BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001N03

Length=599
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006359862.1|  PREDICTED: 39S ribosomal protein L46, mitoch...    249   9e-80   Solanum tuberosum [potatoes]
ref|XP_004236846.1|  PREDICTED: 39S ribosomal protein L46, mitoch...    248   3e-79   Solanum lycopersicum
ref|XP_004247399.1|  PREDICTED: 39S ribosomal protein L46, mitoch...    248   4e-79   Solanum lycopersicum
ref|XP_006359291.1|  PREDICTED: 39S ribosomal protein L46, mitoch...    244   8e-78   Solanum tuberosum [potatoes]
ref|XP_011093029.1|  PREDICTED: 39S ribosomal protein L46, mitoch...    239   1e-75   Sesamum indicum [beniseed]
ref|XP_009784201.1|  PREDICTED: 39S ribosomal protein L46, mitoch...    238   3e-75   Nicotiana sylvestris
ref|XP_009610439.1|  PREDICTED: 39S ribosomal protein L46, mitoch...    236   2e-74   Nicotiana tomentosiformis
gb|EYU32177.1|  hypothetical protein MIMGU_mgv1a012774mg                234   8e-74   Erythranthe guttata [common monkey flower]
gb|KEH18785.1|  39S ribosomal protein L46                               234   9e-74   Medicago truncatula
ref|XP_004510692.1|  PREDICTED: 39S ribosomal protein L46, mitoch...    234   1e-73   Cicer arietinum [garbanzo]
ref|XP_007051699.1|  Decoy isoform 2                                    231   1e-73   
ref|XP_007051698.1|  Decoy isoform 1                                    231   8e-73   
ref|XP_004494826.1|  PREDICTED: 39S ribosomal protein L46, mitoch...    231   1e-72   Cicer arietinum [garbanzo]
ref|XP_004494827.1|  PREDICTED: 39S ribosomal protein L46, mitoch...    230   3e-72   Cicer arietinum [garbanzo]
gb|AET04314.2|  39S ribosomal protein L46                               229   7e-72   Medicago truncatula
ref|XP_003629838.1|  39S ribosomal protein L46                          230   2e-71   
emb|CAN73362.1|  hypothetical protein VITISV_006167                     229   2e-71   Vitis vinifera
ref|XP_010661810.1|  PREDICTED: 39S ribosomal protein L46, mitoch...    224   6e-70   Vitis vinifera
ref|XP_010559102.1|  PREDICTED: 54S ribosomal protein L17, mitoch...    224   1e-69   Tarenaya hassleriana [spider flower]
ref|NP_001145941.1|  uncharacterized protein LOC100279464               222   3e-69   
ref|XP_010112966.1|  hypothetical protein L484_021487                   221   8e-69   Morus notabilis
gb|AFW86415.1|  hypothetical protein ZEAMMB73_080636                    221   1e-68   
ref|XP_006656026.1|  PREDICTED: 39S ribosomal protein L46, mitoch...    221   1e-68   Oryza brachyantha
ref|XP_007147685.1|  hypothetical protein PHAVU_006G145900g             220   2e-68   Phaseolus vulgaris [French bean]
ref|XP_004965300.1|  PREDICTED: 39S ribosomal protein L46, mitoch...    219   2e-67   Setaria italica
ref|XP_002511925.1|  DECOY, putative                                    219   2e-67   Ricinus communis
ref|XP_003563932.1|  PREDICTED: 39S ribosomal protein L46, mitoch...    217   5e-67   Brachypodium distachyon [annual false brome]
ref|XP_002438278.1|  hypothetical protein SORBIDRAFT_10g011040          217   8e-67   Sorghum bicolor [broomcorn]
ref|XP_010679139.1|  PREDICTED: 39S ribosomal protein L46, mitoch...    215   2e-66   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_001057451.1|  Os06g0300600                                       216   2e-66   
gb|EEC80450.1|  hypothetical protein OsI_22651                          216   2e-66   Oryza sativa Indica Group [Indian rice]
ref|XP_006598926.1|  PREDICTED: 39S ribosomal protein L46, mitoch...    214   3e-66   Glycine max [soybeans]
