|BAJ33895.1|  unnamed protein product                                159   4e-43    
ref|NP_001150196.1|  cysteine protease 1 precursor                      160   4e-43    
ref|NP_001149658.1|  cysteine protease 1 precursor                      160   4e-43    
gb|ADQ85986.1|  actinidin                                               159   4e-43    
sp|A5HII1.1|ACTN_ACTDE  RecName: Full=Actinidain; Short=Actinidin...    158   5e-43    
ref|NP_001148706.1|  cysteine protease 1 precursor                      160   5e-43    
gb|ADQ85985.1|  actinidin                                               158   5e-43    
ref|XP_010927504.1|  PREDICTED: oryzain alpha chain-like                160   5e-43    
gb|EEC78138.1|  hypothetical protein OsI_17694                          159   7e-43    
dbj|BAH11164.1|  cysteine protease                                      159   8e-43    
ref|XP_006297986.1|  hypothetical protein CARUB_v10014028mg             157   9e-43    
ref|XP_006396922.1|  hypothetical protein EUTSA_v10028681mg             159   9e-43    
ref|XP_002883178.1|  hypothetical protein ARALYDRAFT_479457             159   9e-43    
emb|CAA34486.1|  unnamed protein product                                157   9e-43    
ref|XP_006652996.1|  PREDICTED: oryzain beta chain-like                 159   1e-42    
emb|CAJ86180.1|  H0212B02.7                                             159   1e-42    
gb|KFK39253.1|  hypothetical protein AALP_AA3G220200                    159   1e-42    
gb|EPS63179.1|  hypothetical protein M569_11610                         154   1e-42    
gb|AEV40973.1|  putative oryzain beta chain precursor                   159   2e-42    
ref|XP_006406504.1|  hypothetical protein EUTSA_v10020714mg             158   2e-42    
gb|ABQ10190.1|  actinidin Act1b                                         157   2e-42    
ref|XP_006287995.1|  hypothetical protein CARUB_v10001228mg             156   2e-42    
emb|CDY50157.1|  BnaA01g26170D                                          158   2e-42    
ref|XP_008344336.1|  PREDICTED: probable cysteine proteinase At3g...    150   3e-42    
emb|CDX95456.1|  BnaC01g33480D                                          155   4e-42    
ref|XP_010435084.1|  PREDICTED: probable cysteine proteinase At4g...    155   5e-42    
ref|XP_004169515.1|  PREDICTED: cysteine proteinase RD21a-like          157   5e-42    
gb|KGN55227.1|  hypothetical protein Csa_4G641600                       157   5e-42    
ref|XP_004141271.1|  PREDICTED: cysteine proteinase RD21a-like          157   6e-42    
emb|CDX95457.1|  BnaC01g33490D                                          157   6e-42    
ref|XP_004977049.1|  PREDICTED: oryzain alpha chain-like                157   6e-42    
ref|XP_002448736.1|  hypothetical protein SORBIDRAFT_06g032320          157   7e-42    
ref|XP_006297656.1|  hypothetical protein CARUB_v10013678mg             157   7e-42    
gb|AAP41847.1|  senescence-associated cysteine protease                 157   8e-42    
sp|P00785.4|ACTN_ACTCH  RecName: Full=Actinidain; Short=Actinidin...    155   1e-41    
gb|AEV41071.1|  putative oryzain beta chain precursor                   156   1e-41    
ref|XP_010422086.1|  PREDICTED: probable cysteine proteinase At4g...    154   1e-41    
gb|AEV41117.1|  putative oryzain beta chain precursor                   156   1e-41    
gb|AAU81594.1|  cysteine proteinase                                     149   1e-41    
ref|XP_002867702.1|  hypothetical protein ARALYDRAFT_329301             154   2e-41    
dbj|BAN33745.1|  cysteine protease a                                    154   2e-41    
ref|NP_001105993.1|  cysteine protease component of protease-inhi...    155   2e-41    
emb|CDY50154.1|  BnaA01g26140D                                          155   2e-41    
ref|XP_009111878.1|  PREDICTED: probable cysteine proteinase At3g...    155   2e-41    
ref|XP_009111886.1|  PREDICTED: probable cysteine proteinase At3g...    155   3e-41    
ref|XP_004292313.1|  PREDICTED: xylem cysteine proteinase 1             153   3e-41    
gb|KFK39254.1|  hypothetical protein AALP_AA3G220300                    152   4e-41    
ref|XP_006396923.1|  hypothetical protein EUTSA_v10028733mg             153   4e-41    
ref|XP_010455537.1|  PREDICTED: probable cysteine proteinase At4g...    153   5e-41    
ref|XP_008357550.1|  PREDICTED: probable cysteine proteinase At3g...    147   5e-41    
ref|XP_010422085.1|  PREDICTED: probable cysteine proteinase At4g...    153   5e-41    
ref|XP_006652923.1|  PREDICTED: oryzain alpha chain-like                154   5e-41    
ref|XP_008452589.1|  PREDICTED: low-temperature-induced cysteine ...    155   5e-41    
ref|XP_004971418.1|  PREDICTED: xylem cysteine proteinase 2-like        152   7e-41    
ref|XP_010455538.1|  PREDICTED: probable cysteine proteinase At4g...    152   7e-41    
ref|NP_001266166.1|  uncharacterized protein LOC101492472               151   7e-41    
emb|CDY63262.1|  BnaCnng41770D                                          149   9e-41    
ref|XP_008678577.1|  PREDICTED: oryzain alpha chain-like                152   1e-40    
ref|XP_002872576.1|  hypothetical protein ARALYDRAFT_489965             152   1e-40    
ref|XP_010436251.1|  PREDICTED: xylem cysteine proteinase 1-like        150   1e-40    
ref|NP_567377.1|  putative cysteine proteinase                          151   2e-40    
ref|XP_009102734.1|  PREDICTED: xylem cysteine proteinase 1             151   2e-40    
ref|XP_004171356.1|  PREDICTED: cysteine proteinase RD21a-like          146   2e-40    
ref|XP_009128675.1|  PREDICTED: probable cysteine proteinase At4g...    151   2e-40    
emb|CAE04498.2|  OSJNBb0059K02.8                                        153   2e-40    
ref|NP_001104879.1|  cysteine proteinase Mir3 precursor                 153   2e-40    
dbj|BAN33746.1|  cysteine protease a2                                   151   2e-40    
ref|XP_007043092.1|  Xylem cysteine peptidase 1                         150   2e-40    
gb|KFK30176.1|  hypothetical protein AALP_AA7G227600                    150   3e-40    
ref|XP_006422409.1|  hypothetical protein CICLE_v10028739mg             150   4e-40    
gb|KFK31907.1|  hypothetical protein AALP_AA6G174500                    150   4e-40    
ref|XP_006289222.1|  hypothetical protein CARUB_v10002678mg             150   4e-40    
ref|XP_010435073.1|  PREDICTED: probable cysteine proteinase At4g...    150   7e-40    
ref|XP_007135980.1|  hypothetical protein PHAVU_009G008100g             149   8e-40    
gb|KJB77459.1|  hypothetical protein B456_012G138700                    149   1e-39    
emb|CDX75496.1|  BnaA01g02060D                                          149   1e-39    
ref|NP_974687.1|  xylem cysteine proteinase 1                           147   1e-39    
ref|XP_006283942.1|  hypothetical protein CARUB_v10005061mg             149   1e-39    
ref|XP_003527269.1|  PREDICTED: xylem cysteine proteinase 2-like        148   2e-39    
gb|AJA74416.1|  cysteine protease                                       147   2e-39    
ref|XP_004161017.1|  PREDICTED: xylem cysteine proteinase 1-like        148   2e-39    
ref|XP_006384862.1|  XYLEM CYSTEINE PEPTIDASE 1 family protein          148   2e-39    
ref|XP_004144898.1|  PREDICTED: xylem cysteine proteinase 1-like        148   2e-39    
dbj|BAD29956.1|  cysteine protease                                      149   2e-39    
emb|CDX69132.1|  BnaC01g03210D                                          149   3e-39    
ref|NP_567376.1|  putative cysteine proteinase                          148   3e-39    
ref|XP_006415025.1|  hypothetical protein EUTSA_v10007664mg             149   3e-39    
gb|ACE96957.1|  peptidase C1A papain                                    142   3e-39    
gb|ACE96960.1|  peptidase C1A papain                                    142   3e-39    
ref|XP_011040826.1|  PREDICTED: xylem cysteine proteinase 1             147   3e-39    
ref|XP_010446933.1|  PREDICTED: xylem cysteine proteinase 1             147   4e-39    
ref|XP_007135981.1|  hypothetical protein PHAVU_009G008200g             147   4e-39    
ref|XP_008451198.1|  PREDICTED: xylem cysteine proteinase 1-like        147   4e-39    
gb|ACU18142.1|  unknown                                                 147   4e-39    
ref|XP_010433893.1|  PREDICTED: zingipain-2-like                        147   4e-39    
ref|XP_010437483.1|  PREDICTED: xylem cysteine proteinase 1-like ...    147   5e-39    
ref|XP_003522989.1|  PREDICTED: xylem cysteine proteinase 2             147   5e-39    
gb|AAM13065.1|  drought-inducible cysteine proteinase RD21A precu...    147   5e-39    
gb|ACE96974.1|  peptidase C1A papain                                    141   5e-39    
gb|EMT26055.1|  Xylem cysteine proteinase 1                             147   5e-39    
ref|XP_009391873.1|  PREDICTED: xylem cysteine proteinase 1-like        147   6e-39    
ref|XP_006285150.1|  hypothetical protein CARUB_v10006494mg             147   7e-39    
ref|NP_567983.1|  xylem cysteine proteinase 1                           147   7e-39    
ref|XP_009115337.1|  PREDICTED: probable cysteine proteinase At4g...    147   8e-39    
ref|XP_006284015.1|  hypothetical protein CARUB_v10005136mg             147   8e-39    
gb|EMS56635.1|  Oryzain alpha chain                                     149   1e-38    
gb|EMS68758.1|  Oryzain beta chain                                      148   1e-38    
ref|XP_004500831.1|  PREDICTED: xylem cysteine proteinase 2-like        146   1e-38    
ref|XP_003522988.1|  PREDICTED: xylem cysteine proteinase 2-like        146   1e-38    
ref|XP_002877310.1|  hypothetical protein ARALYDRAFT_484828             146   1e-38    
emb|CAQ00106.1|  papain-like cysteine proteinase                        148   2e-38    
gb|AAA79915.1|  cysteine proteinase                                     147   2e-38    
emb|CAQ00103.1|  papain-like cysteine proteinase                        145   2e-38    
ref|XP_009137125.1|  PREDICTED: zingipain-2                             145   2e-38    
emb|CDX95451.1|  BnaC01g33430D                                          147   2e-38    
ref|XP_002872575.1|  hypothetical protein ARALYDRAFT_911472             146   2e-38    
ref|XP_009128676.1|  PREDICTED: probable cysteine proteinase At4g...    146   2e-38    
ref|XP_010448692.1|  PREDICTED: zingipain-2-like                        145   2e-38    
ref|NP_195406.2|  cysteine proteinase1                                  145   3e-38    
dbj|BAF00916.1|  cysteine proteinase                                    145   3e-38    
ref|XP_010231852.1|  PREDICTED: xylem cysteine proteinase 1-like        145   3e-38    
ref|XP_006412113.1|  hypothetical protein EUTSA_v10025568mg             145   3e-38    
ref|XP_010445171.1|  PREDICTED: zingipain-2-like                        145   3e-38    
emb|CDY46178.1|  BnaA05g20650D                                          145   4e-38    
sp|Q94B08.2|GCP1_ARATH  RecName: Full=Germination-specific cystei...    145   4e-38    
ref|NP_566867.1|  putative cysteine proteinase                          145   4e-38    
ref|XP_009145795.1|  PREDICTED: probable cysteine proteinase At3g...    146   4e-38    
gb|ACE96966.1|  peptidase C1A papain                                    139   5e-38    
gb|ACI00280.1|  triticain beta 2                                        146   5e-38    
dbj|BAK03074.1|  predicted protein                                      146   5e-38    
ref|XP_003579458.1|  PREDICTED: oryzain beta chain-like                 146   6e-38    
emb|CDY37617.1|  BnaCnng08320D                                          144   7e-38    
ref|XP_010526865.1|  PREDICTED: xylem cysteine proteinase 1             144   1e-37    
ref|XP_010679531.1|  PREDICTED: cysteine proteinase COT44-like          144   1e-37    
dbj|BAF93840.1|  triticain beta 2                                       145   1e-37    
ref|XP_010437247.1|  PREDICTED: germination-specific cysteine pro...    144   1e-37    
ref|XP_010090710.1|  Xylem cysteine proteinase 1                        144   1e-37    
gb|AAP32193.1|  cysteine protease 14                                    143   1e-37    
gb|AAP32192.1|  cysteine protease 14                                    143   1e-37    
emb|CAQ00104.1|  papain-like cysteine proteinase                        143   2e-37    
dbj|BAF02547.1|  triticain beta                                         145   2e-37    
ref|XP_003527271.1|  PREDICTED: xylem cysteine proteinase 2-like        143   2e-37    
ref|XP_002963113.1|  hypothetical protein SELMODRAFT_270344             145   2e-37    
ref|XP_002869093.1|  hypothetical protein ARALYDRAFT_491113             143   2e-37    
ref|XP_008453002.1|  PREDICTED: xylem cysteine proteinase 2             142   3e-37    
ref|XP_002980210.1|  hypothetical protein SELMODRAFT_153766             144   3e-37    
gb|AFW59666.1|  hypothetical protein ZEAMMB73_680472                    138   3e-37    
ref|XP_009384829.1|  PREDICTED: xylem cysteine proteinase 1-like        142   3e-37    
ref|XP_010928804.1|  PREDICTED: xylem cysteine proteinase 1-like        142   3e-37    
gb|KHN33772.1|  Xylem cysteine proteinase 2                             142   3e-37    
ref|XP_010645699.1|  PREDICTED: xylem cysteine proteinase 1             142   3e-37    
dbj|BAH82657.1|  cysteine protease                                      141   3e-37    
ref|XP_010432076.1|  PREDICTED: germination-specific cysteine pro...    142   4e-37    
gb|AAM65468.1|  cysteine proteinase                                     142   4e-37    
gb|KCW70346.1|  hypothetical protein EUGRSUZ_F03589                     140   5e-37    
ref|XP_010446685.1|  PREDICTED: germination-specific cysteine pro...    142   5e-37    
ref|XP_006844723.1|  hypothetical protein AMTR_s00016p00253110          142   5e-37    
gb|EPS58726.1|  cysteine proteinase                                     137   6e-37    
ref|XP_006291187.1|  hypothetical protein CARUB_v10017312mg             143   6e-37    
ref|XP_010690568.1|  PREDICTED: xylem cysteine proteinase 2             141   7e-37    
ref|XP_002868998.1|  cysteine proteinase                                142   7e-37    
ref|XP_008235821.1|  PREDICTED: xylem cysteine proteinase 1             141   8e-37    
ref|XP_007201382.1|  hypothetical protein PRUPE_ppa007891mg             141   8e-37    
gb|KDP47019.1|  hypothetical protein JCGZ_10746                         141   9e-37    
ref|XP_008382503.1|  PREDICTED: xylem cysteine proteinase 1-like        141   1e-36    
ref|XP_009340788.1|  PREDICTED: xylem cysteine proteinase 1-like        141   1e-36    
ref|XP_003580686.1|  PREDICTED: oryzain alpha chain-like isoform X1     141   1e-36    
ref|XP_003603871.1|  Cysteine proteinase                                141   1e-36    
ref|XP_006305193.1|  hypothetical protein CARUB_v10009557mg             141   1e-36    
gb|ACU23856.1|  unknown                                                 141   1e-36    
ref|XP_010240524.1|  PREDICTED: oryzain alpha chain-like isoform X2     141   1e-36    
ref|XP_007018686.1|  Xylem cysteine peptidase 1                         141   1e-36    
ref|XP_004168497.1|  PREDICTED: xylem cysteine proteinase 1-like        140   1e-36    
ref|XP_004145553.1|  PREDICTED: xylem cysteine proteinase 1-like        140   1e-36    
ref|XP_009109364.1|  PREDICTED: cysteine proteinase COT44-like          141   1e-36    
ref|XP_006849990.1|  hypothetical protein AMTR_s00022p00165270          140   1e-36    
ref|XP_011034818.1|  PREDICTED: xylem cysteine proteinase 2-like        140   2e-36    
ref|XP_002273243.2|  PREDICTED: xylem cysteine proteinase 1             140   2e-36    
ref|XP_010498526.1|  PREDICTED: xylem cysteine proteinase 2-like        140   2e-36    
ref|XP_006647791.1|  PREDICTED: xylem cysteine proteinase 1-like        140   2e-36    
gb|EPS64955.1|  cysteine protease                                       135   2e-36    
gb|KDO85216.1|  hypothetical protein CISIN_1g0186492mg                  139   2e-36    
ref|XP_009620556.1|  PREDICTED: xylem cysteine proteinase 1-like        140   3e-36    
ref|XP_006411912.1|  hypothetical protein EUTSA_v10025483mg             140   3e-36    
emb|CDY01351.1|  BnaA07g11240D                                          140   3e-36    
ref|XP_009390652.1|  PREDICTED: xylem cysteine proteinase 1-like        140   3e-36    
ref|XP_009103325.1|  PREDICTED: xylem cysteine proteinase 2             140   3e-36    
ref|XP_008799257.1|  PREDICTED: xylem cysteine proteinase 1-like        140   3e-36    
gb|EMT14712.1|  Xylem cysteine proteinase 1                             140   3e-36    
ref|XP_011100156.1|  PREDICTED: xylem cysteine proteinase 2-like        140   3e-36    
ref|XP_010063152.1|  PREDICTED: xylem cysteine proteinase 2             140   3e-36    
ref|XP_002301901.2|  hypothetical protein POPTR_0002s00720g             140   3e-36    
gb|AEV41024.1|  putative oryzain beta chain precursor                   141   4e-36    



>dbj|BAF46304.1| cysteine proteinase precursor [Ipomoea nil]
Length=474

 Score =   332 bits (850),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 171/171 (100%), Positives = 171/171 (100%), Gaps = 0/171 (0%)
 Frame = +3

Query  45   MARPSILFTFLFavvsaaaaaaEDMSIITYDQQHPAKGLVRSEDEVKEMFESWLVKHGKS  224
            MARPSILFTFLFAVVSAAAAAAEDMSIITYDQQHPAKGLVRSEDEVKEMFESWLVKHGKS
Sbjct  1    MARPSILFTFLFAVVSAAAAAAEDMSIITYDQQHPAKGLVRSEDEVKEMFESWLVKHGKS  60

Query  225  YNAVDEKDKRFKIFRDNLKYIDEKNSLENRSYKLGLNRFADITNEEYRTGYLGAKRDASR  404
            YNAVDEKDKRFKIFRDNLKYIDEKNSLENRSYKLGLNRFADITNEEYRTGYLGAKRDASR
Sbjct  61   YNAVDEKDKRFKIFRDNLKYIDEKNSLENRSYKLGLNRFADITNEEYRTGYLGAKRDASR  120

Query  405  NMVKSKSDRYAPVAGDSLPDSIDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            NMVKSKSDRYAPVAGDSLPDSIDWREKGAVTGVKDQGSCGSCWAFSTIAAV
Sbjct  121  NMVKSKSDRYAPVAGDSLPDSIDWREKGAVTGVKDQGSCGSCWAFSTIAAV  171



>gb|AAK48495.1|AF259983_1 putative cysteine protease [Ipomoea batatas]
Length=462

 Score =   230 bits (586),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 112/147 (76%), Positives = 129/147 (88%), Gaps = 2/147 (1%)
 Frame = +3

Query  123  IITYDQQHPAKGLVRSEDEVKEMFESWLVKHGKSYNAVD-EKDKRFKIFRDNLKYIDEKN  299
            IITYD++HPAKGL RS++EV  ++ESWLV+HGKSYN +  EKDKRF+IF+DNL+YIDE+N
Sbjct  26   IITYDEEHPAKGLSRSDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQN  85

Query  300  SLENRSYKLGLNRFADITNEEYRTGYLGAKRDASRNMVKSKSD-RYAPVAGDSLPDSIDW  476
            S  +RSYKLGLNRFAD+TNEEYR+ YLGAK DA R + K+KSD RYAP AG SLPDSIDW
Sbjct  86   SRGDRSYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKAGGSLPDSIDW  145

Query  477  REKGAVTGVKDQGSCGSCWAFSTIAAV  557
            REKGAV  VKDQGSCGSCWAFSTIAAV
Sbjct  146  REKGAVAEVKDQGSCGSCWAFSTIAAV  172



>ref|XP_011069730.1| PREDICTED: low-temperature-induced cysteine proteinase-like [Sesamum 
indicum]
Length=471

 Score =   229 bits (584),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 103/148 (70%), Positives = 125/148 (84%), Gaps = 0/148 (0%)
 Frame = +3

Query  114  DMSIITYDQQHPAKGLVRSEDEVKEMFESWLVKHGKSYNAVDEKDKRFKIFRDNLKYIDE  293
            DMSII+YD+ H   G VRS++EV  M+ESW+VKHGKSYNA+ EK+KRF+IF+DNL+YI+E
Sbjct  29   DMSIISYDESHGGPGFVRSDEEVMSMYESWMVKHGKSYNALGEKEKRFEIFKDNLRYIEE  88

Query  294  KNSLENRSYKLGLNRFADITNEEYRTGYLGAKRDASRNMVKSKSDRYAPVAGDSLPDSID  473
            +N++ NR+YKLGLNRFAD++NEEYR  Y+G + DA R   K KSDRYAP  GDSLPDSID
Sbjct  89   QNAMPNRTYKLGLNRFADLSNEEYRRTYMGTRTDAKRRFSKVKSDRYAPKVGDSLPDSID  148

Query  474  WREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            WREKGAV  +KDQG CGSCWAFSTIA+V
Sbjct  149  WREKGAVAPIKDQGGCGSCWAFSTIASV  176



>ref|XP_011074404.1| PREDICTED: low-temperature-induced cysteine proteinase [Sesamum 
indicum]
Length=469

 Score =   222 bits (566),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 105/149 (70%), Positives = 124/149 (83%), Gaps = 1/149 (1%)
 Frame = +3

Query  114  DMSIITYDQQ-HPAKGLVRSEDEVKEMFESWLVKHGKSYNAVDEKDKRFKIFRDNLKYID  290
            DMSIITYD+  H A   +RS DEV  M+ESWL+KHGKSYNA+ EK++RF+IF+DNL+YID
Sbjct  26   DMSIITYDENNHLAGPGLRSHDEVMSMYESWLMKHGKSYNALGEKERRFEIFKDNLRYID  85

Query  291  EKNSLENRSYKLGLNRFADITNEEYRTGYLGAKRDASRNMVKSKSDRYAPVAGDSLPDSI  470
            E+N+L  R+YKLGLNRFAD+TNEEYR  +LGA+ D  R +  +KSDRYAP  G+SLPDSI
Sbjct  86   EQNALGGRTYKLGLNRFADLTNEEYRKTFLGARPDGKRRLTSTKSDRYAPKVGESLPDSI  145

Query  471  DWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            DWR KGAV  VKDQGSCGSCWAFSTIAAV
Sbjct  146  DWRAKGAVAPVKDQGSCGSCWAFSTIAAV  174



>ref|XP_009769754.1| PREDICTED: low-temperature-induced cysteine proteinase-like [Nicotiana 
sylvestris]
Length=470

 Score =   217 bits (553),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 101/149 (68%), Positives = 125/149 (84%), Gaps = 6/149 (4%)
 Frame = +3

Query  114  DMSIITYDQ-QHPAKGLVRSEDEVKEMFESWLVKHGKSYNAVDEKDKRFKIFRDNLKYID  290
            DMSI+TYD+ QH      R++DEV  ++ESWL++HGKSYNA+DEKDKRF+IF+DNL+YID
Sbjct  32   DMSILTYDENQH-----FRTDDEVMSLYESWLLEHGKSYNALDEKDKRFQIFKDNLRYID  86

Query  291  EKNSLENRSYKLGLNRFADITNEEYRTGYLGAKRDASRNMVKSKSDRYAPVAGDSLPDSI  470
            E+NS+ N+SYKLGL +FAD+TNEEYR+ YLG K    R ++K+KSDRY P  GDSLPDS+
Sbjct  87   EQNSVPNKSYKLGLTKFADLTNEEYRSMYLGTKTSDRRRLLKNKSDRYLPKVGDSLPDSV  146

Query  471  DWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            DWREKG + GVKDQGSCGSCWAFS IA+V
Sbjct  147  DWREKGVLVGVKDQGSCGSCWAFSAIASV  175



>dbj|BAE80740.1| cysteine proteinase [Platycodon grandiflorus]
Length=462

 Score =   217 bits (553),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 109/176 (62%), Positives = 133/176 (76%), Gaps = 9/176 (5%)
 Frame = +3

Query  30   LLLPTMARPSILFTFLFavvsaaaaaaEDMSIITYDQQHPAKGLVRSEDEVKEMFESWLV  209
            LL P+MA  ++LF    A  +       DMSII YD  H +K   R++DEV  M+ESWLV
Sbjct  3    LLSPSMAI-ALLFALFVASSAL------DMSIINYDATHASKSSWRTDDEVMAMYESWLV  55

Query  210  KHGKSYNAVDEKDKRFKIFRDNLKYIDEKNSLENRSYKLGLNRFADITNEEYRTGYLGAK  389
            KHGKSYNA+ EK+KRF+IF+DNL++IDE N+ EN SYK+GLNRFAD+TNEEYR+ YLGAK
Sbjct  56   KHGKSYNALGEKEKRFQIFKDNLRFIDEHNAEENLSYKVGLNRFADLTNEEYRSTYLGAK  115

Query  390  RDASRNMVKSKSDRYAPVAGDSLPDSIDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
              +   + K KSDRYAP  GDSLP+S+DWR KGAV  +KDQGSCGSCWAFST+ AV
Sbjct  116  --SKPKLSKVKSDRYAPRVGDSLPESVDWRAKGAVAPIKDQGSCGSCWAFSTVNAV  169



>ref|XP_009613155.1| PREDICTED: low-temperature-induced cysteine proteinase-like [Nicotiana 
tomentosiformis]
 gb|AGV15820.1| cysteine protease CP6 [Nicotiana tabacum]
Length=466

 Score =   217 bits (553),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 101/149 (68%), Positives = 125/149 (84%), Gaps = 6/149 (4%)
 Frame = +3

Query  114  DMSIITYDQ-QHPAKGLVRSEDEVKEMFESWLVKHGKSYNAVDEKDKRFKIFRDNLKYID  290
            DMSI+TYD+ QH      R++DEV  ++ESWLV+HGKSYNA+DEKDKRF+IF++NL+YID
Sbjct  28   DMSILTYDENQH-----FRTDDEVMSLYESWLVEHGKSYNALDEKDKRFQIFKENLRYID  82

Query  291  EKNSLENRSYKLGLNRFADITNEEYRTGYLGAKRDASRNMVKSKSDRYAPVAGDSLPDSI  470
            E+NS+ N+SYKLGL +FAD+TNEEYR+ YLG K    R ++K+KSDRY P  GDSLPDS+
Sbjct  83   EQNSVPNKSYKLGLTKFADLTNEEYRSMYLGTKTSDRRRLLKNKSDRYLPKVGDSLPDSV  142

Query  471  DWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            DWREKG + GVKDQGSCGSCWAFS IA+V
Sbjct  143  DWREKGVLVGVKDQGSCGSCWAFSAIASV  171



>gb|EYU36326.1| hypothetical protein MIMGU_mgv1a005614mg [Erythranthe guttata]
Length=477

 Score =   217 bits (553),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 108/177 (61%), Positives = 136/177 (77%), Gaps = 6/177 (3%)
 Frame = +3

Query  39   PTMARPSILFTFLFavvsaaaaaaEDMSIITYDQQH----PAKGLVRSEDEVKEMFESWL  206
            P+ +  S+L   L+  +  A A A DMSII+YD+++    PA   +RS DEV  M ESW+
Sbjct  7    PSSSTMSLLTFSLYISLFLAQAWASDMSIISYDRKNNLAVPAG--LRSHDEVVSMHESWM  64

Query  207  VKHGKSYNAVDEKDKRFKIFRDNLKYIDEKNSLENRSYKLGLNRFADITNEEYRTGYLGA  386
             +HGKSYNAV EK+KR +IF+DNL+YIDE+N++ENR+YKLGLNRFAD+TN+EYR  +LG+
Sbjct  65   AEHGKSYNAVGEKEKRLEIFKDNLRYIDEQNAIENRTYKLGLNRFADLTNDEYRKTFLGS  124

Query  387  KRDASRNMVKSKSDRYAPVAGDSLPDSIDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            + D  R +   KSDRYAP  GD+LPDSIDWREKGAV  +KDQGSCGSCWAFSTI AV
Sbjct  125  RPDGKRRLTGRKSDRYAPKVGDALPDSIDWREKGAVVPIKDQGSCGSCWAFSTITAV  181



>ref|NP_001234324.1| low-temperature-induced cysteine proteinase precursor [Solanum 
lycopersicum]
 gb|AAD48496.1|AF172856_1 cysteine protease TDI-65 [Solanum lycopersicum]
 emb|CAA05894.1| CYP1 [Solanum lycopersicum]
 emb|CEL26633.1| cysteine protease [Solanum lycopersicum]
Length=466

 Score =   214 bits (546),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 104/168 (62%), Positives = 133/168 (79%), Gaps = 8/168 (5%)
 Frame = +3

Query  57   SILFTFLFavvsaaaaaaEDMSIITYDQQHPAKGLVRSEDEVKEMFESWLVKHGKSYNAV  236
            SIL   +F+ +S+A     DMSII+YD+ H  +   R++DEV  ++ESWL++HGKSYNA+
Sbjct  11   SILLMLIFSTLSSA----SDMSIISYDETHIHR---RTDDEVSALYESWLIEHGKSYNAL  63

Query  237  DEKDKRFKIFRDNLKYIDEKNSLENRSYKLGLNRFADITNEEYRTGYLGAKRDASR-NMV  413
             EKDKRF+IF+DNL+YIDE+NS+ N+SYKLGL +FAD+TNEEYR+ YLG K    R  + 
Sbjct  64   GEKDKRFQIFKDNLRYIDEQNSVPNQSYKLGLTKFADLTNEEYRSIYLGTKSSGDRKKLS  123

Query  414  KSKSDRYAPVAGDSLPDSIDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            K+KSDRY P  GDSLP+SIDWREKG + GVKDQGSCGSCWAFS +AA+
Sbjct  124  KNKSDRYLPKVGDSLPESIDWREKGVLVGVKDQGSCGSCWAFSAVAAM  171



>dbj|BAD29957.1| cysteine protease [Daucus carota]
Length=437

 Score =   212 bits (539),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 101/149 (68%), Positives = 118/149 (79%), Gaps = 2/149 (1%)
 Frame = +3

Query  114  DMSIITYDQQHPAKGLVRSEDEVKEMFESWLVKHGKSYNAVDEKDKRFKIFRDNLKYIDE  293
            DMSII YDQ H    L+R++DEV  M+ SWLVKHGKSYNA+ EK+ RF+IF+DNL+YID 
Sbjct  24   DMSIINYDQTH-TNSLIRTDDEVMTMYNSWLVKHGKSYNALGEKETRFQIFKDNLRYIDN  82

Query  294  KNSLENRSYKLGLNRFADITNEEYRTGYLGAK-RDASRNMVKSKSDRYAPVAGDSLPDSI  470
             N+  +RSY+LGLNRFAD+TNEEYR  YLG K R++   + K  SDRYAPV G+ LPDSI
Sbjct  83   HNADPDRSYELGLNRFADLTNEEYRAKYLGTKSRESRPKLSKGPSDRYAPVEGEELPDSI  142

Query  471  DWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            DWREKGAV  VKDQGSCGSCWAFS I AV
Sbjct  143  DWREKGAVAAVKDQGSCGSCWAFSAIGAV  171



>ref|NP_001274877.1| low-temperature-induced cysteine proteinase-like precursor [Solanum 
tuberosum]
 emb|CAB53515.1| cysteine protease [Solanum tuberosum]
Length=466

 Score =   213 bits (541),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 100/168 (60%), Positives = 132/168 (79%), Gaps = 4/168 (2%)
 Frame = +3

Query  57   SILFTFLFavvsaaaaaaEDMSIITYDQQHPAKGLVRSEDEVKEMFESWLVKHGKSYNAV  236
            ++  + L  ++ +  ++A DMSII+YD+ H      RS+DEV  ++ESWL++HGKSYNA+
Sbjct  7    TLTISLLLMLIFSTLSSASDMSIISYDETHIHH---RSDDEVSALYESWLIEHGKSYNAL  63

Query  237  DEKDKRFKIFRDNLKYIDEKNSLENRSYKLGLNRFADITNEEYRTGYLGAKRDAS-RNMV  413
             EKDKRF+IF+DNLKYIDE+NS+ N+SYKLGL +FAD+TNEEYR+ YLG K     R + 
Sbjct  64   GEKDKRFQIFKDNLKYIDEQNSVPNQSYKLGLTKFADLTNEEYRSIYLGTKSSGDRRKLS  123

Query  414  KSKSDRYAPVAGDSLPDSIDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            K+KSDRY P  GDSLP+S+DWR+KG + GVKDQGSCGSCWAFS +AA+
Sbjct  124  KNKSDRYLPKVGDSLPESVDWRDKGVLVGVKDQGSCGSCWAFSAVAAM  171



>ref|XP_004238129.1| PREDICTED: low-temperature-induced cysteine proteinase [Solanum 
lycopersicum]
Length=472

 Score =   213 bits (541),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 95/149 (64%), Positives = 120/149 (81%), Gaps = 0/149 (0%)
 Frame = +3

Query  111  EDMSIITYDQQHPAKGLVRSEDEVKEMFESWLVKHGKSYNAVDEKDKRFKIFRDNLKYID  290
            EDMSII+Y+++H   G  R++DEV  M+ESWLV+H K YNA+ EKDKRF+IF+DNLKYID
Sbjct  28   EDMSIISYNEKHHTIGAGRTDDEVMSMYESWLVEHKKVYNALGEKDKRFQIFKDNLKYID  87

Query  291  EKNSLENRSYKLGLNRFADITNEEYRTGYLGAKRDASRNMVKSKSDRYAPVAGDSLPDSI  470
            E N++  +SYKLGL +FAD+TNEEYR+ YLG K DASR +   +SDRYAP  GD LP+S+
Sbjct  88   EHNAMPEKSYKLGLTKFADLTNEEYRSVYLGTKPDASRRLSSRQSDRYAPKVGDRLPESV  147

Query  471  DWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            DW +KG + GVKDQG CGSCWAFS +AA+
Sbjct  148  DWVKKGVLVGVKDQGQCGSCWAFSAVAAI  176



>gb|EPS63305.1| hypothetical protein M569_11479, partial [Genlisea aurea]
Length=453

 Score =   212 bits (539),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 92/148 (62%), Positives = 125/148 (84%), Gaps = 0/148 (0%)
 Frame = +3

Query  114  DMSIITYDQQHPAKGLVRSEDEVKEMFESWLVKHGKSYNAVDEKDKRFKIFRDNLKYIDE  293
            DMSI++Y +    +  +RSE+E   ++ESW+V+HG+SYNA+ EK++RF+IF+DNL+YIDE
Sbjct  24   DMSIVSYGESRGHRTPLRSEEEAMSLYESWIVEHGRSYNALGEKERRFEIFKDNLRYIDE  83

Query  294  KNSLENRSYKLGLNRFADITNEEYRTGYLGAKRDASRNMVKSKSDRYAPVAGDSLPDSID  473
            +N++ NR+Y+LGLNRFAD+TN+EYRT +LG + DA R ++K++SDRYA  AGDSLPDS+D
Sbjct  84   QNAIGNRTYRLGLNRFADLTNKEYRTTFLGTRIDAKRRLLKARSDRYAAKAGDSLPDSVD  143

Query  474  WREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            WR KGAV  +KDQG CGSCWAFSTIA+V
Sbjct  144  WRSKGAVAPIKDQGGCGSCWAFSTIASV  171



>gb|AAX84673.1| cysteine protease CP1 [Manihot esculenta]
Length=467

 Score =   212 bits (539),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 102/175 (58%), Positives = 132/175 (75%), Gaps = 3/175 (2%)
 Frame = +3

Query  33   LLPTMARPSILFTFLFavvsaaaaaaEDMSIITYDQQHPAKGLVRSEDEVKEMFESWLVK  212
            ++      + +F  LF   + ++A   DMSII+YDQ H  K   R++DEV  ++E WLVK
Sbjct  1    MMGLFGSSAAMFVLLFLSFTLSSA--SDMSIISYDQTHATKSSWRTDDEVMAIYEEWLVK  58

Query  213  HGKSYNAVDEKDKRFKIFRDNLKYIDEKNSLENRSYKLGLNRFADITNEEYRTGYLGAKR  392
             GK YNA+ E++KRF++F+DNL++IDE NS ENR+YKLGLN FAD+TNEEYR+ YLGA+ 
Sbjct  59   QGKVYNALGEREKRFQVFKDNLRFIDEHNS-ENRTYKLGLNGFADLTNEEYRSTYLGARG  117

Query  393  DASRNMVKSKSDRYAPVAGDSLPDSIDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
               RN ++  SDRYAP  G+SLPDS+DWR++GAV  VKDQGSCGSCWAFSTIAAV
Sbjct  118  GMKRNRLRKTSDRYAPRVGESLPDSVDWRKEGAVAEVKDQGSCGSCWAFSTIAAV  172



>ref|XP_006473275.1| PREDICTED: cysteine proteinase RD21a-like [Citrus sinensis]
Length=468

 Score =   211 bits (537),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 111/179 (62%), Positives = 139/179 (78%), Gaps = 11/179 (6%)
 Frame = +3

Query  27   LLLLPTMARPSILFTFLFavvsaaaaaaEDMSIITYDQQHPAKGLV-RSEDEVKEMFESW  203
            L   PTMA   +   FLF V SA      DMSI++YD+ H +K    R++DEV  MFE+W
Sbjct  3    LFRSPTMA---MFLLFLFTVSSAL-----DMSIVSYDKTHESKSSSWRTDDEVMAMFEAW  54

Query  204  LVKHGKSYNAVDEKDKRFKIFRDNLKYIDEKNSLENRSYKLGLNRFADITNEEYRTGYLG  383
            LVKHGK+YNA+ EK+KRF+IF++NL++IDE NS ENR+YK+GLNRFAD+TNEEYR+ +LG
Sbjct  55   LVKHGKAYNALGEKEKRFEIFKENLRFIDEHNS-ENRTYKVGLNRFADLTNEEYRSMHLG  113

Query  384  AKRDASRNMVKSK-SDRYAPVAGDSLPDSIDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            A+  A R  +KSK S+RY P  G++LPDS+DWR+KGAV  VKDQGSCGSCWAFSTIAAV
Sbjct  114  ARFGAKRTSLKSKRSNRYLPRVGEALPDSVDWRKKGAVAEVKDQGSCGSCWAFSTIAAV  172



>gb|ABG33750.1| cysteine protease [Hevea brasiliensis]
Length=457

 Score =   211 bits (536),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 99/165 (60%), Positives = 130/165 (79%), Gaps = 3/165 (2%)
 Frame = +3

Query  63   LFTFLFavvsaaaaaaEDMSIITYDQQHPAKGLVRSEDEVKEMFESWLVKHGKSYNAVDE  242
            +F  LF   + ++A   D+SII+YDQ H  K   R++DEV  ++E WLVKHGK+YN++ E
Sbjct  1    MFMLLFFASTLSSA--SDLSIISYDQSHGTKSSWRTDDEVMAIYEDWLVKHGKAYNSLGE  58

Query  243  KDKRFKIFRDNLKYIDEKNSLENRSYKLGLNRFADITNEEYRTGYLGAKRDASRNMVKSK  422
            K++RF++F+DNL++IDE NS ENR+Y++GLNRFAD+TNEEYR+ YLGA     RN ++  
Sbjct  59   KERRFEVFKDNLRFIDEHNS-ENRTYRVGLNRFADLTNEEYRSMYLGALSGIRRNKLRKI  117

Query  423  SDRYAPVAGDSLPDSIDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            SDRY P  GDSLPDS+DWR++GAV GVKDQGSCGSCWAFS +AAV
Sbjct  118  SDRYTPRVGDSLPDSVDWRKEGAVVGVKDQGSCGSCWAFSAVAAV  162



>ref|XP_003550321.1| PREDICTED: cysteine proteinase RD21a-like [Glycine max]
 gb|KHN12811.1| Cysteine proteinase RD21a [Glycine soja]
Length=476

 Score =   211 bits (536),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 104/173 (60%), Positives = 130/173 (75%), Gaps = 7/173 (4%)
 Frame = +3

Query  42   TMARPSILFTFLFavvsaaaaaaEDMSIITYDQQHPAKG-LVRSEDEVKEMFESWLVKHG  218
            TMA   +LFT        A ++A DMSII+YD  H  K   +R+E+E+  M+E WLVKHG
Sbjct  14   TMAAIVLLFTVF------AVSSALDMSIISYDSAHADKAATLRTEEELMSMYEQWLVKHG  67

Query  219  KSYNAVDEKDKRFKIFRDNLKYIDEKNSLENRSYKLGLNRFADITNEEYRTGYLGAKRDA  398
            K YNA+ EK+KRF+IF+DNL++ID+ NS E+R+YKLGLNRFAD+TNEEYR  YLG K D 
Sbjct  68   KVYNALGEKEKRFQIFKDNLRFIDDHNSAEDRTYKLGLNRFADLTNEEYRAKYLGTKIDP  127

Query  399  SRNMVKSKSDRYAPVAGDSLPDSIDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            +R + K+ S+RYAP  GD LPDS+DWR++GAV  VKDQG CGSCWAFS I AV
Sbjct  128  NRRLGKTPSNRYAPRVGDKLPDSVDWRKEGAVPPVKDQGGCGSCWAFSAIGAV  180



>ref|XP_003589134.1| Cysteine proteinase [Medicago truncatula]
Length=299

 Score =   205 bits (522),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 103/172 (60%), Positives = 127/172 (74%), Gaps = 5/172 (3%)
 Frame = +3

Query  54   PSILFTFLFavvsaaaaaaEDMSIITYDQQHPAKGLV-RSEDEVKEMFESWLVKHGKSYN  230
            P++    +  + S   + A DMSII+YD+ HP K    R+  EV  M+E WLVKHGKSYN
Sbjct  8    PAMKLMIVLIISSFTVSLALDMSIISYDKTHPDKSTSKRTNKEVLTMYEEWLVKHGKSYN  67

Query  231  AVDEKDKRFKIFRDNLKYIDEKNSLENRSYKLGLNRFADITNEEYRTGYLGAKRDASRNM  410
             + EKDKRF+IF+DNLK+IDE N L N +Y+LGL RFAD+TNEEYR+ +LG K D +R M
Sbjct  68   GLGEKDKRFEIFKDNLKFIDEHNGL-NSTYRLGLTRFADLTNEEYRSKFLGTKIDPNRRM  126

Query  411  VK---SKSDRYAPVAGDSLPDSIDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
             K   SKS+RYAP  GD LP+S+DWR++GAV GVKDQ SCGSCWAFS IAAV
Sbjct  127  KKLGGSKSNRYAPRVGDKLPESVDWRKEGAVVGVKDQASCGSCWAFSAIAAV  178



>emb|CDP01294.1| unnamed protein product [Coffea canephora]
Length=465

 Score =   210 bits (534),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 97/150 (65%), Positives = 121/150 (81%), Gaps = 1/150 (1%)
 Frame = +3

Query  111  EDMSIITYDQQH-PAKGLVRSEDEVKEMFESWLVKHGKSYNAVDEKDKRFKIFRDNLKYI  287
            EDMSI++Y   +    G  R+++EV  ++E WLVKHGKSYN + EKDKRF+IF+DNL+YI
Sbjct  19   EDMSILSYGNANLKTSGSGRTDEEVMALYEEWLVKHGKSYNGLGEKDKRFEIFKDNLRYI  78

Query  288  DEKNSLENRSYKLGLNRFADITNEEYRTGYLGAKRDASRNMVKSKSDRYAPVAGDSLPDS  467
            DE+NSL +R+Y+LGLNRFAD++NEEYR+ YLG + D  R + K+ SDRY P  GDSLP+S
Sbjct  79   DEQNSLPSRTYQLGLNRFADLSNEEYRSTYLGTRPDPKRRLAKTSSDRYRPKVGDSLPNS  138

Query  468  IDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            IDWREKGAV  VKDQGSCGSCWAFS +AAV
Sbjct  139  IDWREKGAVLPVKDQGSCGSCWAFSAVAAV  168



>gb|AFO83614.1| papain-like cysteine protease [Fagopyrum esculentum]
Length=468

 Score =   210 bits (534),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 103/152 (68%), Positives = 123/152 (81%), Gaps = 5/152 (3%)
 Frame = +3

Query  114  DMSIITYDQQHPAKGL----VRSEDEVKEMFESWLVKHGKSYNAVDEKDKRFKIFRDNLK  281
            D SII+YD  HP K      +RS+DEV  MFESWLV HGK+YNA+ EK+KRF++F+DNL+
Sbjct  27   DNSIISYDNTHPDKSSSSPNMRSDDEVMSMFESWLVHHGKNYNALGEKEKRFQVFKDNLR  86

Query  282  YIDEKNSLENRSYKLGLNRFADITNEEYRTGYLGAKRDASRNMVKSKSDRYAPVAGDSLP  461
            +IDE NS E RSYKLGLN+FAD++NEEYR  YLGAK DA R + K +S RYA  AGDSLP
Sbjct  87   FIDEHNS-EERSYKLGLNKFADLSNEEYRNKYLGAKTDARRRLSKKRSSRYAFRAGDSLP  145

