BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001N04

Length=195
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006367451.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  72.0    5e-13   Solanum tuberosum [potatoes]
ref|XP_010325561.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  70.1    2e-12   
ref|NP_001274792.1|  inositol polyphosphate kinase                    67.4    2e-11   Solanum tuberosum [potatoes]
ref|XP_009781195.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  65.9    8e-11   Nicotiana sylvestris
ref|XP_004244396.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  64.3    2e-10   Solanum lycopersicum
ref|XP_008373591.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  62.0    1e-09   
ref|XP_009622646.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  61.6    2e-09   Nicotiana tomentosiformis
ref|XP_009804255.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  61.6    2e-09   Nicotiana sylvestris
ref|XP_009340198.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  61.6    3e-09   Pyrus x bretschneideri [bai li]
ref|XP_008340742.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  61.6    3e-09   Malus domestica [apple tree]
ref|XP_010096964.1|  Inositol-tetrakisphosphate 1-kinase 1            61.6    3e-09   Morus notabilis
ref|XP_008238214.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  60.8    5e-09   Prunus mume [ume]
ref|XP_007210517.1|  hypothetical protein PRUPE_ppa007677mg           60.8    5e-09   Prunus persica
ref|XP_009615323.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  59.7    1e-08   
ref|XP_009388215.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  57.4    1e-08   
ref|XP_010274276.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  58.5    3e-08   Nelumbo nucifera [Indian lotus]
ref|XP_004300416.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  58.2    4e-08   Fragaria vesca subsp. vesca
ref|XP_002279736.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  57.0    1e-07   
emb|CBI33862.3|  unnamed protein product                              57.0    1e-07   Vitis vinifera
ref|XP_010695549.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  56.2    2e-07   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009389084.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  55.1    5e-07   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010240892.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  54.3    8e-07   Nelumbo nucifera [Indian lotus]
emb|CBI26490.3|  unnamed protein product                              53.5    8e-07   Vitis vinifera
emb|CDP13058.1|  unnamed protein product                              53.5    2e-06   Coffea canephora [robusta coffee]
ref|XP_011082357.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  53.5    2e-06   
ref|XP_002270915.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  53.5    2e-06   
gb|EYU34149.1|  hypothetical protein MIMGU_mgv1a027043mg              53.5    2e-06   Erythranthe guttata [common monkey flower]
emb|CAN68038.1|  hypothetical protein VITISV_018923                   53.5    2e-06   Vitis vinifera
ref|XP_009407835.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  53.1    2e-06   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003534282.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  53.1    2e-06   
ref|XP_009396845.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  52.8    3e-06   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN38938.1|  Inositol-tetrakisphosphate 1-kinase 1                 52.8    3e-06   Glycine soja [wild soybean]
gb|KJB37539.1|  hypothetical protein B456_006G217500                  51.6    8e-06   Gossypium raimondii
gb|KJB37538.1|  hypothetical protein B456_006G217500                  51.6    8e-06   Gossypium raimondii
ref|XP_006854031.1|  hypothetical protein AMTR_s00048p00050940        51.2    1e-05   Amborella trichopoda
ref|XP_007040636.1|  Inositol 1,3,4-trisphosphate 5/6-kinase fami...  50.4    2e-05   
ref|NP_001237829.1|  inositol phosphate kinase                        50.4    2e-05   Glycine max [soybeans]
ref|XP_010908482.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  49.7    3e-05   Elaeis guineensis
ref|XP_008448667.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  49.7    4e-05   Cucumis melo [Oriental melon]
ref|XP_006443251.1|  hypothetical protein CICLE_v10024487mg           49.7    4e-05   Citrus clementina [clementine]
gb|KCW77969.1|  hypothetical protein EUGRSUZ_D02214                   49.7    4e-05   Eucalyptus grandis [rose gum]
ref|XP_010053625.1|  PREDICTED: LOW QUALITY PROTEIN: inositol-tet...  49.7    5e-05   
gb|EYU45388.1|  hypothetical protein MIMGU_mgv1a010042mg              49.3    5e-05   Erythranthe guttata [common monkey flower]
ref|XP_010933449.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  49.3    5e-05   Elaeis guineensis
ref|XP_008786347.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  49.3    5e-05   Phoenix dactylifera
ref|XP_008796245.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  48.9    6e-05   Phoenix dactylifera
ref|XP_002464877.1|  hypothetical protein SORBIDRAFT_01g028090        48.9    7e-05   Sorghum bicolor [broomcorn]
ref|XP_004983548.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  48.9    7e-05   Setaria italica
ref|XP_004509737.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  48.9    8e-05   Cicer arietinum [garbanzo]
ref|XP_007158285.1|  hypothetical protein PHAVU_002G139700g           48.5    9e-05   Phaseolus vulgaris [French bean]
emb|CDX78705.1|  BnaA03g06170D                                        48.5    9e-05   
ref|XP_010549846.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  48.5    9e-05   Tarenaya hassleriana [spider flower]
gb|AAC28859.1|  inositol 1,3,4-trisphosphate 5/6-kinase               48.5    1e-04   Arabidopsis thaliana [mouse-ear cress]
ref|NP_197178.1|  inositol-tetrakisphosphate 1-kinase 1               48.5    1e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006288234.1|  hypothetical protein CARUB_v10001475mg           48.5    1e-04   Capsella rubella
ref|XP_002871735.1|  inositol 1,3,4-trisphosphate 5/6-kinase          48.5    1e-04   
ref|XP_004148764.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  48.5    1e-04   Cucumis sativus [cucumbers]
ref|XP_010492601.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  48.5    1e-04   Camelina sativa [gold-of-pleasure]
ref|XP_010420378.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  48.5    1e-04   Camelina sativa [gold-of-pleasure]
emb|CDX69422.1|  BnaA10g17710D                                        48.1    1e-04   
ref|XP_009121452.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  48.1    1e-04   Brassica rapa
ref|XP_006662634.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  48.1    1e-04   Oryza brachyantha
emb|CDY16981.1|  BnaC09g41080D                                        47.8    1e-04   Brassica napus [oilseed rape]
gb|EAZ17077.1|  hypothetical protein OsJ_32575                        47.8    1e-04   Oryza sativa Japonica Group [Japonica rice]
gb|EAY79626.1|  hypothetical protein OsI_34771                        47.8    2e-04   Oryza sativa Indica Group [Indian rice]
sp|Q7XBW0.1|ITPK5_ORYSJ  RecName: Full=Inositol-tetrakisphosphate...  47.8    2e-04   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001065485.1|  Os10g0576100                                     47.8    2e-04   
ref|XP_010558621.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  47.8    2e-04   Tarenaya hassleriana [spider flower]
gb|EPS70258.1|  hypothetical protein M569_04497                       47.4    2e-04   Genlisea aurea
gb|ACG37127.1|  inositol-tetrakisphosphate 1-kinase 1                 47.4    2e-04   Zea mays [maize]
ref|NP_001105901.1|  inositol-tetrakisphosphate 1-kinase 1            47.4    2e-04   Zea mays [maize]
ref|XP_010235046.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  47.4    2e-04   Brachypodium distachyon [annual false brome]
emb|CDX70710.1|  BnaC03g07940D                                        47.0    3e-04   
ref|XP_009131556.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  47.0    3e-04   Brassica rapa
ref|XP_010453843.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  47.0    3e-04   Camelina sativa [gold-of-pleasure]
ref|XP_002975059.1|  hypothetical protein SELMODRAFT_228325           47.0    3e-04   
ref|XP_006400218.1|  hypothetical protein EUTSA_v10014130mg           47.0    3e-04   Eutrema salsugineum [saltwater cress]
ref|XP_002303428.2|  hypothetical protein POPTR_0003s09290g           47.0    3e-04   Populus trichocarpa [western balsam poplar]
ref|XP_011028157.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  47.0    3e-04   Populus euphratica
emb|CAL49035.1|  inositol phosphate kinase                            47.0    3e-04   Hordeum vulgare [barley]
gb|EMS68297.1|  Inositol-tetrakisphosphate 1-kinase 1                 47.0    3e-04   Triticum urartu
ref|XP_002974206.1|  hypothetical protein SELMODRAFT_232261           46.2    6e-04   
ref|XP_011018535.1|  PREDICTED: inositol-tetrakisphosphate 1-kina...  46.2    6e-04   Populus euphratica
gb|KFK25896.1|  hypothetical protein AALP_AA8G176700                  45.8    7e-04   Arabis alpina [alpine rockcress]
ref|XP_007156414.1|  hypothetical protein PHAVU_003G284100g           45.8    8e-04   Phaseolus vulgaris [French bean]