gb|KHN18820.1|  39S ribosomal protein L46, mitochondrial                214   5e-66   Glycine soja [wild soybean]
ref|XP_003548630.1|  PREDICTED: 39S ribosomal protein L46, mitoch...    214   5e-66   Glycine max [soybeans]
ref|XP_003534686.1|  PREDICTED: 39S ribosomal protein L46, mitoch...    213   1e-65   
gb|ACU23195.1|  unknown                                                 213   2e-65   Glycine max [soybeans]
gb|KDP46856.1|  hypothetical protein JCGZ_24065                         212   3e-65   Jatropha curcas
gb|KGN44851.1|  hypothetical protein Csa_7G391280                       213   4e-65   Cucumis sativus [cucumbers]
dbj|BAJ99373.1|  predicted protein                                      212   8e-65   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004148875.1|  PREDICTED: 39S ribosomal protein L46, mitoch...    211   9e-65   Cucumis sativus [cucumbers]
ref|XP_008451408.1|  PREDICTED: 54S ribosomal protein L17, mitoch...    211   1e-64   Cucumis melo [Oriental melon]
emb|CDP08755.1|  unnamed protein product                                211   1e-64   Coffea canephora [robusta coffee]
ref|XP_003546166.1|  PREDICTED: 39S ribosomal protein L46, mitoch...    210   2e-64   
gb|ACU19535.1|  unknown                                                 210   2e-64   Glycine max [soybeans]
ref|XP_008451409.1|  PREDICTED: 54S ribosomal protein L17, mitoch...    210   2e-64   Cucumis melo [Oriental melon]
ref|XP_002461132.1|  hypothetical protein SORBIDRAFT_02g041260          210   2e-64   Sorghum bicolor [broomcorn]
ref|XP_004307545.1|  PREDICTED: 39S ribosomal protein L46, mitoch...    210   2e-64   Fragaria vesca subsp. vesca
gb|KJB24643.1|  hypothetical protein B456_004G155200                    208   1e-63   Gossypium raimondii
ref|XP_002892819.1|  hypothetical protein ARALYDRAFT_888845             206   6e-63   Arabidopsis lyrata subsp. lyrata
ref|XP_006444943.1|  hypothetical protein CICLE_v10021940mg             206   1e-62   
gb|EPS64107.1|  hypothetical protein M569_10674                         205   1e-62   Genlisea aurea
ref|XP_010458967.1|  PREDICTED: 54S ribosomal protein L17, mitoch...    205   2e-62   Camelina sativa [gold-of-pleasure]
ref|NP_001154338.1|  protein decoy                                      205   2e-62   Arabidopsis thaliana [mouse-ear cress]
ref|NP_172914.1|  protein decoy                                         205   2e-62   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010252867.1|  PREDICTED: 39S ribosomal protein L46, mitoch...    205   2e-62   Nelumbo nucifera [Indian lotus]
ref|XP_006306556.1|  hypothetical protein CARUB_v10012651mg             204   3e-62   Capsella rubella
gb|KCW80911.1|  hypothetical protein EUGRSUZ_C02275                     206   5e-62   Eucalyptus grandis [rose gum]
ref|XP_009133763.1|  PREDICTED: 39S ribosomal protein L46, mitoch...    204   6e-62   Brassica rapa
ref|XP_009142409.1|  PREDICTED: 39S ribosomal protein L46, mitoch...    204   7e-62   Brassica rapa
gb|EMT05997.1|  hypothetical protein F775_31074                         216   8e-62   
ref|XP_010496294.1|  PREDICTED: 39S ribosomal protein L46, mitoch...    203   9e-62   Camelina sativa [gold-of-pleasure]
ref|XP_006444940.1|  hypothetical protein CICLE_v10021940mg             203   9e-62   Citrus clementina [clementine]
emb|CDY37090.1|  BnaA04g26680D                                          204   1e-61   Brassica napus [oilseed rape]
ref|XP_010048602.1|  PREDICTED: 39S ribosomal protein L46, mitoch...    202   2e-61   Eucalyptus grandis [rose gum]
ref|XP_006416994.1|  hypothetical protein EUTSA_v10008660mg             202   2e-61   Eutrema salsugineum [saltwater cress]