Query  462  DSIDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            +S+DWR++GAV  VKDQGSCGSCWAFSTIAAV
Sbjct  146  ESVDWRKEGAVVDVKDQGSCGSCWAFSTIAAV  177



>ref|XP_006342644.1| PREDICTED: low-temperature-induced cysteine proteinase-like [Solanum 
tuberosum]
Length=466

 Score =   209 bits (533),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 98/168 (58%), Positives = 131/168 (78%), Gaps = 4/168 (2%)
 Frame = +3

Query  57   SILFTFLFavvsaaaaaaEDMSIITYDQQHPAKGLVRSEDEVKEMFESWLVKHGKSYNAV  236
            ++  + L  ++ +  ++A DMSII+YD+ H      R++DEV  ++ESWL++HGKSYNA+
Sbjct  7    TLTISLLLMLIFSTLSSASDMSIISYDETHIHH---RTDDEVSALYESWLIEHGKSYNAL  63

Query  237  DEKDKRFKIFRDNLKYIDEKNSLENRSYKLGLNRFADITNEEYRTGYLGAKRDAS-RNMV  413
             EKDKRF+IF+DNLKYIDE+NS+ N+SYKLGL +FAD+T EEYR+ YLG K     R + 
Sbjct  64   GEKDKRFQIFKDNLKYIDEQNSVPNQSYKLGLTKFADLTTEEYRSIYLGTKSSGDRRRLS  123

Query  414  KSKSDRYAPVAGDSLPDSIDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            K+KSDRY P  GDSLP+S+DWR+KG + GVKDQGSCGSCWAFS +AA+
Sbjct  124  KNKSDRYLPKVGDSLPESVDWRDKGVLVGVKDQGSCGSCWAFSAVAAM  171



>gb|KDP41692.1| hypothetical protein JCGZ_16099 [Jatropha curcas]
Length=466

 Score =   209 bits (533),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 103/172 (60%), Positives = 135/172 (78%), Gaps = 4/172 (2%)
 Frame = +3

Query  45   MARPSI-LFTFLFavvsaaaaaaEDMSIITYDQQHPAKGLVRSEDEVKEMFESWLVKHGK  221
            ++RPS  +F  LF   + ++A   DMSII+YDQ H AK   R++DEV  ++E WL K+GK
Sbjct  3    LSRPSAAMFMLLFFAFTLSSAM--DMSIISYDQSHAAKSSWRTDDEVMAIYEEWLEKNGK  60

Query  222  SYNAVDEKDKRFKIFRDNLKYIDEKNSLENRSYKLGLNRFADITNEEYRTGYLGAKRDAS  401
            +YNA+ EK++RF+IF+DNL++IDE NS ENR+YK+ LNRFADI+NEEYR+ YLGA+    
Sbjct  61   AYNALGEKERRFQIFKDNLRFIDEHNS-ENRAYKVALNRFADISNEEYRSLYLGAQAGVR  119

Query  402  RNMVKSKSDRYAPVAGDSLPDSIDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            RN ++  SDRY P  G+SLPDS+DWR++GAV  VKDQGSCGSCWAFSTI+AV
Sbjct  120  RNKLRKSSDRYTPRVGESLPDSVDWRKEGAVAEVKDQGSCGSCWAFSTISAV  171



>gb|KHN22488.1| Cysteine proteinase RD21a [Glycine soja]
Length=464

 Score =   209 bits (531),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 103/172 (60%), Positives = 129/172 (75%), Gaps = 5/172 (3%)
 Frame = +3

Query  45   MARPSILFTFLFavvsaaaaaaEDMSIITYDQQHPAKG-LVRSEDEVKEMFESWLVKHGK  221
            MA  +IL  F    VS+A     DMSII+YD  H A    +R+E+E+  M+E WLVKHGK
Sbjct  1    MAMATILLLFTVFAVSSAL----DMSIISYDNAHAATAATLRTEEELMSMYEQWLVKHGK  56

Query  222  SYNAVDEKDKRFKIFRDNLKYIDEKNSLENRSYKLGLNRFADITNEEYRTGYLGAKRDAS  401
             YNA+ EK+KRF+IF+DNL++ID+ NS E+R+YKLGLNRFAD+TNEEYR  YLG K D +
Sbjct  57   VYNALGEKEKRFQIFKDNLRFIDDHNSQEDRTYKLGLNRFADLTNEEYRAKYLGTKIDPN  116

Query  402  RNMVKSKSDRYAPVAGDSLPDSIDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            R + K+ S+RYAP  GD LP+S+DWR++GAV  VKDQG CGSCWAFS I AV
Sbjct  117  RRLGKTPSNRYAPRVGDKLPESVDWRKEGAVPPVKDQGGCGSCWAFSAIGAV  168



>ref|XP_006354848.1| PREDICTED: cysteine proteinase RD21a-like [Solanum tuberosum]
Length=471

 Score =   208 bits (529),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 97/167 (58%), Positives = 125/167 (75%), Gaps = 2/167 (1%)
 Frame = +3

Query  57   SILFTFLFavvsaaaaaaEDMSIITYDQQHPAKGLVRSEDEVKEMFESWLVKHGKSYNAV  236
            SIL   +F     + A  EDMSII+Y+++H   G  R++DEV  ++ESWLV+H K YNA+
Sbjct  11   SILVMVVFPPAVTSGA--EDMSIISYNEKHHKIGAGRTDDEVMSLYESWLVEHKKVYNAL  68

Query  237  DEKDKRFKIFRDNLKYIDEKNSLENRSYKLGLNRFADITNEEYRTGYLGAKRDASRNMVK  416
             EKDKRF+IF+DNLKYIDE N++  +SYKLGL +FAD+TNEEYR+ YLG K DA R +  
Sbjct  69   GEKDKRFQIFKDNLKYIDEHNAMPEKSYKLGLTKFADLTNEEYRSIYLGTKPDAGRRLSS  128

Query  417  SKSDRYAPVAGDSLPDSIDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
             +SDRYAP  GD LP+S+DW +KG + GVKDQG CGSCWAFS +A +
Sbjct  129  RQSDRYAPKVGDRLPESVDWVKKGVLVGVKDQGQCGSCWAFSAVAVI  175



>gb|AEZ65083.1| cysteine protease [Carica papaya]
Length=467

 Score =   208 bits (529),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 104/163 (64%), Positives = 131/163 (80%), Gaps = 3/163 (2%)
 Frame = +3

Query  75   LFavvsaaaaaaEDMSIITYDQQHPAKGLVRSEDEVKEMFESWLVKHGKSYNAVDEKDKR  254
            LF ++   A++A DMSI++YDQ+H  K   R++DEV  M+E+WLVKHGK+YNA+ EK+KR
Sbjct  10   LFLLMIFTASSAVDMSIVSYDQRHADKSSWRTDDEVMAMYEAWLVKHGKAYNALGEKEKR  69

Query  255  FKIFRDNLKYIDEKNSLENRSYKLGLNRFADITNEEYRTGYLGAKRDASR--NMVKSKSD  428
            F IF+DNL++IDE NS +N +Y+LGLNRFAD+TNEEYR+ YLG K  A+R    V  KSD
Sbjct  70   FGIFKDNLRFIDEHNS-QNLTYRLGLNRFADLTNEEYRSMYLGVKPGATRVTRKVSRKSD  128

Query  429  RYAPVAGDSLPDSIDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            R+A   GD+LPD IDWR++GAV GVKDQGSCGSCWAFSTIAAV
Sbjct  129  RFAARVGDALPDFIDWRKEGAVVGVKDQGSCGSCWAFSTIAAV  171



>ref|XP_011029381.1| PREDICTED: cysteine proteinase RD21a [Populus euphratica]
Length=465

 Score =   207 bits (527),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 99/148 (67%), Positives = 121/148 (82%), Gaps = 2/148 (1%)
 Frame = +3

Query  114  DMSIITYDQQHPAKGLVRSEDEVKEMFESWLVKHGKSYNAVDEKDKRFKIFRDNLKYIDE  293
            DMSII+YDQ H  K   R++DEV  M+E WLVKHGK+YNA+ EK+KRF+IF+DNL +ID+
Sbjct  25   DMSIISYDQTHVTKSSWRTDDEVMAMYEEWLVKHGKNYNALGEKEKRFEIFKDNLMFIDQ  84

Query  294  KNSLENRSYKLGLNRFADITNEEYRTGYLGAKRDASRNMVKSKSDRYAPVAGDSLPDSID  473
             NS ENR+YK+GLNRFAD+TNEEYR+ YLG +    + + K+ SDRYAP  GDSLPDS+D
Sbjct  85   HNS-ENRTYKVGLNRFADLTNEEYRSMYLGTRTGHKKRLPKT-SDRYAPRVGDSLPDSVD  142

Query  474  WREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            WR++GAV  VKDQG CGSCWAFSTIAAV
Sbjct  143  WRKEGAVAEVKDQGGCGSCWAFSTIAAV  170



>ref|XP_010059895.1| PREDICTED: low-temperature-induced cysteine proteinase [Eucalyptus 
grandis]
 gb|KCW66363.1| hypothetical protein EUGRSUZ_F00184 [Eucalyptus grandis]
Length=470

 Score =   207 bits (526),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 103/174 (59%), Positives = 133/174 (76%), Gaps = 6/174 (3%)
 Frame = +3

Query  39   PTMARPSILFTFLFavvsaaaaaaEDMSIITYDQQHPAKGLVRSEDEVKEMFESWLVKHG  218
            P+ +   + F  +F  +S+AA    DMSII+YD+ H      R++ EV  ++ESWLVKHG
Sbjct  6    PSRSLMGMFFFLMFLALSSAA----DMSIISYDRAHGGDPGQRTDAEVMALYESWLVKHG  61

Query  219  KSYNAVDEKDKRFKIFRDNLKYIDEKNSLENRSYKLGLNRFADITNEEYRTGYLGAKRDA  398
            K+YNA+ EK++RF IF+DNL++IDE NS  NR+Y LGLNRFAD+TNEEYR+ YLG + DA
Sbjct  62   KAYNALGEKERRFDIFKDNLRFIDEHNS-GNRTYTLGLNRFADLTNEEYRSTYLGTRPDA  120

Query  399  SRNMVKSKSD-RYAPVAGDSLPDSIDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            SR + KS+S  RY P  G+ LP+S+DWR++GAV GVKDQGSCGSCWAFSTIAAV
Sbjct  121  SRRLTKSRSSRRYEPRLGEQLPESVDWRKEGAVVGVKDQGSCGSCWAFSTIAAV  174



>ref|XP_003545327.1| PREDICTED: cysteine proteinase RD21a-like [Glycine max]
Length=496

 Score =   206 bits (525),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 103/171 (60%), Positives = 128/171 (75%), Gaps = 6/171 (4%)
 Frame = +3

Query  45   MARPSILFTFLFavvsaaaaaaEDMSIITYDQQHPAKGLVRSEDEVKEMFESWLVKHGKS  224
            MA  +IL  F    VS+A     DMSII+YD  H A    RS++E+  M+E WLVKHGK 
Sbjct  36   MAMATILLLFTVFAVSSAL----DMSIISYDNAHAATS--RSDEELMSMYEQWLVKHGKV  89

Query  225  YNAVDEKDKRFKIFRDNLKYIDEKNSLENRSYKLGLNRFADITNEEYRTGYLGAKRDASR  404
            YNA+ EK+KRF+IF+DNL++ID+ NS E+R+YKLGLNRFAD+TNEEYR  YLG K D +R
Sbjct  90   YNALGEKEKRFQIFKDNLRFIDDHNSQEDRTYKLGLNRFADLTNEEYRAKYLGTKIDPNR  149

Query  405  NMVKSKSDRYAPVAGDSLPDSIDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
             + K+ S+RYAP  GD LP+S+DWR++GAV  VKDQG CGSCWAFS I AV
Sbjct  150  RLGKTPSNRYAPRVGDKLPESVDWRKEGAVPPVKDQGGCGSCWAFSAIGAV  200



>ref|XP_007160879.1| hypothetical protein PHAVU_001G024500g [Phaseolus vulgaris]
 gb|ESW32873.1| hypothetical protein PHAVU_001G024500g [Phaseolus vulgaris]
Length=466

 Score =   206 bits (523),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 103/173 (60%), Positives = 132/173 (76%), Gaps = 7/173 (4%)
 Frame = +3

Query  42   TMARPSILFTF-LFavvsaaaaaaEDMSIITYDQQHPAKGLVRSEDEVKEMFESWLVKHG  218
            T A  +I+  F LFA+ SA      DMSII+YD  H  K   R+++EV  ++E WLVKHG
Sbjct  5    TSANMAIMLLFALFALSSAL-----DMSIISYDNAHQDKATWRTDEEVNSLYEEWLVKHG  59

Query  219  KSYNAVDEKDKRFKIFRDNLKYIDEKNSLENRSYKLGLNRFADITNEEYRTGYLGAKRDA  398
            K YNA+ EKDKRF+IF+DNL++ID++N+ ENR+YKLGLNRFAD+TNEEYR  YLG K D 
Sbjct  60   KLYNALGEKDKRFQIFKDNLRFIDQQNA-ENRTYKLGLNRFADLTNEEYRARYLGTKIDP  118

Query  399  SRNMVKSKSDRYAPVAGDSLPDSIDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            +R + ++ S+RYAP  G++LPDS+DWR++GAV  VKDQ SCGSCWAFS I AV
Sbjct  119  NRRLGRTPSNRYAPRVGETLPDSVDWRKEGAVVPVKDQASCGSCWAFSAIGAV  171



>emb|CAB17076.1| cysteine proteinase precursor [Phaseolus vulgaris]
Length=455

 Score =   205 bits (522),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 94/148 (64%), Positives = 120/148 (81%), Gaps = 1/148 (1%)
 Frame = +3

Query  114  DMSIITYDQQHPAKGLVRSEDEVKEMFESWLVKHGKSYNAVDEKDKRFKIFRDNLKYIDE  293
            DMSII+YD  H  K   R+++EV  ++E WLVKHGK YNA+ EKDKRF+IF+DNL++ID+
Sbjct  14   DMSIISYDNAHQDKATWRTDEEVNSLYEEWLVKHGKLYNALGEKDKRFQIFKDNLRFIDQ  73

Query  294  KNSLENRSYKLGLNRFADITNEEYRTGYLGAKRDASRNMVKSKSDRYAPVAGDSLPDSID  473
            +N+ ENR+YKLGLNRFAD+TNEEYR  YLG K D +R + ++ S+RYAP  G++LPDS+D
Sbjct  74   QNA-ENRTYKLGLNRFADLTNEEYRARYLGTKIDPNRRLGRTPSNRYAPRVGETLPDSVD  132

Query  474  WREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            WR++GAV  VKDQ SCGSCWAFS I AV
Sbjct  133  WRKEGAVVPVKDQASCGSCWAFSAIGAV  160



>ref|XP_010270819.1| PREDICTED: cysteine proteinase RD21a-like [Nelumbo nucifera]
Length=474

 Score =   206 bits (523),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 101/171 (59%), Positives = 132/171 (77%), Gaps = 7/171 (4%)
 Frame = +3

Query  45   MARPSILFTFLFavvsaaaaaaEDMSIITYDQQHPAKGLVRSEDEVKEMFESWLVKHGKS  224
            +A  ++L+ F       A + A DMSI+ YD++H  K   RS+ EV+ ++ESWLV HGK+
Sbjct  13   VAVAALLYLFF------AVSLATDMSIVKYDEEHGMKTGWRSDQEVRGLYESWLVTHGKA  66

Query  225  YNAVDEKDKRFKIFRDNLKYIDEKNSLENRSYKLGLNRFADITNEEYRTGYLGAKRDASR  404
            YNA+ EK++RF+IF+DNL++IDE NS  NR+YK+GLNRFAD+TN+EYR  YLG K + +R
Sbjct  67   YNALGEKERRFEIFKDNLRFIDEHNS-GNRTYKVGLNRFADLTNDEYRAMYLGTKLNPNR  125

Query  405  NMVKSKSDRYAPVAGDSLPDSIDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
               + KS+RYA  AGD+LPDS+DWR+KGAV  VKDQGSCGSCWAFSTIAAV
Sbjct  126  RASRPKSNRYAFQAGDALPDSVDWRDKGAVVAVKDQGSCGSCWAFSTIAAV  176



>gb|KCW66364.1| hypothetical protein EUGRSUZ_F00184 [Eucalyptus grandis]
Length=470

 Score =   205 bits (521),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 102/174 (59%), Positives = 132/174 (76%), Gaps = 6/174 (3%)
 Frame = +3

Query  39   PTMARPSILFTFLFavvsaaaaaaEDMSIITYDQQHPAKGLVRSEDEVKEMFESWLVKHG  218
            P+ +   + F  +F  +S+AA    DMSII+YD+ H      R++ EV  ++ESWLVKHG
Sbjct  6    PSRSLMGMFFFLMFLALSSAA----DMSIISYDRAHGGDPGQRTDAEVMALYESWLVKHG  61

Query  219  KSYNAVDEKDKRFKIFRDNLKYIDEKNSLENRSYKLGLNRFADITNEEYRTGYLGAKRDA  398
            K+YNA+ EK++RF IF+DNL++IDE NS  NR+Y LGLNRFAD+TNEEYR+ YLG + DA
Sbjct  62   KAYNALGEKERRFDIFKDNLRFIDEHNS-GNRTYTLGLNRFADLTNEEYRSTYLGTRPDA  120

Query  399  SRNMVKSKSD-RYAPVAGDSLPDSIDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            SR + KS+S  RY P  G+ LP+S+DWR++GAV GVKDQGSCG CWAFSTIAAV
Sbjct  121  SRRLTKSRSSRRYEPRLGEQLPESVDWRKEGAVVGVKDQGSCGDCWAFSTIAAV  174



>ref|XP_009775102.1| PREDICTED: low-temperature-induced cysteine proteinase-like [Nicotiana 
sylvestris]
Length=473

 Score =   205 bits (521),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 98/170 (58%), Positives = 134/170 (79%), Gaps = 5/170 (3%)
 Frame = +3

Query  57   SILFTFLFavvsaaaaaaEDMSIITYDQQHPAKG---LVRSEDEVKEMFESWLVKHGKSY  227
            SIL   +F+ VS++AA  EDMSII+Y+++H   G   + R++DEV  ++ESWLV+H K Y
Sbjct  11   SILVMLMFSAVSSSAA--EDMSIISYNEKHHTNGESTVWRTDDEVMSLYESWLVEHKKVY  68

Query  228  NAVDEKDKRFKIFRDNLKYIDEKNSLENRSYKLGLNRFADITNEEYRTGYLGAKRDASRN  407
            NA+ EKDKRF+IF+DNL+YIDE NS+ ++SYKLGL +FAD+TNEEY++ YLG K D    
Sbjct  69   NALGEKDKRFQIFKDNLRYIDEHNSVPDKSYKLGLTQFADLTNEEYKSIYLGTKPDGRSR  128

Query  408  MVKSKSDRYAPVAGDSLPDSIDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            ++ ++SDRYAP  GDSLPDS+DWR+KG +  VK+QG CGSCWAFS +A++
Sbjct  129  LLNTQSDRYAPKVGDSLPDSVDWRKKGVLVDVKNQGQCGSCWAFSAVASI  178



>emb|CAN61026.1| hypothetical protein VITISV_001146 [Vitis vinifera]
Length=469

 Score =   204 bits (519),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 102/167 (61%), Positives = 131/167 (78%), Gaps = 1/167 (1%)
 Frame = +3

Query  57   SILFTFLFavvsaaaaaaEDMSIITYDQQHPAKGLVRSEDEVKEMFESWLVKHGKSYNAV  236
            S +  FLF ++  A+A+A DMSII YD+ H  K   R++++V  ++E+WL KHGKSYNA+
Sbjct  8    SSMAVFLFLLLGLASASAXDMSIIGYDETHGDKSSWRTDEDVMAVYEAWLAKHGKSYNAL  67

Query  237  DEKDKRFKIFRDNLKYIDEKNSLENRSYKLGLNRFADITNEEYRTGYLGAKRDASRNMVK  416
             EK++RF+IF+DNL++IDE N+ ENR+YK+GLNRFAD+TNEEYR+ YLG +  A R    
Sbjct  68   GEKERRFQIFKDNLRFIDEHNA-ENRTYKVGLNRFADLTNEEYRSMYLGTRTAAKRRSSN  126

Query  417  SKSDRYAPVAGDSLPDSIDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
              SDRYA   GDSLP+S+DWR+KGAV  VKDQGSCGSCWAFSTIAAV
Sbjct  127  KISDRYAFRVGDSLPESVDWRKKGAVVEVKDQGSCGSCWAFSTIAAV  173



>gb|ABQ10204.1| cysteine protease Cp6 [Actinidia deliciosa]
Length=461

 Score =   204 bits (518),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 94/132 (71%), Positives = 117/132 (89%), Gaps = 2/132 (2%)
 Frame = +3

Query  165  RSEDEVKEMFESWLVKHGKSYNAVDEKDKRFKIFRDNLKYIDEKNSLENRSYKLGLNRFA  344
            R++DEV  M+ESWLVKHGKSYNA+ EK+KRF+IF+DNL++IDE N+ E+R+YK+GLNRFA
Sbjct  37   RTDDEVMAMYESWLVKHGKSYNAIGEKEKRFQIFKDNLRFIDEHNA-ESRTYKVGLNRFA  95

Query  345  DITNEEYRTGYLGAKRDASRNM-VKSKSDRYAPVAGDSLPDSIDWREKGAVTGVKDQGSC  521
            D+TN+EYR+ YLGA+  + R +  + +SDRY PVAG+SLPDS+DWREKGAV GVKDQGSC
Sbjct  96   DLTNDEYRSMYLGARTGSRRRLSTQKRSDRYVPVAGESLPDSVDWREKGAVVGVKDQGSC  155

Query  522  GSCWAFSTIAAV  557
            GSCWAFSTIAAV
Sbjct  156  GSCWAFSTIAAV  167



>ref|XP_003589135.1| Cysteine proteinase [Medicago truncatula]
 gb|AES59386.1| papain family cysteine protease [Medicago truncatula]
Length=457

 Score =   204 bits (518),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 103/172 (60%), Positives = 127/172 (74%), Gaps = 5/172 (3%)
 Frame = +3

Query  54   PSILFTFLFavvsaaaaaaEDMSIITYDQQHPAKGLV-RSEDEVKEMFESWLVKHGKSYN  230
            P++    +  + S   + A DMSII+YD+ HP K    R+  EV  M+E WLVKHGKSYN
Sbjct  8    PAMKLMIVLIISSFTVSLALDMSIISYDKTHPDKSTSKRTNKEVLTMYEEWLVKHGKSYN  67

Query  231  AVDEKDKRFKIFRDNLKYIDEKNSLENRSYKLGLNRFADITNEEYRTGYLGAKRDASRNM  410
             + EKDKRF+IF+DNLK+IDE N L N +Y+LGL RFAD+TNEEYR+ +LG K D +R M
Sbjct  68   GLGEKDKRFEIFKDNLKFIDEHNGL-NSTYRLGLTRFADLTNEEYRSKFLGTKIDPNRRM  126

Query  411  VK---SKSDRYAPVAGDSLPDSIDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
             K   SKS+RYAP  GD LP+S+DWR++GAV GVKDQ SCGSCWAFS IAAV
Sbjct  127  KKLGGSKSNRYAPRVGDKLPESVDWRKEGAVVGVKDQASCGSCWAFSAIAAV  178



>ref|XP_002510170.1| cysteine protease, putative [Ricinus communis]
 gb|EEF52357.1| cysteine protease, putative [Ricinus communis]
Length=469

 Score =   204 bits (518),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 97/151 (64%), Positives = 123/151 (81%), Gaps = 4/151 (3%)
 Frame = +3

Query  114  DMSIITYDQQHPAKGLVRSEDEVKEMFESWLVKHGKSY---NAVDEKDKRFKIFRDNLKY  284
            DMSI++YDQ H  K   R++DEV  ++E WLVK+GK++   NA+ EK++RF++F+DNL++
Sbjct  25   DMSIVSYDQTHLTKSSWRTDDEVMAIYEEWLVKNGKAHSNNNALGEKERRFQVFKDNLRF  84

Query  285  IDEKNSLENRSYKLGLNRFADITNEEYRTGYLGAKRDASRNMVKSKSDRYAPVAGDSLPD  464
            IDE NS ENRSYK+GLNRFAD+TNEEYR+ YLGA+  A RN +   S+RY P  GDSLPD
Sbjct  85   IDEHNS-ENRSYKVGLNRFADLTNEEYRSMYLGARSGAKRNRLSRSSNRYLPRVGDSLPD  143

Query  465  SIDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            S+DWR++GAV  VKDQGSCGSCWAFSTIAAV
Sbjct  144  SVDWRKEGAVAEVKDQGSCGSCWAFSTIAAV  174



>ref|XP_006494485.1| PREDICTED: cysteine proteinase RD21a-like [Citrus sinensis]
Length=372

 Score =   201 bits (511),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 100/173 (58%), Positives = 129/173 (75%), Gaps = 8/173 (5%)
 Frame = +3

Query  45   MARPSILFTFLFavvsaaaaaaEDMSIITYDQQHPAKGLVRSEDEVKEMFESWLVKHGKS  224
            +A  +++F F  +  SAA     DMSII+YD  H      R++DEV  ++++WL KHGK+
Sbjct  8    LAISTLVFLFFISSSSAA-----DMSIISYDNNHDHSSSWRTDDEVMTIYQTWLAKHGKT  62

Query  225  YNAVDEKDKRFKIFRDNLKYIDEKNSLENRSYKLGLNRFADITNEEYRTGYLGAKRDASR  404
             N +   +KRF+IF+DNL++IDE NSL NR+YK+GLN+FAD+TNEEYR  YLG + DA R
Sbjct  63   SNGMGHNEKRFQIFKDNLRFIDEHNSL-NRTYKVGLNKFADLTNEEYRAMYLGTRSDAKR  121

Query  405  NMVKSK--SDRYAPVAGDSLPDSIDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
             ++KSK  S RYA  AGD LP+S+DWREKGAV  VKDQGSCGSCWAFST+AAV
Sbjct  122  RLMKSKVASQRYACKAGDELPESVDWREKGAVNPVKDQGSCGSCWAFSTVAAV  174



>ref|XP_003589133.1| Cysteine proteinase [Medicago truncatula]
 gb|ABD32628.1| Granulin; Peptidase C1A, papain [Medicago truncatula]
 gb|AES59384.1| papain family cysteine protease [Medicago truncatula]
Length=474

 Score =   204 bits (518),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 103/172 (60%), Positives = 127/172 (74%), Gaps = 5/172 (3%)
 Frame = +3

Query  54   PSILFTFLFavvsaaaaaaEDMSIITYDQQHPAKGLV-RSEDEVKEMFESWLVKHGKSYN  230
            P++    +  + S   + A DMSII+YD+ HP K    R+  EV  M+E WLVKHGKSYN
Sbjct  8    PAMKLMIVLIISSFTVSLALDMSIISYDKTHPDKSTSKRTNKEVLTMYEEWLVKHGKSYN  67

Query  231  AVDEKDKRFKIFRDNLKYIDEKNSLENRSYKLGLNRFADITNEEYRTGYLGAKRDASRNM  410
             + EKDKRF+IF+DNLK+IDE N L N +Y+LGL RFAD+TNEEYR+ +LG K D +R M
Sbjct  68   GLGEKDKRFEIFKDNLKFIDEHNGL-NSTYRLGLTRFADLTNEEYRSKFLGTKIDPNRRM  126

Query  411  VK---SKSDRYAPVAGDSLPDSIDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
             K   SKS+RYAP  GD LP+S+DWR++GAV GVKDQ SCGSCWAFS IAAV
Sbjct  127  KKLGGSKSNRYAPRVGDKLPESVDWRKEGAVVGVKDQASCGSCWAFSAIAAV  178



>gb|KDO79088.1| hypothetical protein CISIN_1g017419mg [Citrus sinensis]
Length=372

 Score =   201 bits (511),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 100/173 (58%), Positives = 129/173 (75%), Gaps = 8/173 (5%)
 Frame = +3

Query  45   MARPSILFTFLFavvsaaaaaaEDMSIITYDQQHPAKGLVRSEDEVKEMFESWLVKHGKS  224
            +A  +++F F  +  SAA     DMSII+YD  H      R++DEV  ++++WL KHGK+
Sbjct  8    LAISTLVFLFFISSSSAA-----DMSIISYDNNHDHSSSWRTDDEVMTIYQTWLAKHGKT  62

Query  225  YNAVDEKDKRFKIFRDNLKYIDEKNSLENRSYKLGLNRFADITNEEYRTGYLGAKRDASR  404
             N +   +KRF+IF+DNL++IDE NSL NR+YK+GLN+FAD+TNEEYR  YLG + DA R
Sbjct  63   SNGMGHNEKRFQIFKDNLRFIDEHNSL-NRTYKVGLNKFADLTNEEYRAMYLGTRSDAKR  121

Query  405  NMVKSK--SDRYAPVAGDSLPDSIDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
             ++KSK  S RYA  AGD LP+S+DWREKGAV  VKDQGSCGSCWAFST+AAV
Sbjct  122  RLMKSKVASQRYACKAGDELPESVDWREKGAVNPVKDQGSCGSCWAFSTVAAV  174



>gb|KJB14609.1| hypothetical protein B456_002G133800 [Gossypium raimondii]
Length=477

 Score =   204 bits (518),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 98/150 (65%), Positives = 124/150 (83%), Gaps = 4/150 (3%)
 Frame = +3

Query  114  DMSIITYDQQHPAKGLV--RSEDEVKEMFESWLVKHGKSYNAVDEKDKRFKIFRDNLKYI  287
            DMSII+YD+ HP K     R++DEV  M+E WLVKHGK+YN + EK++RF+IF+DNL++I
Sbjct  23   DMSIISYDETHPDKSTSSWRTDDEVMAMYEEWLVKHGKTYNGLGEKERRFQIFKDNLRFI  82

Query  288  DEKNSLENRSYKLGLNRFADITNEEYRTGYLGAKRDASRNMVKSKSDRYAPVAGDSLPDS  467
            DE N+ E++S+K+GLNRFAD+TNEEYR  YLG K+ A+R + K+ SDRYA + G+ LPDS
Sbjct  83   DEHNADESQSFKVGLNRFADLTNEEYRAIYLGIKK-ANRKVSKA-SDRYAALLGEKLPDS  140

Query  468  IDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            +DWREKGAV  VKDQGSCGSCWAFSTIAAV
Sbjct  141  VDWREKGAVAEVKDQGSCGSCWAFSTIAAV  170



>ref|XP_007017153.1| Granulin repeat cysteine protease family protein [Theobroma cacao]
 gb|EOY14378.1| Granulin repeat cysteine protease family protein [Theobroma cacao]
Length=466

 Score =   203 bits (517),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 95/150 (63%), Positives = 120/150 (80%), Gaps = 4/150 (3%)
 Frame = +3

Query  114  DMSIITYDQQHP--AKGLVRSEDEVKEMFESWLVKHGKSYNAVDEKDKRFKIFRDNLKYI  287
            DMSII+YD+ HP  +K + R++DEV  M+E WLVKHGK+YN + EK++RF+IF+DNL++I
Sbjct  23   DMSIISYDEGHPDKSKSIWRTDDEVMAMYEEWLVKHGKAYNGLGEKERRFEIFKDNLRFI  82

Query  288  DEKNSLENRSYKLGLNRFADITNEEYRTGYLGAKRDASRNMVKSKSDRYAPVAGDSLPDS  467
            DE N+ ++ S+K+GLNRFAD+TNEEYR  YLG K+   +  V  +SDRYAP  G+ LPDS
Sbjct  83   DEHNADDSHSFKVGLNRFADLTNEEYRAMYLGTKKPERK--VSKRSDRYAPSLGEELPDS  140

Query  468  IDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            IDWREKGAV  VKDQG CGSCWAFS IAAV
Sbjct  141  IDWREKGAVAAVKDQGGCGSCWAFSAIAAV  170



>gb|KJB14610.1| hypothetical protein B456_002G133800 [Gossypium raimondii]
Length=457

 Score =   203 bits (516),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 98/150 (65%), Positives = 124/150 (83%), Gaps = 4/150 (3%)
 Frame = +3

Query  114  DMSIITYDQQHPAKGLV--RSEDEVKEMFESWLVKHGKSYNAVDEKDKRFKIFRDNLKYI  287
            DMSII+YD+ HP K     R++DEV  M+E WLVKHGK+YN + EK++RF+IF+DNL++I
Sbjct  23   DMSIISYDETHPDKSTSSWRTDDEVMAMYEEWLVKHGKTYNGLGEKERRFQIFKDNLRFI  82

Query  288  DEKNSLENRSYKLGLNRFADITNEEYRTGYLGAKRDASRNMVKSKSDRYAPVAGDSLPDS  467
            DE N+ E++S+K+GLNRFAD+TNEEYR  YLG K+ A+R + K+ SDRYA + G+ LPDS
Sbjct  83   DEHNADESQSFKVGLNRFADLTNEEYRAIYLGIKK-ANRKVSKA-SDRYAALLGEKLPDS  140

Query  468  IDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            +DWREKGAV  VKDQGSCGSCWAFSTIAAV
Sbjct  141  VDWREKGAVAEVKDQGSCGSCWAFSTIAAV  170



>gb|KHG05637.1| Cysteinease RD21a -like protein [Gossypium arboreum]
Length=457

 Score =   202 bits (514),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 96/150 (64%), Positives = 118/150 (79%), Gaps = 4/150 (3%)
 Frame = +3

Query  114  DMSIITYDQQHPAKGLV--RSEDEVKEMFESWLVKHGKSYNAVDEKDKRFKIFRDNLKYI  287
            DMSII+YD+ HP K     R++DEV  M+E WLVKHGK+YN + EK++R +IF+DNL++I
Sbjct  23   DMSIISYDEAHPDKSTSSWRTDDEVMAMYEEWLVKHGKTYNGLGEKERRLQIFKDNLRFI  82

Query  288  DEKNSLENRSYKLGLNRFADITNEEYRTGYLGAKRDASRNMVKSKSDRYAPVAGDSLPDS  467
            DE N+ E+ S+K+GLNRFAD+TNEEYR  YLG K+   +  V   SDRYAP+ G  LPDS
Sbjct  83   DEHNADESHSFKVGLNRFADLTNEEYRAIYLGIKKPNRK--VSKASDRYAPLLGQKLPDS  140

Query  468  IDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            +DWREKGAV  VKDQGSCGSCWAFSTIAAV
Sbjct  141  VDWREKGAVAEVKDQGSCGSCWAFSTIAAV  170



>ref|XP_006374886.1| cysteine proteinase [Populus trichocarpa]
 gb|ABK95110.1| unknown [Populus trichocarpa]
 gb|ERP52683.1| cysteine proteinase [Populus trichocarpa]
Length=465

 Score =   202 bits (514),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 96/148 (65%), Positives = 119/148 (80%), Gaps = 2/148 (1%)
 Frame = +3

Query  114  DMSIITYDQQHPAKGLVRSEDEVKEMFESWLVKHGKSYNAVDEKDKRFKIFRDNLKYIDE  293
            DMSII+Y Q H  K   R++DEV  M+E WLVKHGK+YNA+ EK+KRF+IF+DNL +ID+
Sbjct  25   DMSIISYHQTHATKSSWRTDDEVMAMYEEWLVKHGKNYNALGEKEKRFEIFKDNLMFIDQ  84

Query  294  KNSLENRSYKLGLNRFADITNEEYRTGYLGAKRDASRNMVKSKSDRYAPVAGDSLPDSID  473
             NS ENR+Y +GLNRFAD+TNEE+R+ YLG +    + + K+ SDRYAP  GDSLPDS+D
Sbjct  85   HNS-ENRTYTVGLNRFADLTNEEFRSMYLGTRTGHKKRLPKT-SDRYAPRVGDSLPDSVD  142

Query  474  WREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            WR++GAV  VKDQG CGSCWAFSTIAAV
Sbjct  143  WRKEGAVAEVKDQGGCGSCWAFSTIAAV  170



>emb|CAA46863.1| thiolprotease [Pisum sativum]
Length=464

 Score =   202 bits (514),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 98/166 (59%), Positives = 127/166 (77%), Gaps = 3/166 (2%)
 Frame = +3

Query  66   FTFLFavvsaaaaaaEDMSIITYDQQHPAKGLVRSEDEVKEMFESWLVKHGKSYNAVDEK  245
             T LF  ++   + A DM II+YD+ HP K   R+ D+V  M+E WLVKHGK+YNA+ EK
Sbjct  5    LTILFITLTFTLSLALDMCIISYDKTHPDKSTPRTNDQVLTMYEEWLVKHGKNYNALGEK  64

Query  246  DKRFKIFRDNLKYIDEKNSLENRSYKLGLNRFADITNEEYRTGYLGAKRDASR--NMVKS  419
            +KRF+IF+DNL +IDE NS +N S++LGLNRFAD+TNEEYRT +LG + + +R    V S
Sbjct  65   EKRFEIFKDNLGFIDEHNS-KNLSFRLGLNRFADLTNEEYRTRFLGTRINPNRRNRKVNS  123

Query  420  KSDRYAPVAGDSLPDSIDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            +++RYA   GD LP+S+DWR++GAV GVKDQGSCGSCWAFS IAAV
Sbjct  124  QTNRYATRVGDKLPESVDWRKEGAVVGVKDQGSCGSCWAFSAIAAV  169



>gb|AGV15823.1| cysteine protease CP15 [Nicotiana tabacum]
Length=474

 Score =   202 bits (513),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 99/170 (58%), Positives = 133/170 (78%), Gaps = 5/170 (3%)
 Frame = +3

Query  57   SILFTFLFavvsaaaaaaEDMSIITYDQQHPAKG---LVRSEDEVKEMFESWLVKHGKSY  227
            SIL   +F+VVS++AA  EDMSII+Y+++H   G   + R++DEV  ++ESWLV+H K Y
Sbjct  11   SILVMLMFSVVSSSAA--EDMSIISYNEKHHTNGESTVWRTDDEVMSLYESWLVEHKKVY  68

Query  228  NAVDEKDKRFKIFRDNLKYIDEKNSLENRSYKLGLNRFADITNEEYRTGYLGAKRDASRN  407
            NA+ EKDKRF+IF+DNL+YIDE+NS   +SYKLGL +FAD+TNEEY++ YLG K D    
Sbjct  69   NALGEKDKRFQIFKDNLRYIDEQNSAPEKSYKLGLTQFADLTNEEYKSIYLGTKPDGRSR  128

Query  408  MVKSKSDRYAPVAGDSLPDSIDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            +  ++SDRYAP  GDSLPDS+DWR+KG +  VK+QG CGSCWAFS +A++
Sbjct  129  LSYTQSDRYAPKVGDSLPDSVDWRKKGVLVDVKNQGQCGSCWAFSAVASI  178



>ref|XP_009604895.1| PREDICTED: low-temperature-induced cysteine proteinase-like [Nicotiana 
tomentosiformis]
Length=473

 Score =   201 bits (511),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 95/170 (56%), Positives = 131/170 (77%), Gaps = 6/170 (4%)
 Frame = +3

Query  57   SILFTFLFavvsaaaaaaEDMSIITYDQQHPAKG---LVRSEDEVKEMFESWLVKHGKSY  227
            SIL   +F+ V+++A   EDMSII+Y+++H   G   + R++DE+  ++ESWLV+H K Y
Sbjct  11   SILVMLMFSAVTSSA---EDMSIISYNEKHHTNGESTVWRTDDEIVSLYESWLVEHKKVY  67

Query  228  NAVDEKDKRFKIFRDNLKYIDEKNSLENRSYKLGLNRFADITNEEYRTGYLGAKRDASRN  407
            NA+ EKDKRF+IF+DNL+YIDE+NS   +SYKLGL +FAD+TNEEY++ YLG K D    
Sbjct  68   NALGEKDKRFQIFKDNLRYIDEQNSAPEKSYKLGLTQFADLTNEEYKSIYLGTKPDGRSR  127

Query  408  MVKSKSDRYAPVAGDSLPDSIDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            +  ++SDRYAP  GDSLPDS+DWR+KG +  VK+QG CGSCWAFS +A++
Sbjct  128  LSYTQSDRYAPKVGDSLPDSVDWRKKGVLVDVKNQGQCGSCWAFSAVASI  177



>dbj|BAD29958.1| cysteine protease [Daucus carota]
Length=496

 Score =   201 bits (512),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 95/148 (64%), Positives = 121/148 (82%), Gaps = 2/148 (1%)
 Frame = +3

Query  114  DMSIITYDQQHPAKGLVRSEDEVKEMFESWLVKHGKSYNAVDEKDKRFKIFRDNLKYIDE  293
            DMSIITYD+ H A G  +++DE   +FESWLV HGKSYNA+ E++KRF+IF++NL+YIDE
Sbjct  21   DMSIITYDETH-AVGF-KTDDEATTLFESWLVTHGKSYNALGEEEKRFQIFKNNLRYIDE  78

Query  294  KNSLENRSYKLGLNRFADITNEEYRTGYLGAKRDASRNMVKSKSDRYAPVAGDSLPDSID  473
            +N +E+R +KLGLN+FAD+TNEEYR+ Y G K    R  V +KS RYA ++G+SLP+S+D
Sbjct  79   QNLVEDRGFKLGLNKFADLTNEEYRSKYTGIKSKDLRKKVSAKSGRYATLSGESLPESVD  138

Query  474  WREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            WRE GAV  VKDQGSCGSCWAFSTI+AV
Sbjct  139  WRESGAVATVKDQGSCGSCWAFSTISAV  166



>dbj|BAD29960.1| cysteine protease [Daucus carota]
Length=460

 Score =   200 bits (509),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 94/148 (64%), Positives = 117/148 (79%), Gaps = 3/148 (2%)
 Frame = +3

Query  114  DMSIITYDQQHPAKGLVRSEDEVKEMFESWLVKHGKSYNAVDEKDKRFKIFRDNLKYIDE  293
            DMSIITYDQ H    +  ++D +   +ESWLVKHGKSYNA+ EK++RF+IF+DN  YIDE
Sbjct  21   DMSIITYDQTH---AVGSTDDVIMAAYESWLVKHGKSYNALGEKEQRFQIFKDNFLYIDE  77

Query  294  KNSLENRSYKLGLNRFADITNEEYRTGYLGAKRDASRNMVKSKSDRYAPVAGDSLPDSID  473
            +N+ ++RS+KLGLNRFAD+TNEEYR+ Y G +   SR  V  KS RYA +AG+SLP+S+D
Sbjct  78   QNAAKDRSFKLGLNRFADLTNEEYRSKYTGIRTKDSRKKVSGKSQRYASLAGESLPESVD  137

Query  474  WREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            WRE GAV  VKDQG CGSCWAFSTI+AV
Sbjct  138  WREHGAVASVKDQGQCGSCWAFSTISAV  165



>ref|XP_009772520.1| PREDICTED: cysteine proteinase RD21a-like [Nicotiana sylvestris]
Length=468

 Score =   200 bits (509),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 96/151 (64%), Positives = 122/151 (81%), Gaps = 4/151 (3%)
 Frame = +3

Query  114  DMSIITYDQQHPAKGLV--RSEDEVKEMFESWLVKHGKSYNAVDEKDKRFKIFRDNLKYI  287
            DMSII+Y++QH   G    R++DEV+ ++ESWLVKHGK+YNA+ EK+KRF+IF+DNL++I
Sbjct  22   DMSIISYNEQHGQMGTTHHRTDDEVRGLYESWLVKHGKNYNAIGEKEKRFEIFKDNLRFI  81

Query  288  DEKNSLENRSYKLGLNRFADITNEEYRTGYLGAKRD-ASRNMVKSKSDRYAPVAGDSLPD  464
            DE N+ ENRSYKLGLNRF+D+TNEEYR  ++G + D  +R M   KSDRY   AG+ LP+
Sbjct  82   DEHNA-ENRSYKLGLNRFSDLTNEEYRAMFVGGRLDRKTRLMKNPKSDRYTFQAGEKLPE  140

Query  465  SIDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            S+DWREKGAV  VKDQG CGSCWAFST+ AV
Sbjct  141  SVDWREKGAVAPVKDQGQCGSCWAFSTVGAV  171



>ref|XP_002284973.1| PREDICTED: low-temperature-induced cysteine proteinase [Vitis 
vinifera]
Length=467

 Score =   200 bits (508),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 101/167 (60%), Positives = 129/167 (77%), Gaps = 3/167 (2%)
 Frame = +3

Query  57   SILFTFLFavvsaaaaaaEDMSIITYDQQHPAKGLVRSEDEVKEMFESWLVKHGKSYNAV  236
            S +  FLF ++  A+A   DMSII YD+ H  K   R++++V  ++E+WL KHGKSYNA+
Sbjct  8    SSMAVFLFLLLGLASAL--DMSIIGYDETHGDKSSWRTDEDVMAVYEAWLAKHGKSYNAL  65

Query  237  DEKDKRFKIFRDNLKYIDEKNSLENRSYKLGLNRFADITNEEYRTGYLGAKRDASRNMVK  416
             EK++RF+IF+DNL++IDE N+ ENR+YK+GLNRFAD+TNEEYR+ YLG +  A R    
Sbjct  66   GEKERRFQIFKDNLRFIDEHNA-ENRTYKVGLNRFADLTNEEYRSMYLGTRTAAKRRSSN  124

Query  417  SKSDRYAPVAGDSLPDSIDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
              SDRYA   GDSLP+S+DWR+KGAV  VKDQGSCGSCWAFSTIAAV
Sbjct  125  KISDRYAFRVGDSLPESVDWRKKGAVVEVKDQGSCGSCWAFSTIAAV  171