>ref|XP_006367451.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 1-like [Solanum 
tuberosum]
Length=363

 Score = 72.0 bits (175),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 34/40 (85%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +1

Query  76   MAERMGRYGVGXALAPKKQASFIQTSLVNLARXRGIDLVK  195
            MAERM R+GVG ALAPKKQASFIQ SLVNLA+ RGIDLVK
Sbjct  1    MAERMRRFGVGYALAPKKQASFIQVSLVNLAKERGIDLVK  40



>ref|XP_010325561.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 1-like [Solanum 
lycopersicum]
Length=365

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 33/42 (79%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +1

Query  70   VSMAERMGRYGVGXALAPKKQASFIQTSLVNLARXRGIDLVK  195
            + MAERM RY VG ALAPKKQASFIQ SLVNLA+ RGIDL+K
Sbjct  1    MKMAERMRRYSVGYALAPKKQASFIQLSLVNLAKERGIDLIK  42



>ref|NP_001274792.1| inositol polyphosphate kinase [Solanum tuberosum]
 gb|ABO72542.1| inositol polyphosphate kinase [Solanum tuberosum]
 emb|CAM12754.1| inositol polyphosphate kinase [Solanum tuberosum]
Length=365

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 32/42 (76%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +1

Query  70   VSMAERMGRYGVGXALAPKKQASFIQTSLVNLARXRGIDLVK  195
            + MAE M RY VG ALAPKKQASFIQ SLVNLA+ RGIDL+K
Sbjct  1    MKMAEPMRRYSVGYALAPKKQASFIQVSLVNLAKERGIDLIK  42



>ref|XP_009781195.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 1-like [Nicotiana 
sylvestris]
 ref|XP_009781201.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 1-like [Nicotiana 
sylvestris]
 ref|XP_009781209.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 1-like [Nicotiana 
sylvestris]
 ref|XP_009781216.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 1-like [Nicotiana 
sylvestris]
 ref|XP_009781220.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 1-like [Nicotiana 
sylvestris]
Length=363

 Score = 65.9 bits (159),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 31/40 (78%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +1

Query  76   MAERMGRYGVGXALAPKKQASFIQTSLVNLARXRGIDLVK  195
            M E M RYGVG ALAPKK+ASFIQ SLVNLA+ RGIDL+K
Sbjct  1    MEEPMKRYGVGYALAPKKRASFIQLSLVNLAKERGIDLIK  40



>ref|XP_004244396.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 1-like [Solanum 
lycopersicum]
Length=349

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 31/40 (78%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +1

Query  76   MAERMGRYGVGXALAPKKQASFIQTSLVNLARXRGIDLVK  195
            MAERM R+GVG ALA KK+ASFIQ SLV+LA+ RGIDLVK
Sbjct  1    MAERMRRFGVGYALAAKKEASFIQVSLVHLAKERGIDLVK  40



>ref|XP_008373591.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 1-like [Malus 
domestica]
Length=359

 Score = 62.0 bits (149),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 31/40 (78%), Positives = 34/40 (85%), Gaps = 2/40 (5%)
 Frame = +1

Query  76   MAERMGRYGVGXALAPKKQASFIQTSLVNLARXRGIDLVK  195
            MAER  R+GVG ALAPKKQ SFIQ SLVNLA+ RGIDLV+
Sbjct  1    MAER--RFGVGYALAPKKQRSFIQESLVNLAKSRGIDLVR  38



>ref|XP_009622646.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 1-like [Nicotiana 
tomentosiformis]
Length=360

 Score = 61.6 bits (148),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 30/40 (75%), Positives = 34/40 (85%), Gaps = 2/40 (5%)
 Frame = +1

Query  76   MAERMGRYGVGXALAPKKQASFIQTSLVNLARXRGIDLVK  195
            MAER  R+GVG ALAPKKQASFIQ +LVNLA  RGIDL++
Sbjct  1    MAER--RFGVGYALAPKKQASFIQATLVNLASERGIDLIR  38



>ref|XP_009804255.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 1-like [Nicotiana 
sylvestris]
Length=361

 Score = 61.6 bits (148),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 30/40 (75%), Positives = 34/40 (85%), Gaps = 2/40 (5%)
 Frame = +1

Query  76   MAERMGRYGVGXALAPKKQASFIQTSLVNLARXRGIDLVK  195
            MAER  R+GVG ALAPKKQASFIQ +LVNLA  RGIDL++
Sbjct  1    MAER--RFGVGYALAPKKQASFIQATLVNLASERGIDLIR  38



>ref|XP_009340198.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 1-like [Pyrus 
x bretschneideri]
 ref|XP_009346394.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 1-like [Pyrus 
x bretschneideri]
Length=359

 Score = 61.6 bits (148),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 30/40 (75%), Positives = 34/40 (85%), Gaps = 2/40 (5%)
 Frame = +1

Query  76   MAERMGRYGVGXALAPKKQASFIQTSLVNLARXRGIDLVK  195
            MAER  R+G+G ALAPKKQ SFIQ SLV+LAR RGIDLV+
Sbjct  1    MAER--RFGIGYALAPKKQQSFIQESLVDLARSRGIDLVR  38