emb|CDX95682.1|  BnaC03g25630D                                          202   3e-61   
gb|AAB48039.1|  decoy                                                   201   4e-61   Arabidopsis thaliana [mouse-ear cress]
gb|KFK43707.1|  hypothetical protein AALP_AA1G162600                    201   7e-61   Arabis alpina [alpine rockcress]
ref|XP_002301376.2|  hypothetical protein POPTR_0002s16630g             201   1e-60   
ref|XP_006857649.1|  hypothetical protein AMTR_s00061p00143360          200   2e-60   Amborella trichopoda
ref|XP_011023270.1|  PREDICTED: 39S ribosomal protein L46, mitoch...    199   6e-60   Populus euphratica
ref|XP_009391791.1|  PREDICTED: 54S ribosomal protein L17, mitoch...    198   8e-60   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008371440.1|  PREDICTED: 54S ribosomal protein L17, mitoch...    198   1e-59   Malus domestica [apple tree]
ref|XP_009378423.1|  PREDICTED: 39S ribosomal protein L46, mitoch...    197   2e-59   Pyrus x bretschneideri [bai li]
ref|XP_007218304.1|  hypothetical protein PRUPE_ppa010842mg             196   7e-59   Prunus persica
ref|XP_008233590.1|  PREDICTED: 39S ribosomal protein L46, mitoch...    195   1e-58   Prunus mume [ume]
ref|XP_009357695.1|  PREDICTED: 39S ribosomal protein L46, mitoch...    195   1e-58   Pyrus x bretschneideri [bai li]
ref|XP_009347441.1|  PREDICTED: 54S ribosomal protein L17, mitoch...    195   2e-58   Pyrus x bretschneideri [bai li]
ref|XP_010928038.1|  PREDICTED: 39S ribosomal protein L46, mitoch...    194   4e-58   Elaeis guineensis
ref|XP_006444944.1|  hypothetical protein CICLE_v10021940mg             191   8e-58   
emb|CDY27332.1|  BnaC04g50730D                                          202   2e-57   Brassica napus [oilseed rape]
ref|XP_006444942.1|  hypothetical protein CICLE_v10021940mg             188   1e-56   
ref|XP_010928037.1|  PREDICTED: 39S ribosomal protein L46, mitoch...    186   6e-55   
gb|AAF63174.1|AC010657_10  T5E21.12                                     184   4e-54   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006359292.1|  PREDICTED: 39S ribosomal protein L46, mitoch...    176   1e-51   
gb|KJB61927.1|  hypothetical protein B456_009G392100                    169   9e-49   Gossypium raimondii
gb|EAZ36734.1|  hypothetical protein OsJ_21070                          155   8e-43   Oryza sativa Japonica Group [Japonica rice]
ref|XP_001752736.1|  predicted protein                                  154   2e-42   
emb|CDY23448.1|  BnaC04g49760D                                          160   3e-42   Brassica napus [oilseed rape]
ref|XP_004158950.1|  PREDICTED: 39S ribosomal protein L46, mitoch...    149   1e-40   
gb|KEH24642.1|  decoy                                                   141   1e-38   Medicago truncatula
ref|XP_009793597.1|  PREDICTED: 39S ribosomal protein L46, mitoch...    134   1e-35   Nicotiana sylvestris
gb|EMS58710.1|  hypothetical protein TRIUR3_26422                       142   3e-35   Triticum urartu
ref|XP_008809307.1|  PREDICTED: 39S ribosomal protein L46, mitoch...    129   6e-34   
gb|KJB24644.1|  hypothetical protein B456_004G155200                    110   4e-26   Gossypium raimondii
gb|KHG07503.1|  39S ribosomal L46, mitochondrial                      89.0    9e-19   Gossypium arboreum [tree cotton]
ref|XP_002985848.1|  hypothetical protein SELMODRAFT_424892           88.6    5e-18   Selaginella moellendorffii
ref|XP_002984785.1|  hypothetical protein SELMODRAFT_446047           87.4    1e-17   Selaginella moellendorffii
ref|XP_005846128.1|  hypothetical protein CHLNCDRAFT_53397            83.6    5e-16   Chlorella variabilis