>ref|XP_006425969.1| hypothetical protein CICLE_v10025887mg [Citrus clementina]
 gb|ESR39209.1| hypothetical protein CICLE_v10025887mg [Citrus clementina]
Length=372

 Score =   197 bits (500),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 99/173 (57%), Positives = 128/173 (74%), Gaps = 8/173 (5%)
 Frame = +3

Query  45   MARPSILFTFLFavvsaaaaaaEDMSIITYDQQHPAKGLVRSEDEVKEMFESWLVKHGKS  224
            +A  +++F F  +  SAA     DMSII+YD  H      R++DEV  ++++WL K GK+
Sbjct  8    LAISTLVFLFFISSSSAA-----DMSIISYDNNHDHSSSWRTDDEVMTIYQTWLAKRGKT  62

Query  225  YNAVDEKDKRFKIFRDNLKYIDEKNSLENRSYKLGLNRFADITNEEYRTGYLGAKRDASR  404
             N +   +KRF+IF+DNL++IDE NSL NR+YK+GLN+FAD+TNEEYR  YLG + DA R
Sbjct  63   SNGMGHNEKRFQIFKDNLRFIDEHNSL-NRTYKVGLNKFADLTNEEYRAMYLGTRSDAKR  121

Query  405  NMVKSK--SDRYAPVAGDSLPDSIDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
             ++KSK  S RYA  AGD LP+S+DWREKGAV  VKDQGSCGSCWAFST+AAV
Sbjct  122  RLMKSKVASQRYAFKAGDELPESVDWREKGAVNPVKDQGSCGSCWAFSTVAAV  174



>gb|KJB48623.1| hypothetical protein B456_008G078300 [Gossypium raimondii]
Length=240

 Score =   192 bits (489),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 89/150 (59%), Positives = 120/150 (80%), Gaps = 3/150 (2%)
 Frame = +3

Query  117  MSIITYDQQHPAKGLV-RSEDEVKEMFESWLVKHGKSYNAVDEKDKRFKIFRDNLKYIDE  293
            +S +T +Q HP+     RS+DEV  +++SW+++HGK+YN + E++KRF+IF+DNL++IDE
Sbjct  20   ISTLTLNQNHPSSSSSWRSDDEVMGLYKSWVIQHGKAYNGIGEEEKRFEIFKDNLRFIDE  79

Query  294  KNSLENRSYKLGLNRFADITNEEYRTGYLGAKRDASRNMVKSK--SDRYAPVAGDSLPDS  467
             NS  N +YKLGLN+FAD+TN+EYR  +LG + D  R ++KSK  S RYA  AGD+LPDS
Sbjct  80   HNSNNNTTYKLGLNKFADLTNQEYRAKFLGTRTDPRRRLMKSKVPSSRYAHRAGDNLPDS  139

Query  468  IDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            +DWR+ GAV+ VKDQGSCGSCWAFSTIAAV
Sbjct  140  VDWRDHGAVSPVKDQGSCGSCWAFSTIAAV  169



>ref|XP_009354165.1| PREDICTED: low-temperature-induced cysteine proteinase-like [Pyrus 
x bretschneideri]
Length=469

 Score =   199 bits (505),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 98/154 (64%), Positives = 121/154 (79%), Gaps = 7/154 (5%)
 Frame = +3

Query  114  DMSIITYDQQ---HPAKGLVRSEDEVKEMFESWLVKHGKSYNAVDEKDKRFKIFRDNLKY  284
            DMSI++YD       + G  R++DEV  M+E WL +HGK+YNA+ EK++RF+IF+DNL+Y
Sbjct  25   DMSIVSYDNNLGDGKSTGSWRTDDEVMSMYEGWLAEHGKAYNALGEKERRFQIFKDNLRY  84

Query  285  IDEKNSLENRSYKLGLNRFADITNEEYRTGYLGAKRDASRNMV---KSKSDRYAPVAGDS  455
            IDE+NS +N SYKLGLNRFAD++NEEYR  YLG K  A +  +    +KSDRYAP  GDS
Sbjct  85   IDEQNS-KNLSYKLGLNRFADLSNEEYRNTYLGTKTRAQKKRLSNRNTKSDRYAPRVGDS  143

Query  456  LPDSIDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            LPDSIDWRE+GAV  VKDQGSCGSCWAFSTI+AV
Sbjct  144  LPDSIDWREEGAVNPVKDQGSCGSCWAFSTISAV  177



>ref|XP_006434711.1| hypothetical protein CICLE_v100010541mg, partial [Citrus clementina]
 gb|ESR47951.1| hypothetical protein CICLE_v100010541mg, partial [Citrus clementina]
Length=160

 Score =   189 bits (481),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 101/167 (60%), Positives = 126/167 (75%), Gaps = 11/167 (7%)
 Frame = +3

Query  27   LLLLPTMARPSILFTFLFavvsaaaaaaEDMSIITYDQQHPAKGLV-RSEDEVKEMFESW  203
            L   PTMA   +   FLF V SA      DMSI++YD+ H +K    R++DEV  MFE+W
Sbjct  3    LFRSPTMA---MFLLFLFTVSSAL-----DMSIVSYDKTHESKSSSWRTDDEVMGMFEAW  54

Query  204  LVKHGKSYNAVDEKDKRFKIFRDNLKYIDEKNSLENRSYKLGLNRFADITNEEYRTGYLG  383
             VKHGK+YNA+ EK+KRF+IF+DNL++IDE NS ENR+YK+GLNRFAD+TNEEYR+ YLG
Sbjct  55   FVKHGKAYNALGEKEKRFEIFKDNLRFIDEHNS-ENRTYKVGLNRFADLTNEEYRSMYLG  113

Query  384  AKRDASRNMVKSK-SDRYAPVAGDSLPDSIDWREKGAVTGVKDQGSC  521
            A+  A R  +KSK SDRY P  G++LPDS+DWR+KGAV  VKDQGSC
Sbjct  114  ARFGAKRTSLKSKRSDRYLPRVGEALPDSVDWRKKGAVAEVKDQGSC  160



>gb|AER60490.1| cysteine proteases [Gossypium hirsutum]
Length=371

 Score =   196 bits (497),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 88/149 (59%), Positives = 119/149 (80%), Gaps = 2/149 (1%)
 Frame = +3

Query  117  MSIITYDQQHPAKGLVRSEDEVKEMFESWLVKHGKSYNAVDEKDKRFKIFRDNLKYIDEK  296
            +S +T +Q HP+    RS+DEV  +++SW+++HGK+YN + E++KRF+IF+DNL++IDE 
Sbjct  20   ISTLTLNQNHPSSSSWRSDDEVMGLYKSWVIQHGKAYNGIGEEEKRFEIFKDNLRFIDEH  79

Query  297  NSLENRSYKLGLNRFADITNEEYRTGYLGAKRDASRNMVKSK--SDRYAPVAGDSLPDSI  470
            NS  N +YKLGLN+FAD+TN+EYR  +LG + D  R ++KSK  S RYA  AGD+LPDS+
Sbjct  80   NSNNNTTYKLGLNKFADLTNQEYRAKFLGTRTDPRRRLMKSKIPSSRYAHRAGDNLPDSV  139

Query  471  DWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            DWR+ GAV+ VKDQGSCGSCWAFSTIA V
Sbjct  140  DWRDHGAVSPVKDQGSCGSCWAFSTIATV  168



>ref|XP_008393776.1| PREDICTED: low-temperature-induced cysteine proteinase-like [Malus 
domestica]
Length=475

 Score =   198 bits (504),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 102/177 (58%), Positives = 131/177 (74%), Gaps = 9/177 (5%)
 Frame = +3

Query  51   RPSILFTFLFavvsaaaaaaEDMSIITYDQQH-----PAKGLVRSEDEVKEMFESWLVKH  215
            R S +   L  +     ++A DMSII+YD  +      + G  R++DEV  ++E WL +H
Sbjct  5    RSSPVVAILLLLTIFTVSSALDMSIISYDSNNHVGDSKSSGSWRTDDEVMSIYEGWLXEH  64

Query  216  GKSYNAVDEKDKRFKIFRDNLKYIDEKNSLENRSYKLGLNRFADITNEEYRTGYLGAKRD  395
            GK+YNA+ EK++RF+IF+DNL+YIDE+NS +N SYKLGLNRFAD++NEEYR  YLGAK  
Sbjct  65   GKAYNALGEKERRFQIFKDNLRYIDEQNS-KNLSYKLGLNRFADLSNEEYRNTYLGAKTR  123

Query  396  ASRNMV---KSKSDRYAPVAGDSLPDSIDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            A    V    +KSDRYAP  GDSLPDS+DWR++GAV+ VKDQGSCGSCWAFSTI+AV
Sbjct  124  AQMKRVSNRNTKSDRYAPRVGDSLPDSVDWRKEGAVSPVKDQGSCGSCWAFSTISAV  180



>ref|XP_004499026.1| PREDICTED: cysteine proteinase RD21a-like [Cicer arietinum]
Length=472

 Score =   198 bits (503),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 99/177 (56%), Positives = 126/177 (71%), Gaps = 3/177 (2%)
 Frame = +3

Query  33   LLPTMARPSILFTFLFavvsaaaaaaEDMSIITYDQQHPAKGLVRSEDEVKEMFESWLVK  212
            +  T    ++  T L  +++   + A DMSII+YD+ H  K   R+E EV  ++E WLVK
Sbjct  1    MASTTLSHAMNLTILLVLLTFTVSLALDMSIISYDKTHTDKSSHRTEKEVLTLYEEWLVK  60

Query  213  HGKSYNAVDEKDKRFKIFRDNLKYIDEKNSLENRSYKLGLNRFADITNEEYRTGYLGAKR  392
            HGK YN + EKDKRF IF+DNLK+IDE N L N +Y+LGL RFAD+TNEEYR  +LG + 
Sbjct  61   HGKVYNGLGEKDKRFDIFKDNLKFIDEHNVL-NSTYRLGLTRFADLTNEEYRAKFLGTRV  119

Query  393  DASRNM--VKSKSDRYAPVAGDSLPDSIDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            D +R +  V S S+RYAP  GD LP+S+DWR++GAV  VKDQGSCGSCWAFS IAAV
Sbjct  120  DPNRKIRKVNSPSNRYAPRVGDKLPESVDWRKEGAVAAVKDQGSCGSCWAFSAIAAV  176



>gb|KJB48626.1| hypothetical protein B456_008G078300 [Gossypium raimondii]
Length=286

 Score =   193 bits (490),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 89/150 (59%), Positives = 120/150 (80%), Gaps = 3/150 (2%)
 Frame = +3

Query  117  MSIITYDQQHPAKGLV-RSEDEVKEMFESWLVKHGKSYNAVDEKDKRFKIFRDNLKYIDE  293
            +S +T +Q HP+     RS+DEV  +++SW+++HGK+YN + E++KRF+IF+DNL++IDE
Sbjct  20   ISTLTLNQNHPSSSSSWRSDDEVMGLYKSWVIQHGKAYNGIGEEEKRFEIFKDNLRFIDE  79

Query  294  KNSLENRSYKLGLNRFADITNEEYRTGYLGAKRDASRNMVKSK--SDRYAPVAGDSLPDS  467
             NS  N +YKLGLN+FAD+TN+EYR  +LG + D  R ++KSK  S RYA  AGD+LPDS
Sbjct  80   HNSNNNTTYKLGLNKFADLTNQEYRAKFLGTRTDPRRRLMKSKVPSSRYAHRAGDNLPDS  139

Query  468  IDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            +DWR+ GAV+ VKDQGSCGSCWAFSTIAAV
Sbjct  140  VDWRDHGAVSPVKDQGSCGSCWAFSTIAAV  169



>gb|AJA74414.1| cysteine protease [Cicer arietinum]
Length=495

 Score =   198 bits (504),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 99/177 (56%), Positives = 126/177 (71%), Gaps = 3/177 (2%)
 Frame = +3

Query  33   LLPTMARPSILFTFLFavvsaaaaaaEDMSIITYDQQHPAKGLVRSEDEVKEMFESWLVK  212
            +  T    ++  T L  +++   + A DMSII+YD+ H  K   R+E EV  ++E WLVK
Sbjct  1    MASTTLSHAMNLTILLVLLTFTVSLALDMSIISYDKTHTDKSSHRTEKEVLTLYEEWLVK  60

Query  213  HGKSYNAVDEKDKRFKIFRDNLKYIDEKNSLENRSYKLGLNRFADITNEEYRTGYLGAKR  392
            HGK YN + EKDKRF IF+DNLK+IDE N L N +Y+LGL RFAD+TNEEYR  +LG + 
Sbjct  61   HGKVYNGLGEKDKRFDIFKDNLKFIDEHNVL-NSTYRLGLTRFADLTNEEYRAKFLGTRV  119

Query  393  DASRNM--VKSKSDRYAPVAGDSLPDSIDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            D +R +  V S S+RYAP  GD LP+S+DWR++GAV  VKDQGSCGSCWAFS IAAV
Sbjct  120  DPNRKIRKVNSPSNRYAPRVGDKLPESVDWRKEGAVAAVKDQGSCGSCWAFSAIAAV  176



>gb|KJB48624.1| hypothetical protein B456_008G078300 [Gossypium raimondii]
Length=314

 Score =   193 bits (491),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 89/150 (59%), Positives = 120/150 (80%), Gaps = 3/150 (2%)
 Frame = +3

Query  117  MSIITYDQQHPAKGLV-RSEDEVKEMFESWLVKHGKSYNAVDEKDKRFKIFRDNLKYIDE  293
            +S +T +Q HP+     RS+DEV  +++SW+++HGK+YN + E++KRF+IF+DNL++IDE
Sbjct  20   ISTLTLNQNHPSSSSSWRSDDEVMGLYKSWVIQHGKAYNGIGEEEKRFEIFKDNLRFIDE  79

Query  294  KNSLENRSYKLGLNRFADITNEEYRTGYLGAKRDASRNMVKSK--SDRYAPVAGDSLPDS  467
             NS  N +YKLGLN+FAD+TN+EYR  +LG + D  R ++KSK  S RYA  AGD+LPDS
Sbjct  80   HNSNNNTTYKLGLNKFADLTNQEYRAKFLGTRTDPRRRLMKSKVPSSRYAHRAGDNLPDS  139

Query  468  IDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            +DWR+ GAV+ VKDQGSCGSCWAFSTIAAV
Sbjct  140  VDWRDHGAVSPVKDQGSCGSCWAFSTIAAV  169



>ref|XP_009359945.1| PREDICTED: low-temperature-induced cysteine proteinase-like [Pyrus 
x bretschneideri]
Length=474

 Score =   197 bits (501),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 98/156 (63%), Positives = 123/156 (79%), Gaps = 9/156 (6%)
 Frame = +3

Query  114  DMSIITYDQQH-----PAKGLVRSEDEVKEMFESWLVKHGKSYNAVDEKDKRFKIFRDNL  278
            DMSII+YD  +      + G  R++DEV  ++E WL +HGK+YNA+ EK++RF+IF+DNL
Sbjct  25   DMSIISYDSNNHLGDSKSSGSWRTDDEVMSIYEGWLAEHGKAYNALGEKERRFQIFKDNL  84

Query  279  KYIDEKNSLENRSYKLGLNRFADITNEEYRTGYLGAKRDASRNMV---KSKSDRYAPVAG  449
            +YIDE+NS +N SYKLGLNRFAD++NEEYR  YLGAK  A    V    +KSDRYAP  G
Sbjct  85   RYIDEQNS-KNLSYKLGLNRFADLSNEEYRNTYLGAKTRAQMKRVSNRNTKSDRYAPRVG  143

Query  450  DSLPDSIDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            DSLPDS+DWR++GAV+ VKDQGSCGSCWAFSTI+AV
Sbjct  144  DSLPDSVDWRKEGAVSPVKDQGSCGSCWAFSTISAV  179



>ref|XP_011097243.1| PREDICTED: cysteine proteinase COT44 [Sesamum indicum]
Length=371

 Score =   194 bits (493),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 97/171 (57%), Positives = 128/171 (75%), Gaps = 5/171 (3%)
 Frame = +3

Query  54   PSILFTFLFavvsaaaaaaEDMSIITYDQQHPAKGLVRSEDEVKEMFESWLVKHGKSYNA  233
            P+ +   L    +  +A A D SI+ Y+ +H A    RSE++VK ++E WL KHGK+YN 
Sbjct  2    PAFIAALLIISSAVVSAHATDFSILDYNNKHAASN-PRSEEQVKGLYERWLAKHGKAYNG  60

Query  234  VDEKDKRFKIFRDNLKYIDEKNSLENRSYKLGLNRFADITNEEYRTGYLGAKRDASRNMV  413
            + EKD+RF+IF+DNLK++DE NS  NR+YK+GLNRFAD+TNEE+R+ YLG + DA R  V
Sbjct  61   IGEKDRRFQIFKDNLKFVDEHNS-GNRTYKVGLNRFADLTNEEFRSVYLGTRTDAKRRFV  119

Query  414  KSK--SDRYAPVAG-DSLPDSIDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            KSK  S RYA  AG D LP+S+DWRE+GAV  +K+QG+CGSCWAFST+AAV
Sbjct  120  KSKNASRRYAFRAGDDELPESVDWRERGAVAPIKNQGTCGSCWAFSTVAAV  170



>ref|XP_011088223.1| PREDICTED: low-temperature-induced cysteine proteinase-like [Sesamum 
indicum]
Length=468

 Score =   196 bits (499),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 100/172 (58%), Positives = 125/172 (73%), Gaps = 2/172 (1%)
 Frame = +3

Query  45   MARPSILFTFLFavvsaaaaaaEDMSIITYDQQHPAKGLVRSEDEVKEMFESWLVKHGKS  224
            MA P  L   L  +     ++A DMSIITYD+ H      RSE+EV  ++ESWL KHGK+
Sbjct  1    MASPLKLSFSLLILSFFILSSALDMSIITYDENHKMGSPHRSENEVMALYESWLAKHGKA  60

Query  225  YNAVDEKDKRFKIFRDNLKYIDEKNSLENRSYKLGLNRFADITNEEYRTGYLGAKRDASR  404
            YNA+ EK+KRF+IF+DNLK+IDE NS  +RSYKLGLNRFAD+TNEEYR  ++  + D   
Sbjct  61   YNAIGEKEKRFEIFKDNLKFIDEHNS-ADRSYKLGLNRFADLTNEEYRMLFVSGRVDRKT  119

Query  405  NMVKSK-SDRYAPVAGDSLPDSIDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
             ++  + SDRYA  AG+ LP S+DWR+KGAV  VKDQG CGSCWAFST+AAV
Sbjct  120  KLINRRASDRYAFKAGEELPQSVDWRKKGAVAPVKDQGQCGSCWAFSTVAAV  171



>ref|XP_009591184.1| PREDICTED: cysteine proteinase RD21a-like [Nicotiana tomentosiformis]
Length=468

 Score =   196 bits (499),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 94/151 (62%), Positives = 121/151 (80%), Gaps = 4/151 (3%)
 Frame = +3

Query  114  DMSIITYDQQHPAKGLV--RSEDEVKEMFESWLVKHGKSYNAVDEKDKRFKIFRDNLKYI  287
            D SII+YD+QH   G    R++DEV+ ++ESWLVKHGK+YNA+ EK++RF+IF DNL++I
Sbjct  22   DKSIISYDEQHGQMGTTHHRTDDEVRGLYESWLVKHGKNYNAIGEKERRFEIFNDNLRFI  81

Query  288  DEKNSLENRSYKLGLNRFADITNEEYRTGYLGAKRDASRNMVKS-KSDRYAPVAGDSLPD  464
            DE N+ ENR YKLGLNRF+D+TNEEYR  ++G + D    ++KS KS+RYA  AG+ LP+
Sbjct  82   DEHNA-ENRPYKLGLNRFSDLTNEEYRAMFVGGRLDRKTRLMKSPKSNRYAFQAGEKLPE  140

Query  465  SIDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            S+DWREKGAV  VKDQG CGSCWAFST+ AV
Sbjct  141  SVDWREKGAVAPVKDQGQCGSCWAFSTVGAV  171



>ref|XP_002524912.1| cysteine protease, putative [Ricinus communis]
 gb|EEF37409.1| cysteine protease, putative [Ricinus communis]
Length=366

 Score =   194 bits (492),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 96/173 (55%), Positives = 128/173 (74%), Gaps = 4/173 (2%)
 Frame = +3

Query  45   MARPSILFTFLFavvsaaaaaaEDMSIITYDQQHPAKGLVRSEDEVKEMFESWLVKHGKS  224
            MA P  L T LF   + ++A   DMSI++++  H  +   RS++EV  M+  WL KH K+
Sbjct  1    MALPISLSTLLFLFFTLSSAW--DMSILSHNHGHHHQSSWRSDNEVISMYNWWLAKHSKT  58

Query  225  YNAVDEKDKRFKIFRDNLKYIDEKNSLENRSYKLGLNRFADITNEEYRTGYLGAKRDASR  404
            YN + E++KRF+IF++NL++IDE N+ +NR+YK+GL RFAD+TNEEYR  +LG K D  R
Sbjct  59   YNKLGEREKRFEIFKNNLRFIDEHNNSKNRTYKVGLTRFADLTNEEYRAKFLGTKSDPKR  118

Query  405  NMVKSK--SDRYAPVAGDSLPDSIDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
             ++KSK  S RYA  AGD LP+SIDWR+ GAV+ +KDQGSCGSCWAFSTIAAV
Sbjct  119  RLMKSKNPSQRYAFKAGDVLPESIDWRQSGAVSAIKDQGSCGSCWAFSTIAAV  171



>gb|KJB48625.1| hypothetical protein B456_008G078300 [Gossypium raimondii]
Length=372

 Score =   193 bits (490),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 89/150 (59%), Positives = 120/150 (80%), Gaps = 3/150 (2%)
 Frame = +3

Query  117  MSIITYDQQHPAKGLV-RSEDEVKEMFESWLVKHGKSYNAVDEKDKRFKIFRDNLKYIDE  293
            +S +T +Q HP+     RS+DEV  +++SW+++HGK+YN + E++KRF+IF+DNL++IDE
Sbjct  20   ISTLTLNQNHPSSSSSWRSDDEVMGLYKSWVIQHGKAYNGIGEEEKRFEIFKDNLRFIDE  79

Query  294  KNSLENRSYKLGLNRFADITNEEYRTGYLGAKRDASRNMVKSK--SDRYAPVAGDSLPDS  467
             NS  N +YKLGLN+FAD+TN+EYR  +LG + D  R ++KSK  S RYA  AGD+LPDS
Sbjct  80   HNSNNNTTYKLGLNKFADLTNQEYRAKFLGTRTDPRRRLMKSKVPSSRYAHRAGDNLPDS  139

Query  468  IDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            +DWR+ GAV+ VKDQGSCGSCWAFSTIAAV
Sbjct  140  VDWRDHGAVSPVKDQGSCGSCWAFSTIAAV  169



>gb|KJB48622.1| hypothetical protein B456_008G078300 [Gossypium raimondii]
Length=372

 Score =   193 bits (490),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 89/150 (59%), Positives = 120/150 (80%), Gaps = 3/150 (2%)
 Frame = +3

Query  117  MSIITYDQQHPAKGLV-RSEDEVKEMFESWLVKHGKSYNAVDEKDKRFKIFRDNLKYIDE  293
            +S +T +Q HP+     RS+DEV  +++SW+++HGK+YN + E++KRF+IF+DNL++IDE
Sbjct  20   ISTLTLNQNHPSSSSSWRSDDEVMGLYKSWVIQHGKAYNGIGEEEKRFEIFKDNLRFIDE  79

Query  294  KNSLENRSYKLGLNRFADITNEEYRTGYLGAKRDASRNMVKSK--SDRYAPVAGDSLPDS  467
             NS  N +YKLGLN+FAD+TN+EYR  +LG + D  R ++KSK  S RYA  AGD+LPDS
Sbjct  80   HNSNNNTTYKLGLNKFADLTNQEYRAKFLGTRTDPRRRLMKSKVPSSRYAHRAGDNLPDS  139

Query  468  IDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            +DWR+ GAV+ VKDQGSCGSCWAFSTIAAV
Sbjct  140  VDWRDHGAVSPVKDQGSCGSCWAFSTIAAV  169



>ref|XP_009395501.1| PREDICTED: oryzain alpha chain-like [Musa acuminata subsp. malaccensis]
Length=469

 Score =   195 bits (496),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 87/149 (58%), Positives = 119/149 (80%), Gaps = 1/149 (1%)
 Frame = +3

Query  114  DMSIITYDQQHPAKGLVRSEDEVKEMFESWLVKHGKSYNAVDEKDKRFKIFRDNLKYIDE  293
            DMSII+YD++H A+GL RSE+EV+ M+++W+ +HG+ +NA+ E+++RF++F+DNL++ID 
Sbjct  25   DMSIISYDEEHGARGLERSEEEVRRMYDAWVAEHGRVHNALGEREQRFEVFKDNLRFIDA  84

Query  294  KNS-LENRSYKLGLNRFADITNEEYRTGYLGAKRDASRNMVKSKSDRYAPVAGDSLPDSI  470
             N+  E   + LGLNRFAD+TNEEYR  YLG +   +   +++ SDRY   AGD LP+S+
Sbjct  85   HNADAEAYGFSLGLNRFADLTNEEYRATYLGTRAGGTARRLRAPSDRYRHEAGDELPESV  144

Query  471  DWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            DWREKGAV  VKDQGSCGSCWAFSTIAAV
Sbjct  145  DWREKGAVAAVKDQGSCGSCWAFSTIAAV  173



>ref|XP_010244238.1| PREDICTED: cysteine proteinase RD21a-like [Nelumbo nucifera]
Length=475

 Score =   195 bits (496),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 91/148 (61%), Positives = 120/148 (81%), Gaps = 1/148 (1%)
 Frame = +3

Query  114  DMSIITYDQQHPAKGLVRSEDEVKEMFESWLVKHGKSYNAVDEKDKRFKIFRDNLKYIDE  293
            DMSII+Y+++H      R+ ++VK ++E+WLV+HGK+YNA+ EK+KRF+IF+DNLK+IDE
Sbjct  30   DMSIISYNKEHGLTSGGRTNEQVKALYETWLVRHGKAYNALGEKEKRFEIFKDNLKFIDE  89

Query  294  KNSLENRSYKLGLNRFADITNEEYRTGYLGAKRDASRNMVKSKSDRYAPVAGDSLPDSID  473
             NS +N +Y+LGLNRFAD+TN EYR  YLG K + ++   ++KS+RYA  A D LP S+D
Sbjct  90   HNS-QNHTYRLGLNRFADLTNAEYRALYLGKKPNPNKRDSRAKSNRYAFQADDDLPSSVD  148

Query  474  WREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            WREKGAV  VKDQGSCGSCWAFST+AAV
Sbjct  149  WREKGAVVPVKDQGSCGSCWAFSTVAAV  176



>ref|XP_004291075.1| PREDICTED: cysteine proteinase RD21a [Fragaria vesca subsp. vesca]
Length=469

 Score =   195 bits (496),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 104/174 (60%), Positives = 126/174 (72%), Gaps = 10/174 (6%)
 Frame = +3

Query  39   PTMARPSILFTFLFavvsaaaaaaEDMSIITYDQQHPAKGLVRSED-EVKEMFESWLVKH  215
            P MA   IL   +FAV SAA     DMSII YD  H +       D EV  ++E WL +H
Sbjct  9    PIMA---ILLLAMFAVSSAA-----DMSIIAYDNNHASSSDSGRSDDEVMSLYERWLAEH  60

Query  216  GKSYNAVDEKDKRFKIFRDNLKYIDEKNSLENRSYKLGLNRFADITNEEYRTGYLGAKRD  395
            GK+YN + EK+KRF+IF+DNLK+IDE N+L N SYKLGLNRFAD++N+EYR+ +LG K  
Sbjct  61   GKAYNGLGEKEKRFQIFKDNLKFIDEHNAL-NLSYKLGLNRFADLSNDEYRSTFLGTKPR  119

Query  396  ASRNMVKSKSDRYAPVAGDSLPDSIDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            A   + K+KSDRYAP  GD LPDS+DWR++GAVT VKDQG CGSCWAFSTI AV
Sbjct  120  AMNRLSKTKSDRYAPRVGDQLPDSVDWRKEGAVTAVKDQGQCGSCWAFSTICAV  173



>ref|XP_003603086.1| Cysteine proteinase [Medicago truncatula]
 gb|AES73337.1| papain family cysteine protease [Medicago truncatula]
Length=474

 Score =   195 bits (495),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 102/172 (59%), Positives = 124/172 (72%), Gaps = 6/172 (3%)
 Frame = +3

Query  57   SILFTFLFavvsaaaaaaEDMSIITYDQQHPAKGLVRSEDEVKEMFESWLVKHGKSYNAV  236
            S +   L       A  A DMSII+YD+ H  K   RS+ EVK ++E W VKHGK  N +
Sbjct  8    SPMLVILIVFTLFTATFALDMSIISYDKTHSDKSSRRSDKEVKNIYEEWRVKHGKLNNNI  67

Query  237  D--EKDKRFKIFRDNLKYIDEKNSLENRSYKLGLNRFADITNEEYRTGYLGAKRDASRNM  410
            D  EKDKRF+IF+DNLK+IDE N+ ENR+YK+GLNRFAD++NEEYR+ YLG K D    M
Sbjct  68   DGSEKDKRFEIFKDNLKFIDEHNA-ENRTYKVGLNRFADLSNEEYRSRYLGTKIDPIGMM  126

Query  411  V---KSKSDRYAPVAGDSLPDSIDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            +   K++S+RYAP  GD LP S+DWR +GAV  VKDQGSCGSCWAFSTIAAV
Sbjct  127  MARTKTRSNRYAPSVGDKLPKSVDWRSQGAVVQVKDQGSCGSCWAFSTIAAV  178



>ref|XP_010549252.1| PREDICTED: cysteine proteinase RD21a-like [Tarenaya hassleriana]
Length=458

 Score =   194 bits (493),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 95/172 (55%), Positives = 125/172 (73%), Gaps = 7/172 (4%)
 Frame = +3

Query  42   TMARPSILFTFLFavvsaaaaaaEDMSIITYDQQHPAKGLVRSEDEVKEMFESWLVKHGK  221
             + +P++   FL  +  ++A    DMSII+YD++H   G  RSE E +EM+E+WLVKHGK
Sbjct  2    VLGKPALAILFLATIAVSSAI---DMSIISYDEKHHVSGGGRSEAETEEMYEAWLVKHGK  58

Query  222  SYNAVDEKDKRFKIFRDNLKYIDEKNSLENRSYKLGLNRFADITNEEYRTGYLGAKRDAS  401
             YNA+ EKD+RF+IF+DNL++IDE N+  N +Y+LGL RFAD+TN+EYR+ YLGAK    
Sbjct  59   FYNALGEKDRRFEIFKDNLRFIDEHNA-RNLTYRLGLTRFADLTNDEYRSMYLGAK---P  114

Query  402  RNMVKSKSDRYAPVAGDSLPDSIDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
                   SDRY P  GD++PDS+DWR++GAV  VKDQG CGSCWAFS I AV
Sbjct  115  HKRTLRTSDRYLPRVGDAIPDSVDWRKEGAVPEVKDQGGCGSCWAFSAIGAV  166



>ref|XP_010691718.1| PREDICTED: cysteine proteinase RD21a-like [Beta vulgaris subsp. 
vulgaris]
Length=471

 Score =   194 bits (493),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 94/150 (63%), Positives = 118/150 (79%), Gaps = 2/150 (1%)
 Frame = +3

Query  114  DMSIITYDQQHPAKGLV--RSEDEVKEMFESWLVKHGKSYNAVDEKDKRFKIFRDNLKYI  287
            DMSII+YDQ H    +   RSEDEV  ++ESWLVKH K+YNA+ EK+KRF+IF+DNLK+I
Sbjct  30   DMSIISYDQDHHTNIVSSSRSEDEVMNLYESWLVKHRKNYNALGEKEKRFQIFKDNLKFI  89

Query  288  DEKNSLENRSYKLGLNRFADITNEEYRTGYLGAKRDASRNMVKSKSDRYAPVAGDSLPDS  467
            D+ NS + +S+KLGLN+FAD+TN+E+R+ Y G K+  S   +K KSDRY    GD LP S
Sbjct  90   DQHNSDDQQSFKLGLNKFADLTNDEFRSKYFGRKKKDSLLKMKVKSDRYLFREGDQLPKS  149

Query  468  IDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            +DWREKGAV+ +KDQG CGSCWAFSTIAAV
Sbjct  150  VDWREKGAVSHIKDQGQCGSCWAFSTIAAV  179



>ref|XP_007042494.1| Granulin repeat cysteine protease family protein [Theobroma cacao]
 gb|EOX98325.1| Granulin repeat cysteine protease family protein [Theobroma cacao]
Length=579

 Score =   195 bits (496),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 99/179 (55%), Positives = 131/179 (73%), Gaps = 8/179 (4%)
 Frame = +3

Query  36   LPTMARPS-ILFTFLFavvsaaaaaaEDMSIITYDQQHPAKGLVRSEDEVKEMFESWLVK  212
            +  + +PS I F  LF  ++ ++A   DMSII YD +H  +   R+E +++ M+E+WLVK
Sbjct  109  MALLKKPSRIFFVMLFFSLTLSSAL--DMSIIDYDLKHGGQQQKRTETQIRRMYETWLVK  166

Query  213  HGKSYNAVDEKDKRFKIFRDNLKYIDEKNSLENRSYKLGLNRFADITNEEYRTGYLGAKR  392
            HGK+YN + EK+KRF+IF+DNLK+I+E NS+ N +YK+GLNRFAD+TNEEY+  YLGA+ 
Sbjct  167  HGKAYNGLGEKEKRFEIFKDNLKFIEEHNSV-NGTYKVGLNRFADLTNEEYKAMYLGARL  225

Query  393  D----ASRNMVKSKSDRYAPVAGDSLPDSIDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            D    + R   K KS RY    GD LP+S+DWREKGAV  VKDQG CGSCWAFST+AAV
Sbjct  226  DGKTVSHRLAGKEKSQRYVFRVGDKLPESVDWREKGAVVAVKDQGQCGSCWAFSTVAAV  284



>gb|EYU25464.1| hypothetical protein MIMGU_mgv1a006201mg [Erythranthe guttata]
Length=453

 Score =   192 bits (488),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 92/150 (61%), Positives = 116/150 (77%), Gaps = 5/150 (3%)
 Frame = +3

Query  114  DMSIITYDQQHPAKGLVRSEDEVKEMFESWLVKHGKSYN--AVDEKDKRFKIFRDNLKYI  287
            DMSI+++     ++  +RS  E+  M ESW+VKHG+SY   AV EK++RF+IFRDNL YI
Sbjct  29   DMSILSHGG---SRSFLRSHSEMVSMHESWMVKHGRSYGNAAVGEKERRFEIFRDNLMYI  85

Query  288  DEKNSLENRSYKLGLNRFADITNEEYRTGYLGAKRDASRNMVKSKSDRYAPVAGDSLPDS  467
            DE+N+ + R++KLGLNRFAD+TN EYR  +LG + D  R + K +SDRYAP  GDSLPDS
Sbjct  86   DEQNAEDGRTHKLGLNRFADLTNAEYRKTFLGTRTDPKRRLSKVRSDRYAPKVGDSLPDS  145

Query  468  IDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            +DWR KGAV  VKDQGSCGSCWAFSTIA+V
Sbjct  146  VDWRAKGAVAPVKDQGSCGSCWAFSTIASV  175



>ref|XP_004230752.1| PREDICTED: cysteine proteinase RD21a-like [Solanum lycopersicum]
Length=470

 Score =   192 bits (489),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 91/151 (60%), Positives = 123/151 (81%), Gaps = 4/151 (3%)
 Frame = +3

Query  114  DMSIITYDQQHPAKGLV--RSEDEVKEMFESWLVKHGKSYNAVDEKDKRFKIFRDNLKYI  287
            DMSII+YD++H   G    R++DEVK ++ESW+VKHGK+YNA+ EK+KRF+IF+DNL++I
Sbjct  22   DMSIISYDEKHADLGATNHRTDDEVKGLYESWIVKHGKNYNAIGEKEKRFEIFKDNLRFI  81

Query  288  DEKNSLENRSYKLGLNRFADITNEEYRTGYLGAKRDASRNMVKS-KSDRYAPVAGDSLPD  464
            DE+N+ E R YKLGLNRF+D+TN+EYR  ++G + D    ++K+ KS+RYA  AG+ LP+
Sbjct  82   DEQNA-ETRPYKLGLNRFSDLTNDEYRALFVGGRFDKKTRLLKNPKSERYAFKAGEKLPE  140

Query  465  SIDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            S+DWR+KGAV  VKDQG CGSCWAFST+ AV
Sbjct  141  SVDWRQKGAVAPVKDQGQCGSCWAFSTVGAV  171



>gb|AAQ62999.1| oil palm polygalacturonase allergen PEST472 [Elaeis guineensis]
Length=525

 Score =   193 bits (491),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 90/151 (60%), Positives = 120/151 (79%), Gaps = 3/151 (2%)
 Frame = +3

Query  114  DMSIITYDQQHPAKGLVRSEDEVKEMFESWLVKHGKSYNAVDEKDKRFKIFRDNLKYIDE  293
            DMSII+YD+ H  +GL RSE+E++ ++E WL KHG++ NA+ EK++RF+IF+DN+++ID 
Sbjct  24   DMSIISYDEAHGVQGLERSEEEMRLLYEGWLAKHGRADNALGEKERRFEIFKDNVRFIDA  83

Query  294  KNSLE---NRSYKLGLNRFADITNEEYRTGYLGAKRDASRNMVKSKSDRYAPVAGDSLPD  464
             N+     +RS++LGLNRFAD+TNEEYRT YLG +  + R   +  SDRY   AG+ LP+
Sbjct  84   HNAAADSGHRSFRLGLNRFADMTNEEYRTVYLGTRPASHRRRARLGSDRYRYNAGEELPE  143

Query  465  SIDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            S+DWR+KGAVT VKDQGSCGSCWAFSTIAAV
Sbjct  144  SVDWRDKGAVTTVKDQGSCGSCWAFSTIAAV  174



>gb|KJB63901.1| hypothetical protein B456_010G022700 [Gossypium raimondii]
Length=467

 Score =   192 bits (487),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 99/175 (57%), Positives = 127/175 (73%), Gaps = 13/175 (7%)
 Frame = +3

Query  42   TMARPSILFTFLFavvsaaaaaaEDMSIITYDQQHPAKGLV--RSEDEVKEMFESWLVKH  215
            TMA   IL   +F + SA      DMS+++YD+ HP + +   R+ DE+  M+E WLVKH
Sbjct  7    TMA---ILLLMMFTLSSAF-----DMSVVSYDKSHPDRSMSSWRTFDEIMAMYEDWLVKH  58

Query  216  GKSYNAVDEKDKRFKIFRDNLKYIDEKNSLENRSYKLGLNRFADITNEEYRTGYLGAKRD  395
            GK YN + EK+KRF+IF+DNL++IDE NS E  S+KLGLN+FAD+TNEEYR  +LG K+ 
Sbjct  59   GKVYNGLGEKEKRFEIFKDNLRFIDEHNSEETHSFKLGLNQFADLTNEEYRFTFLGVKKP  118

Query  396  ASRNMVKSKSDRYAPVAGD-SLPDSIDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
              +  V  +SDRY  + G+ +LPDS+DWR KGAV  VKDQGSCGSCWAFSTIAAV
Sbjct  119  NKK--VSKRSDRYVQLLGEAALPDSVDWRTKGAVAPVKDQGSCGSCWAFSTIAAV  171



>ref|XP_006346518.1| PREDICTED: cysteine proteinase RD21a-like [Solanum tuberosum]
Length=470

 Score =   191 bits (486),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 90/151 (60%), Positives = 123/151 (81%), Gaps = 4/151 (3%)
 Frame = +3

Query  114  DMSIITYDQQHPAKGLV--RSEDEVKEMFESWLVKHGKSYNAVDEKDKRFKIFRDNLKYI  287
            DMSII+Y ++H   G+   R++DEVK ++ESW+VKHGK+YNA+ EK+KRF+IF+DNL++I
Sbjct  22   DMSIISYGEKHADLGVTSHRTDDEVKGLYESWIVKHGKNYNAIGEKEKRFEIFKDNLRFI  81

Query  288  DEKNSLENRSYKLGLNRFADITNEEYRTGYLGAKRDASRNMVKS-KSDRYAPVAGDSLPD  464
            DE+N+ E R YKLGLNRF+D+TN+EYR  ++G + D    ++K+ KS+RYA  AG+ LP+
Sbjct  82   DEQNA-ETRPYKLGLNRFSDLTNDEYRAVFVGGRFDKKTRLLKNPKSERYAFKAGEELPE  140

Query  465  SIDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            S+DWR+KGAV  VKDQG CGSCWAFST+ AV
Sbjct  141  SVDWRQKGAVAPVKDQGQCGSCWAFSTVGAV  171



>ref|XP_010906541.1| PREDICTED: oryzain alpha chain-like [Elaeis guineensis]
Length=470

 Score =   191 bits (486),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 88/151 (58%), Positives = 116/151 (77%), Gaps = 3/151 (2%)
 Frame = +3

Query  114  DMSIITYDQQHPAKGLVRSEDEVKEMFESWLVKHGKSYNAVDEKDKRFKIFRDNLKYIDE  293
            DMSII+YD+ H  +GL RSE+E++ ++E WL KHG++YNA+ EK++RF+IF+DN+ +ID 
Sbjct  24   DMSIISYDEAHGVRGLERSEEEMRILYEGWLAKHGRAYNALGEKERRFEIFKDNVLFIDA  83

Query  294  KNSLE---NRSYKLGLNRFADITNEEYRTGYLGAKRDASRNMVKSKSDRYAPVAGDSLPD  464
             N+     +RS++LGLNRFAD+TNEEYR  YLG +    R   +  SDRY   AG+ LP+
Sbjct  84   HNAAADAGHRSFRLGLNRFADMTNEEYRAVYLGTRPAGHRRRARVGSDRYRYNAGEDLPE  143

Query  465  SIDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            S+DWR KGAV  VKDQGSCGSCWAFST+AAV
Sbjct  144  SVDWRAKGAVAAVKDQGSCGSCWAFSTVAAV  174



>gb|ABR19827.1| cysteine proteinase [Elaeis guineensis]
Length=470

 Score =   191 bits (485),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 88/151 (58%), Positives = 116/151 (77%), Gaps = 3/151 (2%)
 Frame = +3

Query  114  DMSIITYDQQHPAKGLVRSEDEVKEMFESWLVKHGKSYNAVDEKDKRFKIFRDNLKYIDE  293
            DMSII+YD+ H  +GL RSE+E++ ++E WL KHG++YNA+ EK++RF+IF+DN+ +ID 
Sbjct  24   DMSIISYDEAHGVRGLERSEEEMRILYEGWLAKHGRAYNALGEKERRFEIFKDNVLFIDA  83

Query  294  KNSLE---NRSYKLGLNRFADITNEEYRTGYLGAKRDASRNMVKSKSDRYAPVAGDSLPD  464
             N+     +RS++LGLNRFAD+TNEEYR  YLG +    R   +  SDRY   AG+ LP+
Sbjct  84   HNAAADAGHRSFRLGLNRFADMTNEEYRAVYLGTRPAGHRRRARVGSDRYRYNAGEDLPE  143

Query  465  SIDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            S+DWR KGAV  VKDQGSCGSCWAFST+AAV
Sbjct  144  SVDWRAKGAVAAVKDQGSCGSCWAFSTVAAV  174



>ref|XP_010928366.1| PREDICTED: oryzain alpha chain-like [Elaeis guineensis]
Length=465

 Score =   191 bits (485),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 89/151 (59%), Positives = 119/151 (79%), Gaps = 3/151 (2%)
 Frame = +3

Query  114  DMSIITYDQQHPAKGLVRSEDEVKEMFESWLVKHGKSYNAVDEKDKRFKIFRDNLKYIDE  293
            DMSII+YD+ H  +GL RSE+E++ ++E WL KHG++ NA+ EK++RF+IF+DN+++ID 
Sbjct  24   DMSIISYDEAHGVQGLERSEEEMRLLYEGWLAKHGRADNALGEKERRFEIFKDNVRFIDA  83

Query  294  KNSLE---NRSYKLGLNRFADITNEEYRTGYLGAKRDASRNMVKSKSDRYAPVAGDSLPD  464
             N+     +RS++LGLNRFAD+TNEEYR  YLG +  + R   +  SDRY   AG+ LP+
Sbjct  84   HNAAADSGHRSFRLGLNRFADMTNEEYRAVYLGTRPASHRRRARLGSDRYRYNAGEELPE  143

Query  465  SIDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            S+DWR+KGAVT VKDQGSCGSCWAFSTIAAV
Sbjct  144  SVDWRDKGAVTTVKDQGSCGSCWAFSTIAAV  174



>dbj|BAC75923.1| cysteine protease-1 [Helianthus annuus]
Length=461

 Score =   191 bits (485),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 94/153 (61%), Positives = 118/153 (77%), Gaps = 6/153 (4%)
 Frame = +3

Query  114  DMSIITYDQQH----PAKGLVRSEDEVKEMFESWLVKHGKSYNAVDEKDKRFKIFRDNLK  281
            DMSII YD  H     +   +R++DEV  ++ESWLVKHGK+YNA+ EKD+RF+IF+DNL+
Sbjct  22   DMSIINYDATHMSSSSSSAPLRTDDEVNALYESWLVKHGKTYNALGEKDRRFQIFKDNLR  81