>ref|XP_008340742.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 1-like [Malus 
domestica]
Length=359

 Score = 61.6 bits (148),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 30/40 (75%), Positives = 34/40 (85%), Gaps = 2/40 (5%)
 Frame = +1

Query  76   MAERMGRYGVGXALAPKKQASFIQTSLVNLARXRGIDLVK  195
            MAER  R+G+G ALAPKKQ SFIQ SLV+LAR RGIDLV+
Sbjct  1    MAER--RFGIGYALAPKKQQSFIQESLVDLARSRGIDLVR  38



>ref|XP_010096964.1| Inositol-tetrakisphosphate 1-kinase 1 [Morus notabilis]
 gb|EXB66541.1| Inositol-tetrakisphosphate 1-kinase 1 [Morus notabilis]
Length=368

 Score = 61.6 bits (148),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 31/40 (78%), Positives = 34/40 (85%), Gaps = 2/40 (5%)
 Frame = +1

Query  76   MAERMGRYGVGXALAPKKQASFIQTSLVNLARXRGIDLVK  195
            MAER  R+GVG ALAPKKQ SFIQ SLV+LAR RGIDLV+
Sbjct  1    MAER--RFGVGYALAPKKQQSFIQDSLVSLARSRGIDLVR  38



>ref|XP_008238214.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 1 [Prunus mume]
Length=359

 Score = 60.8 bits (146),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 30/40 (75%), Positives = 33/40 (83%), Gaps = 2/40 (5%)
 Frame = +1

Query  76   MAERMGRYGVGXALAPKKQASFIQTSLVNLARXRGIDLVK  195
            MAER  R+G+G ALAPKKQ SFIQ SLV LAR RGIDLV+
Sbjct  1    MAER--RFGIGYALAPKKQQSFIQESLVGLARSRGIDLVR  38



>ref|XP_007210517.1| hypothetical protein PRUPE_ppa007677mg [Prunus persica]
 gb|EMJ11716.1| hypothetical protein PRUPE_ppa007677mg [Prunus persica]
Length=359

 Score = 60.8 bits (146),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 30/40 (75%), Positives = 33/40 (83%), Gaps = 2/40 (5%)
 Frame = +1

Query  76   MAERMGRYGVGXALAPKKQASFIQTSLVNLARXRGIDLVK  195
            MAER  R+G+G ALAPKKQ SFIQ SLV LAR RGIDLV+
Sbjct  1    MAER--RFGIGYALAPKKQQSFIQESLVGLARSRGIDLVR  38



>ref|XP_009615323.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 1-like [Nicotiana 
tomentosiformis]
Length=359

 Score = 59.7 bits (143),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +1

Query  88   MGRYGVGXALAPKKQASFIQTSLVNLARXRGIDLVK  195
            M RY VG ALAPKK+ASFIQ SLVNLA+ RGIDL+K
Sbjct  1    MKRYDVGYALAPKKRASFIQLSLVNLAKERGIDLIK  36



>ref|XP_009388215.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 1-like [Musa acuminata 
subsp. malaccensis]
Length=144

 Score = 57.4 bits (137),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +1

Query  76   MAERMGRYGVGXALAPKKQASFIQTSLVNLARXRGIDLV  192
            MAE   R+ VG ALAPKKQ SFIQ SLV+L+R RG+DLV
Sbjct  1    MAENTRRFTVGYALAPKKQKSFIQPSLVDLSRKRGVDLV  39



>ref|XP_010274276.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 1-like [Nelumbo 
nucifera]
Length=376

 Score = 58.5 bits (140),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 26/40 (65%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +1

Query  76   MAERMGRYGVGXALAPKKQASFIQTSLVNLARXRGIDLVK  195
            M++   RY +G ALAPKKQ SFIQ SLVNLA+ RGIDL++
Sbjct  1    MSDSTRRYEIGYALAPKKQQSFIQVSLVNLAKERGIDLIR  40



>ref|XP_004300416.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 1 [Fragaria vesca 
subsp. vesca]
Length=359

 Score = 58.2 bits (139),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 29/40 (73%), Positives = 32/40 (80%), Gaps = 1/40 (3%)
 Frame = +1

Query  76   MAERMGRYGVGXALAPKKQASFIQTSLVNLARXRGIDLVK  195
            MAE   R+GVG ALAPKKQ SFIQ SLV LAR RG+DLV+
Sbjct  1    MAEER-RFGVGYALAPKKQQSFIQDSLVELARSRGVDLVR  39



>ref|XP_002279736.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 1-like [Vitis 
vinifera]
Length=368

 Score = 57.0 bits (136),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 25/40 (63%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +1

Query  76   MAERMGRYGVGXALAPKKQASFIQTSLVNLARXRGIDLVK  195
            MAE+  R+ +G ALAPKK+ SFIQ SLV+LA+ RGIDL++
Sbjct  1    MAEQQRRFAIGYALAPKKRESFIQVSLVSLAQERGIDLIR  40



>emb|CBI33862.3| unnamed protein product [Vitis vinifera]
Length=378

 Score = 57.0 bits (136),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 25/40 (63%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +1

Query  76   MAERMGRYGVGXALAPKKQASFIQTSLVNLARXRGIDLVK  195
            MAE+  R+ +G ALAPKK+ SFIQ SLV+LA+ RGIDL++
Sbjct  1    MAEQQRRFAIGYALAPKKRESFIQVSLVSLAQERGIDLIR  40



>ref|XP_010695549.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 1-like [Beta vulgaris 
subsp. vulgaris]
Length=342

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 26/40 (65%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  76   MAERMGRYGVGXALAPKKQASFIQTSLVNLARXRGIDLVK  195
            MAE   R+ +G ALAPKKQ SFI+ SL+NLAR R IDL+K
Sbjct  1    MAEERRRFSIGYALAPKKQQSFIRESLINLARERLIDLIK  40



>ref|XP_009389084.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 1-like [Musa acuminata 
subsp. malaccensis]
Length=347

 Score = 55.1 bits (131),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 28/39 (72%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +1

Query  76   MAERMGRYGVGXALAPKKQASFIQTSLVNLARXRGIDLV  192
            MA    R+ VG ALAPKKQ SFIQ SLV LAR RGIDLV
Sbjct  1    MAGNPRRFTVGYALAPKKQQSFIQPSLVELARRRGIDLV  39



>ref|XP_010240892.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 1 [Nelumbo nucifera]
Length=357

 Score = 54.3 bits (129),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 24/40 (60%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  76   MAERMGRYGVGXALAPKKQASFIQTSLVNLARXRGIDLVK  195
            M++   RY +G ALAPKKQ SFIQ SLVNLA+ R +DL++
Sbjct  1    MSDSSRRYRIGYALAPKKQQSFIQDSLVNLAKERSVDLIR  40



>emb|CBI26490.3| unnamed protein product [Vitis vinifera]
Length=237

 Score = 53.5 bits (127),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 26/40 (65%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +1