ref|XP_011016234.1|  PREDICTED: 39S ribosomal protein L46, mitoch...  81.6    6e-16   Populus euphratica
ref|XP_005650541.1|  hypothetical protein COCSUDRAFT_60992            82.4    8e-16   Coccomyxa subellipsoidea C-169
ref|XP_011398740.1|  39S ribosomal protein L46, mitochondrial         73.2    1e-12   Auxenochlorella protothecoides
ref|XP_006359294.1|  PREDICTED: uncharacterized protein LOC102591608  69.3    2e-12   
ref|XP_002508846.1|  predicted protein                                71.2    5e-12   Micromonas commoda
ref|XP_010246565.1|  PREDICTED: 39S ribosomal protein L46, mitoch...  70.1    5e-12   Nelumbo nucifera [Indian lotus]
ref|XP_005536202.1|  mitochondrial ribosomal protein L46              71.6    2e-11   Cyanidioschyzon merolae strain 10D
ref|XP_003083852.1|  Mitochondrial ribosomal protein L17 (ISS)        67.8    1e-10   Ostreococcus tauri
ref|XP_635795.1|  hypothetical protein DDB_G0290311                   68.6    2e-10   Dictyostelium discoideum AX4
ref|XP_004988034.1|  hypothetical protein PTSG_13142                  65.1    2e-09   Salpingoeca rosetta
ref|XP_004172215.1|  PREDICTED: 39S ribosomal protein L46, mitoch...  62.0    4e-09   
ref|XP_005715454.1|  unnamed protein product                          63.2    9e-09   Chondrus crispus [carageen]
ref|XP_002291686.1|  predicted protein                                63.5    1e-08   Thalassiosira pseudonana CCMP1335
ref|XP_001660444.1|  AAEL009833-PA                                    62.0    2e-08   
ref|XP_009418190.1|  PREDICTED: uncharacterized protein LOC103998440  57.0    1e-07   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004341522.1|  hydrolase, NUDIX domain containing protein       59.7    2e-07   Acanthamoeba castellanii str. Neff
ref|XP_002985937.1|  hypothetical protein SELMODRAFT_424881           57.4    3e-07   
gb|EMP35226.1|  39S ribosomal protein L46                             56.2    5e-07   Chelonia mydas [green seaturtle]
ref|XP_003063987.1|  predicted protein                                58.2    6e-07   Micromonas pusilla CCMP1545
gb|EKV16030.1|  50S ribosomal subunit L30                             58.2    6e-07   Penicillium digitatum Pd1
gb|EPT05402.1|  hypothetical protein FOMPIDRAFT_1039417               57.8    8e-07   Fomitopsis pinicola FP-58527 SS1
ref|XP_001402265.2|  mitochondrial 54S ribosomal protein YmL17/YmL30  57.8    8e-07   Aspergillus niger CBS 513.88
gb|KGO63190.1|  Ribosomal protein L46                                 57.8    9e-07   Penicillium expansum
gb|KGO45328.1|  Ribosomal protein L46                                 57.8    9e-07   Penicillium expansum
gb|EOB03109.1|  39S ribosomal protein L46, mitochondrial              56.6    9e-07   Anas platyrhynchos [duck]
emb|CDM31272.1|  NUDIX hydrolase domain-like                          57.8    1e-06   Penicillium roqueforti FM164
gb|KGO65591.1|  Ribosomal protein L46                                 57.8    1e-06   Penicillium italicum
ref|XP_005017173.1|  PREDICTED: 39S ribosomal protein L46, mitoch...  56.6    1e-06   
ref|XP_002568934.1|  Pc21g19430                                       57.8    1e-06   Penicillium rubens Wisconsin 54-1255
emb|CBJ28077.1|  mitochondrial ribosomal protein L46 isoform 2        57.0    1e-06   Ectocarpus siliculosus
dbj|GAM34646.1|  hypothetical protein TCE0_015r02356                  57.0    2e-06   Talaromyces cellulolyticus
ref|XP_536185.2|  PREDICTED: 39S ribosomal protein L46, mitochond...  56.6    2e-06   Canis lupus familiaris [dogs]