Query  282  YIDEKNSLENRSYKLGLNRFADITNEEYRTGYLGAKR-DASRNMVKSKSDRYAPVAGDSL  458
            +IDE NS  + +YKLGLN+FAD+TNEEYR  Y G K  D  + + K KSDRYA  +GDSL
Sbjct  82   FIDEHNS-GDHTYKLGLNKFADLTNEEYRMTYTGIKTIDDKKKLSKMKSDRYAYRSGDSL  140

Query  459  PDSIDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            P+ +DWRE+GAVT VKDQGSCGSCWAFST  +V
Sbjct  141  PEYVDWREQGAVTDVKDQGSCGSCWAFSTTGSV  173



>emb|CAE54307.1| cysteine proteinase [Gossypium hirsutum]
Length=372

 Score =   189 bits (479),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 87/150 (58%), Positives = 119/150 (79%), Gaps = 3/150 (2%)
 Frame = +3

Query  117  MSIITYDQQHPAKGLV-RSEDEVKEMFESWLVKHGKSYNAVDEKDKRFKIFRDNLKYIDE  293
            +S +T +Q HP+     RS+DEV  +++SW+++HGK+YN + E++KRF+IF+DNL++IDE
Sbjct  20   ISTLTLNQNHPSSSSSWRSDDEVMGLYKSWVIQHGKAYNGIGEEEKRFEIFKDNLRFIDE  79

Query  294  KNSLENRSYKLGLNRFADITNEEYRTGYLGAKRDASRNMVKSK--SDRYAPVAGDSLPDS  467
             NS  N +YKLGLN+FAD+TN+EYR  +LG + D  R ++KSK  S RYA  AGD+LPDS
Sbjct  80   HNSNNNTTYKLGLNKFADLTNQEYRAKFLGTRTDPRRRLMKSKIPSSRYAHRAGDNLPDS  139

Query  468  IDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            ++WR+ GAV+ VKDQGSCGSCWAFS IAAV
Sbjct  140  VNWRDHGAVSRVKDQGSCGSCWAFSAIAAV  169



>ref|XP_010107858.1| Cysteine proteinase RD21a [Morus notabilis]
 gb|EXC17258.1| Cysteine proteinase RD21a [Morus notabilis]
Length=476

 Score =   191 bits (485),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 101/182 (55%), Positives = 132/182 (73%), Gaps = 12/182 (7%)
 Frame = +3

Query  36   LPTMARPSIL---FTFLFavvsaaaaaaEDMSIITYDQQHPAKGLV----RSEDEVKEMF  194
            +  + RPS++   F  L + +   + A+ DMSII YD +H   G+V    RSE E++ M+
Sbjct  1    MAILRRPSVISFSFLVLVSFLVGFSWASPDMSIIDYDAKH---GIVVPTERSETEMRAMY  57

Query  195  ESWLVKHGKSYNAVDEKDKRFKIFRDNLKYIDEKNSLENRSYKLGLNRFADITNEEYRTG  374
            ESWLV H K+YNA+ EK++RF+IF+DNL+++D  N+  NR++KLGLNRFAD+TN+EYR G
Sbjct  58   ESWLVIHAKAYNALREKERRFEIFKDNLRFVDAHNA-ANRTFKLGLNRFADLTNDEYRAG  116

Query  375  YLGAKRDASRNMVKS-KSDRYAPVAGDSLPDSIDWREKGAVTGVKDQGSCGSCWAFSTIA  551
            +LG K D    +  S KSDRYA  AGD LP+SIDWR+KGAV  VKDQG CGSCWAFSTI 
Sbjct  117  FLGVKIDRIGTLFGSRKSDRYAFRAGDELPESIDWRDKGAVAPVKDQGQCGSCWAFSTIG  176

Query  552  AV  557
            AV
Sbjct  177  AV  178



>ref|XP_009784112.1| PREDICTED: cysteine proteinase COT44-like [Nicotiana sylvestris]
Length=374

 Score =   188 bits (478),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 99/175 (57%), Positives = 130/175 (74%), Gaps = 6/175 (3%)
 Frame = +3

Query  45   MARPSILFTFLFavvsaaaaaaEDMSIITYDQQHPAK--GLVRSEDEVKEMFESWLVKHG  218
            MA+ +I+ T LFA+ S+ + A  DMSII Y   H A    L   ED+VK  +E WL +HG
Sbjct  1    MAK-TIITTLLFALFSSLSYAI-DMSIIDYKNNHYASKWTLQSDEDQVKNRYEMWLAEHG  58

Query  219  KSYNAVDEKDKRFKIFRDNLKYIDEKNSLENRSYKLGLNRFADITNEEYRTGYLGAKRDA  398
            ++YNA+ EK+KRF+IF+DNL++I+E N+  NR+YK+GLN+FAD+TNEEYRT YLG K DA
Sbjct  59   RAYNALGEKEKRFEIFKDNLRFIEEHNNSGNRTYKVGLNQFADLTNEEYRTMYLGTKSDA  118

Query  399  SRNMVKSK--SDRYAPVAGDSLPDSIDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
             R  VKSK  S RYA    + +P S+DWR++GAV  +K+QGSCGSCWAFST+AAV
Sbjct  119  RRRFVKSKNPSQRYASRPNELMPHSVDWRKRGAVAPIKNQGSCGSCWAFSTVAAV  173



>ref|XP_008365104.1| PREDICTED: low-temperature-induced cysteine proteinase-like [Malus 
domestica]
Length=472

 Score =   191 bits (484),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 99/179 (55%), Positives = 127/179 (71%), Gaps = 10/179 (6%)
 Frame = +3

Query  39   PTMARPSILFTFLFavvsaaaaaaEDMSIITYDQQ---HPAKGLVRSEDEVKEMFESWLV  209
            P  + P++    L     ++A    DMSII+ D       + G  R++DEV   +E WL 
Sbjct  3    PYRSSPAVALLLLXIFTVSSAL---DMSIISXDNXLGDGKSTGSWRTDDEVMSXYEGWLA  59

Query  210  KHGKSYNAVDEKDKRFKIFRDNLKYIDEKNSLENRSYKLGLNRFADITNEEYRTGYLGAK  389
            +HGK+YNA+ EK++RF+IF+DNL+YIDE+NS +N SYKLGLNRFAD++N EYR  YLG K
Sbjct  60   EHGKAYNALGEKERRFQIFKDNLRYIDEQNS-KNLSYKLGLNRFADLSNXEYRNTYLGTK  118

Query  390  RDASRNMV---KSKSDRYAPVAGDSLPDSIDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
              A +  +    +KSDRYAP  GDSLPDSIDWRE+GAV  +KDQGSCGSCWAFSTI+AV
Sbjct  119  TRAQKKRLSNRNTKSDRYAPRVGDSLPDSIDWREEGAVNPIKDQGSCGSCWAFSTISAV  177



>gb|KJB43804.1| hypothetical protein B456_007G216900 [Gossypium raimondii]
Length=277

 Score =   185 bits (470),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 95/176 (54%), Positives = 122/176 (69%), Gaps = 17/176 (10%)
 Frame = +3

Query  36   LPTMARPSILFTFLFavvsaaaaaaEDMSIITYDQQHPAKGLVRSEDEVKEMFESWLVKH  215
            + T   P     FLF  +S         S  ++ Q H      RS+DEV  ++++WLVKH
Sbjct  1    MTTTVTPISTLFFLFFTLS---------SATSFSQNH-----WRSDDEVMSLYQAWLVKH  46

Query  216  GKSYNAVDEKDKRFKIFRDNLKYIDEKNSLENRSYKLGLNRFADITNEEYRTGYLGAKRD  395
            GK YN + E++ RF IF+DNLK+ID+ NS +N +YKLGLN+FAD+TN+EYR+ +LG K D
Sbjct  47   GKQYNGIGEEENRFDIFKDNLKFIDQHNS-KNTTYKLGLNKFADLTNQEYRSMFLGTKSD  105

Query  396  ASRNMVKSK--SDRYAPVAGDSLPDSIDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
              R ++KSK  S RYA  AGDSLP+S+DWR+ GAVT VKDQG CGSCWAFSTIAAV
Sbjct  106  PKRRVMKSKNPSQRYASRAGDSLPESVDWRDHGAVTPVKDQGRCGSCWAFSTIAAV  161



>ref|XP_008813817.1| PREDICTED: low-temperature-induced cysteine proteinase-like [Phoenix 
dactylifera]
Length=469

 Score =   190 bits (483),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 87/149 (58%), Positives = 116/149 (78%), Gaps = 1/149 (1%)
 Frame = +3

Query  114  DMSIITYDQQHPAKGLVRSEDEVKEMFESWLVKHGKSYNAVDEKDKRFKIFRDNLKYIDE  293
            DMSII+YD+ H  +GL RSE++++ ++E WL KHG++YNA+ EK++RF+IF+DN+++ID 
Sbjct  25   DMSIISYDETHGVRGLERSEEDMRLLYEGWLAKHGRAYNALGEKERRFEIFKDNVRFIDA  84

Query  294  KNS-LENRSYKLGLNRFADITNEEYRTGYLGAKRDASRNMVKSKSDRYAPVAGDSLPDSI  470
             N+   + S++LGLNRFAD+TNEEYR  YLG +    R   +  SDRY   AGD LP+S+
Sbjct  85   HNADAGHHSFRLGLNRFADMTNEEYRAVYLGTRPAGHRRRARVGSDRYRYDAGDVLPESV  144

Query  471  DWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            DWR KGAV  VKDQGSCGSCWAFST+AAV
Sbjct  145  DWRVKGAVAAVKDQGSCGSCWAFSTVAAV  173



>gb|ABQ10202.1| cysteine protease Cp4 [Actinidia deliciosa]
Length=463

 Score =   190 bits (482),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 87/148 (59%), Positives = 114/148 (77%), Gaps = 4/148 (3%)
 Frame = +3

Query  114  DMSIITYDQQHPAKGLVRSEDEVKEMFESWLVKHGKSYNAVDEKDKRFKIFRDNLKYIDE  293
            DMSII+YDQ HP +   R++ E   ++E WL  HGK+YNA+ EK++RF+IF+DNL+++DE
Sbjct  24   DMSIISYDQTHPPQ---RTDAEAMAIYEKWLTTHGKAYNAIGEKERRFEIFKDNLRFVDE  80

Query  294  KNSLENRSYKLGLNRFADITNEEYRTGYLGAKRDASRNMVKSKSDRYAPVAGDSLPDSID  473
             N++   SY++GLNRFAD+TNEEYR+ +LG   +       +KSDRYA  AGD LP S+D
Sbjct  81   HNAVAG-SYRVGLNRFADLTNEEYRSMFLGGNMEMKERSASTKSDRYAFRAGDKLPGSVD  139

Query  474  WREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            WREKGAV+ VKDQG CGSCWAFSTI+AV
Sbjct  140  WREKGAVSPVKDQGQCGSCWAFSTISAV  167



>emb|CDO97206.1| unnamed protein product [Coffea canephora]
Length=462

 Score =   190 bits (482),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 92/149 (62%), Positives = 120/149 (81%), Gaps = 6/149 (4%)
 Frame = +3

Query  114  DMSIITYDQQHPAKGLVRSEDEVKEMFESWLVKHGKSYNAVDEKDKRFKIFRDNLKYIDE  293
            DMSII YD++H +      +DEVK ++ESWLVKHGK+YNA+ EK+KRF+IF+DNL++I E
Sbjct  22   DMSIIDYDKKHKSS----DDDEVKALYESWLVKHGKNYNALGEKEKRFEIFKDNLRFIKE  77

Query  294  KNSLENRSYKLGLNRFADITNEEYRTGYLGAKRD-ASRNMVKSKSDRYAPVAGDSLPDSI  470
             N+ ++R YKLGLNRFAD+TN+EYR+ ++G + D ++R M +  +DRYA  AGDSLP+S+
Sbjct  78   HNA-QDRPYKLGLNRFADLTNDEYRSMFVGGRMDRSTRLMNRRSNDRYALRAGDSLPESV  136

Query  471  DWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            DWR KGAV  VKDQG CGSCWAFSTI AV
Sbjct  137  DWRAKGAVAPVKDQGQCGSCWAFSTIGAV  165



>gb|KJB58559.1| hypothetical protein B456_009G214900 [Gossypium raimondii]
Length=437

 Score =   189 bits (480),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 94/150 (63%), Positives = 119/150 (79%), Gaps = 4/150 (3%)
 Frame = +3

Query  114  DMSIITYDQQHP--AKGLVRSEDEVKEMFESWLVKHGKSYNAVDEKDKRFKIFRDNLKYI  287
            DMSII+YD+ HP  +K   R++DEV  M+E WLVKHGK+YN + EK++RFKIF+DNL++I
Sbjct  23   DMSIISYDEGHPDKSKSSWRTDDEVMVMYEEWLVKHGKAYNGLGEKERRFKIFKDNLRFI  82

Query  288  DEKNSLENRSYKLGLNRFADITNEEYRTGYLGAKRDASRNMVKSKSDRYAPVAGDSLPDS  467
            DE N  E+ S+K+GLNRFAD+TN+EYR  YLG K+ +++     KS+RYAP  G+ LP S
Sbjct  83   DEHNVDESHSFKVGLNRFADLTNDEYRAMYLGTKKSSNKV--SKKSNRYAPRVGEELPAS  140

Query  468  IDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            IDWREKGAV  VKDQGSCGSCWAFST+ AV
Sbjct  141  IDWREKGAVVPVKDQGSCGSCWAFSTVGAV  170



>gb|AAK07730.1| CPR1-like cysteine proteinase [Nicotiana tabacum]
Length=374

 Score =   187 bits (476),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 90/152 (59%), Positives = 116/152 (76%), Gaps = 4/152 (3%)
 Frame = +3

Query  114  DMSIITYDQQHPAK--GLVRSEDEVKEMFESWLVKHGKSYNAVDEKDKRFKIFRDNLKYI  287
            DMSII Y   H A+   L   ED+VK  +E WL +HG++YNA+ EK+KRF+IF+DNL++I
Sbjct  22   DMSIIDYKNNHYARKWTLQSDEDQVKNRYEMWLAEHGRAYNALGEKEKRFEIFKDNLRFI  81

Query  288  DEKNSLENRSYKLGLNRFADITNEEYRTGYLGAKRDASRNMVKSK--SDRYAPVAGDSLP  461
            +E N+  NR+YK+GLN+FAD+TNEEYRT YLG K DA R  VKSK  S RYA    + +P
Sbjct  82   EEHNNSGNRTYKVGLNQFADLTNEEYRTMYLGTKSDARRRFVKSKNPSQRYASRPNELMP  141

Query  462  DSIDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
             S+DWR++GAV  +K+QGSCGSCWAFST+AAV
Sbjct  142  HSVDWRKRGAVAPIKNQGSCGSCWAFSTVAAV  173



>ref|XP_008342944.1| PREDICTED: cysteine proteinase RD21a-like [Malus domestica]
Length=473

 Score =   189 bits (481),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 94/151 (62%), Positives = 121/151 (80%), Gaps = 5/151 (3%)
 Frame = +3

Query  114  DMSIITYDQQH--PAKGLVRSEDEVKEMFESWLVKHGKSYNAVDEKDKRFKIFRDNLKYI  287
            DMSI+ Y+++H  PA    R+E EVK ++ESWLVKH K+YNA+ EK++RF+IF+DNL++I
Sbjct  31   DMSIVDYNEKHGMPASS-DRTETEVKALYESWLVKHAKNYNALGEKERRFEIFKDNLRFI  89

Query  288  DEKNSLENRSYKLGLNRFADITNEEYRTGYLGAKRDASRNMVKS-KSDRYAPVAGDSLPD  464
            DE N+ ++R+YK+GLNRFAD+TNEEYR+ YLGAK D    +  S KSDRYA  AGD LP+
Sbjct  90   DEHNN-QSRTYKVGLNRFADLTNEEYRSVYLGAKVDRRSRLXGSRKSDRYAFRAGDKLPE  148

Query  465  SIDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            S+DWR +GAV  VKDQG CGSCWAFST+ AV
Sbjct  149  SVDWRAEGAVPAVKDQGQCGSCWAFSTVGAV  179



>gb|KJB58557.1| hypothetical protein B456_009G214900 [Gossypium raimondii]
Length=467

 Score =   189 bits (480),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 94/150 (63%), Positives = 119/150 (79%), Gaps = 4/150 (3%)
 Frame = +3

Query  114  DMSIITYDQQHP--AKGLVRSEDEVKEMFESWLVKHGKSYNAVDEKDKRFKIFRDNLKYI  287
            DMSII+YD+ HP  +K   R++DEV  M+E WLVKHGK+YN + EK++RFKIF+DNL++I
Sbjct  23   DMSIISYDEGHPDKSKSSWRTDDEVMVMYEEWLVKHGKAYNGLGEKERRFKIFKDNLRFI  82

Query  288  DEKNSLENRSYKLGLNRFADITNEEYRTGYLGAKRDASRNMVKSKSDRYAPVAGDSLPDS  467
            DE N  E+ S+K+GLNRFAD+TN+EYR  YLG K+ +++     KS+RYAP  G+ LP S
Sbjct  83   DEHNVDESHSFKVGLNRFADLTNDEYRAMYLGTKKSSNKV--SKKSNRYAPRVGEELPAS  140

Query  468  IDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            IDWREKGAV  VKDQGSCGSCWAFST+ AV
Sbjct  141  IDWREKGAVVPVKDQGSCGSCWAFSTVGAV  170



>ref|XP_008799871.1| PREDICTED: oryzain alpha chain-like isoform X1 [Phoenix dactylifera]
 ref|XP_008799878.1| PREDICTED: oryzain alpha chain-like isoform X2 [Phoenix dactylifera]
Length=473

 Score =   189 bits (480),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 86/151 (57%), Positives = 115/151 (76%), Gaps = 3/151 (2%)
 Frame = +3

Query  114  DMSIITYDQQHPAKGLVRSEDEVKEMFESWLVKHGKSYNAVDEKDKRFKIFRDNLKYIDE  293
            DMSII+YD+ H  +GL RSE+E++ ++E WL KHG++YNA+ EK++RF+IF+DN+++ID 
Sbjct  27   DMSIISYDEAHGVRGLERSEEEMRLLYEGWLAKHGRAYNALGEKERRFEIFKDNVRFIDA  86

Query  294  KNS---LENRSYKLGLNRFADITNEEYRTGYLGAKRDASRNMVKSKSDRYAPVAGDSLPD  464
             N+     + S++LGLNRFAD+TNEEYR  YLG +    R   +  SDRY   AG+ LP+
Sbjct  87   HNAEADAGHHSFRLGLNRFADMTNEEYRAVYLGTRPAGHRRRARFGSDRYRYNAGEELPE  146

Query  465  SIDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            S+DWR KGA   VKDQGSCGSCWAFST+AAV
Sbjct  147  SVDWRAKGAAAAVKDQGSCGSCWAFSTVAAV  177



>emb|CAB16317.1| cysteine proteinase precursor [Nicotiana tabacum]
Length=374

 Score =   187 bits (474),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 98/175 (56%), Positives = 130/175 (74%), Gaps = 6/175 (3%)
 Frame = +3

Query  45   MARPSILFTFLFavvsaaaaaaEDMSIITYDQQHPAK--GLVRSEDEVKEMFESWLVKHG  218
            MA+ +I+ T LFA+ S+ + A  DMSII Y   H A+   L   ED+VK  +E WL +HG
Sbjct  1    MAK-TIITTLLFALFSSLSYAI-DMSIIDYKNNHYARKWTLQSDEDQVKNRYEMWLAEHG  58

Query  219  KSYNAVDEKDKRFKIFRDNLKYIDEKNSLENRSYKLGLNRFADITNEEYRTGYLGAKRDA  398
            ++YNA+ EK+KRF+IF+DNL++I+  N+  NR+YK+GLN+FAD+TNEEYRT YLG K DA
Sbjct  59   RAYNALGEKEKRFEIFKDNLRFIEGHNNSGNRTYKVGLNQFADLTNEEYRTMYLGTKSDA  118

Query  399  SRNMVKSK--SDRYAPVAGDSLPDSIDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
             R  VKSK  S RYA    + +P S+DWR++GAV  +K+QGSCGSCWAFST+AAV
Sbjct  119  RRRFVKSKNPSQRYASRPNELMPHSVDWRKRGAVAPIKNQGSCGSCWAFSTVAAV  173



>ref|XP_010070600.1| PREDICTED: cysteine proteinase COT44-like [Eucalyptus grandis]
 gb|KCW59473.1| hypothetical protein EUGRSUZ_H02220 [Eucalyptus grandis]
Length=386

 Score =   187 bits (474),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 91/170 (54%), Positives = 127/170 (75%), Gaps = 3/170 (2%)
 Frame = +3

Query  54   PSILFTFLFavvsaaaaaaEDMSIITYDQQHPAKGLVRSEDEVKEMFESWLVKHGKSYNA  233
            P++L   LF ++S+AA + +  SII Y  +       R++ EV EM+E WL +HGK+YN 
Sbjct  7    PTVLAALLFLILSSAALS-DPASIIDYAAKGRTASAPRTDGEVVEMYELWLARHGKAYNG  65

Query  234  VDEKDKRFKIFRDNLKYIDEKNSLENRSYKLGLNRFADITNEEYRTGYLGAKRDASRNMV  413
            + E++ RF++F+DNL++IDE NS +NR+Y LGLN+FAD+TN+EYR  YLG + +A R ++
Sbjct  66   LGEREMRFQVFKDNLRFIDEHNSSQNRTYTLGLNKFADLTNDEYRAMYLGTRSEAKRRVM  125

Query  414  KSK--SDRYAPVAGDSLPDSIDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            KS+  S RYA  AGD LP+++DWR KGAV  VKDQG+CGSCWAFST+AAV
Sbjct  126  KSRNASRRYAVRAGDRLPEAVDWRLKGAVNPVKDQGTCGSCWAFSTVAAV  175



>ref|XP_008361440.1| PREDICTED: cysteine proteinase RD21a-like [Malus domestica]
Length=289

 Score =   184 bits (467),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 93/156 (60%), Positives = 117/156 (75%), Gaps = 9/156 (6%)
 Frame = +3

Query  114  DMSIITYDQQH-----PAKGLVRSEDEVKEMFESWLVKHGKSYNAVDEKDKRFKIFRDNL  278
            DMSII+YD  +      + G  R+++ V  ++E WL +HGK+YNA+ EK++ F+IF+DNL
Sbjct  25   DMSIISYDSNNHLGDNKSLGSWRTDNVVMSIYEGWLAEHGKAYNALGEKERSFQIFKDNL  84

Query  279  KYIDEKNSLENRSYKLGLNRFADITNEEYRTGYLGAKRDASRNMVKS---KSDRYAPVAG  449
            +YIDEKNS +N SYKLGLNRF D+ NEEYR  YLGAK  A    V +   KSDRYAP  G
Sbjct  85   RYIDEKNS-KNLSYKLGLNRFVDLLNEEYRNTYLGAKTRAQMKRVSNRNIKSDRYAPHVG  143

Query  450  DSLPDSIDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            DSL DS+DWR++GAV+ VKDQGSCGSCW FSTI+AV
Sbjct  144  DSLLDSVDWRKEGAVSPVKDQGSCGSCWTFSTISAV  179



>ref|XP_010556436.1| PREDICTED: cysteine proteinase RD21a-like [Tarenaya hassleriana]
Length=459

 Score =   188 bits (478),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 92/171 (54%), Positives = 124/171 (73%), Gaps = 6/171 (4%)
 Frame = +3

Query  45   MARPSILFTFLFavvsaaaaaaEDMSIITYDQQHPAKGLVRSEDEVKEMFESWLVKHGKS  224
            + R ++ + F+        ++A DM+I +Y Q H AK   R+++E   M+E+WLVKHGK 
Sbjct  3    LGRSNLAYLFM---AVLVTSSASDMTITSYGQSHVAKTDWRTDEEAMAMYEAWLVKHGKI  59

Query  225  YNAVDEKDKRFKIFRDNLKYIDEKNSLENRSYKLGLNRFADITNEEYRTGYLGAKRDASR  404
            YN + EK+KR +IF+DNL++IDE NS+ NR+Y+LGLNRFAD+TNEEYR+ YLG  +   +
Sbjct  60   YNELGEKEKRLEIFKDNLRFIDEHNSV-NRTYRLGLNRFADLTNEEYRSMYLGLGKPKRK  118

Query  405  NMVKSKSDRYAPVAGDSLPDSIDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
             +    ++RY P  GD LP+S+DWREKGAV  VKDQGSCGSCWAFS IAAV
Sbjct  119  PL--KTTNRYMPRVGDDLPESVDWREKGAVAEVKDQGSCGSCWAFSAIAAV  167



>gb|KHG00992.1| Cysteinease RD21a -like protein [Gossypium arboreum]
Length=375

 Score =   186 bits (473),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 86/152 (57%), Positives = 118/152 (78%), Gaps = 5/152 (3%)
 Frame = +3

Query  117  MSIITYDQQHPAKGLV---RSEDEVKEMFESWLVKHGKSYNAVDEKDKRFKIFRDNLKYI  287
            +S +T +Q HP+       RS+DEV  +++SW+++HGK+YN + E++KRF+IF+DNL ++
Sbjct  21   ISTLTLNQNHPSSSSSSSWRSDDEVMGLYKSWVIQHGKAYNGIGEEEKRFEIFKDNLMFV  80

Query  288  DEKNSLENRSYKLGLNRFADITNEEYRTGYLGAKRDASRNMVKSK--SDRYAPVAGDSLP  461
            DE NS  N +YKLGLN+FAD+TN+EYR  +LG + D  R ++KSK  S RYA  AGD+LP
Sbjct  81   DEHNSNNNTTYKLGLNKFADLTNQEYRAKFLGTRTDPRRRLMKSKIPSSRYAHRAGDNLP  140

Query  462  DSIDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            DS++WR+ GAV+ VKDQGSCGSCWAFS IAAV
Sbjct  141  DSVNWRDHGAVSRVKDQGSCGSCWAFSAIAAV  172



>ref|NP_001242660.1| uncharacterized protein LOC100807362 precursor [Glycine max]
 gb|ACU18666.1| unknown [Glycine max]
Length=367

 Score =   186 bits (471),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 91/166 (55%), Positives = 122/166 (73%), Gaps = 8/166 (5%)
 Frame = +3

Query  60   ILFTFLFavvsaaaaaaEDMSIITYDQQHPAKGLVRSEDEVKEMFESWLVKHGKSYNAVD  239
            +LFT L    +       DMSII+YD+ H  K   +S++EV  ++E WLVKHGK YNAV+
Sbjct  14   VLFTVLAVSSAL------DMSIISYDRSHADKSGWKSDEEVMSIYEEWLVKHGKVYNAVE  67

Query  240  EKDKRFKIFRDNLKYIDEKNSLENRSYKLGLNRFADITNEEYRTGYLGAKRDASRNMVKS  419
            EK+KRF+IF+DNL +I+E N++ NR+YK+GLNRF+D++NEEYR+ YLG K D SR M + 
Sbjct  68   EKEKRFQIFKDNLNFIEEHNAV-NRTYKVGLNRFSDLSNEEYRSKYLGTKIDPSRMMAR-  125

Query  420  KSDRYAPVAGDSLPDSIDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
             S RY+P   D+LP+S+DWR++GAV  VK+Q  C  CWAFS IAAV
Sbjct  126  PSRRYSPRVADNLPESVDWRKEGAVVRVKNQSECEGCWAFSAIAAV  171



>gb|ABQ10200.1| cysteine protease Cp2 [Actinidia deliciosa]
Length=376

 Score =   186 bits (471),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 89/149 (60%), Positives = 114/149 (77%), Gaps = 3/149 (2%)
 Frame = +3

Query  117  MSIITYDQQHPAKGLVRSEDEVKEMFESWLVKHGKSYNAVDEKDKRFKIFRDNLKYIDEK  296
            MSII Y+     K   R+++EV  ++  WL KHGK+YN + E+++RF+IF+DNLK++DE 
Sbjct  22   MSIIDYNTNPNHKSSSRTDEEVMGIYAEWLAKHGKAYNGIGERERRFEIFKDNLKFVDEH  81

Query  297  NSLENRSYKLGLNRFADITNEEYRTGYLGAKRDASRNMVKSKSD--RYAPVAGDSLPDSI  470
            NS ENRSYK+GLNRFAD+TNEEYR+ +LG K D+ R  +KSKS   RYA    D LP+S+
Sbjct  82   NS-ENRSYKVGLNRFADLTNEEYRSMFLGTKTDSKRRFMKSKSASRRYAVQDSDMLPESV  140

Query  471  DWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            DWRE GAV  +KDQGSCGSCWAFST+AAV
Sbjct  141  DWRESGAVAPIKDQGSCGSCWAFSTVAAV  169



>gb|KHG12125.1| Cysteinease RD21a -like protein [Gossypium arboreum]
Length=615

 Score =   190 bits (483),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 94/150 (63%), Positives = 120/150 (80%), Gaps = 4/150 (3%)
 Frame = +3

Query  114  DMSIITYDQQHP--AKGLVRSEDEVKEMFESWLVKHGKSYNAVDEKDKRFKIFRDNLKYI  287
            DMSII+YD+ HP  +K   R++DEV  M+E WLVKHGK+YN + EK++RFKIF+DNL++I
Sbjct  23   DMSIISYDEGHPDKSKSSWRTDDEVMVMYEEWLVKHGKAYNGLGEKERRFKIFKDNLRFI  82

Query  288  DEKNSLENRSYKLGLNRFADITNEEYRTGYLGAKRDASRNMVKSKSDRYAPVAGDSLPDS  467
            DE N+ E+ S+K+GLNRFAD+TN+EYR  YLG K+ +++     KS+RYAP  G+ LP S
Sbjct  83   DEHNANESHSFKVGLNRFADLTNDEYRAMYLGTKKSSNKV--SKKSNRYAPRVGEELPAS  140

Query  468  IDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            IDWREKGAV  VKDQGSCGSCWAFST+ AV
Sbjct  141  IDWREKGAVVPVKDQGSCGSCWAFSTVGAV  170



>gb|KDP31986.1| hypothetical protein JCGZ_12447 [Jatropha curcas]
Length=366

 Score =   185 bits (469),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 88/149 (59%), Positives = 113/149 (76%), Gaps = 2/149 (1%)
 Frame = +3

Query  114  DMSIITYDQQHPAKGLVRSEDEVKEMFESWLVKHGKSYNAVDEKDKRFKIFRDNLKYIDE  293
            DMSII+YD  H  +   RS+DEV +M+  WL KH K+YN + E+++RF+IF++NL++IDE
Sbjct  22   DMSIISYDDHHNHQSGWRSDDEVMDMYNWWLAKHQKAYNKLGERERRFEIFKNNLRFIDE  81

Query  294  KNSLENRSYKLGLNRFADITNEEYRTGYLGAKRDASRN-MVKSKSDRYAPVAGDSLPDSI  470
             NS EN SYKLGL +FAD+TNEEYR  +LG + D  R  M K  S RYA   GD LP+S+
Sbjct  82   HNS-ENHSYKLGLTKFADLTNEEYRAMFLGTRVDVKRRLMTKKPSRRYAFKVGDELPESV  140

Query  471  DWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            DWRE+GAV  +KDQG+CGSCWAFSTIAA+
Sbjct  141  DWREEGAVNPIKDQGNCGSCWAFSTIAAI  169



>ref|XP_008236565.1| PREDICTED: cysteine proteinase RD21a-like [Prunus mume]
Length=476

 Score =   187 bits (476),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 95/151 (63%), Positives = 120/151 (79%), Gaps = 5/151 (3%)
 Frame = +3

Query  114  DMSIITYDQQHPAKGLV--RSEDEVKEMFESWLVKHGKSYNAVDEKDKRFKIFRDNLKYI  287
            DMSII YD++H   G+   R+E EVK ++ESWLVKH K+YNA+ EK++RF+IF+DNL+++
Sbjct  30   DMSIIDYDEKH-GMGVPSDRTEAEVKALYESWLVKHRKNYNALGEKERRFEIFKDNLRFV  88

Query  288  DEKNSLENRSYKLGLNRFADITNEEYRTGYLGAKRDASRNMVKS-KSDRYAPVAGDSLPD  464
            DE N  ++RSYK+GLNRFAD+TNEEYR+ YLGAK D    +  S KS+RYA  AGD LP+
Sbjct  89   DEHNK-QSRSYKVGLNRFADLTNEEYRSIYLGAKVDRRFRLSGSRKSNRYAYRAGDELPE  147

Query  465  SIDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            S+DWR KGAV  VKDQG CGSCWAFST+ AV
Sbjct  148  SVDWRAKGAVAPVKDQGQCGSCWAFSTVGAV  178



>ref|XP_008377786.1| PREDICTED: cysteine proteinase RD21a-like [Malus domestica]
Length=349

 Score =   184 bits (468),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 93/156 (60%), Positives = 117/156 (75%), Gaps = 9/156 (6%)
 Frame = +3

Query  114  DMSIITYDQQH-----PAKGLVRSEDEVKEMFESWLVKHGKSYNAVDEKDKRFKIFRDNL  278
            DMSII+YD  +      + G  R+++ V  ++E WL +HGK+YNA+ EK++ F+IF+DNL
Sbjct  25   DMSIISYDSNNHLGDNKSLGSWRTDNVVMSIYEGWLAEHGKAYNALGEKERSFQIFKDNL  84

Query  279  KYIDEKNSLENRSYKLGLNRFADITNEEYRTGYLGAKRDASRNMVKS---KSDRYAPVAG  449
            +YIDEKNS +N SYKLGLNRF D+ NEEYR  YLGAK  A    V +   KSDRYAP  G
Sbjct  85   RYIDEKNS-KNLSYKLGLNRFVDLLNEEYRNTYLGAKTRAQMKRVSNRNIKSDRYAPHVG  143

Query  450  DSLPDSIDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            DSL DS+DWR++GAV+ VKDQGSCGSCW FSTI+AV
Sbjct  144  DSLLDSVDWRKEGAVSPVKDQGSCGSCWTFSTISAV  179



>gb|KJB43803.1| hypothetical protein B456_007G216900 [Gossypium raimondii]
Length=367

 Score =   185 bits (469),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 95/176 (54%), Positives = 122/176 (69%), Gaps = 17/176 (10%)
 Frame = +3

Query  36   LPTMARPSILFTFLFavvsaaaaaaEDMSIITYDQQHPAKGLVRSEDEVKEMFESWLVKH  215
            + T   P     FLF  +S         S  ++ Q H      RS+DEV  ++++WLVKH
Sbjct  1    MTTTVTPISTLFFLFFTLS---------SATSFSQNH-----WRSDDEVMSLYQAWLVKH  46

Query  216  GKSYNAVDEKDKRFKIFRDNLKYIDEKNSLENRSYKLGLNRFADITNEEYRTGYLGAKRD  395
            GK YN + E++ RF IF+DNLK+ID+ NS +N +YKLGLN+FAD+TN+EYR+ +LG K D
Sbjct  47   GKQYNGIGEEENRFDIFKDNLKFIDQHNS-KNTTYKLGLNKFADLTNQEYRSMFLGTKSD  105

Query  396  ASRNMVKSK--SDRYAPVAGDSLPDSIDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
              R ++KSK  S RYA  AGDSLP+S+DWR+ GAVT VKDQG CGSCWAFSTIAAV
Sbjct  106  PKRRVMKSKNPSQRYASRAGDSLPESVDWRDHGAVTPVKDQGRCGSCWAFSTIAAV  161



>gb|KJB43805.1| hypothetical protein B456_007G216900 [Gossypium raimondii]
Length=366

 Score =   184 bits (468),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 95/176 (54%), Positives = 122/176 (69%), Gaps = 17/176 (10%)
 Frame = +3

Query  36   LPTMARPSILFTFLFavvsaaaaaaEDMSIITYDQQHPAKGLVRSEDEVKEMFESWLVKH  215
            + T   P     FLF  +S         S  ++ Q H      RS+DEV  ++++WLVKH
Sbjct  1    MTTTVTPISTLFFLFFTLS---------SATSFSQNH-----WRSDDEVMSLYQAWLVKH  46

Query  216  GKSYNAVDEKDKRFKIFRDNLKYIDEKNSLENRSYKLGLNRFADITNEEYRTGYLGAKRD  395
            GK YN + E++ RF IF+DNLK+ID+ NS +N +YKLGLN+FAD+TN+EYR+ +LG K D
Sbjct  47   GKQYNGIGEEENRFDIFKDNLKFIDQHNS-KNTTYKLGLNKFADLTNQEYRSMFLGTKSD  105

Query  396  ASRNMVKSK--SDRYAPVAGDSLPDSIDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
              R ++KSK  S RYA  AGDSLP+S+DWR+ GAVT VKDQG CGSCWAFSTIAAV
Sbjct  106  PKRRVMKSKNPSQRYASRAGDSLPESVDWRDHGAVTPVKDQGRCGSCWAFSTIAAV  161



>ref|XP_009618803.1| PREDICTED: cysteine proteinase COT44-like [Nicotiana tomentosiformis]
Length=376

 Score =   184 bits (468),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 99/177 (56%), Positives = 134/177 (76%), Gaps = 8/177 (5%)
 Frame = +3

Query  45   MARPSILFTFLFavvsaaaaaaEDMSIITY-DQQHPA---KGLVRSEDEVKEMFESWLVK  212
            MA+ +I+ T LFA+ S+ + A  DMSII Y + QH     K   ++++EVK ++E WL +
Sbjct  1    MAK-TIITTLLFALFSSLSYAI-DMSIIDYKNNQHVGNMKKWTWQNDEEVKGIYELWLAE  58

Query  213  HGKSYNAVDEKDKRFKIFRDNLKYIDEKNSLENRSYKLGLNRFADITNEEYRTGYLGAKR  392
            HGK+YNA+ EK+KRF+IF+DNLK+I+E N+  NR+YK+GLN+FAD+TNEEYRT YLG + 
Sbjct  59   HGKAYNALGEKEKRFEIFKDNLKFIEEHNNSGNRTYKVGLNQFADLTNEEYRTMYLGTRS  118

Query  393  DASRNMVKSK--SDRYAPVAGDSLPDSIDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            DA R  VKSK  S RYA    + +P S+DWR++GAV  +K+QGSCGSCWAFST+AAV
Sbjct  119  DARRRFVKSKNPSHRYASRPNELMPHSVDWRKRGAVAPIKNQGSCGSCWAFSTVAAV  175



>gb|KDP47124.1| hypothetical protein JCGZ_22120 [Jatropha curcas]
Length=242

 Score =   181 bits (458),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 96/179 (54%), Positives = 120/179 (67%), Gaps = 14/179 (8%)
 Frame = +3

Query  45   MARPS------ILFTFLFavvsaaaaaaEDMSIITYDQQHPAKGLVRSEDEVKEMFESWL  206
            MA P       IL  FLF    A      DMSII Y+ +H      R++  V+ ++E WL
Sbjct  1    MASPGRSLPFFILCGFLFFSSLAL-----DMSIIDYNIRHGQNPEERTDANVRRIYEMWL  55

Query  207  VKHGKSYNAVDEKDKRFKIFRDNLKYIDEKNSLENRSYKLGLNRFADITNEEYRTGYLGA  386
            VKHGK+YNA+ EK+KRF+IF+DNLK+IDE NS+ NRSYKLGLNRFAD++NEEYR  +LG 
Sbjct  56   VKHGKAYNALGEKEKRFQIFKDNLKFIDEHNSV-NRSYKLGLNRFADLSNEEYRAMFLGT  114

Query  387  KRDASRNMVKS--KSDRYAPVAGDSLPDSIDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            + +    +  S     RY    GD LP+ +DWREKGAV  VK+QG CGSCWAFST+AAV
Sbjct  115  RMERKNRLGASMGTESRYLYKEGDDLPEKVDWREKGAVVPVKNQGQCGSCWAFSTVAAV  173



>ref|XP_011000919.1| PREDICTED: cysteine proteinase RD21a-like [Populus euphratica]
Length=488

 Score =   187 bits (475),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 96/175 (55%), Positives = 122/175 (70%), Gaps = 6/175 (3%)
 Frame = +3

Query  42   TMARPSILFTFLFavvsaaaaaaEDMSIITYDQQHPAKGLV--RSEDEVKEMFESWLVKH  215
            TMA     F FL      +   A DMSII Y+ +H   G V  R+E E   ++E WLV+H
Sbjct  11   TMASLYRSFAFLATFYFLSVCLAIDMSIIDYNLKH---GQVPERTEAETLRLYEMWLVEH  67

Query  216  GKSYNAVDEKDKRFKIFRDNLKYIDEKNSLENRSYKLGLNRFADITNEEYRTGYLGAKRD  395
            GK+YNA+ EK++RF+IF+DNLK++D+ NS+ N SYKLGLN+FAD++NEEYR  YLG + D
Sbjct  68   GKAYNALGEKERRFEIFKDNLKFVDQHNSVGNPSYKLGLNKFADLSNEEYRAAYLGTRMD  127

Query  396  ASRNMVKS-KSDRYAPVAGDSLPDSIDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
              R ++   KS RY    GD LP+S+DWREKGAV  VKDQG CGSCWAFST+ AV
Sbjct  128  GKRRLLGGPKSARYLFKDGDDLPESVDWREKGAVAPVKDQGQCGSCWAFSTVGAV  182



>ref|XP_002518705.1| cysteine protease, putative [Ricinus communis]
 gb|EEF43630.1| cysteine protease, putative [Ricinus communis]
Length=471

 Score =   186 bits (473),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 85/148 (57%), Positives = 116/148 (78%), Gaps = 1/148 (1%)
 Frame = +3

Query  114  DMSIITYDQQHPAKGLVRSEDEVKEMFESWLVKHGKSYNAVDEKDKRFKIFRDNLKYIDE  293
            DMSI+ Y+ +H  K  +R++ +V+ M+E WLV+HGK+YNA+ EK+KRF+IF+DNL++IDE
Sbjct  25   DMSIVDYNIKHGTKYPLRTDSQVRRMYEMWLVEHGKAYNALGEKEKRFEIFKDNLRFIDE  84

Query  294  KNSLENRSYKLGLNRFADITNEEYRTGYLGAKRDASRNMVKSKSDRYAPVAGDSLPDSID  473
             NS++ RSYK+GLNRFAD+TNEEY+  +LG K +     + ++S RY    GD LP+++D
Sbjct  85   HNSVD-RSYKVGLNRFADLTNEEYKAMFLGTKMERKNRFLGTRSQRYLFKDGDDLPENVD  143

Query  474  WREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            WREKGAV  VKDQG CGSCWAFST+ AV
Sbjct  144  WREKGAVVPVKDQGQCGSCWAFSTVGAV  171



>ref|XP_007199820.1| hypothetical protein PRUPE_ppa005328mg [Prunus persica]
 gb|EMJ01019.1| hypothetical protein PRUPE_ppa005328mg [Prunus persica]
Length=466

 Score =   186 bits (472),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 95/151 (63%), Positives = 119/151 (79%), Gaps = 5/151 (3%)
 Frame = +3

Query  114  DMSIITYDQQHPAKGLV--RSEDEVKEMFESWLVKHGKSYNAVDEKDKRFKIFRDNLKYI  287
            DMSII YD +H   G+   R+E EVK ++ESWLVKH K+YNA+ EK++RF+IF+DNL+++
Sbjct  20   DMSIINYDDKH-GMGVPSDRTEAEVKALYESWLVKHRKNYNALGEKERRFEIFKDNLRFV  78

Query  288  DEKNSLENRSYKLGLNRFADITNEEYRTGYLGAKRDASRNMVKS-KSDRYAPVAGDSLPD  464
            DE N  ++RSYK+GLNRFAD+TNEEYR+ YLGAK D    +  S KS+RYA  AGD LP+
Sbjct  79   DEHNK-QSRSYKVGLNRFADLTNEEYRSIYLGAKVDRRFRLSWSRKSNRYAYRAGDELPE  137

Query  465  SIDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            S+DWR KGAV  VKDQG CGSCWAFST+ AV
Sbjct  138  SVDWRAKGAVAPVKDQGQCGSCWAFSTVGAV  168



>ref|XP_011000142.1| PREDICTED: cysteine proteinase RD21a-like [Populus euphratica]
Length=479

 Score =   186 bits (473),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 93/175 (53%), Positives = 124/175 (71%), Gaps = 12/175 (7%)
 Frame = +3

Query  36   LPTMARPSILFTFLFavvsaaaaaaEDMSIITYDQQHPAKGLVRSEDEVKEMFESWLVKH  215
            L  +A  S+L+  L            DMSII Y+ +H  +   R+E E + ++E WLVKH
Sbjct  8    LAVLAMLSLLYVCLAI----------DMSIIDYNIKH-GQIPERTEAETRRIYEMWLVKH  56

Query  216  GKSYNAVDEKDKRFKIFRDNLKYIDEKNSLENRSYKLGLNRFADITNEEYRTGYLGAKRD  395
            G++YNA+ EK++RF+IF+DNLK+IDE NS+ N SYKLGLN FAD++N+EYR+ YLG + D
Sbjct  57   GRAYNALGEKERRFEIFKDNLKFIDEHNSVGNPSYKLGLNMFADLSNDEYRSVYLGTRMD  116

Query  396  ASRNMVK-SKSDRYAPVAGDSLPDSIDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
              R ++   KS+RY    GD LP+++DWREKGAVT VKDQG CGSCWAFST+ AV
Sbjct  117  RKRRLLSGPKSERYLFKEGDDLPETVDWREKGAVTPVKDQGQCGSCWAFSTVGAV  171



>ref|XP_004304028.1| PREDICTED: cysteine proteinase RD21a-like [Fragaria vesca subsp. 
vesca]
Length=476

 Score =   186 bits (472),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 97/175 (55%), Positives = 122/175 (70%), Gaps = 10/175 (6%)
 Frame = +3