Query  76   MAERMGRYGVGXALAPKKQASFIQTSLVNLARXRGIDLVK  195
            MAE+  R+ VG ALAPKK +SFIQ SLV+ A+ RGIDLV+
Sbjct  1    MAEQPRRFTVGYALAPKKVSSFIQPSLVDHAKQRGIDLVR  40



>emb|CDP13058.1| unnamed protein product [Coffea canephora]
Length=369

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 27/38 (71%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = +1

Query  82   ERMGRYGVGXALAPKKQASFIQTSLVNLARXRGIDLVK  195
            E   R+ VG ALAPKKQASFIQ SLV LA  RGIDLV+
Sbjct  2    EEPKRFAVGYALAPKKQASFIQGSLVQLACERGIDLVQ  39



>ref|XP_011082357.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 1-like [Sesamum 
indicum]
Length=374

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 26/41 (63%), Positives = 32/41 (78%), Gaps = 1/41 (2%)
 Frame = +1

Query  76   MAERMGR-YGVGXALAPKKQASFIQTSLVNLARXRGIDLVK  195
            M E MGR + VG ALA KKQASFIQ SL+N+A+ + IDL+K
Sbjct  1    MGEPMGRRFAVGYALASKKQASFIQISLINVAKEKSIDLIK  41



>ref|XP_002270915.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 1 [Vitis vinifera]
Length=337

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 26/40 (65%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +1

Query  76   MAERMGRYGVGXALAPKKQASFIQTSLVNLARXRGIDLVK  195
            MAE+  R+ VG ALAPKK +SFIQ SLV+ A+ RGIDLV+
Sbjct  1    MAEQPRRFTVGYALAPKKVSSFIQPSLVDHAKQRGIDLVR  40



>gb|EYU34149.1| hypothetical protein MIMGU_mgv1a027043mg [Erythranthe guttata]
Length=372

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 26/41 (63%), Positives = 32/41 (78%), Gaps = 1/41 (2%)
 Frame = +1

Query  76   MAERMGR-YGVGXALAPKKQASFIQTSLVNLARXRGIDLVK  195
            M E MGR + VG ALA KKQASFIQ SL+N+A+ + IDL+K
Sbjct  1    MEEPMGRRFAVGYALASKKQASFIQISLINIAKEKSIDLIK  41



>emb|CAN68038.1| hypothetical protein VITISV_018923 [Vitis vinifera]
Length=398

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 26/40 (65%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +1

Query  76   MAERMGRYGVGXALAPKKQASFIQTSLVNLARXRGIDLVK  195
            MAE+  R+ VG ALAPKK +SFIQ SLV+ A+ RGIDLV+
Sbjct  62   MAEQPRRFTVGYALAPKKVSSFIQPSLVDHAKQRGIDLVR  101



>ref|XP_009407835.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 1-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009407836.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 1-like [Musa acuminata 
subsp. malaccensis]
Length=339

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 26/33 (79%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +1

Query  94   RYGVGXALAPKKQASFIQTSLVNLARXRGIDLV  192
            R+ VG ALAPKKQ SFIQ SLV LAR RGIDLV
Sbjct  9    RFVVGYALAPKKQQSFIQPSLVGLARERGIDLV  41



>ref|XP_003534282.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 1-like isoform 
X1 [Glycine max]
Length=341

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 27/40 (68%), Positives = 31/40 (78%), Gaps = 1/40 (3%)
 Frame = +1

Query  76   MAERMGRYGVGXALAPKKQASFIQTSLVNLARXRGIDLVK  195
            MAE   R+ +G AL PKKQ SFI+ SLVNLAR RGIDLV+
Sbjct  1    MAEEK-RFRIGYALLPKKQNSFIRDSLVNLARSRGIDLVR  39



>ref|XP_009396845.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 1-like [Musa acuminata 
subsp. malaccensis]
Length=339

 Score = 52.8 bits (125),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 26/33 (79%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +1

Query  94   RYGVGXALAPKKQASFIQTSLVNLARXRGIDLV  192
            R+ VG ALAPKKQ SFIQ SLV LAR RGIDLV
Sbjct  9    RFVVGYALAPKKQRSFIQPSLVGLARERGIDLV  41



>gb|KHN38938.1| Inositol-tetrakisphosphate 1-kinase 1 [Glycine soja]
Length=341

 Score = 52.8 bits (125),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 27/40 (68%), Positives = 31/40 (78%), Gaps = 1/40 (3%)
 Frame = +1

Query  76   MAERMGRYGVGXALAPKKQASFIQTSLVNLARXRGIDLVK  195
            MAE   R+ +G AL PKKQ SFI+ SLVNLAR RGIDLV+
Sbjct  1    MAEEK-RFRIGYALLPKKQNSFIRDSLVNLARSRGIDLVR  39



>gb|KJB37539.1| hypothetical protein B456_006G217500 [Gossypium raimondii]
Length=354

 Score = 51.6 bits (122),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 24/40 (60%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +1

Query  76   MAERMGRYGVGXALAPKKQASFIQTSLVNLARXRGIDLVK  195
            MA    R+ +G AL PKK+ SFI+ SLVNLA+ RG+DLVK
Sbjct  1    MAGEKRRFTIGYALLPKKENSFIRESLVNLAKSRGVDLVK  40



>gb|KJB37538.1| hypothetical protein B456_006G217500 [Gossypium raimondii]
Length=365

 Score = 51.6 bits (122),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 24/40 (60%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +1

Query  76   MAERMGRYGVGXALAPKKQASFIQTSLVNLARXRGIDLVK  195
            MA    R+ +G AL PKK+ SFI+ SLVNLA+ RG+DLVK
Sbjct  1    MAGEKRRFTIGYALLPKKENSFIRESLVNLAKSRGVDLVK  40



>ref|XP_006854031.1| hypothetical protein AMTR_s00048p00050940 [Amborella trichopoda]
 gb|ERN15498.1| hypothetical protein AMTR_s00048p00050940 [Amborella trichopoda]
Length=383

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 23/33 (70%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +1

Query  94   RYGVGXALAPKKQASFIQTSLVNLARXRGIDLV  192
            RY +G ALAPKKQ SFI+ SL+NLA+ +GIDLV
Sbjct  6    RYLIGYALAPKKQQSFIRLSLINLAKEKGIDLV  38



>ref|XP_007040636.1| Inositol 1,3,4-trisphosphate 5/6-kinase family protein [Theobroma 
cacao]
 gb|EOY25137.1| Inositol 1,3,4-trisphosphate 5/6-kinase family protein [Theobroma 
cacao]
Length=369

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 24/40 (60%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +1

Query  76   MAERMGRYGVGXALAPKKQASFIQTSLVNLARXRGIDLVK  195
            MA    R+ +G AL PKK+ SFI+ SLVN A+ RGIDLVK
Sbjct  1    MAREERRFEIGYALVPKKENSFIRESLVNQAKSRGIDLVK  40