ref|XP_004284406.1|  PREDICTED: 39S ribosomal protein L46, mitoch...  56.6    2e-06   Orcinus orca [Orca]
ref|XP_005294941.1|  PREDICTED: 39S ribosomal protein L46, mitoch...  56.6    2e-06   Chrysemys picta bellii
dbj|GAA91002.1|  CAF1 family ribonuclease                             57.4    2e-06   Aspergillus kawachii IFO 4308
gb|ETE69357.1|  39S ribosomal protein L46, mitochondrial              55.5    2e-06   Ophiophagus hannah
ref|XP_007427210.1|  PREDICTED: 39S ribosomal protein L46, mitoch...  54.7    2e-06   
ref|XP_316723.3|  AGAP006684-PA                                       56.2    2e-06   Anopheles gambiae str. PEST
ref|XP_007194426.1|  PREDICTED: 39S ribosomal protein L46, mitoch...  55.8    3e-06   Balaenoptera acutorostrata scammoni
ref|XP_004431984.1|  PREDICTED: 39S ribosomal protein L46, mitoch...  56.2    3e-06   Ceratotherium simum simum [southern square-lipped rhinoceros]
ref|XP_007122534.1|  PREDICTED: 39S ribosomal protein L46, mitoch...  55.8    4e-06   Physeter catodon
ref|XP_007194425.1|  PREDICTED: 39S ribosomal protein L46, mitoch...  55.8    4e-06   Balaenoptera acutorostrata scammoni
ref|XP_004763841.1|  PREDICTED: 39S ribosomal protein L46, mitoch...  55.1    4e-06   Mustela putorius furo [black ferret]
ref|XP_007446131.1|  PREDICTED: 39S ribosomal protein L46, mitoch...  55.5    4e-06   Lipotes vexillifer [baiji]
ref|XP_005051831.1|  PREDICTED: 39S ribosomal protein L46, mitoch...  55.5    4e-06   Ficedula albicollis
ref|XP_004623339.1|  PREDICTED: 39S ribosomal protein L46, mitoch...  55.5    4e-06   Octodon degus
emb|CEG81112.1|  hypothetical protein RMATCC62417_15350               55.5    4e-06   Rhizopus microsporus
ref|XP_010114263.1|  PREDICTED: 39S ribosomal protein L46, mitoch...  54.7    5e-06   Chlamydotis macqueenii
ref|XP_004325670.1|  PREDICTED: 39S ribosomal protein L46, mitoch...  55.5    5e-06   Tursiops truncatus [Atlantic bottle-nosed dolphin]
gb|ETN60459.1|  mitochondrial ribosomal protein, L46                  55.5    5e-06   Anopheles darlingi [American malaria mosquito]
ref|XP_005108662.1|  PREDICTED: 39S ribosomal protein L46, mitoch...  55.5    5e-06   Aplysia californica
ref|XP_007060419.1|  PREDICTED: 39S ribosomal protein L46, mitoch...  55.1    6e-06   Chelonia mydas [green seaturtle]
ref|XP_010619339.1|  PREDICTED: 39S ribosomal protein L46, mitoch...  55.1    6e-06   Fukomys damarensis [Damara mole rat]
ref|XP_004798683.1|  PREDICTED: 39S ribosomal protein L46, mitoch...  55.1    6e-06   
ref|XP_005320175.1|  PREDICTED: 39S ribosomal protein L46, mitoch...  55.1    6e-06   Ictidomys tridecemlineatus
ref|XP_004763840.1|  PREDICTED: 39S ribosomal protein L46, mitoch...  55.1    6e-06   Mustela putorius furo [black ferret]
ref|XP_002919597.1|  PREDICTED: 39S ribosomal protein L46, mitoch...  55.1    6e-06   Ailuropoda melanoleuca
ref|XP_004763839.1|  PREDICTED: 39S ribosomal protein L46, mitoch...  55.1    6e-06   Mustela putorius furo [black ferret]
ref|NP_001264041.1|  39S ribosomal protein L46, mitochondrial         55.1    7e-06   Gallus gallus [bantam]
ref|XP_007673999.1|  hypothetical protein BAUCODRAFT_120182           55.1    7e-06   Baudoinia panamericana UAMH 10762
ref|XP_008564987.1|  PREDICTED: 39S ribosomal protein L46, mitoch...  55.1    7e-06   Galeopterus variegatus [Malayan flying lemur]
ref|XP_006733180.1|  PREDICTED: 39S ribosomal protein L46, mitoch...  55.1    7e-06   Leptonychotes weddellii
gb|KFM67643.1|  39S ribosomal protein L46, mitochondrial              54.7    7e-06   Stegodyphus mimosarum
ref|XP_009902220.1|  PREDICTED: 39S ribosomal protein L46, mitoch...  53.9    7e-06   Picoides pubescens