Query  39   PTMARPSILFTFLFavvsaaaaaaEDMSIITYDQQHPAKGLV--RSEDEVKEMFESWLVK  212
            P MA     F  L        A+A DMSII YD +H   G+V  R+E EVK M+ESWLVK
Sbjct  13   PAMAAAVFFFLLL------GLASAADMSIIDYDNKH-HMGVVPERTEAEVKAMYESWLVK  65

Query  213  HGKSYNAVDEKDKRFKIFRDNLKYIDEKNSLENRSYKLGLNRFADITNEEYRTGYLGAKR  392
            H K+YNA+ E ++RF+IF DNL+++DE N + NRSYK+GLNRFAD+TN EYR+ +LG K+
Sbjct  66   HRKAYNALGEMERRFEIFMDNLRFVDEHNKV-NRSYKVGLNRFADMTNLEYRSKFLGMKK  124

Query  393  DASRNMVKSKSDRYAPVAGDSLPDSIDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            D S  ++  +S RY    GD LP S+DWR +GAV  VKDQG CGSCWAFST+ AV
Sbjct  125  DRSARLLGGESGRYMYQVGDKLPASVDWRAEGAVAEVKDQGQCGSCWAFSTVGAV  179



>ref|XP_007047371.1| Granulin repeat cysteine protease family protein [Theobroma cacao]
 gb|EOX91528.1| Granulin repeat cysteine protease family protein [Theobroma cacao]
Length=384

 Score =   184 bits (466),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 85/131 (65%), Positives = 108/131 (82%), Gaps = 2/131 (2%)
 Frame = +3

Query  171  EDEVKEMFESWLVKHGKSYNAVDEKDKRFKIFRDNLKYIDEKNSLENRSYKLGLNRFADI  350
            +DEV+ +++SWLVKHGK+YN + E++ RF IF+DNLK+IDE NS  NR+YKLGLN+FAD+
Sbjct  50   DDEVRSLYKSWLVKHGKAYNGIGEEEMRFDIFKDNLKFIDEHNSNNNRTYKLGLNKFADL  109

Query  351  TNEEYRTGYLGAKRDASRNMVKSK--SDRYAPVAGDSLPDSIDWREKGAVTGVKDQGSCG  524
            TN+EYR+ +LG + D  R ++KSK  S RYA  AGDSLP+S+DWRE G+V  VKDQG CG
Sbjct  110  TNQEYRSKFLGTRSDPRRRVMKSKNPSQRYAFRAGDSLPESVDWREHGSVNPVKDQGYCG  169

Query  525  SCWAFSTIAAV  557
            SCWAFSTIAAV
Sbjct  170  SCWAFSTIAAV  180



>ref|XP_010094652.1| Cysteine proteinase RD21a [Morus notabilis]
 gb|EXB56503.1| Cysteine proteinase RD21a [Morus notabilis]
Length=463

 Score =   186 bits (471),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 90/148 (61%), Positives = 115/148 (78%), Gaps = 7/148 (5%)
 Frame = +3

Query  114  DMSIITYDQQHPAKGLVRSEDEVKEMFESWLVKHGKSYNAVDEKDKRFKIFRDNLKYIDE  293
            DMSI++Y+    +    R++DEV  ++E+WLVKHGK YNA+ EK+KRF+IF+DNL++IDE
Sbjct  27   DMSIVSYNLVDQSSS--RTDDEVMAIYEAWLVKHGKVYNALGEKEKRFQIFKDNLRFIDE  84

Query  294  KNSLENRSYKLGLNRFADITNEEYRTGYLGAKRDASRNMVKSKSDRYAPVAGDSLPDSID  473
             N+ ++R YKLGLNRFAD+TNEEYR+ YLG K    + +    S RYAP  GD LP  +D
Sbjct  85   HNA-QDRPYKLGLNRFADLTNEEYRSTYLGTKIRGQKKV----SQRYAPRVGDDLPSFVD  139

Query  474  WREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            WR++GAV GVKDQGSCGSCWAFSTIAAV
Sbjct  140  WRKEGAVVGVKDQGSCGSCWAFSTIAAV  167



>gb|AEZ65082.1| cysteine protease [Carica papaya]
Length=471

 Score =   185 bits (470),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 95/178 (53%), Positives = 124/178 (70%), Gaps = 6/178 (3%)
 Frame = +3

Query  33   LLPTMARPSILFTFLFavvsaaaaaaEDMSIITYD-QQHPAKGLVRSEDEVKEMFESWLV  209
            + P   R  I  +FLF V S + A+   MSII YD    P +   R+E  + +M+E WLV
Sbjct  1    MAPPPFRLCIAISFLFMVFSLSLAS---MSIIDYDLPADPLQSTERTEAHMMKMYEHWLV  57

Query  210  KHGKSYNAVDEKDKRFKIFRDNLKYIDEKNSLENRSYKLGLNRFADITNEEYRTGYLGAK  389
            KHGK+YNA+ EK++RF+IF+DNL+++DE+NS+  R+YKLGL +FAD+TNEEYR  YLGAK
Sbjct  58   KHGKNYNAIGEKERRFEIFKDNLRFVDEQNSVPGRTYKLGLTKFADLTNEEYRAMYLGAK  117

Query  390  RDASRNMVKSKSDRYAPVAG--DSLPDSIDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
             +    +   +S RY   AG  D LP  +DWREKGAVT VKDQG CGSCWAFST+ +V
Sbjct  118  MEKKEKLRTERSQRYLHKAGNDDDLPSHVDWREKGAVTEVKDQGQCGSCWAFSTVGSV  175



>gb|KHN04480.1| Cysteine proteinase RD21a [Glycine soja]
Length=360

 Score =   182 bits (463),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 86/148 (58%), Positives = 115/148 (78%), Gaps = 2/148 (1%)
 Frame = +3

Query  114  DMSIITYDQQHPAKGLVRSEDEVKEMFESWLVKHGKSYNAVDEKDKRFKIFRDNLKYIDE  293
            DMSII+YD+ H  K   +S++EV  ++E WLVKHGK YNAV+EK+KRF+IF+DNL +I+E
Sbjct  19   DMSIISYDRSHADKSGWKSDEEVMSIYEEWLVKHGKVYNAVEEKEKRFQIFKDNLNFIEE  78

Query  294  KNSLENRSYKLGLNRFADITNEEYRTGYLGAKRDASRNMVKSKSDRYAPVAGDSLPDSID  473
             N++ NR+YK+GLNRF+D++NEEYR+ YLG K D  R M +  S RY+P   D+LP+S+D
Sbjct  79   HNAV-NRTYKVGLNRFSDLSNEEYRSKYLGTKIDPRRMMAR-PSRRYSPRVADNLPESVD  136

Query  474  WREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            WR++GAV  VK+Q  C  CWAFS IAAV
Sbjct  137  WRKEGAVVRVKNQSECEGCWAFSAIAAV  164



>gb|EYU37647.1| hypothetical protein MIMGU_mgv1a005905mg [Erythranthe guttata]
Length=465

 Score =   185 bits (470),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 90/149 (60%), Positives = 116/149 (78%), Gaps = 7/149 (5%)
 Frame = +3

Query  114  DMSIITYDQQHPAKGLVRSEDEVKEMFESWLVKHGKSYNAVDEKDKRFKIFRDNLKYIDE  293
            DMSIITYD++H      RSE +   M+ESWLVKHGK+YNA+ EK+KRF+IF+DNL +++E
Sbjct  25   DMSIITYDEKHQ-----RSEGDAMAMYESWLVKHGKAYNAIGEKEKRFQIFKDNLMFVEE  79

Query  294  KNSLENRSYKLGLNRFADITNEEYRTGYLGAKRD-ASRNMVKSKSDRYAPVAGDSLPDSI  470
             NS + R YK+G+NRFAD+TNEEYR+ ++  + D  +R M +  SDRYA  AG+ LP+ +
Sbjct  80   HNSAD-RPYKVGMNRFADLTNEEYRSMFVRGRLDRNARLMNRRASDRYALKAGEKLPEFV  138

Query  471  DWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            DWREKGAV  VKDQG CGSCWAFSTIAA+
Sbjct  139  DWREKGAVAPVKDQGQCGSCWAFSTIAAI  167



>ref|XP_010061721.1| PREDICTED: low-temperature-induced cysteine proteinase [Eucalyptus 
grandis]
 gb|KCW68707.1| hypothetical protein EUGRSUZ_F02310 [Eucalyptus grandis]
Length=478

 Score =   185 bits (470),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 91/154 (59%), Positives = 123/154 (80%), Gaps = 6/154 (4%)
 Frame = +3

Query  114  DMSIITYDQQH-----PAKGLVRSEDEVKEMFESWLVKHGKSYNAVDEKDKRFKIFRDNL  278
            DMSI++YD+ H      +    RS+DEV  ++ESWL KHGK+YNA+ EK+KRF++F+DNL
Sbjct  29   DMSIVSYDRAHGDRSSSSSSSWRSDDEVMAVYESWLAKHGKAYNALGEKEKRFQVFKDNL  88

Query  279  KYIDEKNSLENRSYKLGLNRFADITNEEYRTGYLGAKRDAS-RNMVKSKSDRYAPVAGDS  455
            ++ID+ N+  +R+Y +GLN+FAD+TNEEYR+ YLGA+ D S R + +++SDRYA  AG+ 
Sbjct  89   RFIDDHNAGGDRTYTVGLNQFADLTNEEYRSMYLGARMDRSGRRLGRARSDRYAVAAGEE  148

Query  456  LPDSIDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            LP S+DWR++GAV  VKDQGSCGSCWAFSTIAAV
Sbjct  149  LPASVDWRKEGAVVDVKDQGSCGSCWAFSTIAAV  182



>ref|XP_009390984.1| PREDICTED: oryzain alpha chain-like [Musa acuminata subsp. malaccensis]
Length=469

 Score =   185 bits (469),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 83/151 (55%), Positives = 114/151 (75%), Gaps = 3/151 (2%)
 Frame = +3

Query  114  DMSIITYDQQHPAKGLVRSEDEVKEMFESWLVKHGKSYNAVDEKDKRFKIFRDNLKYIDE  293
            DMSII+YD++H  KGL RS++E++ M+E WL+KHG++YNA+ E ++RF+IF+DNL++ID 
Sbjct  23   DMSIISYDEEHGVKGLERSKEEMRRMYEGWLIKHGRTYNALGEMERRFEIFKDNLRFIDA  82

Query  294  KNSLEN---RSYKLGLNRFADITNEEYRTGYLGAKRDASRNMVKSKSDRYAPVAGDSLPD  464
             N+  +     Y+LGLNRFAD+TNEEYR G++G +   +    +  SDRY    G+ LP+
Sbjct  83   HNAEADAGLHRYRLGLNRFADLTNEEYRAGFIGTRPRGAARRNRVPSDRYRLGDGEELPE  142

Query  465  SIDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            S+DWR KGAV  VKDQG CGSCWAFST+ AV
Sbjct  143  SVDWRAKGAVAAVKDQGYCGSCWAFSTVGAV  173



>emb|CAQ00115.1| papain-like cysteine proteinase [Hordeum vulgare subsp. vulgare]
Length=190

 Score =   177 bits (449),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 83/152 (55%), Positives = 115/152 (76%), Gaps = 5/152 (3%)
 Frame = +3

Query  117  MSIITYDQQHPAKGLV---RSEDEVKEMFESWLVKHGKSYNAVDEKDKRFKIFRDNLKYI  287
            +S +T +Q HP+       RS+DEV  +++SW+++HGK+YN + E++KRF+IF+DNL ++
Sbjct  21   ISTLTLNQNHPSSSSSSSWRSDDEVMGLYKSWVIQHGKAYNGIGEEEKRFEIFKDNLMFV  80

Query  288  DEKNSLENRSYKLGLNRFADITNEEYRTGYLGAKRDASRNMVKSK--SDRYAPVAGDSLP  461
            DE NS  N +YKLGLN+FAD+TN+EYR  +LG + D  R ++KSK  S R A  A D+LP
Sbjct  81   DEHNSNNNTTYKLGLNKFADLTNQEYRAKFLGTRTDPRRRLMKSKIPSSRNAHRAADNLP  140

Query  462  DSIDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            DS++WR+ GAV+ VKDQGS GSCWAFS IAAV
Sbjct  141  DSVNWRDHGAVSRVKDQGSWGSCWAFSAIAAV  172



>ref|XP_002310708.2| hypothetical protein POPTR_0007s10650g [Populus trichocarpa]
 gb|EEE91158.2| hypothetical protein POPTR_0007s10650g [Populus trichocarpa]
Length=376

 Score =   182 bits (462),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 93/175 (53%), Positives = 127/175 (73%), Gaps = 11/175 (6%)
 Frame = +3

Query  45   MARPSILFTFLFavvsaaaaaaEDMSIITYDQQHPA--KGLVRSEDEVKEMFESWLVKHG  218
            +A  ++LF F         ++A DMSI  +D  H +  +   RS+DEV  +++ WL KHG
Sbjct  3    LAISTLLFLFF------TVSSALDMSIFNHDDNHLSHDQSSWRSDDEVMSIYKWWLQKHG  56

Query  219  KSYNAVDEKDKRFKIFRDNLKYIDEKNSLENRSYKLGLNRFADITNEEYRTGYLGAKRDA  398
            K+YN + EK KRF+IF++NL++IDE NS +NR+YK+GL +FAD+TN+EYR  +LG + D 
Sbjct  57   KAYNRLGEKAKRFEIFKNNLRFIDEHNS-QNRTYKVGLTKFADLTNQEYRAMFLGTRSDP  115

Query  399  SRNMVKSK--SDRYAPVAGDSLPDSIDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
             R ++KSK  S+RYA  AGD LP+S+DWR KGAV  +KDQGSCGSCWAFST+AAV
Sbjct  116  KRRLMKSKNPSERYAYKAGDKLPESVDWRGKGAVNPIKDQGSCGSCWAFSTVAAV  170



>ref|XP_010540378.1| PREDICTED: cysteine proteinase RD21a-like [Tarenaya hassleriana]
Length=460

 Score =   184 bits (467),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 94/173 (54%), Positives = 124/173 (72%), Gaps = 9/173 (5%)
 Frame = +3

Query  45   MARPSILFTFLFavvsaaaaaaEDMSIITYDQQH--PAKGLVRSEDEVKEMFESWLVKHG  218
            + +P +   FL      + ++A DMSII+YD++H     G  RSE +   ++E+WLVKHG
Sbjct  3    LVKPVLAILFL---TVISLSSAMDMSIISYDEKHHVSGGGGGRSEVDTAALYEAWLVKHG  59

Query  219  KSYNAVDEKDKRFKIFRDNLKYIDEKNSLENRSYKLGLNRFADITNEEYRTGYLGAKRDA  398
            K YNA+ EKD+RF+IF++NL++IDE N+ +N SY+LGL RFAD+TNEEYR+ YLGAK   
Sbjct  60   KFYNALGEKDRRFEIFKENLRFIDEHNA-KNLSYRLGLTRFADLTNEEYRSMYLGAK---  115

Query  399  SRNMVKSKSDRYAPVAGDSLPDSIDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
                    SDRY P   D+LPDS+DWR++GAV+ VKDQGSCGSCWAFS I AV
Sbjct  116  PHKRTLRTSDRYQPRVSDALPDSVDWRKEGAVSDVKDQGSCGSCWAFSAIGAV  168



>ref|XP_002306486.2| hypothetical protein POPTR_0005s18520g [Populus trichocarpa]
 gb|EEE93482.2| hypothetical protein POPTR_0005s18520g [Populus trichocarpa]
Length=396

 Score =   182 bits (462),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 95/175 (54%), Positives = 128/175 (73%), Gaps = 11/175 (6%)
 Frame = +3

Query  45   MARPSILFTFLFavvsaaaaaaEDMSIITYDQQHPA--KGLVRSEDEVKEMFESWLVKHG  218
            +A  ++LF  LF + SA      DMSI+T +   P   +   RS+DEV  M++ WL KHG
Sbjct  3    LAISALLF-LLFTMSSAL-----DMSILTSNDNQPNHDRSSWRSDDEVMSMYKWWLAKHG  56

Query  219  KSYNAVDEKDKRFKIFRDNLKYIDEKNSLENRSYKLGLNRFADITNEEYRTGYLGAKRDA  398
            K+YN + E+ +RF+IF++NL++IDE NS +N +YK+GL +FAD+TNEEYR  +LG + DA
Sbjct  57   KAYNRLGEEAERFEIFKNNLRFIDEHNS-QNHTYKVGLTKFADLTNEEYRAMFLGTRSDA  115

Query  399  SRNMVKSKS--DRYAPVAGDSLPDSIDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
             R ++KSKS  +RYA  AGD LP+S+DWR KGAV  +KDQGSCGSCWAFST+AAV
Sbjct  116  KRRLMKSKSPSERYAFKAGDKLPESVDWRAKGAVNPIKDQGSCGSCWAFSTVAAV  170



>ref|XP_002313136.2| hypothetical protein POPTR_0009s10090g [Populus trichocarpa]
 gb|EEE87091.2| hypothetical protein POPTR_0009s10090g [Populus trichocarpa]
Length=477

 Score =   184 bits (467),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 91/165 (55%), Positives = 118/165 (72%), Gaps = 2/165 (1%)
 Frame = +3

Query  66   FTFLFavvsaaaaaaEDMSIITYDQQHPAKGLVRSEDEVKEMFESWLVKHGKSYNAVDEK  245
            F FL      +   A DMSII Y+ +H  +   R+E E   ++E WLVK+GK+YNA+ EK
Sbjct  8    FAFLATFYFVSVCLAIDMSIIDYNLKH-GQVPERTEAETLRLYEMWLVKYGKAYNALGEK  66

Query  246  DKRFKIFRDNLKYIDEKNSLENRSYKLGLNRFADITNEEYRTGYLGAKRDASRNMVKS-K  422
            ++RF+IF+DNLK++D+ NS+ N SYKLGLN+FAD++NEEYR  YLG + D  R ++   K
Sbjct  67   ERRFEIFKDNLKFVDQHNSVGNPSYKLGLNKFADLSNEEYRAAYLGTRMDGKRRLLGGPK  126

Query  423  SDRYAPVAGDSLPDSIDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            S RY    GD LP+S+DWREKGAV  VKDQG CGSCWAFST+ AV
Sbjct  127  SARYLFKDGDDLPESVDWREKGAVAPVKDQGQCGSCWAFSTVGAV  171



>ref|XP_008220266.1| PREDICTED: low-temperature-induced cysteine proteinase [Prunus 
mume]
Length=472

 Score =   184 bits (466),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 87/154 (56%), Positives = 121/154 (79%), Gaps = 7/154 (5%)
 Frame = +3

Query  114  DMSIITYDQQH---PAKGLVRSEDEVKEMFESWLVKHGKSYNAVDEKDKRFKIFRDNLKY  284
            DMSII+YD ++    +K   R+++EV  ++E WL KHGK+YN + EK++RF+IF+DNL+Y
Sbjct  25   DMSIISYDDKNVVGESKSSWRTDEEVMSIYEGWLAKHGKAYNGLGEKERRFQIFKDNLRY  84

Query  285  IDEKNSLENRSYKLGLNRFADITNEEYRTGYLGAKRDASRNMV---KSKSDRYAPVAGDS  455
            ID+ N+ +N SYKLGLNRFAD++N+EYR+ +LG K  A +  +    +KSDRYAP  GDS
Sbjct  85   IDDHNA-KNLSYKLGLNRFADLSNDEYRSTFLGTKTRAQKKRLSNRNTKSDRYAPRVGDS  143

Query  456  LPDSIDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            LPDS+DWR++G V  +KDQGSCGSCWAF+TI++V
Sbjct  144  LPDSVDWRKEGVVNPIKDQGSCGSCWAFATISSV  177



>ref|XP_002298740.2| hypothetical protein POPTR_0001s30950g [Populus trichocarpa]
 gb|EEE83545.2| hypothetical protein POPTR_0001s30950g [Populus trichocarpa]
Length=479

 Score =   184 bits (466),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 87/149 (58%), Positives = 115/149 (77%), Gaps = 2/149 (1%)
 Frame = +3

Query  114  DMSIITYDQQHPAKGLVRSEDEVKEMFESWLVKHGKSYNAVDEKDKRFKIFRDNLKYIDE  293
            DMSII Y+ +H  +   R+E E + ++E WLVKHG++YNA+ EK++RF+IF+DNLK+IDE
Sbjct  24   DMSIIDYNIKH-GQVPERTEAETRRIYEMWLVKHGRAYNALGEKERRFEIFKDNLKFIDE  82

Query  294  KNSLENRSYKLGLNRFADITNEEYRTGYLGAKRDA-SRNMVKSKSDRYAPVAGDSLPDSI  470
             NS+ N SYKLGLN+FAD++N+EYR+ YLG + D   R +   KS+RY    GD LP+++
Sbjct  83   HNSVGNPSYKLGLNKFADLSNDEYRSVYLGTRMDGKGRLLGGPKSERYLFKEGDDLPETV  142

Query  471  DWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            DWREKGAV  VKDQG CGSCWAFST+ AV
Sbjct  143  DWREKGAVAPVKDQGQCGSCWAFSTVGAV  171



>ref|XP_006343212.1| PREDICTED: cysteine proteinase RD21a-like [Solanum tuberosum]
Length=366

 Score =   181 bits (459),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 83/131 (63%), Positives = 108/131 (82%), Gaps = 2/131 (2%)
 Frame = +3

Query  171  EDEVKEMFESWLVKHGKSYNAVDEKDKRFKIFRDNLKYIDEKNSLENRSYKLGLNRFADI  350
            ++EVK ++E WLV+HGK YN + EK KRF+IF+DNL++I+E N+L+N++Y LGLNRFAD+
Sbjct  34   DEEVKGIYEIWLVEHGKIYNGLGEKGKRFEIFKDNLRFIEEHNNLKNQTYVLGLNRFADL  93

Query  351  TNEEYRTGYLGAKRDASRNMVKSK--SDRYAPVAGDSLPDSIDWREKGAVTGVKDQGSCG  524
            TNEEYRT +LG + DA R +VKSK  S RY   A D +P+S+DWR+KGAV  +KDQGSCG
Sbjct  94   TNEEYRTMFLGTRSDARRRLVKSKNASHRYVFRASDHVPESVDWRKKGAVAPIKDQGSCG  153

Query  525  SCWAFSTIAAV  557
            SCWAFST+AAV
Sbjct  154  SCWAFSTVAAV  164



>gb|KCW68708.1| hypothetical protein EUGRSUZ_F02310 [Eucalyptus grandis]
Length=478

 Score =   183 bits (465),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 90/154 (58%), Positives = 122/154 (79%), Gaps = 6/154 (4%)
 Frame = +3

Query  114  DMSIITYDQQH-----PAKGLVRSEDEVKEMFESWLVKHGKSYNAVDEKDKRFKIFRDNL  278
            DMSI++YD+ H      +    RS+DEV  ++ESWL KHGK+YNA+ EK+KRF++F+DNL
Sbjct  29   DMSIVSYDRAHGDRSSSSSSSWRSDDEVMAVYESWLAKHGKAYNALGEKEKRFQVFKDNL  88

Query  279  KYIDEKNSLENRSYKLGLNRFADITNEEYRTGYLGAKRDAS-RNMVKSKSDRYAPVAGDS  455
            ++ID+ N+  +R+Y +GLN+FAD+TNEEYR+ YLGA+ D S R + +++SDRYA  AG+ 
Sbjct  89   RFIDDHNAGGDRTYTVGLNQFADLTNEEYRSMYLGARMDRSGRRLGRARSDRYAVAAGEE  148

Query  456  LPDSIDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            LP S+DWR++GAV  VKDQGSCG CWAFSTIAAV
Sbjct  149  LPASVDWRKEGAVVDVKDQGSCGDCWAFSTIAAV  182



>dbj|BAD16614.1| cysteine proteinase [Dianthus caryophyllus]
Length=459

 Score =   183 bits (464),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 96/168 (57%), Positives = 124/168 (74%), Gaps = 14/168 (8%)
 Frame = +3

Query  60   ILFTFLFavvsaaaaaaEDMSIITYDQQHPAKGLVRSEDEVKEMFESWLVKHGKSYNAVD  239
            +LF+ +F V S+A     D+SII        +   R +DE+  ++E+WLVKHGK+YN + 
Sbjct  10   LLFSIIFIVSSSAL----DLSIID-------RAFNRPDDEIASLYETWLVKHGKNYNGLG  58

Query  240  EKDKRFKIFRDNLKYIDEKNSLENRSYKLGLNRFADITNEEYRTGYLGAKRD--ASRNMV  413
            EK  RF IF+DNL+++DE+NS EN S+KLGLNRFAD+TNEEYR+ YLG +    A     
Sbjct  59   EKQLRFNIFKDNLRFVDERNS-ENLSFKLGLNRFADLTNEEYRSVYLGTRPRSVAVARSG  117

Query  414  KSKSDRYAPVAGDSLPDSIDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            +SKSDRYA  AGD+LP+S+DWR+KGAV G+KDQGSCGSCWAFS IAAV
Sbjct  118  RSKSDRYAFRAGDTLPESVDWRKKGAVAGIKDQGSCGSCWAFSAIAAV  165



>ref|XP_007222885.1| hypothetical protein PRUPE_ppa005199mg [Prunus persica]
 gb|EMJ24084.1| hypothetical protein PRUPE_ppa005199mg [Prunus persica]
Length=472

 Score =   183 bits (465),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 87/154 (56%), Positives = 121/154 (79%), Gaps = 7/154 (5%)
 Frame = +3

Query  114  DMSIITYDQQH---PAKGLVRSEDEVKEMFESWLVKHGKSYNAVDEKDKRFKIFRDNLKY  284
            DMSII+YD ++    +K   R+++EV  ++E WL KHGK+YN + EK++RF+IF+DNL+Y
Sbjct  25   DMSIISYDDKNVVGESKSSWRTDEEVMSIYEGWLAKHGKAYNGLGEKERRFQIFKDNLRY  84

Query  285  IDEKNSLENRSYKLGLNRFADITNEEYRTGYLGAKRDASRNMV---KSKSDRYAPVAGDS  455
            ID+ N+ +N SYKLGLNRFAD++N+EYR+ +LG K  A +  +    +KSDRYAP  GDS
Sbjct  85   IDDHNA-KNLSYKLGLNRFADLSNDEYRSTFLGTKTRAQKRRLSNRNTKSDRYAPRVGDS  143

Query  456  LPDSIDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            LPDS+DWR++G V  +KDQGSCGSCWAF+TI++V
Sbjct  144  LPDSVDWRKEGVVNPIKDQGSCGSCWAFATISSV  177



>ref|XP_006393620.1| hypothetical protein EUTSA_v10011464mg [Eutrema salsugineum]
 gb|ESQ30906.1| hypothetical protein EUTSA_v10011464mg [Eutrema salsugineum]
Length=459

 Score =   183 bits (464),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 98/173 (57%), Positives = 127/173 (73%), Gaps = 11/173 (6%)
 Frame = +3

Query  39   PTMARPSILFTFLFavvsaaaaaaEDMSIITYDQQHPAKGLVRSEDEVKEMFESWLVKHG  218
            PTMA   ILF  + AV SA      DMSII+YD+ H      RS+ EVK ++E+WLVKHG
Sbjct  6    PTMA---ILFLTMIAVSSAM-----DMSIISYDESHHTVSGGRSDAEVKRLYETWLVKHG  57

Query  219  KSYNAVDEKDKRFKIFRDNLKYIDEKNSLENRSYKLGLNRFADITNEEYRTGYLGAKRDA  398
            K  N++ EKD+RF+IF+DNL++ID+ N+ +N SY+LGL +FAD+TN+EYR+ YLGAK   
Sbjct  58   KVQNSLVEKDRRFEIFKDNLRFIDDHNA-KNLSYRLGLTKFADLTNDEYRSIYLGAKMQK  116

Query  399  SRNMVKSKSDRYAPVAGDSLPDSIDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            +R   +  S RY    GD+LP+S+DWR++GAV  VKDQGSCGSCWAFSTI AV
Sbjct  117  NRE--RRASTRYEARVGDALPESVDWRKEGAVVEVKDQGSCGSCWAFSTIGAV  167



>ref|XP_002285299.1| PREDICTED: cysteine proteinase RD21a-like [Vitis vinifera]
Length=469

 Score =   182 bits (463),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 89/149 (60%), Positives = 120/149 (81%), Gaps = 6/149 (4%)
 Frame = +3

Query  114  DMSIITYDQQHPAKGLVRSEDEVKEMFESWLVKHGKSYNAVDEKDKRFKIFRDNLKYIDE  293
            DMSII+Y  +       R++ EV  ++E+WLVKHGKSYNA+ E+++RF+IF+DNL++I+E
Sbjct  32   DMSIISYGDRLEK----RTDAEVMAVYEAWLVKHGKSYNALGERERRFEIFKDNLRFIEE  87

Query  294  KNSLENRSYKLGLNRFADITNEEYRTGYLGAKRDASRNMVKSK-SDRYAPVAGDSLPDSI  470
             N++ NR+YK+GLNRFAD+TNEEYR+ YLG + +  R +  S+ SDRY+  AG+ LP+S+
Sbjct  88   HNAV-NRTYKVGLNRFADLTNEEYRSRYLGRRDETRRGLRASRVSDRYSFRAGEDLPESV  146

Query  471  DWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            DWREKGAV  VKDQG+CGSCWAFSTIAAV
Sbjct  147  DWREKGAVVPVKDQGNCGSCWAFSTIAAV  175



>gb|EYU34557.1| hypothetical protein MIMGU_mgv1a007408mg [Erythranthe guttata]
Length=408

 Score =   181 bits (459),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 81/133 (61%), Positives = 112/133 (84%), Gaps = 3/133 (2%)
 Frame = +3

Query  165  RSEDEVKEMFESWLVKHGKSYNAVDEKDKRFKIFRDNLKYIDEKNSLENRSYKLGLNRFA  344
            R++++VK ++ESWL KHGK+YN + EKD+RF IF+DNLK++D+ NS  NR+Y++GLN+FA
Sbjct  36   RTDEQVKGLYESWLAKHGKAYNGIGEKDRRFDIFKDNLKFVDDHNS-GNRTYEVGLNKFA  94

Query  345  DITNEEYRTGYLGAKRDASRNMVKSK--SDRYAPVAGDSLPDSIDWREKGAVTGVKDQGS  518
            D+TNEEYR+ YLG + D +R  VKSK  S RYA  +G+ LP+S+DWRE+GAV+ +K+QG+
Sbjct  95   DLTNEEYRSTYLGTRSDPTRRFVKSKNPSRRYALRSGEMLPESVDWRERGAVSPIKNQGT  154

Query  519  CGSCWAFSTIAAV  557
            CGSCWAFST+AAV
Sbjct  155  CGSCWAFSTVAAV  167



>gb|ACU13684.1| unknown [Glycine max]
Length=229

 Score =   176 bits (445),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 81/132 (61%), Positives = 101/132 (77%), Gaps = 2/132 (2%)
 Frame = +3

Query  168  SEDEVKEMFESWLVKHGKSYNAVDEKDKRFKIFRDNLKYIDEKNSLENRSYKLGLNRFAD  347
            +++EV  M+E WLVKH K YN + EKDKRF++F+DNL +I E N+ +N +YKLGLN+FAD
Sbjct  32   TDNEVMTMYEEWLVKHQKVYNGLREKDKRFQVFKDNLGFIQEHNNNQNNTYKLGLNQFAD  91

Query  348  ITNEEYRTGYLGAKRDASRNMVKSKS--DRYAPVAGDSLPDSIDWREKGAVTGVKDQGSC  521
            +TNEEYR  Y G K DA R ++K+KS   RYA  AGD LP  +DWR KGAV  +KDQGSC
Sbjct  92   MTNEEYRVMYFGTKSDAKRRLMKTKSTGHRYAYSAGDRLPVHVDWRVKGAVAPIKDQGSC  151

Query  522  GSCWAFSTIAAV  557
            GSCWAFST+A V
Sbjct  152  GSCWAFSTVATV  163



>gb|KHN08598.1| Cysteine proteinase RD21a [Glycine soja]
Length=435

 Score =   181 bits (459),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 85/151 (56%), Positives = 111/151 (74%), Gaps = 14/151 (9%)
 Frame = +3

Query  114  DMSIITYDQQHPAKGLVRSEDEVKEMFESWLVKHGKSYNAVDEKDKRFKIFRDNLKYIDE  293
            DMSII YD+ H            + ++E+WLVKHGK+YNA+ EK++RFKIF+DNL++I+E
Sbjct  2    DMSIIDYDESH-----------TRHVYEAWLVKHGKAYNALGEKERRFKIFKDNLRFIEE  50

Query  294  KNSLENRSYKLGLNRFADITNEEYRTGYLGAKRDASRN---MVKSKSDRYAPVAGDSLPD  464
             N   ++SYKLGLN+FAD+TNEEYR  +LG +    +N   +V  K+DRYA  AG+ LP 
Sbjct  51   HNGAGDKSYKLGLNKFADLTNEEYRAMFLGTRTRGPKNKAAVVAKKTDRYAYRAGEELPA  110

Query  465  SIDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
             +DWREKGAVT +KDQG CGSCWAFST+ AV
Sbjct  111  MVDWREKGAVTPIKDQGQCGSCWAFSTVGAV  141



>gb|KHG18408.1| Cysteinease RD21a -like protein [Gossypium arboreum]
 gb|KHG29615.1| Cysteinease RD21a -like protein [Gossypium arboreum]
Length=367

 Score =   179 bits (454),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 84/133 (63%), Positives = 107/133 (80%), Gaps = 3/133 (2%)
 Frame = +3

Query  165  RSEDEVKEMFESWLVKHGKSYNAVDEKDKRFKIFRDNLKYIDEKNSLENRSYKLGLNRFA  344
            RS+DEV  ++++WL+KHGK YN + E++ RF IF+DNLK+ID+ NS +N +YKLGLN+FA
Sbjct  30   RSDDEVMSLYQAWLIKHGKQYNGIGEEENRFDIFKDNLKFIDQHNS-KNTTYKLGLNKFA  88

Query  345  DITNEEYRTGYLGAKRDASRNMVKSK--SDRYAPVAGDSLPDSIDWREKGAVTGVKDQGS  518
            D+TN+EYR+ +LG K D  R ++KSK  S RYA  AGD LP+S DWR+ GAVT VKDQG 
Sbjct  89   DLTNQEYRSMFLGTKSDPKRRVMKSKNPSQRYASRAGDRLPESFDWRDHGAVTPVKDQGR  148

Query  519  CGSCWAFSTIAAV  557
            CGSCWAFSTIAAV
Sbjct  149  CGSCWAFSTIAAV  161



>ref|XP_009398671.1| PREDICTED: oryzain alpha chain-like [Musa acuminata subsp. malaccensis]
Length=473

 Score =   181 bits (460),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 83/152 (55%), Positives = 115/152 (76%), Gaps = 4/152 (3%)
 Frame = +3

Query  114  DMSIITYDQQHPAKGLVRSEDEVKEMFESWLVKHGKSYNAVDEKDKRFKIFRDNLKYIDE  293
            DMSI++Y+++H  +GL RSEDE++ ++E WL +HG++YNA+ EK+ RF++F+DNL ++D 
Sbjct  26   DMSIVSYNEEHGVRGLERSEDEMRRIYEGWLARHGRAYNALGEKEARFEVFKDNLHFVDG  85

Query  294  KNSLEN---RSYKLGLNRFADITNEEYRTGYLGAKRDASRNMVKSKSDRYA-PVAGDSLP  461
             N+  +   + ++LGLNRFAD+TNEE+R  YLGAK        +  +DRY    AGD LP
Sbjct  86   HNAAADAGRQRFRLGLNRFADLTNEEFRALYLGAKGRGVARRSRVAADRYRYEGAGDVLP  145

Query  462  DSIDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            DS+DWR KGAV  VK+QGSCGSCWAFST+AAV
Sbjct  146  DSVDWRAKGAVAAVKNQGSCGSCWAFSTVAAV  177



>ref|XP_008350332.1| PREDICTED: LOW QUALITY PROTEIN: cysteine proteinase RD21a-like 
[Malus domestica]
Length=462

 Score =   181 bits (458),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 91/153 (59%), Positives = 117/153 (76%), Gaps = 9/153 (6%)
 Frame = +3

Query  114  DMSIITYDQQHPAKGLV----RSEDEVKEMFESWLVKHGKSYNAVDEKDKRFKIFRDNLK  281
            D+SII Y+ +H   G+     R+E E K ++ESWL+KHGK+YNA+ EK++RF+IF+DNL+
Sbjct  20   DVSIIDYNDKH---GMTTPSDRTEPEAKALYESWLIKHGKNYNALGEKERRFEIFKDNLR  76

Query  282  YIDEKNSLENRSYKLGLNRFADITNEEYRTGYLGAKRD-ASRNMVKSKSDRYAPVAGDSL  458
            +IDE N L++R+YK+GLNRFAD+TNEEYR+ YL AK D  SR     KSDRY   AG+ L
Sbjct  77   FIDEHN-LQSRTYKVGLNRFADLTNEEYRSVYLVAKVDRGSRLSGSRKSDRYPFRAGNEL  135

Query  459  PDSIDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            P+S+ WR KGAV  VKDQG CGSCWAFST+ AV
Sbjct  136  PESVHWRAKGAVATVKDQGQCGSCWAFSTVGAV  168



>ref|XP_009396268.1| PREDICTED: oryzain alpha chain-like [Musa acuminata subsp. malaccensis]
Length=473

 Score =   181 bits (458),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 82/152 (54%), Positives = 117/152 (77%), Gaps = 4/152 (3%)
 Frame = +3

Query  114  DMSIITYDQQHPAKGLVRSEDEVKEMFESWLVKHGKSYNAVDEKDKRFKIFRDNLKYIDE  293
            DMSII+YD++H  +GL RS++EV+ M+++W+  HG++YNA+ E+++RF++F+DNL+++D 
Sbjct  26   DMSIISYDEKHGVRGLERSDEEVRRMYDAWMAAHGRAYNALGERERRFEVFKDNLRFVDA  85

Query  294  KNSLEN---RSYKLGLNRFADITNEEYRTGYLGAKRD-ASRNMVKSKSDRYAPVAGDSLP  461
             N+      R ++LGLNRFAD+TNEEYR  YLG + + A+   V+  SDRY   A + L 
Sbjct  86   HNAAAGAGVRGFRLGLNRFADLTNEEYRAVYLGTRANRATARRVRVASDRYRYNASEELS  145

Query  462  DSIDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            + +DWRE+GAV  VKDQGSCGSCWAFSTIAAV
Sbjct  146  EFVDWREQGAVAAVKDQGSCGSCWAFSTIAAV  177



>ref|XP_009335017.1| PREDICTED: cysteine proteinase RD21a-like isoform X2 [Pyrus x 
bretschneideri]
Length=474

 Score =   181 bits (458),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 91/153 (59%), Positives = 117/153 (76%), Gaps = 7/153 (5%)
 Frame = +3

Query  114  DMSIITYDQQH--PAKGLVRSEDEVKEMFESWLVKHGKSYNAVDEKDKRFKIFRDNLKYI  287
            DMSI+ Y+++H  PA     +E EV+ ++ESWLVKH K+YNA+ EK++RF+IF+DNL++I
Sbjct  31   DMSIVDYNEKHGMPASS-DPTEPEVRALYESWLVKHAKNYNALGEKERRFEIFKDNLRFI  89

Query  288  DEKNSLENRSYKLGLNRFADITNEEYRTGYLGAKRDASRNMVKS---KSDRYAPVAGDSL  458
            DE N  ++R+YK+GLNRFAD+TNEEYR+ YLGAK D  R    S   KSDRYA   GD L
Sbjct  90   DEHNK-QSRTYKVGLNRFADLTNEEYRSVYLGAKVDRRRRSGLSGSRKSDRYAFRVGDKL  148

Query  459  PDSIDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            P+ +DWR +GAV  VKDQG CGSCWAFST+ AV
Sbjct  149  PELVDWRAEGAVPAVKDQGQCGSCWAFSTVGAV  181



>ref|XP_009335016.1| PREDICTED: cysteine proteinase RD21a-like isoform X1 [Pyrus x 
bretschneideri]
Length=474

 Score =   181 bits (458),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 91/153 (59%), Positives = 117/153 (76%), Gaps = 7/153 (5%)
 Frame = +3

Query  114  DMSIITYDQQH--PAKGLVRSEDEVKEMFESWLVKHGKSYNAVDEKDKRFKIFRDNLKYI  287
            DMSI+ Y+++H  PA     +E EV+ ++ESWLVKH K+YNA+ EK++RF+IF+DNL++I
Sbjct  31   DMSIVDYNEKHGMPASS-DPTETEVRALYESWLVKHAKNYNALGEKERRFEIFKDNLRFI  89

Query  288  DEKNSLENRSYKLGLNRFADITNEEYRTGYLGAKRDASRNMVKS---KSDRYAPVAGDSL  458
            DE N  ++R+YK+GLNRFAD+TNEEYR+ YLGAK D  R    S   KSDRYA   GD L
Sbjct  90   DEHNK-QSRTYKVGLNRFADLTNEEYRSVYLGAKVDRRRRSGLSGSRKSDRYAFRVGDKL  148

Query  459  PDSIDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            P+ +DWR +GAV  VKDQG CGSCWAFST+ AV
Sbjct  149  PELVDWRAEGAVPAVKDQGQCGSCWAFSTVGAV  181



>ref|XP_009358749.1| PREDICTED: cysteine proteinase RD21a-like [Pyrus x bretschneideri]
 ref|XP_009348984.1| PREDICTED: cysteine proteinase RD21a-like [Pyrus x bretschneideri]
Length=456

 Score =   180 bits (457),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 89/150 (59%), Positives = 114/150 (76%), Gaps = 3/150 (2%)
 Frame = +3

Query  114  DMSIITYDQQHPAKGLV-RSEDEVKEMFESWLVKHGKSYNAVDEKDKRFKIFRDNLKYID  290
            D+SII Y+ +H        +E E K ++ESWL+KHGK+YNA+ EK++RF+IF+DNL++ID
Sbjct  14   DLSIIDYNDKHGMTAPSDPTETEAKALYESWLIKHGKNYNALGEKERRFEIFKDNLRFID  73

Query  291  EKNSLENRSYKLGLNRFADITNEEYRTGYLGAKRD-ASRNMVKSKSDRYAPVAGDSLPDS  467
            E N +++R+ K+GLNRFAD+TNEEYR+ YLGAK D  SR     KSDRY   AGD LP+S
Sbjct  74   EHN-IQSRTSKVGLNRFADLTNEEYRSVYLGAKVDRGSRLSGSRKSDRYIFRAGDELPES  132

Query  468  IDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            +DWR KGAV  VKDQG CGSCWAFST+  V
Sbjct  133  VDWRAKGAVAAVKDQGQCGSCWAFSTVGTV  162



>dbj|BAD29954.1| cysteine protease [Daucus carota]
Length=474

 Score =   181 bits (458),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 92/179 (51%), Positives = 124/179 (69%), Gaps = 10/179 (6%)
 Frame = +3

Query  42   TMA-RPSILFTFLFavvsaaaaaaEDMSIITYDQQHPAKGL----VRSEDEVKEMFESWL  206
            TM+ RP  L  F         ++A DMSIITYD+ H   GL    +R+ D++  ++ESWL
Sbjct  8    TMSPRPQCLVLFFSLASFLMLSSASDMSIITYDETH---GLNSPPLRTHDQLLSLYESWL  64

Query  207  VKHGKSYNAVDEKDKRFKIFRDNLKYIDEKNSLENRSYKLGLNRFADITNEEYRTGYLGA  386
            VKH K+YNA+ EK+ RF IF+DN+ ++D  NS+ N+SYKLGLN+FAD+TN+EYR+ YL  
Sbjct  65   VKHHKNYNALGEKETRFGIFKDNVGFVDRHNSMRNQSYKLGLNKFADLTNDEYRSLYLSG  124

Query  387  K--RDASRNMVKSKSDRYAPVAGDSLPDSIDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            K  +   +N    +SDR+    GD LP+S+DWR++GAV  VKDQG CGSCWAFST+ AV
Sbjct  125  KMMKRERKNEDGFRSDRFVFEDGDHLPESVDWRDRGAVAPVKDQGQCGSCWAFSTVGAV  183



>gb|ABQ10198.1| actinidin Act4b [Actinidia eriantha]
Length=379

 Score =   178 bits (452),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 88/148 (59%), Positives = 112/148 (76%), Gaps = 7/148 (5%)
 Frame = +3

Query  114  DMSIITYDQQHPAKGLVRSEDEVKEMFESWLVKHGKSYNAVDEKDKRFKIFRDNLKYIDE  293
            D SIITY ++       R+ DEV  MFESWLV++GKSYNA+ EK++RF+IF+DNL+++DE
Sbjct  26   DASIITYAKKWEQ----RTNDEVMAMFESWLVEYGKSYNALGEKERRFEIFKDNLRFVDE  81

Query  294  KNSLENRSYKLGLNRFADITNEEYRTGYLGAKRDASRNMVKSKSDRYAPVAGDSLPDSID  473
             N+  NRSYK+GLN+F+D+T EEY + YLG K D     V   SDRY P  GD LP+SID
Sbjct  82   HNADVNRSYKVGLNQFSDLTLEEYSSIYLGTKFDMRMTNV---SDRYEPRVGDQLPNSID  138

Query  474  WREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            WR+KGAV GVK+QG+CGSCW F+ IAAV
Sbjct  139  WRKKGAVLGVKNQGNCGSCWTFAPIAAV  166



>gb|KEH44128.1| papain family cysteine protease [Medicago truncatula]
Length=473

 Score =   180 bits (456),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 86/149 (58%), Positives = 114/149 (77%), Gaps = 4/149 (3%)
 Frame = +3