>ref|NP_001237829.1| inositol phosphate kinase [Glycine max]
 gb|ABU93831.1| inositol phosphate kinase [Glycine max]
Length=339

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 27/41 (66%), Positives = 34/41 (83%), Gaps = 3/41 (7%)
 Frame = +1

Query  76   MAERMGRYGV-GXALAPKKQASFIQTSLVNLARXRGIDLVK  195
            MAE+  R+GV G ALAPKKQ SFI+ SLV+LA+ RGI+LV+
Sbjct  1    MAEK--RFGVIGYALAPKKQNSFIRDSLVSLAKSRGIELVR  39



>ref|XP_010908482.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 1 [Elaeis guineensis]
Length=361

 Score = 49.7 bits (117),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 27/40 (68%), Positives = 30/40 (75%), Gaps = 1/40 (3%)
 Frame = +1

Query  76   MAERMGR-YGVGXALAPKKQASFIQTSLVNLARXRGIDLV  192
            MAE + R + +G ALAPKKQ SFIQ SLV LA  RGIDLV
Sbjct  1    MAEPLRRRFVIGYALAPKKQQSFIQPSLVGLAADRGIDLV  40



>ref|XP_008448667.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 1-like [Cucumis 
melo]
Length=363

 Score = 49.7 bits (117),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 26/40 (65%), Positives = 30/40 (75%), Gaps = 2/40 (5%)
 Frame = +1

Query  76   MAERMGRYGVGXALAPKKQASFIQTSLVNLARXRGIDLVK  195
            M ER  R+ +G ALAPKK+ SFIQ SLV LA  RGIDLV+
Sbjct  1    MEER--RFCIGYALAPKKRHSFIQDSLVALAASRGIDLVR  38



>ref|XP_006443251.1| hypothetical protein CICLE_v10024487mg [Citrus clementina]
 ref|XP_006478958.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 1-like [Citrus 
sinensis]
 gb|ESR56491.1| hypothetical protein CICLE_v10024487mg [Citrus clementina]
Length=318

 Score = 49.7 bits (117),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 23/42 (55%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = +1

Query  70   VSMAERMGRYGVGXALAPKKQASFIQTSLVNLARXRGIDLVK  195
            +S  +R  RY +G ALAPKK+ +FIQ SLV  A  RGIDL++
Sbjct  1    MSNDQRSQRYQIGYALAPKKEQTFIQPSLVTKASERGIDLIR  42



>gb|KCW77969.1| hypothetical protein EUGRSUZ_D02214 [Eucalyptus grandis]
Length=331

 Score = 49.7 bits (117),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 26/40 (65%), Positives = 30/40 (75%), Gaps = 2/40 (5%)
 Frame = +1

Query  76   MAERMGRYGVGXALAPKKQASFIQTSLVNLARXRGIDLVK  195
            MAE  GR+ VG AL PKK+ SFIQ SLV LA  RG+DLV+
Sbjct  1    MAE--GRFRVGYALLPKKRESFIQDSLVALAGSRGVDLVR  38



>ref|XP_010053625.1| PREDICTED: LOW QUALITY PROTEIN: inositol-tetrakisphosphate 1-kinase 
1-like [Eucalyptus grandis]
Length=376

 Score = 49.7 bits (117),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 26/40 (65%), Positives = 30/40 (75%), Gaps = 2/40 (5%)
 Frame = +1

Query  76   MAERMGRYGVGXALAPKKQASFIQTSLVNLARXRGIDLVK  195
            MAE  GR+ VG AL PKK+ SFIQ SLV LA  RG+DLV+
Sbjct  1    MAE--GRFRVGYALLPKKRESFIQDSLVALAGSRGVDLVR  38



>gb|EYU45388.1| hypothetical protein MIMGU_mgv1a010042mg [Erythranthe guttata]
Length=324

 Score = 49.3 bits (116),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 24/39 (62%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = +1

Query  76   MAERMGRYGVGXALAPKKQASFIQTSLVNLARXRGIDLV  192
            MA +   Y +G ALAPKK  SFIQ SLVNLA  RGI+L+
Sbjct  1    MAGKTTTYRIGYALAPKKIQSFIQPSLVNLAEERGIELI  39



>ref|XP_010933449.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 1-like [Elaeis 
guineensis]
 ref|XP_010933450.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 1-like [Elaeis 
guineensis]
 ref|XP_010933451.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 1-like [Elaeis 
guineensis]
Length=349

 Score = 49.3 bits (116),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 24/33 (73%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = +1

Query  94   RYGVGXALAPKKQASFIQTSLVNLARXRGIDLV  192
            R+ +G ALAPKKQ SFIQ SLV LA  RGIDLV
Sbjct  8    RFLIGYALAPKKQQSFIQPSLVGLAADRGIDLV  40



>ref|XP_008786347.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 1-like [Phoenix 
dactylifera]
Length=350

 Score = 49.3 bits (116),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 24/33 (73%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = +1

Query  94   RYGVGXALAPKKQASFIQTSLVNLARXRGIDLV  192
            R+ +G ALAPKKQ SFIQ SLV LA  RGIDLV
Sbjct  8    RFLIGYALAPKKQQSFIQPSLVGLAADRGIDLV  40



>ref|XP_008796245.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 1-like [Phoenix 
dactylifera]
 ref|XP_008796246.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 1-like [Phoenix 
dactylifera]
Length=350

 Score = 48.9 bits (115),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 26/40 (65%), Positives = 30/40 (75%), Gaps = 1/40 (3%)
 Frame = +1

Query  76   MAERMGR-YGVGXALAPKKQASFIQTSLVNLARXRGIDLV  192
            MAE + R + +G ALAPKKQ SFI+ SLV LA  RGIDLV
Sbjct  1    MAEHLRRRFVIGYALAPKKQQSFIRPSLVGLAAGRGIDLV  40



>ref|XP_002464877.1| hypothetical protein SORBIDRAFT_01g028090 [Sorghum bicolor]
 gb|EER91875.1| hypothetical protein SORBIDRAFT_01g028090 [Sorghum bicolor]
Length=342

 Score = 48.9 bits (115),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 23/33 (70%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = +1

Query  94   RYGVGXALAPKKQASFIQTSLVNLARXRGIDLV  192
            RY +G ALAPKKQ SFIQ SLV  A  RG+DLV
Sbjct  18   RYAIGYALAPKKQQSFIQPSLVAQAAARGMDLV  50



>ref|XP_004983548.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 1-like [Setaria 
italica]
Length=347

 Score = 48.9 bits (115),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 23/33 (70%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = +1

Query  94   RYGVGXALAPKKQASFIQTSLVNLARXRGIDLV  192
            RY +G ALAPKKQ SFIQ SLV  A  RG+DLV
Sbjct  23   RYAIGYALAPKKQQSFIQPSLVARAAARGMDLV  55



>ref|XP_004509737.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 1-like [Cicer 
arietinum]
Length=345