ref|XP_004398373.1|  PREDICTED: 39S ribosomal protein L46, mitoch...  54.7    7e-06   Odobenus rosmarus divergens
gb|KFO76523.1|  hypothetical protein N303_10980                       53.9    8e-06   Cuculus canorus
ref|XP_009559709.1|  PREDICTED: 39S ribosomal protein L46, mitoch...  53.9    8e-06   Cuculus canorus
gb|EPQ12180.1|  39S ribosomal protein L46, mitochondrial              53.9    8e-06   Myotis brandtii
ref|XP_009956506.1|  PREDICTED: 39S ribosomal protein L46, mitoch...  53.9    8e-06   Leptosomus discolor
ref|XP_003209577.2|  PREDICTED: LOW QUALITY PROTEIN: 39S ribosoma...  54.7    8e-06   
ref|XP_010360596.1|  PREDICTED: 39S ribosomal protein L46, mitoch...  54.7    8e-06   Rhinopithecus roxellana
ref|XP_006263876.1|  PREDICTED: 39S ribosomal protein L46, mitoch...  54.3    8e-06   
gb|KFO64018.1|  hypothetical protein N302_16313                       54.3    9e-06   Corvus brachyrhynchos
ref|XP_010619342.1|  PREDICTED: 39S ribosomal protein L46, mitoch...  54.3    9e-06   
ref|XP_004370673.1|  PREDICTED: 39S ribosomal protein L46, mitoch...  54.7    9e-06   Trichechus manatus latirostris
ref|XP_005419639.1|  PREDICTED: 39S ribosomal protein L46, mitoch...  54.3    9e-06   Geospiza fortis
ref|XP_008036322.1|  hypothetical protein TRAVEDRAFT_45880            54.7    9e-06   Trametes versicolor FP-101664 SS1
ref|XP_008638376.1|  PREDICTED: 39S ribosomal protein L46, mitoch...  54.3    9e-06   
ref|XP_005873451.1|  PREDICTED: 39S ribosomal protein L46, mitoch...  53.9    1e-05   
gb|KFZ57475.1|  hypothetical protein N338_05794                       53.5    1e-05   Podiceps cristatus
ref|XP_010389338.1|  PREDICTED: 39S ribosomal protein L46, mitoch...  53.9    1e-05   Corvus cornix cornix
ref|XP_006028350.1|  PREDICTED: 39S ribosomal protein L46, mitoch...  53.9    1e-05   
gb|KFV69979.1|  hypothetical protein N307_02740                       53.5    1e-05   Picoides pubescens
gb|KFP13478.1|  hypothetical protein Z169_04113                       53.5    1e-05   Egretta garzetta
ref|XP_009418195.1|  PREDICTED: uncharacterized protein LOC103998442  54.7    1e-05   
ref|XP_005911074.1|  PREDICTED: 39S ribosomal protein L46, mitoch...  54.3    1e-05   Bos mutus
ref|XP_010855042.1|  PREDICTED: 39S ribosomal protein L46, mitoch...  54.3    1e-05   Bison bison bison
ref|XP_001822358.1|  mitochondrial 54S ribosomal protein YmL17/YmL30  54.3    1e-05   Aspergillus oryzae RIB40
ref|XP_007099345.1|  PREDICTED: LOW QUALITY PROTEIN: mitochondria...  53.9    1e-05   Panthera tigris altaica
ref|XP_005483503.1|  PREDICTED: 39S ribosomal protein L46, mitoch...  53.9    1e-05   
gb|KFX51337.1|  54S ribosomal protein L17, mitochondrial              54.3    1e-05   Talaromyces marneffei PM1
ref|XP_004693033.1|  PREDICTED: 39S ribosomal protein L46, mitoch...  53.1    1e-05   
ref|XP_009468517.1|  PREDICTED: 39S ribosomal protein L46, mitoch...  53.5    1e-05   Nipponia nippon
ref|XP_002145154.1|  mitochondrial 54S ribosomal protein YmL17/YmL30  54.3    1e-05   Talaromyces marneffei ATCC 18224
dbj|GAD91787.1|  CAF1 family ribonuclease, putative                   54.7    1e-05   Byssochlamys spectabilis No. 5
ref|XP_005521832.1|  PREDICTED: 39S ribosomal protein L46, mitoch...  53.9    1e-05   Pseudopodoces humilis [Tibetan ground-jay]
gb|KFQ36057.1|  hypothetical protein N331_06273                       53.1    2e-05   Merops nubicus
ref|XP_003986866.1|  PREDICTED: 39S ribosomal protein L46, mitoch...  53.9    2e-05   Felis catus [cat]
ref|XP_009975701.1|  PREDICTED: 39S ribosomal protein L46, mitoch...  53.1    2e-05   Tauraco erythrolophus