Query  114  DMSIITYDQQHPAKGLVRSEDEVKEMFESWLVKHGKSYNAVDEKDKRFKIFRDNLKYIDE  293
            DMSII YD +  A    ++E+ + +++ESWL+KHGK YNA+ EK +RF+IF+DNL+YI+ 
Sbjct  27   DMSIIDYDAKLDA---AKNENHLMKLYESWLMKHGKVYNALGEKVRRFEIFKDNLRYIEN  83

Query  294  KNSLENRSYKLGLNRFADITNEEYRTGYLGAKRDASRNMVK-SKSDRYAPVAGDSLPDSI  470
             N+ EN S+KLGL +FAD+TNEEYR+ +LG +   S+ ++  SKSDRYA    D LP+ +
Sbjct  84   HNNFENHSFKLGLTKFADLTNEEYRSMFLGTRPRKSKGLLSASKSDRYAIRDNDELPEHV  143

Query  471  DWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            DWREKGAV  VKDQG CGSCWAFST+AAV
Sbjct  144  DWREKGAVNPVKDQGQCGSCWAFSTVAAV  172



>ref|XP_002283263.1| PREDICTED: cysteine proteinase COT44 [Vitis vinifera]
Length=374

 Score =   177 bits (450),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 84/133 (63%), Positives = 105/133 (79%), Gaps = 3/133 (2%)
 Frame = +3

Query  165  RSEDEVKEMFESWLVKHGKSYNAVDEKDKRFKIFRDNLKYIDEKNSLENRSYKLGLNRFA  344
            RSE+EV  M++ W+ KHGK+YN + EK+KRF+IF+DNLK+IDE N+ +NR+YK+GLNRFA
Sbjct  37   RSEEEVMGMYQWWMAKHGKAYNGLGEKEKRFEIFKDNLKFIDEHNA-QNRTYKVGLNRFA  95

Query  345  DITNEEYRTGYLGAKRDASRNMVKSK--SDRYAPVAGDSLPDSIDWREKGAVTGVKDQGS  518
            D+TNEEYR  YLG + D  R   K K  S RYA + G+ LP+S+DWRE GAV  VKDQ S
Sbjct  96   DLTNEEYRAIYLGTRSDPKRRFAKLKNASPRYAVMPGEVLPESVDWRETGAVNPVKDQRS  155

Query  519  CGSCWAFSTIAAV  557
            CGSCWAFST+AAV
Sbjct  156  CGSCWAFSTVAAV  168



>gb|KFK44641.1| hypothetical protein AALP_AA1G285100 [Arabis alpina]
Length=460

 Score =   179 bits (455),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 97/173 (56%), Positives = 124/173 (72%), Gaps = 9/173 (5%)
 Frame = +3

Query  45   MARPSILFTFLFavvsaaaaaaEDMSIITYDQQHPAKGLVRSEDEVKEMFESWLVKHGK-  221
            +  PSI+  FL  +  ++A    DMSII+YD+ H      R++ EV +++E+WLVKHGK 
Sbjct  3    LLNPSIVILFLAMIAFSSAI---DMSIISYDETHGLAVGGRTDAEVAKIYEAWLVKHGKK  59

Query  222  -SYNAVDEKDKRFKIFRDNLKYIDEKNSLENRSYKLGLNRFADITNEEYRTGYLGAKRDA  398
             S N++ EKD RF+IF+DNL++IDE NS +N SYKLGL RFAD+TNEEYR+ YLGAK   
Sbjct  60   MSENSLVEKDPRFEIFKDNLRFIDEHNS-KNLSYKLGLTRFADLTNEEYRSKYLGAKMMK  118

Query  399  SRNMVKSKSDRYAPVAGDSLPDSIDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
                 K  S RY    GDS+P+S+DWR++GAV  VKDQGSCGSCWAFSTI AV
Sbjct  119  KE---KRTSQRYEARVGDSIPESVDWRKEGAVAEVKDQGSCGSCWAFSTIGAV  168



>gb|AAC49455.1| Pseudotzain [Pseudotsuga menziesii]
Length=454

 Score =   179 bits (454),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 86/166 (52%), Positives = 116/166 (70%), Gaps = 5/166 (3%)
 Frame = +3

Query  60   ILFTFLFavvsaaaaaaEDMSIITYDQQHPAKGLVRSEDEVKEMFESWLVKHGKSYNAVD  239
            +LF  L     A +A+  D SII+YD Q      +  +D + E++E WL +H K+YN +D
Sbjct  5    LLFAVLALSAMAGSASRADFSIISYDSQD-----LIGDDAIMELYELWLAQHKKAYNGLD  59

Query  240  EKDKRFKIFRDNLKYIDEKNSLENRSYKLGLNRFADITNEEYRTGYLGAKRDASRNMVKS  419
            EK K+F +F+DN  YI + N+  N SYKLGLN+FAD+++EE++  YLG K DA + + +S
Sbjct  60   EKQKKFSVFKDNFLYIHQHNNQGNPSYKLGLNQFADLSHEEFKAAYLGTKLDAKKRLSRS  119

Query  420  KSDRYAPVAGDSLPDSIDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
             S RY    G+ LP+SIDWREKGAVT VK+QGSCGSCWAFST+AAV
Sbjct  120  PSPRYQYSVGEDLPESIDWREKGAVTAVKNQGSCGSCWAFSTVAAV  165



>gb|AHY28813.1| cysteine protease, partial [Pinus elliottii]
Length=182

 Score =   171 bits (434),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 85/166 (51%), Positives = 112/166 (67%), Gaps = 8/166 (5%)
 Frame = +3

Query  60   ILFTFLFavvsaaaaaaEDMSIITYDQQHPAKGLVRSEDEVKEMFESWLVKHGKSYNAVD  239
            + F  L     A +A+  D SII+          +R +D + E++E WL +H K+YN +D
Sbjct  5    LFFALLAMSAMAGSASRADFSIISNKD-------LREDDAIMELYELWLAEHKKAYNGLD  57

Query  240  EKDKRFKIFRDNLKYIDEKNSLENRSYKLGLNRFADITNEEYRTGYLGAKRDASRNMVKS  419
            EK KRF +F+DN  YI E N   NRSYKLGLN+FAD+++EE++  YLGAK D  + +++S
Sbjct  58   EKQKRFTVFKDNFLYIHEHNQ-GNRSYKLGLNQFADLSHEEFKATYLGAKLDTKKRLLRS  116

Query  420  KSDRYAPVAGDSLPDSIDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
             S RY    G+ LP SIDWREKGAV  VKDQG+CGSCWAFST+AAV
Sbjct  117  PSPRYQYSDGEDLPKSIDWREKGAVAPVKDQGACGSCWAFSTVAAV  162



>gb|ACB87490.1| mucunain [Mucuna pruriens]
Length=422

 Score =   178 bits (451),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 83/125 (66%), Positives = 104/125 (83%), Gaps = 3/125 (2%)
 Frame = +3

Query  189  MFESWLVKHGKSYNAVDEKDKRFKIFRDNLKYIDEKNSLENRSYKLGLNRFADITNEEYR  368
            ++E WLVKHGK+YNA+ EKDKRF IF+DNL++ID+ N+ +NR+YKLGLNRFAD+TNEEYR
Sbjct  3    LYEQWLVKHGKAYNALGEKDKRFDIFKDNLRFIDDHNA-DNRTYKLGLNRFADLTNEEYR  61

Query  369  TGYLGAKRDASRNMVKSK--SDRYAPVAGDSLPDSIDWREKGAVTGVKDQGSCGSCWAFS  542
              YLG + D +R  VK+K  S+RYAP  GD+LP+S+DWR + AV  VKDQG+CGSCWAFS
Sbjct  62   ARYLGTRIDPNRRFVKTKTQSNRYAPRVGDNLPESVDWRNESAVLPVKDQGNCGSCWAFS  121

Query  543  TIAAV  557
            TI AV
Sbjct  122  TIGAV  126



>gb|KHN27075.1| Cysteine proteinase RD21a [Glycine soja]
Length=368

 Score =   177 bits (448),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 81/132 (61%), Positives = 101/132 (77%), Gaps = 2/132 (2%)
 Frame = +3

Query  168  SEDEVKEMFESWLVKHGKSYNAVDEKDKRFKIFRDNLKYIDEKNSLENRSYKLGLNRFAD  347
            +++EV  M+E WLVKH K YN + EKDKRF++F+DNL +I E N+ +N +YKLGLN+FAD
Sbjct  32   TDNEVMTMYEEWLVKHQKVYNGLGEKDKRFQVFKDNLGFIQEHNNNQNNTYKLGLNKFAD  91

Query  348  ITNEEYRTGYLGAKRDASRNMVKSKS--DRYAPVAGDSLPDSIDWREKGAVTGVKDQGSC  521
            +TNEEYR  Y G K DA R ++K+KS   RYA  AGD LP  +DWR KGAV  +KDQGSC
Sbjct  92   MTNEEYRVMYFGTKSDAKRRLMKTKSTGHRYAYSAGDQLPVHVDWRVKGAVAPIKDQGSC  151

Query  522  GSCWAFSTIAAV  557
            GSCWAFST+A V
Sbjct  152  GSCWAFSTVATV  163



>emb|CAB17074.1| cysteine proteinase precursor [Phaseolus vulgaris]
Length=364

 Score =   176 bits (447),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 91/177 (51%), Positives = 123/177 (69%), Gaps = 22/177 (12%)
 Frame = +3

Query  36   LPTMARPSILF-TFLFavvsaaaaaaEDMSIITYDQQHPAKGLVRSEDEVKEMFESWLVK  212
            +P+M  P++L  +F F+  +A       MSII Y           SE+EV +M+E WLVK
Sbjct  1    MPSMLIPTLLLLSFTFSHATA-------MSIINY-----------SENEVMDMYEEWLVK  42

Query  213  HGKSYNAVDEKDKRFKIFRDNLKYIDEKNSLENRSYKLGLNRFADITNEEYRTGYLGAKR  392
            H K YN +DEK+KRF++F+DNL +I + N+ +N +Y LGLN+FADITNEEYR  YLG + 
Sbjct  43   HRKVYNGLDEKEKRFQVFKDNLGFIQDHNA-QNNTYTLGLNKFADITNEEYRAMYLGTRT  101

Query  393  DASRNMVKSKS--DRYAPVAGDSLPDSIDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            DA R ++K+++   RYA  +GD LP  +DWR KGAV  +KDQG+CGSCWAFST+AAV
Sbjct  102  DAKRRVMKTQNTGHRYAYNSGDQLPVHVDWRLKGAVGPIKDQGNCGSCWAFSTVAAV  158



>gb|AHY28814.1| cysteine protease, partial [Pinus palustris]
Length=194

 Score =   171 bits (434),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 85/166 (51%), Positives = 112/166 (67%), Gaps = 8/166 (5%)
 Frame = +3

Query  60   ILFTFLFavvsaaaaaaEDMSIITYDQQHPAKGLVRSEDEVKEMFESWLVKHGKSYNAVD  239
            + F  L     A +A+  D SII+          +R +D + E++E WL +H K+YN +D
Sbjct  5    LFFALLAMSAMAGSASRADFSIISNKD-------LREDDAIMELYELWLAEHKKAYNGLD  57

Query  240  EKDKRFKIFRDNLKYIDEKNSLENRSYKLGLNRFADITNEEYRTGYLGAKRDASRNMVKS  419
            EK KRF +F+DN  YI E N   NRSYKLGLN+FAD+++EE++  YLGAK D  + +++S
Sbjct  58   EKQKRFTVFKDNFLYIHEHNQ-GNRSYKLGLNQFADLSHEEFKATYLGAKLDTKKRLLRS  116

Query  420  KSDRYAPVAGDSLPDSIDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
             S RY    G+ LP SIDWREKGAV  VKDQG+CGSCWAFST+AAV
Sbjct  117  PSPRYQYSNGEDLPKSIDWREKGAVAPVKDQGACGSCWAFSTVAAV  162



>gb|AAL60579.1|AF454957_1 senescence-associated cysteine protease [Brassica oleracea]
Length=460

 Score =   178 bits (452),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 94/172 (55%), Positives = 122/172 (71%), Gaps = 9/172 (5%)
 Frame = +3

Query  57   SILFTFLFavvsaaaaaaEDMSIITYDQQHPAKGL-VRSEDEVKEMFESWLVKHGKSYNA  233
            S+  T L   +    + A DMSII+YD++H       RS+ EV  ++E+W+ KHGK   +
Sbjct  3    SVKVTILLLAMMIGVSYAADMSIISYDEKHHITAENERSDAEVARIYEAWMEKHGKKAQS  62

Query  234  ----VDEKDKRFKIFRDNLKYIDEKNSLENRSYKLGLNRFADITNEEYRTGYLGAKRDAS  401
                 +EKD+RF+IF+DNL++IDE N+ +N SYKLGL RFAD+TNEEYR+ YLGAK   S
Sbjct  63   NGLVGEEKDQRFEIFKDNLRFIDEHNN-KNLSYKLGLTRFADLTNEEYRSIYLGAK---S  118

Query  402  RNMVKSKSDRYAPVAGDSLPDSIDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            +  V   SDRY P  GD++PDS+DWR++GAV  VKDQGSCGSCWAFSTI AV
Sbjct  119  KKRVLKTSDRYQPRVGDAIPDSVDWRKEGAVAAVKDQGSCGSCWAFSTIGAV  170



>emb|CDX71540.1| BnaC04g17750D [Brassica napus]
Length=460

 Score =   178 bits (452),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 94/172 (55%), Positives = 122/172 (71%), Gaps = 9/172 (5%)
 Frame = +3

Query  57   SILFTFLFavvsaaaaaaEDMSIITYDQQHPAKGL-VRSEDEVKEMFESWLVKHGKSYNA  233
            S+  T L   +    + A DMSII+YD++H       RS+ EV  ++E+W+ KHGK   +
Sbjct  3    SVKVTILLLAMMIGVSYAADMSIISYDEKHHITAENERSDAEVARIYEAWMEKHGKKAQS  62

Query  234  ----VDEKDKRFKIFRDNLKYIDEKNSLENRSYKLGLNRFADITNEEYRTGYLGAKRDAS  401
                 +EKD+RF+IF+DNL++IDE N+ +N SYKLGL RFAD+TNEEYR+ YLGAK   S
Sbjct  63   NGLVGEEKDQRFEIFKDNLRFIDEHNN-KNLSYKLGLTRFADLTNEEYRSIYLGAK---S  118

Query  402  RNMVKSKSDRYAPVAGDSLPDSIDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            +  V   SDRY P  GD++PDS+DWR++GAV  VKDQGSCGSCWAFSTI AV
Sbjct  119  KKRVLKTSDRYQPRVGDAIPDSVDWRKEGAVAAVKDQGSCGSCWAFSTIGAV  170



>ref|XP_006595983.1| PREDICTED: cysteine proteinase RD21a-like [Glycine max]
Length=250

 Score =   173 bits (438),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 83/150 (55%), Positives = 110/150 (73%), Gaps = 3/150 (2%)
 Frame = +3

Query  114  DMSIITYDQQHPAKGLVRSEDEVKEMFESWLVKHGKSYNAVDEKDKRFKIFRDNLKYIDE  293
            DMSII++D  H  +   R++DEV  MFE WLVKH K YNA+ EK+KRF+IF++NL++IDE
Sbjct  19   DMSIISHDNAHADRATRRTDDEVMSMFEEWLVKHDKVYNALGEKEKRFQIFKNNLRFIDE  78

Query  294  KNSLENRSYKLGLNRFADITNEEYRTGYLGAKRDASR-NMVKSKSDRYAPVAGDSLPDSI  470
            +NSL NR+YKLGLN FAD+TN EYR  YL    D  R ++     + Y P  GD++P S+
Sbjct  79   RNSL-NRTYKLGLNVFADLTNAEYRAMYLRTWDDGPRLDLDTPPRNHYVPRVGDTIPKSV  137

Query  471  DWREKGAVTGVKDQG-SCGSCWAFSTIAAV  557
            DWR++GAVT VK+QG +C SCWAF+ + AV
Sbjct  138  DWRKEGAVTPVKNQGATCNSCWAFTAVGAV  167



>ref|XP_003550041.1| PREDICTED: cysteine proteinase RD21a-like [Glycine max]
Length=366

 Score =   176 bits (446),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 81/132 (61%), Positives = 101/132 (77%), Gaps = 2/132 (2%)
 Frame = +3

Query  168  SEDEVKEMFESWLVKHGKSYNAVDEKDKRFKIFRDNLKYIDEKNSLENRSYKLGLNRFAD  347
            +++EV  M+E WLVKH K YN + EKDKRF++F+DNL +I E N+ +N +YKLGLN+FAD
Sbjct  32   TDNEVMTMYEEWLVKHQKVYNGLGEKDKRFQVFKDNLGFIQEHNNNQNNTYKLGLNKFAD  91

Query  348  ITNEEYRTGYLGAKRDASRNMVKSKS--DRYAPVAGDSLPDSIDWREKGAVTGVKDQGSC  521
            +TNEEYR  Y G K DA R ++K+KS   RYA  AGD LP  +DWR KGAV  +KDQGSC
Sbjct  92   MTNEEYRVMYFGTKSDAKRRLMKTKSTGHRYAYSAGDQLPVHVDWRVKGAVAPIKDQGSC  151

Query  522  GSCWAFSTIAAV  557
            GSCWAFST+A V
Sbjct  152  GSCWAFSTVATV  163



>gb|AAW66796.1| cysteine protease, partial [Pinus taeda]
 gb|AAW66798.1| cysteine protease, partial [Pinus taeda]
 gb|AAW66800.1| cysteine protease, partial [Pinus taeda]
 gb|AAW66810.1| cysteine protease, partial [Pinus taeda]
 gb|AAW66816.1| cysteine protease, partial [Pinus taeda]
 gb|AAW66819.1| cysteine protease, partial [Pinus taeda]
 gb|AAW66823.1| cysteine protease, partial [Pinus taeda]
 gb|AAW66825.1| cysteine protease, partial [Pinus taeda]
Length=193

 Score =   171 bits (433),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 85/166 (51%), Positives = 112/166 (67%), Gaps = 8/166 (5%)
 Frame = +3

Query  60   ILFTFLFavvsaaaaaaEDMSIITYDQQHPAKGLVRSEDEVKEMFESWLVKHGKSYNAVD  239
            + F  L     A +A+  D SII+          +R +D + E++E WL +H K+YN +D
Sbjct  5    LFFALLAMSAMAGSASRADFSIISNKD-------LREDDAIMELYELWLAEHKKAYNGLD  57

Query  240  EKDKRFKIFRDNLKYIDEKNSLENRSYKLGLNRFADITNEEYRTGYLGAKRDASRNMVKS  419
            EK KRF +F+DN  YI E N   NRSYKLGLN+FAD+++EE++  YLGAK D  + +++S
Sbjct  58   EKQKRFTVFKDNFLYIHEHNQ-GNRSYKLGLNQFADLSHEEFKATYLGAKLDTKKRLLRS  116

Query  420  KSDRYAPVAGDSLPDSIDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
             S RY    G+ LP SIDWREKGAV  VKDQG+CGSCWAFST+AAV
Sbjct  117  PSPRYQYSDGEDLPKSIDWREKGAVAPVKDQGACGSCWAFSTVAAV  162



>ref|XP_011008779.1| PREDICTED: cysteine proteinase COT44 [Populus euphratica]
Length=368

 Score =   176 bits (446),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 86/152 (57%), Positives = 117/152 (77%), Gaps = 5/152 (3%)
 Frame = +3

Query  114  DMSIITYD--QQHPAKGLVRSEDEVKEMFESWLVKHGKSYNAVDEKDKRFKIFRDNLKYI  287
            DMSI+T +  Q +  +   RS+DEV  M++ WL KHGK++N + E+ +RF+IF++NL++I
Sbjct  20   DMSILTSNDNQLNHDRSSWRSDDEVMSMYKWWLAKHGKTHNRLGEEAERFEIFKNNLRFI  79

Query  288  DEKNSLENRSYKLGLNRFADITNEEYRTGYLGAKRDASRNMVKSKS--DRYAPVAGDSLP  461
            DE NS +N +YK+GL +FAD+TNEEYR  +LG + DA R ++KSKS  +RYA   GD LP
Sbjct  80   DEHNS-QNHTYKVGLTKFADLTNEEYRAMFLGTRSDAKRRLMKSKSPSERYAFKPGDKLP  138

Query  462  DSIDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            +S+DWR KGAV  +KDQGSCGSCWAFST+AAV
Sbjct  139  ESVDWRAKGAVNPIKDQGSCGSCWAFSTVAAV  170



>ref|XP_010028205.1| PREDICTED: cysteine proteinase COT44-like [Eucalyptus grandis]
 gb|KCW54899.1| hypothetical protein EUGRSUZ_I00879 [Eucalyptus grandis]
Length=364

 Score =   176 bits (446),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 81/133 (61%), Positives = 104/133 (78%), Gaps = 3/133 (2%)
 Frame = +3

Query  165  RSEDEVKEMFESWLVKHGKSYNAVDEKDKRFKIFRDNLKYIDEKNSLENRSYKLGLNRFA  344
            R+++EV  M+E WL KHGK+YN + E+++RF+IFRDNL+++DE N+L NRSY LG+NRFA
Sbjct  25   RTDEEVMGMYELWLAKHGKAYNGLGERERRFEIFRDNLRFVDEHNAL-NRSYTLGMNRFA  83

Query  345  DITNEEYRTGYLGAKRDASRNMVKSK--SDRYAPVAGDSLPDSIDWREKGAVTGVKDQGS  518
            D+TNEEYR  YLG + D  R + K+   S RYAP   D LP ++DWR +GAV  VKDQG+
Sbjct  84   DLTNEEYRAVYLGTRSDPVRRVAKAARASGRYAPRPDDMLPAAVDWRTRGAVNKVKDQGA  143

Query  519  CGSCWAFSTIAAV  557
            CGSCWAFSTIAAV
Sbjct  144  CGSCWAFSTIAAV  156



>ref|XP_006403303.1| hypothetical protein EUTSA_v10003205mg [Eutrema salsugineum]
 gb|ESQ44756.1| hypothetical protein EUTSA_v10003205mg [Eutrema salsugineum]
Length=457

 Score =   178 bits (451),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 93/165 (56%), Positives = 118/165 (72%), Gaps = 6/165 (4%)
 Frame = +3

Query  69   TFLFavvsaaaaaaEDMSIITYDQQHPAKGL-VRSEDEVKEMFESWLVKHGK-SYNAVDE  242
            T L        + A DMSII+YD++H    +  RSE EV +++E W+ KHGK + N +  
Sbjct  7    TILLLATMIGVSFAVDMSIISYDEKHHISAVNGRSEAEVAKIYEEWMAKHGKKTQNGLLG  66

Query  243  KDKRFKIFRDNLKYIDEKNSLENRSYKLGLNRFADITNEEYRTGYLGAKRDASRNMVKSK  422
            +D RF+IF+DNL++IDE N+ +N SYKLGL RFAD+TN+EYR+ YLGAK   S   V   
Sbjct  67   EDHRFEIFKDNLRFIDEHNT-KNLSYKLGLTRFADLTNDEYRSIYLGAKPKKS---VLKT  122

Query  423  SDRYAPVAGDSLPDSIDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            SDRY P  GD+LPDS+DWR++GAV  VKDQGSCGSCWAFSTI AV
Sbjct  123  SDRYLPRVGDALPDSVDWRKEGAVAAVKDQGSCGSCWAFSTIGAV  167



>gb|KEH31479.1| papain family cysteine protease [Medicago truncatula]
Length=359

 Score =   175 bits (444),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 84/135 (62%), Positives = 103/135 (76%), Gaps = 4/135 (3%)
 Frame = +3

Query  162  VRSEDEVKEMFESWLVKHGKSYNAVDEKDKRFKIFRDNLKYIDEKNSLENRSYKLGLNRF  341
            +RS +EV  M+E WLVKH K YN + EKD+RF+IF+DNL +IDE N+ +N +YK+GLN+F
Sbjct  25   MRSNEEVMTMYEEWLVKHHKVYNGLGEKDQRFEIFKDNLGFIDEHNA-QNYTYKVGLNKF  83

Query  342  ADITNEEYRTGYLGAKRDASRNMVKSK---SDRYAPVAGDSLPDSIDWREKGAVTGVKDQ  512
            AD+TNEEYR  YLG K DA RN++K K     RYA  +GD LP  +DWR KGAV  +KDQ
Sbjct  84   ADMTNEEYRNMYLGTKNDAKRNVMKIKITTGHRYAFNSGDRLPVHVDWRSKGAVAHIKDQ  143

Query  513  GSCGSCWAFSTIAAV  557
            GSCGSCWAFSTIA V
Sbjct  144  GSCGSCWAFSTIATV  158



>gb|KHN30007.1| Cysteine proteinase RD21a [Glycine soja]
Length=366

 Score =   176 bits (445),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 81/132 (61%), Positives = 101/132 (77%), Gaps = 2/132 (2%)
 Frame = +3

Query  168  SEDEVKEMFESWLVKHGKSYNAVDEKDKRFKIFRDNLKYIDEKNSLENRSYKLGLNRFAD  347
            +++EV  M+E WLVKH K YN + EKDKRF++F+DNL +I E N+ +N +YKLGLN+FAD
Sbjct  32   TDNEVMTMYEEWLVKHQKVYNGLREKDKRFQVFKDNLGFIQEHNNNQNNTYKLGLNQFAD  91

Query  348  ITNEEYRTGYLGAKRDASRNMVKSKS--DRYAPVAGDSLPDSIDWREKGAVTGVKDQGSC  521
            +TNEEYR  Y G K DA R ++K+KS   RYA  AGD LP  +DWR KGAV  +KDQGSC
Sbjct  92   MTNEEYRVMYFGTKSDAKRRLMKTKSTGHRYAYSAGDQLPVHVDWRVKGAVAPIKDQGSC  151

Query  522  GSCWAFSTIAAV  557
            GSCWAFST+A V
Sbjct  152  GSCWAFSTVATV  163



>gb|AFO83613.1| papain-like cysteine protease [Fagopyrum esculentum]
Length=362

 Score =   175 bits (444),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 81/133 (61%), Positives = 105/133 (79%), Gaps = 2/133 (2%)
 Frame = +3

Query  165  RSEDEVKEMFESWLVKHGKSYNAVDEKDKRFKIFRDNLKYIDEKNSLENRSYKLGLNRFA  344
            RSE+E + +++ WL KH KSYNA+ E +KRF+IF+DNLK+IDE NS+  ++YKLGLN+FA
Sbjct  26   RSEEESRGLYQLWLAKHRKSYNAIGENEKRFEIFKDNLKFIDEHNSVSGQTYKLGLNKFA  85

Query  345  DITNEEYRTGYLGAKRDASRNMVKSK--SDRYAPVAGDSLPDSIDWREKGAVTGVKDQGS  518
            D+TNEEYR+ YLGA+ D  + ++K+K  S RYA V G+ LP ++DWR  GAV  VKDQG 
Sbjct  86   DLTNEEYRSKYLGARFDPEKLVLKAKNASPRYAHVHGEKLPKAVDWRTNGAVNHVKDQGQ  145

Query  519  CGSCWAFSTIAAV  557
            CGSCWAFSTIA V
Sbjct  146  CGSCWAFSTIATV  158



>gb|AAL14614.1|AF417109_1 cysteine proteinase precursor [Vasconcellea cundinamarcensis]
Length=179

 Score =   170 bits (430),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 83/130 (64%), Positives = 102/130 (78%), Gaps = 3/130 (2%)
 Frame = +3

Query  114  DMSIITYDQQHPAKGLVRSEDEVKEMFESWLVKHGKSYNAVDEKDKRFKIFRDNLKYIDE  293
            DMSI++YDQ+H  K   R++DEV  M+E+WLVKHGK YNA+ EK+KRF IF+DNL++IDE
Sbjct  51   DMSIVSYDQKHADKSSWRTDDEVMAMYEAWLVKHGKVYNALGEKEKRFDIFKDNLRFIDE  110

Query  294  KNSLENRSYKLGLNRFADITNEEYRTGYLGAKRDASR--NMVKSKSDRYAPVAGDSLPDS  467
             NS +N +Y+LGLNRFAD+TNEEYR+ YLG K  A+R    V  KS RYAP  GD+LPDS
Sbjct  111  HNS-QNLTYRLGLNRFADLTNEEYRSTYLGVKPGATRAARKVSGKSHRYAPRDGDALPDS  169

Query  468  IDWREKGAVT  497
             DWR KGAVT
Sbjct  170  FDWRTKGAVT  179



>ref|XP_010548429.1| PREDICTED: germination-specific cysteine protease 1 [Tarenaya 
hassleriana]
Length=376

 Score =   175 bits (444),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 81/141 (57%), Positives = 111/141 (79%), Gaps = 4/141 (3%)
 Frame = +3

Query  147  PAKGLVRSEDEVKEMFESWLVKHGKSYNAVDEKDKRFKIFRDNLKYIDEKNSLENR--SY  320
            P+ G  R+E+EV+ M+  W  KHGK+YN +DE+++RF IF+DNL +IDE N  +N   +Y
Sbjct  35   PSDGHRRTEEEVRSMYILWSAKHGKTYNGIDEQERRFNIFKDNLGFIDEHNHNKNTNATY  94

Query  321  KLGLNRFADITNEEYRTGYLGAKRDASRNMVKSK--SDRYAPVAGDSLPDSIDWREKGAV  494
            KLGL +FAD+TNEEYR+ YLG K +++R + K+K  S RYA V G+ LP+++DWR++GAV
Sbjct  95   KLGLTKFADLTNEEYRSLYLGMKSESARRVAKAKNVSRRYAAVNGEMLPETVDWRQRGAV  154

Query  495  TGVKDQGSCGSCWAFSTIAAV  557
            + VKDQG+CGSCWAFSTIAAV
Sbjct  155  SPVKDQGTCGSCWAFSTIAAV  175



>ref|XP_006422960.1| hypothetical protein CICLE_v10028338mg [Citrus clementina]
 gb|ESR36200.1| hypothetical protein CICLE_v10028338mg [Citrus clementina]
Length=479

 Score =   177 bits (450),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 90/171 (53%), Positives = 118/171 (69%), Gaps = 11/171 (6%)
 Frame = +3

Query  60   ILFTFLFavvsaaaaaaEDMSIITYDQQHPAKGLVRSEDEVKEMFESWLVKHGKSYNAVD  239
             L  FLF    A      DMSII Y++ H   G   SE  ++ M+E WLVKHGK+YNA+ 
Sbjct  14   CLCFFLFTSTFAL-----DMSIIDYNRMHGNGGGNMSESHMRMMYEHWLVKHGKNYNALG  68

Query  240  EKDKRFKIFRDNLKYIDEKNSLENRSYKLGLNRFADITNEEYRTGYLGAKRDASR-----  404
            EK++RF+IF+DNLK+++E N++  R+YK+GLN+FAD+TN+E+R  YLGAK +  +     
Sbjct  69   EKERRFEIFKDNLKFVNEHNAVA-RTYKVGLNKFADLTNDEFRNMYLGAKMERKKALRAG  127

Query  405  NMVKSKSDRYAPVAGDSLPDSIDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            N     SDRY    GD+LP+S+DWR KGAV  VKDQG CGSCWAFST+ AV
Sbjct  128  NGNAKSSDRYVYKHGDALPESVDWRAKGAVGPVKDQGQCGSCWAFSTVGAV  178



>ref|XP_003547817.1| PREDICTED: cysteine proteinase RD21a [Glycine max]
Length=366

 Score =   175 bits (443),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 81/132 (61%), Positives = 101/132 (77%), Gaps = 2/132 (2%)
 Frame = +3

Query  168  SEDEVKEMFESWLVKHGKSYNAVDEKDKRFKIFRDNLKYIDEKNSLENRSYKLGLNRFAD  347
            +++EV  M+E WLVKH K YN + EKDKRF++F+DNL +I E N+ +N +YKLGLN+FAD
Sbjct  32   TDNEVMTMYEEWLVKHQKVYNGLREKDKRFQVFKDNLGFIQEHNNNQNNTYKLGLNQFAD  91

Query  348  ITNEEYRTGYLGAKRDASRNMVKSKS--DRYAPVAGDSLPDSIDWREKGAVTGVKDQGSC  521
            +TNEEYR  Y G K DA R ++K+KS   RYA  AGD LP  +DWR KGAV  +KDQGSC
Sbjct  92   MTNEEYRVMYFGTKSDAKRRLMKTKSTGHRYAYSAGDRLPVHVDWRVKGAVAPIKDQGSC  151

Query  522  GSCWAFSTIAAV  557
            GSCWAFST+A V
Sbjct  152  GSCWAFSTVATV  163



>gb|AAB68374.1| cysteine endopeptidase 1 [Phaseolus vulgaris]
 emb|CAA12118.1| cysteine protease [Phaseolus vulgaris]
Length=364

 Score =   174 bits (442),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 90/177 (51%), Positives = 123/177 (69%), Gaps = 22/177 (12%)
 Frame = +3

Query  36   LPTMARPSILF-TFLFavvsaaaaaaEDMSIITYDQQHPAKGLVRSEDEVKEMFESWLVK  212
            +P+M  P++L  +F F+  +A       MSII Y           SE+EV +M+E WLVK
Sbjct  1    MPSMLIPTLLLLSFTFSHATA-------MSIINY-----------SENEVMDMYEEWLVK  42

Query  213  HGKSYNAVDEKDKRFKIFRDNLKYIDEKNSLENRSYKLGLNRFADITNEEYRTGYLGAKR  392
            H K YN +DEK+KRF++F+DNL +I + N+ +N +Y LGLN+FADITN+EYR  YLG + 
Sbjct  43   HRKVYNGLDEKEKRFQVFKDNLGFIQDHNA-QNNTYTLGLNKFADITNKEYRAMYLGTRT  101

Query  393  DASRNMVKSKS--DRYAPVAGDSLPDSIDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            DA R ++K+++   RYA  +GD LP  +DWR KGAV  +KDQG+CGSCWAFST+AAV
Sbjct  102  DAKRRVMKTQNTGHRYAYNSGDQLPVHVDWRLKGAVGPIKDQGNCGSCWAFSTVAAV  158



>gb|ACU18172.1| unknown [Glycine max]
Length=355

 Score =   174 bits (442),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 84/150 (56%), Positives = 111/150 (74%), Gaps = 3/150 (2%)
 Frame = +3

Query  114  DMSIITYDQQHPAKGLVRSEDEVKEMFESWLVKHGKSYNAVDEKDKRFKIFRDNLKYIDE  293
            DMSII++D  H  +   R++DEV  MFE WLVKH K YNA+ EK+KRF+IF++NL++IDE
Sbjct  19   DMSIISHDNAHADRATRRTDDEVMSMFEEWLVKHDKVYNALGEKEKRFQIFKNNLRFIDE  78

Query  294  KNSLENRSYKLGLNRFADITNEEYRTGYLGAKRDASR-NMVKSKSDRYAPVAGDSLPDSI  470
            +NSL NR+YKLGLN FAD+TN EYR  YL    D  R ++     +RY P  GD++P S+
Sbjct  79   RNSL-NRTYKLGLNVFADLTNAEYRAMYLRTWDDGPRLDLDTPPRNRYVPRVGDTIPKSV  137

Query  471  DWREKGAVTGVKDQG-SCGSCWAFSTIAAV  557
            DWR++GAVT VK+QG +C SCWAF+ + AV
Sbjct  138  DWRKEGAVTPVKNQGATCNSCWAFTAVGAV  167



>emb|CDY22370.1| BnaA06g36920D [Brassica napus]
Length=460

 Score =   177 bits (448),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 93/172 (54%), Positives = 121/172 (70%), Gaps = 9/172 (5%)
 Frame = +3

Query  57   SILFTFLFavvsaaaaaaEDMSIITYDQQHPAKG-LVRSEDEVKEMFESWLVKHGKSYNA  233
            S+  T L   +    + A DMSII+YD++H       RS+ EV  ++E+W+ KHGK   +
Sbjct  3    SVKVTILLLAMMIGVSYAADMSIISYDEKHHITADNERSDAEVARIYEAWMEKHGKKAQS  62

Query  234  ----VDEKDKRFKIFRDNLKYIDEKNSLENRSYKLGLNRFADITNEEYRTGYLGAKRDAS  401
                 +EKD+RF+IF+DNL++IDE N+ +N SYKLGL RFAD+TNEEYR+ YLGAK    
Sbjct  63   NGLVGEEKDQRFEIFKDNLRFIDEHNN-KNLSYKLGLTRFADLTNEEYRSIYLGAK---P  118

Query  402  RNMVKSKSDRYAPVAGDSLPDSIDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            +  V   SDRY P  GD++PDS+DWR++GAV  VKDQGSCGSCWAFSTI AV
Sbjct  119  KKRVLKTSDRYQPRVGDAIPDSVDWRKEGAVAAVKDQGSCGSCWAFSTIGAV  170



>gb|AIF75887.1| cysteine protease, partial [Pinus massoniana]
 gb|AIF75888.1| cysteine protease, partial [Pinus massoniana]
 gb|AIF75889.1| cysteine protease, partial [Pinus massoniana]
 gb|AIF75891.1| cysteine protease, partial [Pinus hwangshanensis]
 gb|AIF75892.1| cysteine protease, partial [Pinus hwangshanensis]
 gb|AIF75893.1| cysteine protease, partial [Pinus hwangshanensis]
 gb|AIF75894.1| cysteine protease, partial [Pinus hwangshanensis]
 gb|AIF75895.1| cysteine protease, partial [Pinus hwangshanensis]
Length=188

 Score =   169 bits (429),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 77/132 (58%), Positives = 99/132 (75%), Gaps = 1/132 (1%)
 Frame = +3

Query  162  VRSEDEVKEMFESWLVKHGKSYNAVDEKDKRFKIFRDNLKYIDEKNSLENRSYKLGLNRF  341
            +R +D + E++E WL +H K+YN +DEK KRF +F+DN  YI E N   NRSYKLGLN+F
Sbjct  32   LREDDAIMELYELWLAEHKKAYNGLDEKQKRFTVFKDNFLYIHEHNQ-GNRSYKLGLNQF  90

Query  342  ADITNEEYRTGYLGAKRDASRNMVKSKSDRYAPVAGDSLPDSIDWREKGAVTGVKDQGSC  521
            AD+++EE++  YLGAK D  + +++S S RY    G+ LP SIDWREKGAV  VKDQG C
Sbjct  91   ADLSHEEFKATYLGAKLDTKKRLLRSPSPRYQYSDGEDLPKSIDWREKGAVAPVKDQGQC  150

Query  522  GSCWAFSTIAAV  557
            GSCWAFST+AAV
Sbjct  151  GSCWAFSTVAAV  162



>gb|AIF75886.1| cysteine protease, partial [Pinus massoniana]
Length=188

 Score =   169 bits (429),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 77/132 (58%), Positives = 99/132 (75%), Gaps = 1/132 (1%)
 Frame = +3

Query  162  VRSEDEVKEMFESWLVKHGKSYNAVDEKDKRFKIFRDNLKYIDEKNSLENRSYKLGLNRF  341
            +R +D + E++E WL +H K+YN +DEK KRF +F+DN  YI E N   NRSYKLGLN+F
Sbjct  32   LREDDAIMELYELWLAEHKKAYNGLDEKQKRFTVFKDNFLYIHEHNQ-GNRSYKLGLNQF  90

Query  342  ADITNEEYRTGYLGAKRDASRNMVKSKSDRYAPVAGDSLPDSIDWREKGAVTGVKDQGSC  521
            AD+++EE++  YLGAK D  + +++S S RY    G+ LP SIDWREKGAV  VKDQG C
Sbjct  91   ADLSHEEFKATYLGAKLDTKKRLLRSPSPRYQYSDGEDLPKSIDWREKGAVAPVKDQGQC  150

Query  522  GSCWAFSTIAAV  557
            GSCWAFST+AAV
Sbjct  151  GSCWAFSTVAAV  162



>gb|AFK47737.1| unknown [Medicago truncatula]
Length=359

 Score =   174 bits (442),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 84/135 (62%), Positives = 102/135 (76%), Gaps = 4/135 (3%)
 Frame = +3

Query  162  VRSEDEVKEMFESWLVKHGKSYNAVDEKDKRFKIFRDNLKYIDEKNSLENRSYKLGLNRF  341
            +RS +EV  M+E WLVKH K YN + EKD+RF+IF+DNL +IDE N+ +N +YK+GLN+F
Sbjct  25   MRSNEEVMTMYEEWLVKHHKVYNGLGEKDQRFEIFKDNLGFIDEHNA-QNYTYKVGLNKF  83

Query  342  ADITNEEYRTGYLGAKRDASRNMVKSK---SDRYAPVAGDSLPDSIDWREKGAVTGVKDQ  512
            AD TNEEYR  YLG K DA RN++K K     RYA  +GD LP  +DWR KGAV  +KDQ
Sbjct  84   ADTTNEEYRNMYLGTKNDAKRNVMKIKITTGHRYAFNSGDRLPVHVDWRSKGAVAHIKDQ  143

Query  513  GSCGSCWAFSTIAAV  557
            GSCGSCWAFSTIA V
Sbjct  144  GSCGSCWAFSTIATV  158



>gb|ABZ69059.1| cysteine protease [Pinus radiata]
 gb|ABZ69060.1| cysteine protease [Pinus radiata]
Length=185

 Score =   169 bits (428),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 77/132 (58%), Positives = 100/132 (76%), Gaps = 1/132 (1%)
 Frame = +3

Query  162  VRSEDEVKEMFESWLVKHGKSYNAVDEKDKRFKIFRDNLKYIDEKNSLENRSYKLGLNRF  341
            +R +D + E++E WL +H K+YN +DEK KRF +F+DN  YI E N   NRSYKLGLN+F
Sbjct  32   LREDDAIMELYELWLAEHKKAYNGLDEKQKRFTVFKDNFLYIHEHNQ-GNRSYKLGLNQF  90

Query  342  ADITNEEYRTGYLGAKRDASRNMVKSKSDRYAPVAGDSLPDSIDWREKGAVTGVKDQGSC  521
            AD+++EE++  YLGAK D  + +++S S RY    G+ LP SIDWREKGAV  VKDQG+C
Sbjct  91   ADLSHEEFKATYLGAKLDTKKRLLRSPSPRYQYSDGEDLPKSIDWREKGAVAPVKDQGAC  150

Query  522  GSCWAFSTIAAV  557
            GSCWAFST+AAV
Sbjct  151  GSCWAFSTVAAV  162



>ref|XP_009101816.1| PREDICTED: cysteine proteinase RD21a [Brassica rapa]
Length=460

 Score =   177 bits (448),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 93/172 (54%), Positives = 121/172 (70%), Gaps = 9/172 (5%)
 Frame = +3

Query  57   SILFTFLFavvsaaaaaaEDMSIITYDQQHPAKG-LVRSEDEVKEMFESWLVKHGKSYNA  233
            S+  T L   +    + A DMSII+YD++H       RS+ EV  ++E+W+ KHGK   +
Sbjct  3    SVKVTILLLAMMIGVSYAADMSIISYDEKHHITADNERSDAEVARIYEAWMEKHGKKAQS  62

Query  234  ----VDEKDKRFKIFRDNLKYIDEKNSLENRSYKLGLNRFADITNEEYRTGYLGAKRDAS  401
                 +EKD+RF+IF+DNL++IDE N+ +N SYKLGL RFAD+TNEEYR+ YLGAK    
Sbjct  63   NGLVGEEKDQRFEIFKDNLRFIDEHNN-KNLSYKLGLTRFADLTNEEYRSIYLGAK---P  118

Query  402  RNMVKSKSDRYAPVAGDSLPDSIDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            +  V   SDRY P  GD++PDS+DWR++GAV  VKDQGSCGSCWAFSTI AV
Sbjct  119  KKRVLKTSDRYQPRVGDAIPDSVDWRKEGAVAAVKDQGSCGSCWAFSTIGAV  170



>gb|AAW66804.1| cysteine protease, partial [Pinus taeda]
 gb|AAW66805.1| cysteine protease, partial [Pinus taeda]
 gb|AAW66817.1| cysteine protease, partial [Pinus taeda]
 gb|AAW66818.1| cysteine protease, partial [Pinus taeda]
 gb|AAW66820.1| cysteine protease, partial [Pinus taeda]
Length=193

 Score =   169 bits (429),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 84/166 (51%), Positives = 112/166 (67%), Gaps = 8/166 (5%)
 Frame = +3

Query  60   ILFTFLFavvsaaaaaaEDMSIITYDQQHPAKGLVRSEDEVKEMFESWLVKHGKSYNAVD  239
            + F  L     A +A+  D SII+          +R +D + E++E W+ +H K+YN +D
Sbjct  5    LFFALLAMSAMAGSASRADFSIISNKD-------LREDDAIMELYELWVAEHKKAYNGLD  57

Query  240  EKDKRFKIFRDNLKYIDEKNSLENRSYKLGLNRFADITNEEYRTGYLGAKRDASRNMVKS  419
            EK KRF +F+DN  YI E N   NRSYKLGLN+FAD+++EE++  YLGAK D  + +++S
Sbjct  58   EKQKRFTVFKDNFLYIHEHNQ-GNRSYKLGLNQFADLSHEEFKATYLGAKLDTKKRLLRS  116

Query  420  KSDRYAPVAGDSLPDSIDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
             S RY    G+ LP SIDWREKGAV  VKDQG+CGSCWAFST+AAV
Sbjct  117  PSPRYQYSDGEDLPKSIDWREKGAVAPVKDQGACGSCWAFSTVAAV  162



>gb|AAW66801.1| cysteine protease, partial [Pinus taeda]
Length=193

 Score =   169 bits (428),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 77/132 (58%), Positives = 100/132 (76%), Gaps = 1/132 (1%)
 Frame = +3