 Score = 48.9 bits (115),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 26/41 (63%), Positives = 33/41 (80%), Gaps = 3/41 (7%)
 Frame = +1

Query  76   MAERMGRYGV-GXALAPKKQASFIQTSLVNLARXRGIDLVK  195
            MAE+  R+GV G ALAPKKQ SFI+ SL+ LA+ RGI+LV+
Sbjct  1    MAEK--RFGVIGYALAPKKQNSFIRDSLLTLAKSRGIELVR  39



>ref|XP_007158285.1| hypothetical protein PHAVU_002G139700g [Phaseolus vulgaris]
 gb|ESW30279.1| hypothetical protein PHAVU_002G139700g [Phaseolus vulgaris]
Length=304

 Score = 48.5 bits (114),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 24/32 (75%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +1

Query  97   YGVGXALAPKKQASFIQTSLVNLARXRGIDLV  192
            + VG AL  KKQ+SFIQ SLVNLAR RGIDLV
Sbjct  7    FRVGYALLMKKQSSFIQDSLVNLARSRGIDLV  38



>emb|CDX78705.1| BnaA03g06170D [Brassica napus]
Length=326

 Score = 48.5 bits (114),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 23/34 (68%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +1

Query  94   RYGVGXALAPKKQASFIQTSLVNLARXRGIDLVK  195
            RY VG ALA KKQ SFIQ SL+  +R RGIDL+K
Sbjct  9    RYRVGYALASKKQHSFIQPSLIEHSRQRGIDLIK  42



>ref|XP_010549846.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 1-like [Tarenaya 
hassleriana]
Length=347

 Score = 48.5 bits (114),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 23/34 (68%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +1

Query  94   RYGVGXALAPKKQASFIQTSLVNLARXRGIDLVK  195
            RY VG ALAPKK+ SF++ SL+  AR RGIDLVK
Sbjct  8    RYLVGYALAPKKEHSFMRPSLIEHARQRGIDLVK  41



>gb|AAC28859.1| inositol 1,3,4-trisphosphate 5/6-kinase [Arabidopsis thaliana]
Length=319

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 24/34 (71%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +1

Query  94   RYGVGXALAPKKQASFIQTSLVNLARXRGIDLVK  195
            RY VG ALA KKQ SFIQ SL+  +R RGIDLVK
Sbjct  8    RYLVGYALAAKKQHSFIQPSLIEHSRQRGIDLVK  41



>ref|NP_197178.1| inositol-tetrakisphosphate 1-kinase 1 [Arabidopsis thaliana]
 sp|Q9SBA5.1|ITPK1_ARATH RecName: Full=Inositol-tetrakisphosphate 1-kinase 1; AltName: 
Full=Inositol 1,3,4-trisphosphate 5/6-kinase 1; Short=AtItpk-1; 
Short=Inositol-triphosphate 5/6-kinase 1; Short=Ins(1,3,4)P(3) 
5/6-kinase 1 [Arabidopsis thaliana]
 emb|CAA04976.1| Inositol 1,3,4-Trisphosphate 5/6 kinase [Arabidopsis thaliana]
 emb|CAC01840.1| Inositol 1, 3, 4-Trisphosphate 5/6 kinase [Arabidopsis thaliana]
 gb|AAL59978.1| putative Inositol 1,3,4-Trisphosphate 5/6 kinase [Arabidopsis 
thaliana]
 gb|AAM20052.1| putative inositol 1,3,4-trisphosphate 5/6 kinase [Arabidopsis 
thaliana]
 gb|AAM64585.1| inositol 1,3,4-Trisphosphate 5/6 kinase [Arabidopsis thaliana]
 gb|AED92334.1| inositol-tetrakisphosphate 1-kinase 1 [Arabidopsis thaliana]
Length=319

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 24/34 (71%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +1

Query  94   RYGVGXALAPKKQASFIQTSLVNLARXRGIDLVK  195
            RY VG ALA KKQ SFIQ SL+  +R RGIDLVK
Sbjct  8    RYLVGYALAAKKQHSFIQPSLIEHSRQRGIDLVK  41



>ref|XP_006288234.1| hypothetical protein CARUB_v10001475mg [Capsella rubella]
 gb|EOA21132.1| hypothetical protein CARUB_v10001475mg [Capsella rubella]
Length=319

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 24/34 (71%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +1

Query  94   RYGVGXALAPKKQASFIQTSLVNLARXRGIDLVK  195
            RY VG ALA KKQ SFIQ SL+  +R RGIDLVK
Sbjct  8    RYLVGYALAAKKQHSFIQPSLIEHSRQRGIDLVK  41



>ref|XP_002871735.1| inositol 1,3,4-trisphosphate 5/6-kinase [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47994.1| inositol 1,3,4-trisphosphate 5/6-kinase [Arabidopsis lyrata subsp. 
lyrata]
Length=320

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 24/34 (71%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +1

Query  94   RYGVGXALAPKKQASFIQTSLVNLARXRGIDLVK  195
            RY VG ALA KKQ SFIQ SL+  +R RGIDLVK
Sbjct  9    RYLVGYALAAKKQHSFIQPSLIEHSRQRGIDLVK  42



>ref|XP_004148764.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 1-like [Cucumis 
sativus]
 ref|XP_004165055.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 1-like [Cucumis 
sativus]
 gb|KGN55739.1| hypothetical protein Csa_3G009450 [Cucumis sativus]
Length=363

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 22/34 (65%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +1

Query  94   RYGVGXALAPKKQASFIQTSLVNLARXRGIDLVK  195
            R+ +G ALAPKK+ SFIQ SLV LA  RG+DLV+
Sbjct  5    RFCIGYALAPKKRHSFIQDSLVTLAASRGVDLVR  38



>ref|XP_010492601.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 1-like [Camelina 
sativa]
Length=321

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 24/34 (71%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +1

Query  94   RYGVGXALAPKKQASFIQTSLVNLARXRGIDLVK  195
            RY VG ALA KKQ SFIQ SL+  +R RGIDLVK
Sbjct  8    RYLVGYALAAKKQHSFIQPSLIEHSRQRGIDLVK  41



>ref|XP_010420378.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 1-like [Camelina 
sativa]
Length=321

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 24/34 (71%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +1

Query  94   RYGVGXALAPKKQASFIQTSLVNLARXRGIDLVK  195
            RY VG ALA KKQ SFIQ SL+  +R RGIDLVK
Sbjct  8    RYLVGYALAAKKQHSFIQPSLIEHSRQRGIDLVK  41



>emb|CDX69422.1| BnaA10g17710D [Brassica napus]
Length=319

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 23/34 (68%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +1

Query  94   RYGVGXALAPKKQASFIQTSLVNLARXRGIDLVK  195
            RY VG ALA KKQ SFIQ SL+  +R RGIDL+K
Sbjct  8    RYVVGYALAEKKQNSFIQPSLIEHSRRRGIDLIK  41



>ref|XP_009121452.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 1 [Brassica rapa]
Length=320

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 23/34 (68%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +1

Query  94   RYGVGXALAPKKQASFIQTSLVNLARXRGIDLVK  195
            RY VG ALA KKQ SFIQ SL+  +R RGIDL+K
Sbjct  8    RYVVGYALAEKKQNSFIQPSLIEHSRRRGIDLIK  41



>ref|XP_006662634.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 1-like [Oryza 
brachyantha]
Length=337

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 23/33 (70%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = +1

Query  94   RYGVGXALAPKKQASFIQTSLVNLARXRGIDLV  192
            RY +G ALAPKKQ SFIQ SL+  A  RGIDLV
Sbjct  13   RYVIGYALAPKKQQSFIQPSLLTRAAARGIDLV  45



>emb|CDY16981.1| BnaC09g41080D [Brassica napus]
Length=319

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 23/34 (68%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +1

Query  94   RYGVGXALAPKKQASFIQTSLVNLARXRGIDLVK  195
            RY VG ALA KKQ SFIQ SL+  +R RGIDL+K
Sbjct  8    RYVVGYALAEKKQNSFIQPSLIGHSRQRGIDLIK  41



>gb|EAZ17077.1| hypothetical protein OsJ_32575 [Oryza sativa Japonica Group]
Length=308

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 23/33 (70%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = +1

Query  94   RYGVGXALAPKKQASFIQTSLVNLARXRGIDLV  192
            RY +G ALAPKKQ SFIQ SLV+ A  RG+DLV
Sbjct  15   RYLIGYALAPKKQQSFIQPSLVSRAAGRGMDLV  47



>gb|EAY79626.1| hypothetical protein OsI_34771 [Oryza sativa Indica Group]
Length=336

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 23/33 (70%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = +1

Query  94   RYGVGXALAPKKQASFIQTSLVNLARXRGIDLV  192
            RY +G ALAPKKQ SFIQ SLV+ A  RG+DLV
Sbjct  9    RYLIGYALAPKKQQSFIQPSLVSRAAGRGMDLV  41



>sp|Q7XBW0.1|ITPK5_ORYSJ RecName: Full=Inositol-tetrakisphosphate 1-kinase 5; AltName: 
Full=Inositol 1,3,4-trisphosphate 5/6-kinase 5; Short=Inositol-triphosphate 
5/6-kinase 5; Short=Ins(1,3,4)P(3) 5/6-kinase 
5; Short=OsITP5/6K-5; Short=OsITPK5; AltName: Full=OsITL3 
[Oryza sativa Japonica Group]
 sp|A0JJZ6.1|ITPK5_ORYSI RecName: Full=Inositol-tetrakisphosphate 1-kinase 5; AltName: 
Full=Inositol 1,3,4-trisphosphate 5/6-kinase 5; Short=Inositol-triphosphate 
5/6-kinase 5; Short=Ins(1,3,4)P(3) 5/6-kinase 
5; Short=OsITP5/6K-5; Short=OsITPK5 [Oryza sativa Indica 
Group]
 gb|AAL67584.1|AC018929_6 putative inositol 1,3,4-trisphosphate 5/6-kinase [Oryza sativa 
Japonica Group]
 gb|AAP55148.1| inositol phosphate kinase, putative, expressed [Oryza sativa 
Japonica Group]
 emb|CAL69001.1| inositol phosphate kinase [Oryza sativa Indica Group]
 dbj|BAG86903.1| unnamed protein product [Oryza sativa Japonica Group]
Length=342

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 23/33 (70%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = +1

Query  94   RYGVGXALAPKKQASFIQTSLVNLARXRGIDLV  192
            RY +G ALAPKKQ SFIQ SLV+ A  RG+DLV
Sbjct  15   RYLIGYALAPKKQQSFIQPSLVSRAAGRGMDLV  47



>ref|NP_001065485.1| Os10g0576100 [Oryza sativa Japonica Group]
 dbj|BAF27322.1| Os10g0576100, partial [Oryza sativa Japonica Group]
Length=355

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 23/33 (70%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = +1

Query  94   RYGVGXALAPKKQASFIQTSLVNLARXRGIDLV  192
            RY +G ALAPKKQ SFIQ SLV+ A  RG+DLV
Sbjct  28   RYLIGYALAPKKQQSFIQPSLVSRAAGRGMDLV  60



>ref|XP_010558621.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 1-like [Tarenaya 
hassleriana]
Length=354

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 23/34 (68%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +1

Query  94   RYGVGXALAPKKQASFIQTSLVNLARXRGIDLVK  195
            RY VG ALA KK+ SFIQ SL+  AR RGIDL+K
Sbjct  8    RYLVGYALASKKEHSFIQPSLIEHARQRGIDLIK  41



>gb|EPS70258.1| hypothetical protein M569_04497, partial [Genlisea aurea]
Length=308

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 22/34 (65%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +1

Query  94   RYGVGXALAPKKQASFIQTSLVNLARXRGIDLVK  195
            R+ VG ALA KKQASFIQ SL+ +A  R +DLVK
Sbjct  2    RFNVGYALASKKQASFIQISLLTVAESRSVDLVK  35



>gb|ACG37127.1| inositol-tetrakisphosphate 1-kinase 1 [Zea mays]
Length=342

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 23/33 (70%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = +1

Query  94   RYGVGXALAPKKQASFIQTSLVNLARXRGIDLV  192
            RY +G ALAPKKQ SFIQ SLV  A  RG+DLV
Sbjct  18   RYVIGYALAPKKQQSFIQPSLVAQAASRGMDLV  50



>ref|NP_001105901.1| inositol-tetrakisphosphate 1-kinase 1 [Zea mays]
 sp|Q84Y01.1|ITPK1_MAIZE RecName: Full=Inositol-tetrakisphosphate 1-kinase 1; AltName: 
Full=Inositol 1,3,4-trisphosphate 5/6-kinase 1; Short=Inositol-triphosphate 
5/6-kinase 1; Short=Ins(1,3,4)P(3) 5/6-kinase 
1; AltName: Full=Low phytic acid protein 2; AltName: Full=ZmIpk 
[Zea mays]
 gb|AAO17299.1| inositol phosphate kinase [Zea mays]
 gb|ACN27614.1| unknown [Zea mays]
 tpg|DAA46460.1| TPA: low phytic acid2 [Zea mays]
Length=342

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 23/33 (70%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = +1

Query  94   RYGVGXALAPKKQASFIQTSLVNLARXRGIDLV  192
            RY +G ALAPKKQ SFIQ SLV  A  RG+DLV
Sbjct  18   RYVIGYALAPKKQQSFIQPSLVAQAASRGMDLV  50



>ref|XP_010235046.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 1 [Brachypodium 
distachyon]
Length=348

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 25/40 (63%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = +1