Query  162  VRSEDEVKEMFESWLVKHGKSYNAVDEKDKRFKIFRDNLKYIDEKNSLENRSYKLGLNRF  341
            +R +D + E++E WL +H K+YN +DEK KRF +F+DN  YI E N   NRSYKLGLN+F
Sbjct  32   LREDDAIMELYELWLAEHKKAYNGLDEKQKRFTVFKDNFLYIHEHNQ-GNRSYKLGLNQF  90

Query  342  ADITNEEYRTGYLGAKRDASRNMVKSKSDRYAPVAGDSLPDSIDWREKGAVTGVKDQGSC  521
            AD+++EE++  YLGAK D  + +++S S RY    G+ LP SIDWREKGAV  VKDQG+C
Sbjct  91   ADLSHEEFKATYLGAKLDTKKRLLRSPSPRYQYSDGEDLPKSIDWREKGAVVPVKDQGAC  150

Query  522  GSCWAFSTIAAV  557
            GSCWAFST+AAV
Sbjct  151  GSCWAFSTVAAV  162



>gb|AAW66794.1| cysteine protease, partial [Pinus taeda]
 gb|AAW66795.1| cysteine protease, partial [Pinus taeda]
 gb|AAW66802.1| cysteine protease, partial [Pinus taeda]
 gb|AAW66803.1| cysteine protease, partial [Pinus taeda]
 gb|AAW66806.1| cysteine protease, partial [Pinus taeda]
 gb|AAW66807.1| cysteine protease, partial [Pinus taeda]
 gb|AAW66808.1| cysteine protease, partial [Pinus taeda]
 gb|AAW66811.1| cysteine protease, partial [Pinus taeda]
 gb|AAW66812.1| cysteine protease, partial [Pinus taeda]
 gb|AAW66813.1| cysteine protease, partial [Pinus taeda]
 gb|AAW66814.1| cysteine protease, partial [Pinus taeda]
 gb|AAW66822.1| cysteine protease, partial [Pinus taeda]
Length=193

 Score =   169 bits (428),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 77/132 (58%), Positives = 100/132 (76%), Gaps = 1/132 (1%)
 Frame = +3

Query  162  VRSEDEVKEMFESWLVKHGKSYNAVDEKDKRFKIFRDNLKYIDEKNSLENRSYKLGLNRF  341
            +R +D + E++E WL +H K+YN +DEK KRF +F+DN  YI E N   NRSYKLGLN+F
Sbjct  32   LREDDAIMELYELWLAEHKKAYNGLDEKQKRFTVFKDNFLYIHEHNQ-GNRSYKLGLNQF  90

Query  342  ADITNEEYRTGYLGAKRDASRNMVKSKSDRYAPVAGDSLPDSIDWREKGAVTGVKDQGSC  521
            AD+++EE++  YLGAK D  + +++S S RY    G+ LP SIDWREKGAV  VKDQG+C
Sbjct  91   ADLSHEEFKATYLGAKLDTKKRLLRSPSPRYQYSDGEDLPKSIDWREKGAVAPVKDQGAC  150

Query  522  GSCWAFSTIAAV  557
            GSCWAFST+AAV
Sbjct  151  GSCWAFSTVAAV  162



>emb|CAA53377.1| cysteine protease [Vicia sativa]
Length=368

 Score =   174 bits (441),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 94/177 (53%), Positives = 117/177 (66%), Gaps = 22/177 (12%)
 Frame = +3

Query  45   MARPSILFTFLFavvsaaaaaaEDMSIITY----DQQHPAKGLVRSEDEVKEMFESWLVK  212
            MA  +IL  FLF             S+IT+    D Q P     RS DEV  M+E WLVK
Sbjct  1    MASMTILPFFLF------------FSLITFSLALDIQLPTG---RSNDEVMTMYEEWLVK  45

Query  213  HGKSYNAVDEKDKRFKIFRDNLKYIDEKNSLENRSYKLGLNRFADITNEEYRTGYLGAKR  392
            H K YN + EKD+RF+IF+DNL +IDE N+ +N +Y +GLN+FAD+TNEEYR  YLG + 
Sbjct  46   HQKVYNGLREKDQRFQIFKDNLNFIDEHNA-QNYTYIVGLNKFADMTNEEYRDMYLGTRS  104

Query  393  DASRNMVKSK--SDRYAPVAGDSLPDSIDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            D  R ++K+K    RYA  +GD LP  +DWR KGA+T +KDQGSCGSCWAFSTIA V
Sbjct  105  DIKRRIMKNKITGHRYAYNSGDRLPVHVDWRLKGAITHIKDQGSCGSCWAFSTIATV  161



>ref|XP_004141903.1| PREDICTED: germination-specific cysteine protease 1-like [Cucumis 
sativus]
 ref|XP_004172852.1| PREDICTED: germination-specific cysteine protease 1-like [Cucumis 
sativus]
 gb|KGN48548.1| hypothetical protein Csa_6G491600 [Cucumis sativus]
Length=365

 Score =   174 bits (441),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 82/133 (62%), Positives = 108/133 (81%), Gaps = 3/133 (2%)
 Frame = +3

Query  165  RSEDEVKEMFESWLVKHGKSYNAVDEKDKRFKIFRDNLKYIDEKNSLENRSYKLGLNRFA  344
            RS+ EV+E+++ WL KHGK+YN +DE++KRF+IF++NLK+ID+ NS ENR+YK+GLN FA
Sbjct  26   RSDGEVREIYDLWLAKHGKAYNGIDEREKRFQIFKENLKFIDDHNS-ENRTYKVGLNMFA  84

Query  345  DITNEEYRTGYLGAKRDASRNMVKSK--SDRYAPVAGDSLPDSIDWREKGAVTGVKDQGS  518
            D+TNEEYR  YLG +   +R ++K+K  S RYA    D LP+S+DWR +GAV  VK+QGS
Sbjct  85   DLTNEEYRALYLGTRSPPARRVMKAKTASRRYAVNNLDRLPESMDWRTRGAVAPVKNQGS  144

Query  519  CGSCWAFSTIAAV  557
            CGSCWAFSTIAAV
Sbjct  145  CGSCWAFSTIAAV  157



>dbj|BAD95392.1| cysteine proteinase RD21A [Arabidopsis thaliana]
Length=433

 Score =   176 bits (445),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 101/179 (56%), Positives = 126/179 (70%), Gaps = 14/179 (8%)
 Frame = +3

Query  30   LLLPTMARPSILFTFLFavvsaaaaaaEDMSIITYDQQHPAKGLV-RSEDEVKEMFESWL  206
             L PTMA   ILF  + AV SA      DMSII+YD++H       RSE EV  ++E+WL
Sbjct  3    FLKPTMA---ILFLAMVAVSSAV-----DMSIISYDEKHGVSTTGGRSEAEVMSIYEAWL  54

Query  207  VKHGK--SYNAVDEKDKRFKIFRDNLKYIDEKNSLENRSYKLGLNRFADITNEEYRTGYL  380
            VKHGK  S N++ EKD+RF+IF+DNL+++DE N  +N SY+LGL RFAD+TN+EYR+ YL
Sbjct  55   VKHGKAQSQNSLVEKDRRFEIFKDNLRFVDEHNE-KNLSYRLGLTRFADLTNDEYRSKYL  113

Query  381  GAKRDASRNMVKSKSDRYAPVAGDSLPDSIDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            GAK +  +   +  S RY    GD LP+SIDWR+KGAV  VKDQG CGSCWAFSTI AV
Sbjct  114  GAKME--KKGERRTSLRYEARVGDELPESIDWRKKGAVAEVKDQGGCGSCWAFSTIGAV  170



>ref|XP_006487026.1| PREDICTED: cysteine proteinase RD21a-like [Citrus sinensis]
Length=472

 Score =   176 bits (447),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 89/171 (52%), Positives = 118/171 (69%), Gaps = 11/171 (6%)
 Frame = +3

Query  60   ILFTFLFavvsaaaaaaEDMSIITYDQQHPAKGLVRSEDEVKEMFESWLVKHGKSYNAVD  239
             L  FLF    A      DMSII Y++ H   G   SE  ++ M+E WLVKHGK+YNA+ 
Sbjct  7    CLCFFLFTSTFAL-----DMSIIDYNRMHGNGGGNMSESHMRMMYEHWLVKHGKNYNALG  61

Query  240  EKDKRFKIFRDNLKYIDEKNSLENRSYKLGLNRFADITNEEYRTGYLGAKRDASR-----  404
            E+++RF+IF+DNLK+++E N++  R+YK+GLN+FAD+TN+E+R  YLGAK +  +     
Sbjct  62   EQERRFEIFKDNLKFVNEHNAVA-RTYKVGLNKFADLTNDEFRNMYLGAKMERKKALRAG  120

Query  405  NMVKSKSDRYAPVAGDSLPDSIDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            N     SDRY    GD+LP+S+DWR KGAV  VKDQG CGSCWAFST+ AV
Sbjct  121  NGNAKSSDRYVYKHGDALPESVDWRAKGAVGPVKDQGQCGSCWAFSTVGAV  171



>ref|XP_008238897.1| PREDICTED: cysteine proteinase COT44 [Prunus mume]
Length=366

 Score =   174 bits (440),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 78/133 (59%), Positives = 109/133 (82%), Gaps = 3/133 (2%)
 Frame = +3

Query  165  RSEDEVKEMFESWLVKHGKSYNAVDEKDKRFKIFRDNLKYIDEKNSLENRSYKLGLNRFA  344
            RSE EVK++++ WLVKH K+YN + E+D+RF+IF+DNL++IDE N+ ++R YK+GLN FA
Sbjct  29   RSEAEVKQIYQEWLVKHQKTYNGIGEEDRRFEIFKDNLRFIDEHNA-QDRPYKVGLNAFA  87

Query  345  DITNEEYRTGYLGAKRDASRNMVKSK--SDRYAPVAGDSLPDSIDWREKGAVTGVKDQGS  518
            D+TN+EYR  +LG + D  R ++K+K  S RYA  AG++LP+S+DWR KGAV  +K+QG+
Sbjct  88   DLTNQEYRAKFLGTRSDPKRRLMKAKNPSQRYAFRAGEALPESVDWRVKGAVNPIKNQGN  147

Query  519  CGSCWAFSTIAAV  557
            CGSCWAFST+AAV
Sbjct  148  CGSCWAFSTVAAV  160



>gb|KDO59789.1| hypothetical protein CISIN_1g012022mg [Citrus sinensis]
Length=472

 Score =   176 bits (447),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 89/171 (52%), Positives = 118/171 (69%), Gaps = 11/171 (6%)
 Frame = +3

Query  60   ILFTFLFavvsaaaaaaEDMSIITYDQQHPAKGLVRSEDEVKEMFESWLVKHGKSYNAVD  239
             L  FLF    A      DMSII Y++ H   G   SE  ++ M+E WLVKHGK+YNA+ 
Sbjct  7    CLCFFLFTSTFAL-----DMSIIDYNRMHGNGGGNMSESHMRMMYEHWLVKHGKNYNALG  61

Query  240  EKDKRFKIFRDNLKYIDEKNSLENRSYKLGLNRFADITNEEYRTGYLGAKRDASR-----  404
            E+++RF+IF+DNLK+++E N++  R+YK+GLN+FAD+TN+E+R  YLGAK +  +     
Sbjct  62   EQERRFEIFKDNLKFVNEHNAVA-RTYKVGLNKFADLTNDEFRNMYLGAKMERKKALRAG  120

Query  405  NMVKSKSDRYAPVAGDSLPDSIDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            N     SDRY    GD+LP+S+DWR KGAV  VKDQG CGSCWAFST+ AV
Sbjct  121  NGNAKSSDRYVYKHGDALPESVDWRAKGAVGPVKDQGQCGSCWAFSTVGAV  171



>ref|XP_009367558.1| PREDICTED: cysteine proteinase COT44-like [Pyrus x bretschneideri]
Length=366

 Score =   174 bits (440),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 86/167 (51%), Positives = 117/167 (70%), Gaps = 17/167 (10%)
 Frame = +3

Query  63   LFTFLFavvsaaaaaaEDMSIITYDQQHPAKGLVRSEDEVKEMFESWLVKHGKSYNAVDE  242
            +FT LF                T  Q  P  G  RSE +V+ +++ WLVKH K+YN + E
Sbjct  9    MFTILFLS-------------FTLSQASPIVG-SRSEADVRAIYQEWLVKHQKTYNGIGE  54

Query  243  KDKRFKIFRDNLKYIDEKNSLENRSYKLGLNRFADITNEEYRTGYLGAKRDASRNMVKSK  422
            +++RF+IF+DNLK+IDE N+L+ R YK+GLN FAD+TN+EYR  +LG + D  R ++K+K
Sbjct  55   EERRFEIFKDNLKFIDEHNALD-RPYKVGLNAFADLTNQEYRAKFLGTRSDPKRRVMKAK  113

Query  423  --SDRYAPVAGDSLPDSIDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
              S RYA  AG++LP+S+DWR KGAV  +K+QGSCGSCWAFST+AAV
Sbjct  114  NPSLRYAFRAGETLPESVDWRVKGAVNPIKNQGSCGSCWAFSTVAAV  160



>gb|AAW66797.1| cysteine protease, partial [Pinus taeda]
Length=192

 Score =   168 bits (426),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 77/132 (58%), Positives = 100/132 (76%), Gaps = 1/132 (1%)
 Frame = +3

Query  162  VRSEDEVKEMFESWLVKHGKSYNAVDEKDKRFKIFRDNLKYIDEKNSLENRSYKLGLNRF  341
            +R +D + E++E WL +H K+YN +DEK KRF +F+DN  YI E N   NRSYKLGLN+F
Sbjct  31   LREDDAIMELYELWLAEHKKAYNGLDEKQKRFTVFKDNFLYIHEHNQ-GNRSYKLGLNQF  89

Query  342  ADITNEEYRTGYLGAKRDASRNMVKSKSDRYAPVAGDSLPDSIDWREKGAVTGVKDQGSC  521
            AD+++EE++  YLGAK D  + +++S S RY    G+ LP SIDWREKGAV  VKDQG+C
Sbjct  90   ADLSHEEFKATYLGAKLDTKKRLLRSPSPRYQYSDGEDLPKSIDWREKGAVAPVKDQGAC  149

Query  522  GSCWAFSTIAAV  557
            GSCWAFST+AAV
Sbjct  150  GSCWAFSTVAAV  161



>ref|NP_564497.1| cysteine proteinase RD21a [Arabidopsis thaliana]
 sp|P43297.1|RD21A_ARATH RecName: Full=Cysteine proteinase RD21a; Short=RD21; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAG50628.1|AC083835_13 cysteine protease, putative [Arabidopsis thaliana]
 dbj|BAA02374.1| thiol protease [Arabidopsis thaliana]
 gb|AAL59952.1| putative cysteine proteinase RD21A [Arabidopsis thaliana]
 gb|AAM91715.1| putative cysteine proteinase RD21A [Arabidopsis thaliana]
 gb|AEE32135.1| cysteine proteinase RD21a [Arabidopsis thaliana]
Length=462

 Score =   176 bits (445),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 101/179 (56%), Positives = 126/179 (70%), Gaps = 14/179 (8%)
 Frame = +3

Query  30   LLLPTMARPSILFTFLFavvsaaaaaaEDMSIITYDQQHPAKGLV-RSEDEVKEMFESWL  206
             L PTMA   ILF  + AV SA      DMSII+YD++H       RSE EV  ++E+WL
Sbjct  3    FLKPTMA---ILFLAMVAVSSAV-----DMSIISYDEKHGVSTTGGRSEAEVMSIYEAWL  54

Query  207  VKHGK--SYNAVDEKDKRFKIFRDNLKYIDEKNSLENRSYKLGLNRFADITNEEYRTGYL  380
            VKHGK  S N++ EKD+RF+IF+DNL+++DE N  +N SY+LGL RFAD+TN+EYR+ YL
Sbjct  55   VKHGKAQSQNSLVEKDRRFEIFKDNLRFVDEHNE-KNLSYRLGLTRFADLTNDEYRSKYL  113

Query  381  GAKRDASRNMVKSKSDRYAPVAGDSLPDSIDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            GAK +  +   +  S RY    GD LP+SIDWR+KGAV  VKDQG CGSCWAFSTI AV
Sbjct  114  GAKME--KKGERRTSLRYEARVGDELPESIDWRKKGAVAEVKDQGGCGSCWAFSTIGAV  170



>gb|AAK62661.1| F2G19.31/F2G19.31 [Arabidopsis thaliana]
 gb|AAL87383.1| F2G19.31/F2G19.31 [Arabidopsis thaliana]
Length=462

 Score =   176 bits (445),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 100/179 (56%), Positives = 125/179 (70%), Gaps = 14/179 (8%)
 Frame = +3

Query  30   LLLPTMARPSILFTFLFavvsaaaaaaEDMSIITYDQQHPAKGLV-RSEDEVKEMFESWL  206
             L PTMA   ILF  +  V SA      DMSII+YD++H       RSE EV  ++E+WL
Sbjct  3    FLKPTMA---ILFLAMVTVSSAV-----DMSIISYDEKHGVSTTGGRSEAEVMSIYEAWL  54

Query  207  VKHGK--SYNAVDEKDKRFKIFRDNLKYIDEKNSLENRSYKLGLNRFADITNEEYRTGYL  380
            VKHGK  S N++ EKD+RF+IF+DNL+++DE N  +N SY+LGL RFAD+TN+EYR+ YL
Sbjct  55   VKHGKAQSQNSLVEKDRRFEIFKDNLRFVDEHNE-KNLSYRLGLTRFADLTNDEYRSKYL  113

Query  381  GAKRDASRNMVKSKSDRYAPVAGDSLPDSIDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            GAK +  +   +  S RY    GD LP+SIDWR+KGAV  VKDQG CGSCWAFSTI AV
Sbjct  114  GAKME--KKGERRTSLRYEARVGDELPESIDWRKKGAVAEVKDQGGCGSCWAFSTIGAV  170



>gb|ABK24233.1| unknown [Picea sitchensis]
Length=463

 Score =   175 bits (444),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 86/166 (52%), Positives = 113/166 (68%), Gaps = 5/166 (3%)
 Frame = +3

Query  60   ILFTFLFavvsaaaaaaEDMSIITYDQQHPAKGLVRSEDEVKEMFESWLVKHGKSYNAVD  239
            +LF  L     A +A+  D SII YD +      +R +D + E++E WL +H K+YN + 
Sbjct  5    LLFAVLALSAMAGSASRADFSIIGYDSKD-----LREDDAIMELYELWLAQHKKAYNGLG  59

Query  240  EKDKRFKIFRDNLKYIDEKNSLENRSYKLGLNRFADITNEEYRTGYLGAKRDASRNMVKS  419
            EK  RF +F+DN  YI + N+  N SYKLGLN+FAD+++EE++  YLGAK D  + +  S
Sbjct  60   EKQNRFSVFKDNFLYIHQHNNQGNPSYKLGLNQFADLSHEEFKATYLGAKLDTKKRLSNS  119

Query  420  KSDRYAPVAGDSLPDSIDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
             S RY    G+ LP+SIDWREKGAVT VKDQGSCGSCWAFST+AAV
Sbjct  120  PSPRYQYSDGEDLPESIDWREKGAVTAVKDQGSCGSCWAFSTVAAV  165



>gb|ABS83496.1| cysteine protease [Pinus pinaster]
Length=187

 Score =   168 bits (425),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 77/132 (58%), Positives = 99/132 (75%), Gaps = 1/132 (1%)
 Frame = +3

Query  162  VRSEDEVKEMFESWLVKHGKSYNAVDEKDKRFKIFRDNLKYIDEKNSLENRSYKLGLNRF  341
            +R +D + E++E WL +H K+YN +DEK KRF +F+DN  YI E N   NRSYKLGLN+F
Sbjct  32   LREDDAIMELYELWLAEHKKAYNGLDEKQKRFTVFKDNFLYIHEHNQ-GNRSYKLGLNKF  90

Query  342  ADITNEEYRTGYLGAKRDASRNMVKSKSDRYAPVAGDSLPDSIDWREKGAVTGVKDQGSC  521
            AD+++EE++  YLGAK D  + +++S S RY    G+ LP SIDWR KGAV  VKDQGSC
Sbjct  91   ADLSHEEFKATYLGAKLDTKKRLLRSPSPRYQYSDGEDLPKSIDWRVKGAVAPVKDQGSC  150

Query  522  GSCWAFSTIAAV  557
            GSCWAFST+AAV
Sbjct  151  GSCWAFSTVAAV  162



>gb|ABZ69061.1| cysteine protease [Pinus sylvestris]
Length=214

 Score =   169 bits (427),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 77/132 (58%), Positives = 99/132 (75%), Gaps = 1/132 (1%)
 Frame = +3

Query  162  VRSEDEVKEMFESWLVKHGKSYNAVDEKDKRFKIFRDNLKYIDEKNSLENRSYKLGLNRF  341
            +R +D + E++E WL +H K+YN +DEK KRF +F+DN  YI E N   NRSYKLGLN+F
Sbjct  32   LREDDAIMELYELWLAEHKKAYNGLDEKQKRFTVFKDNFLYIHEHNQ-GNRSYKLGLNQF  90

Query  342  ADITNEEYRTGYLGAKRDASRNMVKSKSDRYAPVAGDSLPDSIDWREKGAVTGVKDQGSC  521
            AD+++EE++  YLGAK D  + +++S S RY    G+ LP SIDWREKGAV  VKDQG C
Sbjct  91   ADLSHEEFKATYLGAKLDTKKRLLRSPSPRYQYSDGEDLPKSIDWREKGAVAPVKDQGQC  150

Query  522  GSCWAFSTIAAV  557
            GSCWAFST+AAV
Sbjct  151  GSCWAFSTVAAV  162



>ref|XP_010494270.1| PREDICTED: cysteine proteinase RD21a-like [Camelina sativa]
Length=467

 Score =   175 bits (444),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 93/157 (59%), Positives = 121/157 (77%), Gaps = 13/157 (8%)
 Frame = +3

Query  114  DMSIITYDQQHPAKGLV----RSEDEVKEMFESWLVKHGK----SYNAVD-EKDKRFKIF  266
            DMSII+YD++H          RS+ EV+ ++++WLV+HGK      N +  EKD+RF+IF
Sbjct  23   DMSIISYDEKHHITTTTTVTSRSDAEVERIYDAWLVEHGKKKMNQKNVLGAEKDQRFEIF  82

Query  267  RDNLKYIDEKNSLENRSYKLGLNRFADITNEEYRTGYLGAKRDASRNMVKSKSDRYAPVA  446
            +DNL++IDE N+ +N SYKLGLNRFAD+TN+EYR+ YLGAK   S+ ++K+ SDRYA   
Sbjct  83   KDNLRFIDEHNT-KNLSYKLGLNRFADLTNQEYRSMYLGAK--PSKRVLKT-SDRYAARV  138

Query  447  GDSLPDSIDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            GDSLPDS+DWR++GAV  VKDQGSCGSCWAFSTI AV
Sbjct  139  GDSLPDSVDWRKEGAVADVKDQGSCGSCWAFSTIGAV  175



>gb|AIF75890.1| cysteine protease, partial [Pinus massoniana]
Length=188

 Score =   167 bits (424),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 76/132 (58%), Positives = 99/132 (75%), Gaps = 1/132 (1%)
 Frame = +3

Query  162  VRSEDEVKEMFESWLVKHGKSYNAVDEKDKRFKIFRDNLKYIDEKNSLENRSYKLGLNRF  341
            +R +D + E++E WL +H K+YN +D+K KRF +F+DN  YI E N   NRSYKLGLN+F
Sbjct  32   LREDDAIMELYELWLAEHKKAYNGLDKKQKRFTVFKDNFLYIHEHNQ-GNRSYKLGLNQF  90

Query  342  ADITNEEYRTGYLGAKRDASRNMVKSKSDRYAPVAGDSLPDSIDWREKGAVTGVKDQGSC  521
            AD+++EE++  YLGAK D  + +++S S RY    G+ LP SIDWREKGAV  VKDQG C
Sbjct  91   ADLSHEEFKATYLGAKLDTKKRLLRSPSPRYQYSDGEDLPKSIDWREKGAVAPVKDQGQC  150

Query  522  GSCWAFSTIAAV  557
            GSCWAFST+AAV
Sbjct  151  GSCWAFSTVAAV  162



>gb|AAW66799.1| cysteine protease, partial [Pinus taeda]
 gb|AAW66809.1| cysteine protease, partial [Pinus taeda]
 gb|AAW66815.1| cysteine protease, partial [Pinus taeda]
 gb|AAW66821.1| cysteine protease, partial [Pinus taeda]
 gb|AAW66824.1| cysteine protease, partial [Pinus taeda]
 gb|ABZ69062.1| cysteine protease [Pinus taeda]
Length=193

 Score =   167 bits (424),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 76/132 (58%), Positives = 100/132 (76%), Gaps = 1/132 (1%)
 Frame = +3

Query  162  VRSEDEVKEMFESWLVKHGKSYNAVDEKDKRFKIFRDNLKYIDEKNSLENRSYKLGLNRF  341
            +R +D + E++E WL +H K+YN +DEK KRF +F+DN  YI E N   N+SYKLGLN+F
Sbjct  32   LREDDAIMELYELWLAEHKKAYNGLDEKQKRFTVFKDNFLYIHEHNQ-GNQSYKLGLNQF  90

Query  342  ADITNEEYRTGYLGAKRDASRNMVKSKSDRYAPVAGDSLPDSIDWREKGAVTGVKDQGSC  521
            AD+++EE++  YLGAK D  + +++S S RY    G+ LP SIDWREKGAV  VKDQG+C
Sbjct  91   ADLSHEEFKATYLGAKLDTKKRLLRSPSPRYQYSDGEDLPKSIDWREKGAVAPVKDQGAC  150

Query  522  GSCWAFSTIAAV  557
            GSCWAFST+AAV
Sbjct  151  GSCWAFSTVAAV  162



>ref|XP_007205396.1| hypothetical protein PRUPE_ppa007467mg [Prunus persica]
 gb|EMJ06595.1| hypothetical protein PRUPE_ppa007467mg [Prunus persica]
Length=366

 Score =   172 bits (437),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 78/133 (59%), Positives = 108/133 (81%), Gaps = 3/133 (2%)
 Frame = +3

Query  165  RSEDEVKEMFESWLVKHGKSYNAVDEKDKRFKIFRDNLKYIDEKNSLENRSYKLGLNRFA  344
            RSE EVK++++ WLVKH K+YN + E+D+RF+IF+DNL++IDE NS ++R YK+GLN FA
Sbjct  29   RSEAEVKQIYQEWLVKHQKTYNGIGEEDRRFEIFKDNLRFIDEHNS-QDRPYKVGLNAFA  87

Query  345  DITNEEYRTGYLGAKRDASRNMVKSK--SDRYAPVAGDSLPDSIDWREKGAVTGVKDQGS  518
            D+TN+EYR  +LG + D  R ++K+K  S RYA   G++LP+S+DWR KGAV  +K+QG+
Sbjct  88   DLTNQEYRAKFLGTRSDPKRRVMKAKNSSQRYAFRVGEALPESVDWRVKGAVNPIKNQGN  147

Query  519  CGSCWAFSTIAAV  557
            CGSCWAFST+AAV
Sbjct  148  CGSCWAFSTVAAV  160



>gb|KHN22490.1| Cysteine proteinase RD21a [Glycine soja]
Length=355

 Score =   172 bits (436),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 83/150 (55%), Positives = 110/150 (73%), Gaps = 3/150 (2%)
 Frame = +3

Query  114  DMSIITYDQQHPAKGLVRSEDEVKEMFESWLVKHGKSYNAVDEKDKRFKIFRDNLKYIDE  293
            DMSII++D  H  +   R++DEV  MFE WLVKH K YNA+ EK+KRF+IF++NL++IDE
Sbjct  19   DMSIISHDNAHADRATRRTDDEVMSMFEEWLVKHDKVYNALGEKEKRFQIFKNNLRFIDE  78

Query  294  KNSLENRSYKLGLNRFADITNEEYRTGYLGAKRDASR-NMVKSKSDRYAPVAGDSLPDSI  470
            +NSL NR+YKLGLN FAD+TN EYR  YL    D  R ++     + Y P  GD++P S+
Sbjct  79   RNSL-NRTYKLGLNVFADLTNAEYRAMYLRTWDDGPRLDLDTPPRNHYVPRVGDTIPKSV  137

Query  471  DWREKGAVTGVKDQG-SCGSCWAFSTIAAV  557
            DWR++GAVT VK+QG +C SCWAF+ + AV
Sbjct  138  DWRKEGAVTPVKNQGATCNSCWAFTAVGAV  167



>ref|XP_004496965.1| PREDICTED: cysteine proteinase RD21a-like isoform X1 [Cicer arietinum]
Length=472

 Score =   175 bits (443),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 85/171 (50%), Positives = 122/171 (71%), Gaps = 5/171 (3%)
 Frame = +3

Query  51   RPSILFTFLFavvsaaaaaaEDMSIITYDQQHPAKGLVRSEDEVKEMFESWLVKHGKSYN  230
            R  +   F+ ++   + + + DMSII YD +  A    +++  + +++ESWL+KHGK YN
Sbjct  6    RSHLSLAFILSLSFLSLSFSLDMSIIDYDAKLEA---AKTDIHLMKIYESWLLKHGKVYN  62

Query  231  AVDEKDKRFKIFRDNLKYIDEKNSLENRSYKLGLNRFADITNEEYRTGYLGAKRDASRNM  410
            A+ EK+ RF+IF+DNL++I   N++EN+S+KLGL +FAD+TNEEYR+ +LG +   S+ +
Sbjct  63   ALGEKEHRFEIFKDNLQFIQNHNNMENQSFKLGLTKFADLTNEEYRSMFLGTRSRNSKGL  122

Query  411  VKS--KSDRYAPVAGDSLPDSIDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            +    KS+RYA    D LP S+DWREKGAVT VKDQG CGSCWAFST+ AV
Sbjct  123  LSGSKKSNRYAFHDTDELPGSVDWREKGAVTPVKDQGQCGSCWAFSTVGAV  173



>dbj|BAH20463.1| cysteine protease [Spinacia oleracea]
Length=473

 Score =   175 bits (443),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 88/157 (56%), Positives = 116/157 (74%), Gaps = 11/157 (7%)
 Frame = +3

Query  114  DMSIITYDQQH---PAKGLVRSEDEVKEMFESWLVKHGKSYNAVDEKDKRFKIFRDNLKY  284
            DMSII+YD  H   P+    RS+DEV  ++ESWLV+H K+YNA+ EK+KRF IF+DNL++
Sbjct  26   DMSIISYDHNHNLLPSSS--RSDDEVMRIYESWLVQHRKNYNALGEKEKRFAIFKDNLEF  83

Query  285  IDEKNSLENRSYKLGLNRFADITNEEYRTGYLG------AKRDASRNMVKSKSDRYAPVA  446
            ID+ NS +++++K+GLN+FAD+TNEE+R+ YLG      +    S    K KSDRY    
Sbjct  84   IDQHNSDDSQTFKVGLNKFADLTNEEFRSVYLGRKKSSSSSPLLSSAKSKVKSDRYLFKE  143

Query  447  GDSLPDSIDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            GD LP+++DWR+ GAV  VKDQG CGSCWAFSTIAAV
Sbjct  144  GDELPEAVDWRKNGAVAKVKDQGQCGSCWAFSTIAAV  180



>ref|XP_004496966.1| PREDICTED: cysteine proteinase RD21a-like isoform X2 [Cicer arietinum]
Length=474

 Score =   175 bits (443),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 85/171 (50%), Positives = 122/171 (71%), Gaps = 5/171 (3%)
 Frame = +3

Query  51   RPSILFTFLFavvsaaaaaaEDMSIITYDQQHPAKGLVRSEDEVKEMFESWLVKHGKSYN  230
            R  +   F+ ++   + + + DMSII YD +  A    +++  + +++ESWL+KHGK YN
Sbjct  6    RSHLSLAFILSLSFLSLSFSLDMSIIDYDAKLEA---AKTDIHLMKIYESWLLKHGKVYN  62

Query  231  AVDEKDKRFKIFRDNLKYIDEKNSLENRSYKLGLNRFADITNEEYRTGYLGAKRDASRNM  410
            A+ EK+ RF+IF+DNL++I   N++EN+S+KLGL +FAD+TNEEYR+ +LG +   S+ +
Sbjct  63   ALGEKEHRFEIFKDNLQFIQNHNNMENQSFKLGLTKFADLTNEEYRSMFLGTRSRNSKGL  122

Query  411  VKS--KSDRYAPVAGDSLPDSIDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            +    KS+RYA    D LP S+DWREKGAVT VKDQG CGSCWAFST+ AV
Sbjct  123  LSGSKKSNRYAFHDTDELPGSVDWREKGAVTPVKDQGQCGSCWAFSTVGAV  173



>ref|XP_010093524.1| Germination-specific cysteine protease 1 [Morus notabilis]
 gb|EXB54190.1| Germination-specific cysteine protease 1 [Morus notabilis]
Length=361

 Score =   172 bits (436),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 78/149 (52%), Positives = 110/149 (74%), Gaps = 2/149 (1%)
 Frame = +3

Query  117  MSIITYDQQHPAKGLVRSEDEVKEMFESWLVKHGKSYNAVDEKDKRFKIFRDNLKYIDEK  296
            M I+ +    P     RS+ EV+EM+  W+  HG+++N + E++ RF+IF+DNL+++DE 
Sbjct  7    MIILCFALSLPPLTSGRSDAEVREMYVKWMATHGRAHNGLGEEETRFEIFKDNLRFVDEH  66

Query  297  NSLENRSYKLGLNRFADITNEEYRTGYLGAKRDASRNMVKSKSD--RYAPVAGDSLPDSI  470
            N+++ R+YK+G+NRFAD+TNEEYR   LG + DA R ++K+KS   RYA  A D LP+++
Sbjct  67   NAVQKRTYKVGMNRFADMTNEEYRREMLGTRSDAKRIVMKAKSPSRRYASRAADQLPETV  126

Query  471  DWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            DW+  GAV  VKDQGSCGSCWAFSTIAAV
Sbjct  127  DWKLNGAVNPVKDQGSCGSCWAFSTIAAV  155



>ref|XP_006280322.1| hypothetical protein CARUB_v10026245mg, partial [Capsella rubella]
 gb|EOA13220.1| hypothetical protein CARUB_v10026245mg, partial [Capsella rubella]
Length=511

 Score =   175 bits (444),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 89/159 (56%), Positives = 117/159 (74%), Gaps = 13/159 (8%)
 Frame = +3

Query  114  DMSIITYDQQHPAKGLV-----RSEDEVKEMFESWLVKHGKSYNAV------DEKDKRFK  260
            DMSII+YD+ H           RS+ EV+ +++SWLV+HGK    +      D+  +RF+
Sbjct  63   DMSIISYDKNHHITTTTTTVTSRSDAEVERIYDSWLVEHGKKKEKMNGLLGSDKDQERFE  122

Query  261  IFRDNLKYIDEKNSLENRSYKLGLNRFADITNEEYRTGYLGAKRDASRNMVKSKSDRYAP  440
            IF+DNL++IDE N+ +N SYKLGLNRFAD+TNEEYR+ YLGAK   ++ ++K  SDRY  
Sbjct  123  IFKDNLRFIDEHNNKKNLSYKLGLNRFADLTNEEYRSMYLGAK--PNKRVLKKTSDRYEA  180

Query  441  VAGDSLPDSIDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
              GD+LPDS+DWR++GAV+ VKDQGSCGSCWAFSTI AV
Sbjct  181  RVGDALPDSVDWRKEGAVSDVKDQGSCGSCWAFSTIGAV  219



>gb|ABQ10192.1| actinidin Act2a [Actinidia deliciosa]
Length=378

 Score =   172 bits (437),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 78/131 (60%), Positives = 102/131 (78%), Gaps = 4/131 (3%)
 Frame = +3

Query  165  RSEDEVKEMFESWLVKHGKSYNAVDEKDKRFKIFRDNLKYIDEKNSLENRSYKLGLNRFA  344
            R+ D+V  M+ESWLV+HGKSYN++DEK+ RF+IF++NL+ ID+ N+  NRSY LGLNRFA
Sbjct  33   RTNDQVMAMYESWLVEHGKSYNSLDEKEMRFEIFKENLRIIDDHNADANRSYSLGLNRFA  92

Query  345  DITNEEYRTGYLGAKRDASRNMVKSKSDRYAPVAGDSLPDSIDWREKGAVTGVKDQGSCG  524
            D+T+EEYR+ YLG KR    ++    S++Y P  GD+LPD +DWR  GAV GVK+QG C 
Sbjct  93   DLTDEEYRSTYLGLKRGPKTDV----SNQYMPKVGDALPDYVDWRTVGAVVGVKNQGLCS  148

Query  525  SCWAFSTIAAV  557
            SCWAFS +AAV
Sbjct  149  SCWAFSAVAAV  159



>ref|XP_009400290.1| PREDICTED: oryzain alpha chain-like [Musa acuminata subsp. malaccensis]
Length=470

 Score =   174 bits (442),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 78/151 (52%), Positives = 107/151 (71%), Gaps = 3/151 (2%)
 Frame = +3

Query  114  DMSIITYDQQHPAKGLVRSEDEVKEMFESWLVKHGKSYNAVDEKDKRFKIFRDNLKYIDE  293
            DMSI+ Y+++H  +GL RSE+E++ M+E WL KHG++ NA+ + + RF IF+DNL+++D 
Sbjct  24   DMSIVAYNKEHGVRGLERSEEEMRRMYEGWLAKHGRANNALGQNEMRFDIFKDNLRFVDA  83

Query  294  KNSLEN---RSYKLGLNRFADITNEEYRTGYLGAKRDASRNMVKSKSDRYAPVAGDSLPD  464
             N+  +     ++LGLNRFAD+TNEEYR  YLG +        +   DRY    G+ LP+
Sbjct  84   HNAAADAGRHRFRLGLNRFADLTNEEYRAAYLGTRARGVARRSRVPGDRYRYEDGEELPE  143

Query  465  SIDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            S+DWR KGAV  VKDQGSCGSCWAFST+ AV
Sbjct  144  SVDWRAKGAVAAVKDQGSCGSCWAFSTVGAV  174



>ref|XP_010481911.1| PREDICTED: cysteine proteinase RD21a [Camelina sativa]
Length=467

 Score =   174 bits (441),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 93/157 (59%), Positives = 121/157 (77%), Gaps = 13/157 (8%)
 Frame = +3

Query  114  DMSIITYDQQHPAKGLV----RSEDEVKEMFESWLVKHGK---SYNAV--DEKDKRFKIF  266
            DMSIITYD++H          RS+ EV+ ++++WLV+HGK   + N V   EKD+RF+IF
Sbjct  23   DMSIITYDEKHHITTTTTVTSRSDAEVERIYDAWLVEHGKKKMNQNNVLGAEKDQRFEIF  82

Query  267  RDNLKYIDEKNSLENRSYKLGLNRFADITNEEYRTGYLGAKRDASRNMVKSKSDRYAPVA  446
            +DNL++IDE N+ +N SYKLGLNRFAD+TN+EYR+ YLGAK   ++ ++K+ SDRY    
Sbjct  83   KDNLRFIDEHNT-KNLSYKLGLNRFADLTNQEYRSMYLGAK--PTKRVLKT-SDRYEARV  138

Query  447  GDSLPDSIDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            GDSLPDS+DWR++GAV  VKDQGSCGSCWAFSTI AV
Sbjct  139  GDSLPDSVDWRKEGAVADVKDQGSCGSCWAFSTIGAV  175



>gb|ABQ10197.1| actinidin Act4a [Actinidia eriantha]
Length=385

 Score =   172 bits (437),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 80/131 (61%), Positives = 105/131 (80%), Gaps = 3/131 (2%)
 Frame = +3

Query  165  RSEDEVKEMFESWLVKHGKSYNAVDEKDKRFKIFRDNLKYIDEKNSLENRSYKLGLNRFA  344
            R+ DEV  MFESWLV++GKSYNA+ EK++RF+IF+DNL+++DE N+  NRSYK+GLN+F+
Sbjct  39   RTNDEVIAMFESWLVEYGKSYNALGEKERRFEIFKDNLRFVDEHNADVNRSYKVGLNQFS  98

Query  345  DITNEEYRTGYLGAKRDASRNMVKSKSDRYAPVAGDSLPDSIDWREKGAVTGVKDQGSCG  524
            D+T+ EY + YLG K +     V   SDRY P  GD LPDS+DWR+KGAV GVK+QG+CG
Sbjct  99   DLTDAEYSSIYLGTKFNIRMTNV---SDRYEPRVGDQLPDSVDWRKKGAVLGVKNQGNCG  155

Query  525  SCWAFSTIAAV  557
            SCW F++IAAV
Sbjct  156  SCWTFASIAAV  166



>gb|ABQ10191.1| actinidin Act1c [Actinidia eriantha]
Length=368

 Score =   172 bits (435),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 76/131 (58%), Positives = 104/131 (79%), Gaps = 3/131 (2%)
 Frame = +3

Query  165  RSEDEVKEMFESWLVKHGKSYNAVDEKDKRFKIFRDNLKYIDEKNSLENRSYKLGLNRFA  344
            R+ DEVK M+ESWL+KHGKSYN++ E+++RF+IF++ L++IDE N+  +RSYK+GLN+FA
Sbjct  29   RTNDEVKAMYESWLIKHGKSYNSLGERERRFEIFKETLRFIDEHNADTSRSYKVGLNQFA  88

Query  345  DITNEEYRTGYLGAKRDASRNMVKSKSDRYAPVAGDSLPDSIDWREKGAVTGVKDQGSCG  524
            D+TNEE+R+ YLG  R +++  V   S+RY P  G  LPD +DWR +GAV  +K+QG CG
Sbjct  89   DLTNEEFRSTYLGFTRGSNKTKV---SNRYEPRVGQVLPDYVDWRSEGAVVDIKNQGQCG  145

Query  525  SCWAFSTIAAV  557
            SCWAFS IAAV
Sbjct  146  SCWAFSAIAAV  156



>ref|XP_004234718.1| PREDICTED: cysteine proteinase COT44-like [Solanum lycopersicum]
Length=379

 Score =   172 bits (436),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 79/132 (60%), Positives = 106/132 (80%), Gaps = 2/132 (2%)
 Frame = +3

Query  168  SEDEVKEMFESWLVKHGKSYNAVDEKDKRFKIFRDNLKYIDEKNSLENRSYKLGLNRFAD  347
            +++EVK ++E WL +HGK YN + E+ KRF+IF+DNL++I+E N+ +N++Y LGLNRFAD
Sbjct  34   TDEEVKRIYEIWLAEHGKIYNGLGEQGKRFEIFKDNLRFIEEHNNSKNQTYVLGLNRFAD  93

Query  348  ITNEEYRTGYLGAKRDASRNMVKSK--SDRYAPVAGDSLPDSIDWREKGAVTGVKDQGSC  521
            +TNEEYRT +LG K DA R +V+SK  S  Y   A DS+P S+DWR+KGAV  +KDQG+C
Sbjct  94   LTNEEYRTIFLGTKSDARRRLVESKNASHHYDFRASDSVPKSVDWRKKGAVAPIKDQGTC  153

Query  522  GSCWAFSTIAAV  557
            GSCWAFST+AAV
Sbjct  154  GSCWAFSTVAAV  165



>ref|XP_008454976.1| PREDICTED: low-temperature-induced cysteine proteinase-like [Cucumis 
melo]
Length=480

 Score =   174 bits (441),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 79/131 (60%), Positives = 103/131 (79%), Gaps = 1/131 (1%)
 Frame = +3

Query  165  RSEDEVKEMFESWLVKHGKSYNAVDEKDKRFKIFRDNLKYIDEKNSLENRSYKLGLNRFA  344
            R+++EV  ++ESWLV HGK+YNA+ EK++RF+IF+DNL +IDE N  E+R+YK+GL RFA
Sbjct  54   RTDEEVAALYESWLVHHGKAYNALGEKERRFEIFKDNLMFIDEHNR-ESRTYKVGLTRFA  112

Query  345  DITNEEYRTGYLGAKRDASRNMVKSKSDRYAPVAGDSLPDSIDWREKGAVTGVKDQGSCG  524
            D+TNEEYR  +LG +     ++  +KS RYA   GD LPD +DWR+KGAV  VKDQG CG
Sbjct  113  DLTNEEYRARFLGGRFSRKPSLSAAKSGRYAAALGDDLPDDVDWRKKGAVANVKDQGQCG  172

Query  525  SCWAFSTIAAV  557
            SCWAFST+AAV
Sbjct  173  SCWAFSTVAAV  183



>ref|XP_004231872.1| PREDICTED: zingipain-2-like [Solanum lycopersicum]
Length=363

 Score =   172 bits (435),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 78/125 (62%), Positives = 102/125 (82%), Gaps = 2/125 (2%)
 Frame = +3

Query  189  MFESWLVKHGKSYNAVDEKDKRFKIFRDNLKYIDEKNSLENRSYKLGLNRFADITNEEYR  368
            ++E WL +HGK YNA+ EK+KRF+IF+DNL++I+E N+ ENR++K+GLN+FAD+TN+EYR
Sbjct  35   LYEKWLAEHGKIYNALGEKEKRFEIFKDNLRFIEEYNASENRTFKVGLNQFADLTNDEYR  94

Query  369  TGYLGAKRDASRNMVKSK--SDRYAPVAGDSLPDSIDWREKGAVTGVKDQGSCGSCWAFS  542
              YLG K DA R +VKSK  S RYA    + LP S+DWR+KGAV  +K+QGSCGSCWAFS
Sbjct  95   AVYLGTKSDARRRLVKSKNTSQRYASPPNELLPHSVDWRKKGAVAPIKNQGSCGSCWAFS  154

Query  543  TIAAV  557
            T+AAV
Sbjct  155  TVAAV  159



>ref|XP_008340386.1| PREDICTED: cysteine proteinase COT44-like [Malus domestica]
Length=366