Query  73   SMAERMGRYGVGXALAPKKQASFIQTSLVNLARXRGIDLV  192
            S A+   RY VG ALAPKKQ SFIQ SL++ A  R IDLV
Sbjct  9    SSADTSRRYVVGYALAPKKQQSFIQPSLLSRASSRDIDLV  48



>emb|CDX70710.1| BnaC03g07940D [Brassica napus]
Length=324

 Score = 47.0 bits (110),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 22/34 (65%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +1

Query  94   RYGVGXALAPKKQASFIQTSLVNLARXRGIDLVK  195
            RY VG ALA KK+ SFIQ SL+  +R RGIDL+K
Sbjct  9    RYRVGYALAAKKENSFIQPSLIEHSRQRGIDLIK  42



>ref|XP_009131556.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 1-like [Brassica 
rapa]
Length=322

 Score = 47.0 bits (110),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 22/34 (65%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +1

Query  94   RYGVGXALAPKKQASFIQTSLVNLARXRGIDLVK  195
            RY VG ALA KK+ SFIQ SL+  +R RGIDL+K
Sbjct  9    RYRVGYALAAKKEHSFIQPSLIEHSRQRGIDLIK  42



>ref|XP_010453843.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 1 [Camelina sativa]
Length=320

 Score = 47.0 bits (110),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 23/34 (68%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +1

Query  94   RYGVGXALAPKKQASFIQTSLVNLARXRGIDLVK  195
            RY VG ALA KKQ SFIQ SL+  ++ RGIDLVK
Sbjct  8    RYLVGYALAAKKQHSFIQPSLIEHSKQRGIDLVK  41



>ref|XP_002975059.1| hypothetical protein SELMODRAFT_228325 [Selaginella moellendorffii]
 gb|EFJ23844.1| hypothetical protein SELMODRAFT_228325 [Selaginella moellendorffii]
Length=316

 Score = 47.0 bits (110),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 23/33 (70%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = +1

Query  94   RYGVGXALAPKKQASFIQTSLVNLARXRGIDLV  192
            R+ VG ALA KKQ SF+Q SLV  AR RGIDLV
Sbjct  6    RFEVGYALAQKKQKSFVQPSLVEHARSRGIDLV  38



>ref|XP_006400218.1| hypothetical protein EUTSA_v10014130mg [Eutrema salsugineum]
 gb|ESQ41671.1| hypothetical protein EUTSA_v10014130mg [Eutrema salsugineum]
Length=319

 Score = 47.0 bits (110),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 23/34 (68%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +1

Query  94   RYGVGXALAPKKQASFIQTSLVNLARXRGIDLVK  195
            RY VG ALA KK+ SFIQ SL+  +R RGIDLVK
Sbjct  8    RYIVGYALAAKKEHSFIQPSLIEHSRQRGIDLVK  41



>ref|XP_002303428.2| hypothetical protein POPTR_0003s09290g [Populus trichocarpa]
 gb|EEE78407.2| hypothetical protein POPTR_0003s09290g [Populus trichocarpa]
Length=351

 Score = 47.0 bits (110),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 25/40 (63%), Positives = 30/40 (75%), Gaps = 1/40 (3%)
 Frame = +1

Query  76   MAERMGRYGVGXALAPKKQASFIQTSLVNLARXRGIDLVK  195
            MA+ M R  VG AL PKKQ SFIQ SL++L + RGIDLV+
Sbjct  1    MADDM-RGVVGYALLPKKQQSFIQDSLLSLCKSRGIDLVR  39



>ref|XP_011028157.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 1-like [Populus 
euphratica]
Length=360

 Score = 47.0 bits (110),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 25/40 (63%), Positives = 30/40 (75%), Gaps = 1/40 (3%)
 Frame = +1

Query  76   MAERMGRYGVGXALAPKKQASFIQTSLVNLARXRGIDLVK  195
            MA+ M R  VG AL PKKQ SFIQ SL++L + RGIDLV+
Sbjct  1    MADDM-RGVVGYALLPKKQQSFIQDSLLSLCKSRGIDLVR  39



>emb|CAL49035.1| inositol phosphate kinase [Hordeum vulgare]
Length=347

 Score = 47.0 bits (110),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 22/33 (67%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = +1

Query  94   RYGVGXALAPKKQASFIQTSLVNLARXRGIDLV  192
            RY VG ALAPKKQ SFI+ SL++ A  RG+DLV
Sbjct  18   RYVVGYALAPKKQNSFIKPSLISRAAARGVDLV  50



>gb|EMS68297.1| Inositol-tetrakisphosphate 1-kinase 1 [Triticum urartu]
Length=357

 Score = 47.0 bits (110),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 22/33 (67%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = +1

Query  94   RYGVGXALAPKKQASFIQTSLVNLARXRGIDLV  192
            RY VG ALAPKKQ SFI+ SL++ A  RG+DLV
Sbjct  20   RYVVGYALAPKKQNSFIKPSLISRAAARGVDLV  52



>ref|XP_002974206.1| hypothetical protein SELMODRAFT_232261 [Selaginella moellendorffii]
 gb|EFJ24428.1| hypothetical protein SELMODRAFT_232261 [Selaginella moellendorffii]
Length=316

 Score = 46.2 bits (108),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 22/33 (67%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = +1

Query  94   RYGVGXALAPKKQASFIQTSLVNLARXRGIDLV  192
            R+ VG ALA KKQ SF+Q SLV  AR RGID+V
Sbjct  6    RFEVGYALAQKKQKSFVQPSLVEHARSRGIDMV  38



>ref|XP_011018535.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 1-like [Populus 
euphratica]
Length=359

 Score = 46.2 bits (108),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 21/31 (68%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +1

Query  103  VGXALAPKKQASFIQTSLVNLARXRGIDLVK  195
            VG AL PKKQ SFIQ SL++L R +G+DLVK
Sbjct  9    VGYALLPKKQQSFIQDSLLSLCRSKGVDLVK  39



>gb|KFK25896.1| hypothetical protein AALP_AA8G176700 [Arabis alpina]
Length=317

 Score = 45.8 bits (107),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 22/34 (65%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +1

Query  94   RYGVGXALAPKKQASFIQTSLVNLARXRGIDLVK  195
            RY VG ALA KK+ SFIQ SL+  ++ RGIDLVK
Sbjct  5    RYLVGYALAAKKEQSFIQPSLIEHSKKRGIDLVK  38



>ref|XP_007156414.1| hypothetical protein PHAVU_003G284100g [Phaseolus vulgaris]
 gb|ESW28408.1| hypothetical protein PHAVU_003G284100g [Phaseolus vulgaris]
Length=341

 Score = 45.8 bits (107),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 23/40 (58%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +1

Query  76   MAERMGRYGVGXALAPKKQASFIQTSLVNLARXRGIDLVK  195
            MAE      +G ALAPKKQ SFI+ SL+ LA+ RGI+LV+
Sbjct  1    MAENTFGGVIGYALAPKKQNSFIRDSLLTLAKSRGIELVR  40



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 566806126740