 Score =   172 bits (435),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 86/167 (51%), Positives = 115/167 (69%), Gaps = 17/167 (10%)
 Frame = +3

Query  63   LFTFLFavvsaaaaaaEDMSIITYDQQHPAKGLVRSEDEVKEMFESWLVKHGKSYNAVDE  242
            +FT LF                T  Q  P  G  RSE +V+ +++ WLVKH K+YN + E
Sbjct  9    MFTILFLS-------------FTLSQASPIVG-SRSEADVRAIYQEWLVKHQKTYNGIGE  54

Query  243  KDKRFKIFRDNLKYIDEKNSLENRSYKLGLNRFADITNEEYRTGYLGAKRDASRNMVKSK  422
             ++RF+IF+DNLK+IDE N+L+ R YK+GLN FAD+TN+EYR  +LG + D  R  +K+K
Sbjct  55   DERRFEIFKDNLKFIDEHNALD-RPYKVGLNAFADLTNQEYRAKFLGTRSDPKRRXMKAK  113

Query  423  --SDRYAPVAGDSLPDSIDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
              S RYA  AG++LP+S+DWR KGAV  +K+QGSCGSCWAFST+AAV
Sbjct  114  NPSLRYAFRAGETLPESVDWRVKGAVNPIKNQGSCGSCWAFSTVAAV  160



>ref|NP_568620.1| Granulin repeat cysteine protease family protein [Arabidopsis 
thaliana]
 dbj|BAB08269.1| cysteine protease component of protease-inhibitor complex [Arabidopsis 
thaliana]
 gb|AAL32686.1| cysteine protease component of protease-inhibitor complex [Arabidopsis 
thaliana]
 gb|AAM47980.1| cysteine protease component of protease-inhibitor complex [Arabidopsis 
thaliana]
 gb|AED94905.1| Granulin repeat cysteine protease family protein [Arabidopsis 
thaliana]
Length=463

 Score =   173 bits (439),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 90/153 (59%), Positives = 119/153 (78%), Gaps = 9/153 (6%)
 Frame = +3

Query  114  DMSIITYDQ-QHPAKGLVRSEDEVKEMFESWLVKHGK---SYNAVD-EKDKRFKIFRDNL  278
            DMSII+YD+  H      RS+ EV+ ++E+W+V+HGK   + N +  EKD+RF+IF+DNL
Sbjct  23   DMSIISYDENHHITTETSRSDSEVERIYEAWMVEHGKKKMNQNGLGAEKDQRFEIFKDNL  82

Query  279  KYIDEKNSLENRSYKLGLNRFADITNEEYRTGYLGAKRDASRNMVKSKSDRYAPVAGDSL  458
            ++IDE N+ +N SYKLGL RFAD+TNEEYR+ YLGAK   ++ ++K+ SDRY    GD+L
Sbjct  83   RFIDEHNT-KNLSYKLGLTRFADLTNEEYRSMYLGAK--PTKRVLKT-SDRYQARVGDAL  138

Query  459  PDSIDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            PDS+DWR++GAV  VKDQGSCGSCWAFSTI AV
Sbjct  139  PDSVDWRKEGAVADVKDQGSCGSCWAFSTIGAV  171



>ref|XP_007155893.1| hypothetical protein PHAVU_003G240800g [Phaseolus vulgaris]
 gb|ESW27887.1| hypothetical protein PHAVU_003G240800g [Phaseolus vulgaris]
Length=364

 Score =   171 bits (434),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 88/177 (50%), Positives = 122/177 (69%), Gaps = 22/177 (12%)
 Frame = +3

Query  36   LPTMARPSILF-TFLFavvsaaaaaaEDMSIITYDQQHPAKGLVRSEDEVKEMFESWLVK  212
            +P+M  P++L  +F F+  +A       +SII Y           SE+EV +M+E WL+K
Sbjct  1    MPSMLIPTLLLLSFTFSHATA-------ISIINY-----------SENEVMDMYEEWLMK  42

Query  213  HGKSYNAVDEKDKRFKIFRDNLKYIDEKNSLENRSYKLGLNRFADITNEEYRTGYLGAKR  392
            H K YN +DEK+KRF++F+DNL +I + N+ +N +Y LGLN+FADITNEEYR  YLG + 
Sbjct  43   HRKVYNGLDEKEKRFQVFKDNLGFIQDHNA-QNNTYTLGLNKFADITNEEYRAMYLGTRT  101

Query  393  DASRNMVKSKS--DRYAPVAGDSLPDSIDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            DA R ++K+++   RYA  +G  LP  +DWR KGAV  +KDQG+CGSCWAFST+AAV
Sbjct  102  DAKRRVMKTQNTGHRYAYNSGYQLPVHVDWRLKGAVGPIKDQGNCGSCWAFSTVAAV  158



>gb|KFK31760.1| hypothetical protein AALP_AA6G155800 [Arabis alpina]
Length=468

 Score =   173 bits (439),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 89/157 (57%), Positives = 115/157 (73%), Gaps = 12/157 (8%)
 Frame = +3

Query  114  DMSIITYDQQHPAKGLV----RSEDEVKEMFESWLVKHGKSYN-----AVDEKDKRFKIF  266
            DMSII+YD+ H          R++ EV  ++E+WLVKHGK+ N      V E  +RF+IF
Sbjct  23   DMSIISYDENHHITTTTTVNSRTDAEVASIYEAWLVKHGKNKNKNDLLLVGETKQRFEIF  82

Query  267  RDNLKYIDEKNSLENRSYKLGLNRFADITNEEYRTGYLGAKRDASRNMVKSKSDRYAPVA  446
            +DNL+YIDE N+ +N SYKLGL RFAD+TNEEYR+ YLGAK   ++ + K+ SDRY    
Sbjct  83   KDNLRYIDEHNNNKNLSYKLGLTRFADLTNEEYRSIYLGAK--PTKRVFKT-SDRYEARV  139

Query  447  GDSLPDSIDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            GD+LP+++DWR++GAV  VKDQGSCGSCWAFSTI AV
Sbjct  140  GDALPETVDWRKEGAVAAVKDQGSCGSCWAFSTIGAV  176



>ref|XP_008440309.1| PREDICTED: cysteine proteinase COT44-like [Cucumis melo]
Length=365

 Score =   171 bits (433),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 80/133 (60%), Positives = 107/133 (80%), Gaps = 3/133 (2%)
 Frame = +3

Query  165  RSEDEVKEMFESWLVKHGKSYNAVDEKDKRFKIFRDNLKYIDEKNSLENRSYKLGLNRFA  344
            RS+ EV+E+++ WL KHGK+YN +DE++KRF+IF++NL +ID+ NS ENR+YK+GLN FA
Sbjct  26   RSDGEVREIYDLWLAKHGKAYNGIDEREKRFQIFKENLNFIDDHNS-ENRTYKVGLNMFA  84

Query  345  DITNEEYRTGYLGAKRDASRNMVKSK--SDRYAPVAGDSLPDSIDWREKGAVTGVKDQGS  518
            D+TN+EYR  YLG +   +R ++K+K  S RYA    D LP+S+DWR +GAV  VK+QGS
Sbjct  85   DLTNDEYRALYLGTRSPPARRVMKAKTASRRYAVNNRDRLPESVDWRARGAVAPVKNQGS  144

Query  519  CGSCWAFSTIAAV  557
            CGSCWAFSTIAAV
Sbjct  145  CGSCWAFSTIAAV  157



>ref|XP_010028191.1| PREDICTED: cysteine proteinase COT44-like [Eucalyptus grandis]
 gb|KCW54882.1| hypothetical protein EUGRSUZ_I00844 [Eucalyptus grandis]
Length=370

 Score =   171 bits (433),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 81/135 (60%), Positives = 104/135 (77%), Gaps = 5/135 (4%)
 Frame = +3

Query  165  RSEDEVKEMFESWLVKHGKSYNAVDEKDKRFKIFRDNLKYIDEKNSLENRSYKLGLNRFA  344
            R+++EV  M+E WL KHGK+YN + E+++RF+IFRDNL+++DE  +L NRSY LG+NRFA
Sbjct  29   RTDEEVMGMYELWLAKHGKAYNGLGERERRFEIFRDNLRFVDEHTAL-NRSYALGMNRFA  87

Query  345  DITNEEYRTGYLGAKRDASRNMVKSK--SDRYA--PVAGDSLPDSIDWREKGAVTGVKDQ  512
            D+TNEEYR  YLG + D  R + K++  SDRYA  P     LP ++DWR KGAV  VKDQ
Sbjct  88   DLTNEEYRAIYLGTRSDPMRRVAKARRASDRYASRPCDDSMLPAAVDWRTKGAVNKVKDQ  147

Query  513  GSCGSCWAFSTIAAV  557
            G+CGSCWAFSTIAAV
Sbjct  148  GACGSCWAFSTIAAV  162



>gb|KHN12823.1| Cysteine proteinase RD21a [Glycine soja]
Length=366

 Score =   171 bits (433),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 88/173 (51%), Positives = 116/173 (67%), Gaps = 14/173 (8%)
 Frame = +3

Query  45   MARPSILFTFLFavvsaaaaaaEDMSIITYDQQHPAKGLVRSEDEVKEMFESWLVKHGKS  224
            MA  ++++T LF   + + A     +II Y           +++EV  M+E WLVKH K 
Sbjct  1    MASMTMIYTLLFLSFTLSYAIKTS-TIINY-----------TDNEVMAMYEEWLVKHQKV  48

Query  225  YNAVDEKDKRFKIFRDNLKYIDEKNSLENRSYKLGLNRFADITNEEYRTGYLGAKRDASR  404
            YN + +KDKRF++F+DNL +I E N+  N +YKLGLN+FAD+TNEEYR  YLG K +A R
Sbjct  49   YNELGKKDKRFQVFKDNLGFIQEHNNNLNNTYKLGLNKFADMTNEEYRAMYLGTKSNAKR  108

Query  405  NMVKSKS--DRYAPVAGDSLPDSIDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
             ++K+KS   RYA  A D LP  +DWR KGAV  +KDQGSCGSCWAFST+A V
Sbjct  109  RLMKTKSTGHRYAFSARDRLPVHVDWRMKGAVAPIKDQGSCGSCWAFSTVATV  161



>ref|XP_004136967.1| PREDICTED: cysteine proteinase RD21a-like [Cucumis sativus]
 gb|KGN43904.1| Cysteine protease [Cucumis sativus]
Length=479

 Score =   173 bits (438),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 78/131 (60%), Positives = 102/131 (78%), Gaps = 1/131 (1%)
 Frame = +3

Query  165  RSEDEVKEMFESWLVKHGKSYNAVDEKDKRFKIFRDNLKYIDEKNSLENRSYKLGLNRFA  344
            R ++EV  ++ESWLV HGK+YNA+ EK++RF+IF+DNL++IDE N  E+R+YK+GL RFA
Sbjct  53   RPDEEVAALYESWLVHHGKAYNAIGEKERRFEIFKDNLRFIDEHNR-ESRTYKVGLTRFA  111

Query  345  DITNEEYRTGYLGAKRDASRNMVKSKSDRYAPVAGDSLPDSIDWREKGAVTGVKDQGSCG  524
            D+TNEEYR  +LG +      +  +KS RYA   GD LPD +DWR+KGAV  VKDQG CG
Sbjct  112  DLTNEEYRARFLGGRFSRKPRLSAAKSGRYAAALGDDLPDDVDWRKKGAVATVKDQGQCG  171

Query  525  SCWAFSTIAAV  557
            SCWAFS++AAV
Sbjct  172  SCWAFSSVAAV  182



>ref|XP_010442084.1| PREDICTED: cysteine proteinase RD21a-like [Camelina sativa]
Length=466

 Score =   172 bits (437),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 92/156 (59%), Positives = 120/156 (77%), Gaps = 12/156 (8%)
 Frame = +3

Query  114  DMSIITYDQQHPAKGLV---RSEDEVKEMFESWLVKHGK---SYNAV--DEKDKRFKIFR  269
            DMSII+YD++H         RS+ EV+ ++++WLV+HGK   + N V   EKD+RF+IF+
Sbjct  23   DMSIISYDEKHHITTTTVTSRSDAEVERIYDAWLVEHGKKKMNQNNVLGAEKDQRFEIFK  82

Query  270  DNLKYIDEKNSLENRSYKLGLNRFADITNEEYRTGYLGAKRDASRNMVKSKSDRYAPVAG  449
            DNL++IDE N+ +N SYKLGLNRFAD+TN+EYR+ YLGAK   S+ ++K+ SDRY    G
Sbjct  83   DNLRFIDEHNT-KNLSYKLGLNRFADLTNQEYRSMYLGAK--PSKRVLKT-SDRYEARVG  138

Query  450  DSLPDSIDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            DSLP S+DWR++GAV  VKDQGSCGSCWAFSTI AV
Sbjct  139  DSLPGSVDWRKEGAVADVKDQGSCGSCWAFSTIGAV  174



>ref|XP_006339859.1| PREDICTED: cysteine proteinase RD21a-like [Solanum tuberosum]
Length=361

 Score =   170 bits (431),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 83/150 (55%), Positives = 110/150 (73%), Gaps = 14/150 (9%)
 Frame = +3

Query  114  DMSIITYDQQHPAKGLVRSEDEVKEMFESWLVKHGKSYNAVDEKDKRFKIFRDNLKYIDE  293
            DMSII Y  +   +G++         +E WL +HGK YNA+ E +KRF+IF+DNL++I+E
Sbjct  22   DMSIIDYKNK---EGII---------YEKWLAEHGKVYNALGENEKRFEIFKDNLRFIEE  69

Query  294  KNSLENRSYKLGLNRFADITNEEYRTGYLGAKRDASRNMVKSK--SDRYAPVAGDSLPDS  467
             N+ ENR+YK+GLN+FAD+TN EYR  YLG + DA R +VKSK  S RYA    + LP S
Sbjct  70   YNNSENRTYKVGLNQFADLTNVEYRAMYLGTRSDARRRLVKSKNTSQRYASRPNELLPQS  129

Query  468  IDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            +DWR++GAV  +K+QGSCGSCWAFST+AAV
Sbjct  130  VDWRKRGAVAPIKNQGSCGSCWAFSTVAAV  159



>ref|NP_001242584.1| uncharacterized protein LOC100804015 precursor [Glycine max]
 gb|ACU20623.1| unknown [Glycine max]
Length=366

 Score =   170 bits (431),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 87/173 (50%), Positives = 116/173 (67%), Gaps = 14/173 (8%)
 Frame = +3

Query  45   MARPSILFTFLFavvsaaaaaaEDMSIITYDQQHPAKGLVRSEDEVKEMFESWLVKHGKS  224
            MA  ++++T LF   + + A     +II Y           +++EV  M+E WLV+H K 
Sbjct  1    MASMTMIYTLLFLSFTLSYAIKTS-TIINY-----------TDNEVMAMYEEWLVRHQKG  48

Query  225  YNAVDEKDKRFKIFRDNLKYIDEKNSLENRSYKLGLNRFADITNEEYRTGYLGAKRDASR  404
            YN + +KDKRF++F+DNL +I E N+  N +YKLGLN+FAD+TNEEYR  YLG K +A R
Sbjct  49   YNELGKKDKRFQVFKDNLGFIQEHNNNLNNTYKLGLNKFADMTNEEYRAMYLGTKSNAKR  108

Query  405  NMVKSKS--DRYAPVAGDSLPDSIDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
             ++K+KS   RYA  A D LP  +DWR KGAV  +KDQGSCGSCWAFST+A V
Sbjct  109  RLMKTKSTGHRYAFSARDRLPVHVDWRMKGAVAPIKDQGSCGSCWAFSTVATV  161



>ref|XP_010688590.1| PREDICTED: low-temperature-induced cysteine proteinase-like [Beta 
vulgaris subsp. vulgaris]
Length=463

 Score =   172 bits (436),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 84/132 (64%), Positives = 111/132 (84%), Gaps = 1/132 (1%)
 Frame = +3

Query  165  RSEDEVKEMFESWLVKHGKSYNAVDEKDKRFKIFRDNLKYIDEKNSLENRSYKLGLNRFA  344
            R++ EV  ++ESWL+KHGK+YNA+ EK++R ++F+DNL +ID+ NS +N+++KLGLN+FA
Sbjct  39   RTDAEVMALYESWLMKHGKNYNALGEKERRLEVFKDNLWFIDQHNSDQNQTFKLGLNQFA  98

Query  345  DITNEEYRTGYLGA-KRDASRNMVKSKSDRYAPVAGDSLPDSIDWREKGAVTGVKDQGSC  521
            D+TNEE+R+ Y+G  +RD +R + +SKSDRY    GDSLP SIDWREKGAV  VKDQGSC
Sbjct  99   DLTNEEFRSKYVGTRRRDRNRRLARSKSDRYGFKEGDSLPPSIDWREKGAVVPVKDQGSC  158

Query  522  GSCWAFSTIAAV  557
            GSCWAFSTIAAV
Sbjct  159  GSCWAFSTIAAV  170



>dbj|BAG16371.1| cysteine protease [Brassica oleracea var. italica]
Length=441

 Score =   172 bits (435),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 86/150 (57%), Positives = 115/150 (77%), Gaps = 9/150 (6%)
 Frame = +3

Query  114  DMSIITYDQQHPAKGLVRSEDEVKEMFESWLVKHGKSYNAVDEKDKRFKIFRDNLKYIDE  293
            DMSII+YD+ H      RS+ EV  ++E WLVKHGK+ N++ EKD+RF+IF+DNL++IDE
Sbjct  17   DMSIISYDKNHHTVS-SRSDAEVSRLYEEWLVKHGKAQNSLTEKDRRFEIFKDNLRFIDE  75

Query  294  KNSLENRSYKLGLNRFADITNEEYRTGYLGA--KRDASRNMVKSKSDRYAPVAGDSLPDS  467
             N  +N SY+LGL +FAD+TN+EYR+ YLG+  KR A+++     S RY    GD++P+S
Sbjct  76   HNG-KNLSYRLGLTKFADLTNDEYRSMYLGSRLKRKATKS-----SLRYEVRVGDAIPES  129

Query  468  IDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            +DWR++GAV  VKDQGSCGSCWAFSTI AV
Sbjct  130  VDWRKEGAVAEVKDQGSCGSCWAFSTIGAV  159



>dbj|BAJ92693.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=289

 Score =   168 bits (425),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 80/151 (53%), Positives = 107/151 (71%), Gaps = 13/151 (9%)
 Frame = +3

Query  114  DMSIITYDQQHPAKGLVRSEDEVKEMFESWLVKHGKSYNAVDEKDKRFKIFRDNLKYIDE  293
            DMSI++Y +        RSE+EV+ M+  W+ +HG +YNA+ E+++RF+ FRDNL+YID+
Sbjct  25   DMSIVSYGE--------RSEEEVRRMYAEWMAEHGSTYNAIGEEERRFEAFRDNLRYIDQ  76

Query  294  KNSLEN---RSYKLGLNRFADITNEEYRTGYLGAKRDASRNMVKSKSDRYAPVAGDSLPD  464
             N+  +    S++LGLNRFAD+TNEEYR+ YLGA+    R   +  S RY     D LP+
Sbjct  77   HNAAADAGVHSFRLGLNRFADLTNEEYRSTYLGARTKPDRE--RKLSARYQAADNDELPE  134

Query  465  SIDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            S+DWR+KGAV  VKDQG CGSCWAFS IAAV
Sbjct  135  SVDWRKKGAVGAVKDQGGCGSCWAFSAIAAV  165



>ref|XP_002863697.1| hypothetical protein ARALYDRAFT_917391 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39956.1| hypothetical protein ARALYDRAFT_917391 [Arabidopsis lyrata subsp. 
lyrata]
Length=463

 Score =   172 bits (435),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 90/153 (59%), Positives = 119/153 (78%), Gaps = 9/153 (6%)
 Frame = +3

Query  114  DMSIITYDQQHPAKGLV-RSEDEVKEMFESWLVKHGK---SYNAVD-EKDKRFKIFRDNL  278
            DMSII+YD+ H    +  RS+ EV+ ++E+W+V+HGK   + N +  EKD+RF+IF+DNL
Sbjct  23   DMSIISYDENHHISTVSSRSDAEVERIYEAWMVEHGKKKMNQNGLGAEKDQRFEIFKDNL  82

Query  279  KYIDEKNSLENRSYKLGLNRFADITNEEYRTGYLGAKRDASRNMVKSKSDRYAPVAGDSL  458
            +YIDE N+ +N SYKLGL RFAD+TN+EYR+ YLGAK    + ++K+ SDRY    GD+L
Sbjct  83   RYIDEHNT-KNLSYKLGLTRFADLTNDEYRSMYLGAK--PVKRVLKT-SDRYEARVGDAL  138

Query  459  PDSIDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            PDS+DWR++GAV  VKDQGSCGSCWAFSTI AV
Sbjct  139  PDSVDWRKEGAVADVKDQGSCGSCWAFSTIGAV  171



>emb|CDY17093.1| BnaC06g00260D [Brassica napus]
Length=457

 Score =   172 bits (435),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 86/150 (57%), Positives = 115/150 (77%), Gaps = 9/150 (6%)
 Frame = +3

Query  114  DMSIITYDQQHPAKGLVRSEDEVKEMFESWLVKHGKSYNAVDEKDKRFKIFRDNLKYIDE  293
            DMSII+YD+ H      RS+ EV  ++E WLVKHGK+ N++ EKD+RF+IF+DNL++IDE
Sbjct  23   DMSIISYDKNHHTVS-SRSDAEVSRLYEEWLVKHGKAQNSLTEKDRRFEIFKDNLRFIDE  81

Query  294  KNSLENRSYKLGLNRFADITNEEYRTGYLGA--KRDASRNMVKSKSDRYAPVAGDSLPDS  467
             N  +N SY+LGL +FAD+TN+EYR+ YLG+  KR A+++     S RY    GD++P+S
Sbjct  82   HNG-KNLSYRLGLTKFADLTNDEYRSMYLGSRLKRKATKS-----SLRYEVRVGDAIPES  135

Query  468  IDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            +DWR++GAV  VKDQGSCGSCWAFSTI AV
Sbjct  136  VDWRKEGAVAEVKDQGSCGSCWAFSTIGAV  165



>ref|XP_010906543.1| PREDICTED: ervatamin-B-like [Elaeis guineensis]
Length=362

 Score =   169 bits (429),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 81/151 (54%), Positives = 111/151 (74%), Gaps = 5/151 (3%)
 Frame = +3

Query  114  DMSIITYDQQHPAKGLVRSEDEVKEMFESWLVKHGKSYNAVDEKDKRFKIFRDNLKYIDE  293
            DMSII+YD+ H  +GL RSE+E++ +FE WLVK+G+SYN   EK+ RF+IF++N+++ID 
Sbjct  24   DMSIISYDEAHGMRGLERSEEEMQILFEGWLVKYGRSYNT--EKEWRFEIFKNNVRFIDA  81

Query  294  KNSLE---NRSYKLGLNRFADITNEEYRTGYLGAKRDASRNMVKSKSDRYAPVAGDSLPD  464
             N+     + S++LGLN FAD+T+EEYR  YLG +      M + +SDRY   A + LP+
Sbjct  82   HNAAADAGHHSFRLGLNHFADMTDEEYRAIYLGTRPAGHDWMARVESDRYRYNASERLPN  141

Query  465  SIDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            S+DWR KGAV  VK+QG CGSCWAFS +AAV
Sbjct  142  SVDWRTKGAVVAVKNQGKCGSCWAFSAVAAV  172



>ref|XP_007136708.1| hypothetical protein PHAVU_009G067300g [Phaseolus vulgaris]
 gb|ESW08702.1| hypothetical protein PHAVU_009G067300g [Phaseolus vulgaris]
Length=373

 Score =   169 bits (429),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 88/169 (52%), Positives = 120/169 (71%), Gaps = 6/169 (4%)
 Frame = +3

Query  54   PSILFTFLFavvsaaaaaaEDMSIITYDQQ-HPAKGLVRSEDEVKEMFESWLVKHGKSYN  230
            P+IL  F   +  ++A    DMSII+YD+  H  K   RS++EV+ ++E WLVKHGK  +
Sbjct  9    PTILIVFFTVLAVSSAL---DMSIISYDRTTHADKTERRSDEEVRSIYEEWLVKHGKVPS  65

Query  231  AVDEKDKRFKIFRDNLKYIDEKNSLENRSYKLGLNRFADITNEEYRTGYLGAKRDASRNM  410
             +  K+KRF+IF+DNLK+ID+ N+ ENR+YK+GLNRFAD++N+EYR+ YL  K +  R M
Sbjct  66   TLALKEKRFQIFKDNLKFIDDHNA-ENRTYKVGLNRFADLSNDEYRSKYLRTKINPLR-M  123

Query  411  VKSKSDRYAPVAGDSLPDSIDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
                S+RYAP   D LP+S+DWR++GAV  VKDQ  C  CWAFS IA+V
Sbjct  124  TAKPSNRYAPRVDDILPESVDWRKEGAVVRVKDQAECDGCWAFSAIASV  172



>ref|XP_008338342.1| PREDICTED: cysteine proteinase COT44-like [Malus domestica]
Length=366

 Score =   169 bits (429),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 77/133 (58%), Positives = 108/133 (81%), Gaps = 3/133 (2%)
 Frame = +3

Query  165  RSEDEVKEMFESWLVKHGKSYNAVDEKDKRFKIFRDNLKYIDEKNSLENRSYKLGLNRFA  344
            RSE +VK +++ WLVKH K+YN + E+++RF+IF+DN+K+IDE N+ ++R YK+GLN FA
Sbjct  29   RSEADVKAIYQEWLVKHQKTYNGIGEEERRFEIFKDNMKFIDEHNA-QDRPYKVGLNAFA  87

Query  345  DITNEEYRTGYLGAKRDASRNMVKSK--SDRYAPVAGDSLPDSIDWREKGAVTGVKDQGS  518
            D+TN+EYR  +LG + D  R ++K+K  S RYA  AG++LP+S+DWR KGAV  +K+QGS
Sbjct  88   DLTNQEYRAKFLGTRSDPKRRVMKAKKPSLRYAFRAGETLPESVDWRVKGAVNPIKNQGS  147

Query  519  CGSCWAFSTIAAV  557
            CGSCWAFST+AAV
Sbjct  148  CGSCWAFSTVAAV  160



>gb|AAL60580.1|AF454958_1 senescence-associated cysteine protease [Brassica oleracea]
Length=485

 Score =   172 bits (435),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 86/150 (57%), Positives = 115/150 (77%), Gaps = 9/150 (6%)
 Frame = +3

Query  114  DMSIITYDQQHPAKGLVRSEDEVKEMFESWLVKHGKSYNAVDEKDKRFKIFRDNLKYIDE  293
            DMSII+YD+ H      RS+ EV  ++E WLVKHGK+ N++ EKD+RF+IF+DNL++IDE
Sbjct  23   DMSIISYDKNHHTVS-SRSDAEVSRLYEEWLVKHGKAQNSLTEKDRRFEIFKDNLRFIDE  81

Query  294  KNSLENRSYKLGLNRFADITNEEYRTGYLGA--KRDASRNMVKSKSDRYAPVAGDSLPDS  467
             N  +N SY+LGL +FAD+TN+EYR+ YLG+  KR A+++     S RY    GD++P+S
Sbjct  82   HNG-KNLSYRLGLTKFADLTNDEYRSMYLGSRLKRKATKS-----SLRYEVRVGDAIPES  135

Query  468  IDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            +DWR++GAV  VKDQGSCGSCWAFSTI AV
Sbjct  136  VDWRKEGAVAEVKDQGSCGSCWAFSTIGAV  165



>ref|XP_002894032.1| F2G19.31/F2G19.31 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH70291.1| F2G19.31/F2G19.31 [Arabidopsis lyrata subsp. lyrata]
Length=455

 Score =   171 bits (433),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 88/151 (58%), Positives = 114/151 (75%), Gaps = 6/151 (4%)
 Frame = +3

Query  114  DMSIITYDQQHPAKGLV-RSEDEVKEMFESWLVKHGKSYN--AVDEKDKRFKIFRDNLKY  284
            DMSII+YD++H       RS+ EV  ++E+WLVKHGK+ N  ++ EKD+RF+IF+DNL++
Sbjct  16   DMSIISYDEKHGVSTTGGRSDAEVMSIYEAWLVKHGKAQNQNSLVEKDRRFEIFKDNLRF  75

Query  285  IDEKNSLENRSYKLGLNRFADITNEEYRTGYLGAKRDASRNMVKSKSDRYAPVAGDSLPD  464
            ID+ N  +N SY+LGL RFAD+TN+EYR+ YLGAK +  +   +  S RY    GD LP+
Sbjct  76   IDDHNK-KNLSYRLGLTRFADLTNDEYRSKYLGAKME--KKGERRTSQRYEARVGDELPE  132

Query  465  SIDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            SIDWR+KGAV  VKDQGSCGSCWAFSTI AV
Sbjct  133  SIDWRKKGAVAEVKDQGSCGSCWAFSTIGAV  163



>dbj|BAG16377.1| cysteine protease [Brassica rapa var. perviridis]
Length=431

 Score =   170 bits (431),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 85/150 (57%), Positives = 114/150 (76%), Gaps = 9/150 (6%)
 Frame = +3

Query  114  DMSIITYDQQHPAKGLVRSEDEVKEMFESWLVKHGKSYNAVDEKDKRFKIFRDNLKYIDE  293
            DMSII+YD+ H      RS+ EV  ++E W+VKHGK+ N++ EKD+RF+IF+DNL++IDE
Sbjct  17   DMSIISYDKNHHTVS-SRSDVEVSRLYEEWVVKHGKAQNSLTEKDRRFEIFKDNLRFIDE  75

Query  294  KNSLENRSYKLGLNRFADITNEEYRTGYLGA--KRDASRNMVKSKSDRYAPVAGDSLPDS  467
             N  +N SY+LGL +FAD+TN+EYR+ YLG+  KR A++      S RY    GD++P+S
Sbjct  76   HNG-KNLSYRLGLTKFADLTNDEYRSMYLGSRLKRKATKT-----SLRYEARVGDAIPES  129

Query  468  IDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            +DWR++GAV  VKDQGSCGSCWAFSTI AV
Sbjct  130  VDWRKEGAVAEVKDQGSCGSCWAFSTIGAV  159



>ref|XP_009123448.1| PREDICTED: LOW QUALITY PROTEIN: cysteine proteinase RD21a-like 
[Brassica rapa]
Length=461

 Score =   171 bits (433),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 85/150 (57%), Positives = 114/150 (76%), Gaps = 9/150 (6%)
 Frame = +3

Query  114  DMSIITYDQQHPAKGLVRSEDEVKEMFESWLVKHGKSYNAVDEKDKRFKIFRDNLKYIDE  293
            DMSII+YD+ H      RS+ EV  ++E W+VKHGK+ N++ EKD+RF+IF+DNL++IDE
Sbjct  23   DMSIISYDKNHHTVS-SRSDVEVSRLYEEWVVKHGKAQNSLTEKDRRFEIFKDNLRFIDE  81

Query  294  KNSLENRSYKLGLNRFADITNEEYRTGYLGA--KRDASRNMVKSKSDRYAPVAGDSLPDS  467
             N  +N SY+LGL +FAD+TN+EYR+ YLG+  KR A++      S RY    GD++P+S
Sbjct  82   HNG-KNLSYRLGLTKFADLTNDEYRSMYLGSRLKRKATKT-----SLRYEARVGDAIPES  135

Query  468  IDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            +DWR++GAV  VKDQGSCGSCWAFSTI AV
Sbjct  136  VDWRKEGAVAEVKDQGSCGSCWAFSTIGAV  165



>emb|CDY06760.1| BnaA10g05390D [Brassica napus]
Length=457

 Score =   170 bits (431),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 85/150 (57%), Positives = 114/150 (76%), Gaps = 9/150 (6%)
 Frame = +3

Query  114  DMSIITYDQQHPAKGLVRSEDEVKEMFESWLVKHGKSYNAVDEKDKRFKIFRDNLKYIDE  293
            DMSII+YD+ H      RS+ EV  ++E W+VKHGK+ N++ EKD+RF+IF+DNL++IDE
Sbjct  23   DMSIISYDKNHHTVS-SRSDVEVSRLYEEWVVKHGKAQNSLTEKDRRFEIFKDNLRFIDE  81

Query  294  KNSLENRSYKLGLNRFADITNEEYRTGYLGA--KRDASRNMVKSKSDRYAPVAGDSLPDS  467
             N  +N SY+LGL +FAD+TN+EYR+ YLG+  KR A++      S RY    GD++P+S
Sbjct  82   HNG-KNLSYRLGLTKFADLTNDEYRSMYLGSRLKRKATKT-----SLRYEARVGDAIPES  135

Query  468  IDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            +DWR++GAV  VKDQGSCGSCWAFSTI AV
Sbjct  136  VDWRKEGAVAEVKDQGSCGSCWAFSTIGAV  165



>dbj|BAJ85145.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=436

 Score =   169 bits (429),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 80/151 (53%), Positives = 107/151 (71%), Gaps = 13/151 (9%)
 Frame = +3

Query  114  DMSIITYDQQHPAKGLVRSEDEVKEMFESWLVKHGKSYNAVDEKDKRFKIFRDNLKYIDE  293
            DMSI++Y +        RSE+EV+ M+  W+ +HG +YNA+ E+++RF+ FRDNL+YID+
Sbjct  25   DMSIVSYGE--------RSEEEVRRMYAEWMAEHGSTYNAIGEEERRFEAFRDNLRYIDQ  76

Query  294  KNSLEN---RSYKLGLNRFADITNEEYRTGYLGAKRDASRNMVKSKSDRYAPVAGDSLPD  464
             N+  +    S++LGLNRFAD+TNEEYR+ YLGA+    R   +  S RY     D LP+
Sbjct  77   HNAAADAGVHSFRLGLNRFADLTNEEYRSTYLGARTKPDRE--RKLSARYQAADNDELPE  134

Query  465  SIDWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            S+DWR+KGAV  VKDQG CGSCWAFS IAAV
Sbjct  135  SVDWRKKGAVGAVKDQGGCGSCWAFSAIAAV  165



>gb|ACR34204.1| unknown [Zea mays]
Length=465

 Score =   170 bits (430),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 74/149 (50%), Positives = 111/149 (74%), Gaps = 2/149 (1%)
 Frame = +3

Query  117  MSIITYDQQHPAKGLVRSEDEVKEMFESWLVKHGKSYNAVDEKDKRFKIFRDNLKYIDEK  296
            MSII+Y+++H A+GL R+E E + ++E WL +HG++YNA+ E+D+RF++F DNL+++D  
Sbjct  27   MSIISYNEEHAARGLERTEPEARTLYELWLAEHGRAYNALGERDRRFRVFWDNLRFVDAH  86

Query  297  NS-LENRSYKLGLNRFADITNEEYRTGYLGAKRDASRNMVKSKSDRYAPVAG-DSLPDSI  470
            N       ++LG+N+FAD+TN+E+R  YLGA+  ASR    +  +RY    G + LP+S+
Sbjct  87   NERAAEHGFRLGMNQFADLTNDEFRAAYLGARIPASRRRGTAVGERYRHGGGAEELPESV  146

Query  471  DWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            DWREKGAV  VK+QG CGSCWAFS +++V
Sbjct  147  DWREKGAVAPVKNQGQCGSCWAFSAVSSV  175



>ref|XP_008668054.1| PREDICTED: cysteine protease 1 isoform X1 [Zea mays]
Length=457

 Score =   169 bits (429),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 74/149 (50%), Positives = 111/149 (74%), Gaps = 2/149 (1%)
 Frame = +3

Query  117  MSIITYDQQHPAKGLVRSEDEVKEMFESWLVKHGKSYNAVDEKDKRFKIFRDNLKYIDEK  296
            MSII+Y+++H A+GL R+E E + ++E WL +HG++YNA+ E+D+RF++F DNL+++D  
Sbjct  27   MSIISYNEEHAARGLERTEPEARTLYELWLAEHGRAYNALGERDRRFRVFWDNLRFVDAH  86

Query  297  NS-LENRSYKLGLNRFADITNEEYRTGYLGAKRDASRNMVKSKSDRYAPVAG-DSLPDSI  470
            N       ++LG+N+FAD+TN+E+R  YLGA+  ASR    +  +RY    G + LP+S+
Sbjct  87   NERAAEHGFRLGMNQFADLTNDEFRAAYLGARIPASRRRGTAVGERYRHGGGAEELPESV  146

Query  471  DWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            DWREKGAV  VK+QG CGSCWAFS +++V
Sbjct  147  DWREKGAVAPVKNQGQCGSCWAFSAVSSV  175



>ref|XP_004289205.2| PREDICTED: cysteine proteinase COT44 [Fragaria vesca subsp. vesca]
Length=354

 Score =   167 bits (424),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 75/134 (56%), Positives = 106/134 (79%), Gaps = 3/134 (2%)
 Frame = +3

Query  162  VRSEDEVKEMFESWLVKHGKSYNAVDEKDKRFKIFRDNLKYIDEKNSLENRSYKLGLNRF  341
            +R++ EV+E++++WLVKH K YN + E++ RF+IF+DNLK++DE N+ ENRSYK+G+N F
Sbjct  25   LRTDAEVRELYQNWLVKHQKVYNGIGEEETRFQIFKDNLKFVDEHNA-ENRSYKVGMNAF  83

Query  342  ADITNEEYRTGYLGAKRDASRNMVKSK--SDRYAPVAGDSLPDSIDWREKGAVTGVKDQG  515
            AD+TN+EYR  +LG + D  R ++K+K  S RY  +  D LP+S+DWR  GAV  +K+QG
Sbjct  84   ADLTNQEYRARFLGTRPDPKRRVMKAKNPSLRYVVLPDDKLPESVDWRALGAVNPIKNQG  143

Query  516  SCGSCWAFSTIAAV  557
            SCGSCWAFST+AAV
Sbjct  144  SCGSCWAFSTVAAV  157



>ref|XP_010487882.1| PREDICTED: probable cysteine proteinase At3g19400 [Camelina sativa]
Length=283

 Score =   165 bits (418),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 76/132 (58%), Positives = 101/132 (77%), Gaps = 2/132 (2%)
 Frame = +3

Query  162  VRSEDEVKEMFESWLVKHGKSYNAVDEKDKRFKIFRDNLKYIDEKNSLENRSYKLGLNRF  341
             RSE E + M+E WLV++ K+YN + EK++RF+IF+DNLK+++E NS+ +R++++GLNRF
Sbjct  35   TRSEAEARRMYERWLVENRKNYNGLGEKERRFEIFKDNLKFVEEHNSVPDRTFEVGLNRF  94

Query  342  ADITNEEYRTGYLGAKRDASRNMVKSKSDRYAPVAGDSLPDSIDWREKGAVTGVKDQGSC  521
            AD+TN+E+R  YL  +R   R  V  K +RY   AGDSLPD IDWR KGAV  VKDQG+C
Sbjct  95   ADLTNDEFRAVYL--RRKMERTRVPVKGERYLYKAGDSLPDEIDWRAKGAVNPVKDQGNC  152

Query  522  GSCWAFSTIAAV  557
            GSCWAFS I AV
Sbjct  153  GSCWAFSAIGAV  164



>tpg|DAA35450.1| TPA: cysteine protease 1 [Zea mays]
Length=522

 Score =   170 bits (431),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 74/149 (50%), Positives = 111/149 (74%), Gaps = 2/149 (1%)
 Frame = +3

Query  117  MSIITYDQQHPAKGLVRSEDEVKEMFESWLVKHGKSYNAVDEKDKRFKIFRDNLKYIDEK  296
            MSII+Y+++H A+GL R+E E + ++E WL +HG++YNA+ E+D+RF++F DNL+++D  
Sbjct  84   MSIISYNEEHAARGLERTEPEARTLYELWLAEHGRAYNALGERDRRFRVFWDNLRFVDAH  143

Query  297  NS-LENRSYKLGLNRFADITNEEYRTGYLGAKRDASRNMVKSKSDRYAPVAG-DSLPDSI  470
            N       ++LG+N+FAD+TN+E+R  YLGA+  ASR    +  +RY    G + LP+S+
Sbjct  144  NERAAEHGFRLGMNQFADLTNDEFRAAYLGARIPASRRRGTAVGERYRHGGGAEELPESV  203

Query  471  DWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            DWREKGAV  VK+QG CGSCWAFS +++V
Sbjct  204  DWREKGAVAPVKNQGQCGSCWAFSAVSSV  232



>ref|NP_001150266.1| cysteine protease 1 precursor [Zea mays]
 gb|ACG38442.1| cysteine protease 1 precursor [Zea mays]
Length=462

 Score =   169 bits (428),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 73/149 (49%), Positives = 111/149 (74%), Gaps = 2/149 (1%)
 Frame = +3

Query  117  MSIITYDQQHPAKGLVRSEDEVKEMFESWLVKHGKSYNAVDEKDKRFKIFRDNLKYIDEK  296
            MSII+Y+++H A+GL R+E E + ++E WL +HG++YNA+ E+D+RF++F DNL+++D  
Sbjct  24   MSIISYNEEHAARGLERTEPEARTLYELWLAEHGRAYNALGERDRRFRVFWDNLRFVDAH  83

Query  297  NS-LENRSYKLGLNRFADITNEEYRTGYLGAKRDASRNMVKSKSDRYAPVAG-DSLPDSI  470
            N       ++LG+N+FAD+TN+E+R  YLGA+  A+R    +  +RY    G + LP+S+
Sbjct  84   NERAAEHGFRLGMNQFADLTNDEFRAAYLGARIPAARRRGTAVGERYRHGGGAEELPESV  143

Query  471  DWREKGAVTGVKDQGSCGSCWAFSTIAAV  557
            DWREKGAV  VK+QG CGSCWAFS +++V
Sbjct  144  DWREKGAVAPVKNQGQCGSCWAFSAVSSV  172



>gb|EPS71857.1| senescence-associated cysteine protease, partial [Genlisea aurea]
Length=326

 Score =   166 bits (419),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 81/134 (60%), Positives = 102/134 (76%), Gaps = 9/134 (7%)
 Frame = +3

Query  165  RSEDEVKEMFESWLVKHGKSYNAVDEKDKRFKIFRDNLKYIDEKNSLENRSYKLGLNRFA  344
            RS+ EVK ++E W  KHGK YNA+ EKDKRF IF+DNLK+ID+ N+L NR+Y+LGLN+FA
Sbjct  1    RSDKEVKNLYEEWAAKHGKVYNAIGEKDKRFDIFKDNLKFIDDHNNLGNRTYRLGLNQFA  60

Query  345  DITNEEYRTGYLGA---KRDASRNMVKSKSDRYAPVAGDSLPDSIDWREKGAVTGVKDQG  515
            D+T +EYR+ YLG    K  A R   KS+       AG+ LP+S+DWREKGAVT VK+Q 
Sbjct  61   DLTAQEYRSLYLGTRSKKNAAIRRFAKSRR------AGEILPESVDWREKGAVTPVKNQR  114

Query  516  SCGSCWAFSTIAAV  557
            SCG+CWAFST+AAV
Sbjct  115  SCGNCWAFSTVAAV  128



>ref|XP_009372437.1| PREDICTED: cysteine proteinase COT44-like [Pyrus x bretschneideri]
Length=366

 Score =   166 bits (421),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 76/133 (57%), Positives = 107/133 (80%), Gaps = 3/133 (2%)
 Frame = +3

Query  165  RSEDEVKEMFESWLVKHGKSYNAVDEKDKRFKIFRDNLKYIDEKNSLENRSYKLGLNRFA  344
            +SE +V+ +++ WLVKH K+YN + E++ RF+IF+DNLK+IDE N+ ++R YK+GLN FA
Sbjct  29   QSEADVRAIYQEWLVKHQKTYNGIGEEEVRFEIFKDNLKFIDEHNA-QDRPYKVGLNAFA  87

Query  345  DITNEEYRTGYLGAKRDASRNMVKSK--SDRYAPVAGDSLPDSIDWREKGAVTGVKDQGS  518
            D+TN+EYR  +LG + D  R ++K+K  S RYA  AG++LP+S+DWR KGAV  +K+QGS
Sbjct  88   DLTNQEYRAKFLGTRSDPKRRVMKAKKPSLRYAFRAGETLPESVDWRVKGAVNPIKNQGS  147

Query  519  CGSCWAFSTIAAV  557
            CGSCWAFST+AAV
Sbjct  148  CGSCWAFSTVAAV  160



>gb|ABQ10194.1| actinidin Act2c [Actinidia arguta]
Length=378

 Score =   167 bits (422),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 76/131 (58%), Positives = 100/131 (76%), Gaps = 4/131 (3%)
 Frame = +3

Query  165  RSEDEVKEMFESWLVKHGKSYNAVDEKDKRFKIFRDNLKYIDEKNSLENRSYKLGLNRFA  344
            R+ D+V++M+ESWLV+ GKSYN++DEK+ RF+IF+DNL+ ID+ N+  NRS+ LGLNRFA
Sbjct  33   RTNDQVRDMYESWLVEQGKSYNSLDEKEMRFEIFKDNLRIIDDHNADANRSFSLGLNRFA  92

Query  345  DITNEEYRTGYLGAKRDASRNMVKSKSDRYAPVAGDSLPDSIDWREKGAVTGVKDQGSCG  524
            D+T+EEYR+ YLG K      +    S+RY P  GD LP+ +DWR  GAV GVK+QG C 
Sbjct  93   DLTDEEYRSTYLGFKSGPKAKV----SNRYVPKVGDVLPNYVDWRTVGAVVGVKNQGLCS  148

Query  525  SCWAFSTIAAV  557
            SCWAFS +AAV
Sbjct  149  SCWAFSAVAAV  159



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 631248065840