ref|XP_010078894.1|  PREDICTED: 39S ribosomal protein L46, mitoch...  53.1    2e-05   Pterocles gutturalis
ref|XP_008945244.1|  PREDICTED: LOW QUALITY PROTEIN: 39S ribosoma...  53.1    2e-05   Merops nubicus
ref|XP_011428481.1|  PREDICTED: 39S ribosomal protein L46, mitoch...  53.9    2e-05   Crassostrea gigas
emb|CAK38994.1|  unnamed protein product                              53.5    2e-05   Aspergillus niger
ref|XP_010974026.1|  PREDICTED: 39S ribosomal protein L46, mitoch...  53.5    2e-05   Camelus dromedarius [camel]
ref|XP_010185611.1|  PREDICTED: 39S ribosomal protein L46, mitoch...  52.8    2e-05   Mesitornis unicolor
ref|XP_006070110.1|  PREDICTED: 39S ribosomal protein L46, mitoch...  53.5    2e-05   Bubalus bubalis [domestic water buffalo]
ref|XP_002187876.2|  PREDICTED: 39S ribosomal protein L46, mitoch...  53.1    2e-05   
ref|XP_008685987.1|  PREDICTED: 39S ribosomal protein L46, mitoch...  53.5    2e-05   Ursus maritimus [white bear]
emb|CCA68916.1|  related to MRPL17-mitochondrial ribosomal protei...  53.5    2e-05   Serendipita indica DSM 11827
ref|XP_004909190.1|  PREDICTED: 39S ribosomal protein L46, mitoch...  53.5    2e-05   
ref|XP_009634183.1|  PREDICTED: 39S ribosomal protein L46, mitoch...  53.1    2e-05   Egretta garzetta
ref|XP_001421985.1|  predicted protein                                51.2    2e-05   Ostreococcus lucimarinus CCE9901
gb|ERE79416.1|  39S ribosomal protein L46                             52.8    2e-05   Cricetulus griseus [Chinese hamsters]
gb|KFQ89126.1|  hypothetical protein N337_08283                       52.8    3e-05   Phoenicopterus ruber ruber
gb|EPY85575.1|  39S ribosomal protein L46, mitochondrial-like pro...  52.8    3e-05   Camelus ferus
ref|XP_005971518.1|  PREDICTED: 39S ribosomal protein L46, mitoch...  53.1    3e-05   Pantholops hodgsonii [Tibetan antelope]
gb|KFQ57479.1|  hypothetical protein N334_09929                       52.4    3e-05   Pelecanus crispus
emb|CEI98109.1|  hypothetical protein RMCBS344292_12225               53.1    3e-05   Rhizopus microsporus
gb|KFQ08009.1|  hypothetical protein N329_13194                       52.4    3e-05   Haliaeetus albicilla
gb|EMF10326.1|  hypothetical protein SEPMUDRAFT_89354                 53.5    3e-05   Sphaerulina musiva SO2202
emb|CDO69012.1|  hypothetical protein BN946_scf184834.g19             53.1    3e-05   Trametes cinnabarina
emb|CEG72132.1|  hypothetical protein RMATCC62417_07743               53.1    3e-05   Rhizopus microsporus
ref|XP_001916683.1|  PREDICTED: 39S ribosomal protein L46, mitoch...  53.1    3e-05   Equus caballus [domestic horse]
ref|XP_006152832.1|  PREDICTED: 39S ribosomal protein L46, mitoch...  53.1    3e-05   Tupaia chinensis
ref|XP_003788703.1|  PREDICTED: 39S ribosomal protein L46, mitoch...  53.1    3e-05   Otolemur garnettii
ref|XP_009484798.1|  PREDICTED: LOW QUALITY PROTEIN: 39S ribosoma...  52.4    3e-05   Pelecanus crispus
gb|EFX87716.1|  hypothetical protein DAPPUDRAFT_127151                52.8    3e-05   Daphnia pulex
gb|EMC88376.1|  39S ribosomal protein L46, mitochondrial              52.4    3e-05   
ref|XP_010002361.1|  PREDICTED: 39S ribosomal protein L46, mitoch...  52.4    3e-05   Chaetura pelagica
ref|NP_001096501.1|  mitochondrial ribosomal protein L46              52.8    3e-05   Xenopus tropicalis [western clawed frog]
ref|XP_005148817.1|  PREDICTED: 39S ribosomal protein L46, mitoch...  52.4    3e-05   Melopsittacus undulatus
ref|XP_006106780.1|  PREDICTED: 39S ribosomal protein L46, mitoch...  52.8    4e-05   Myotis lucifugus
gb|KFU94467.1|  hypothetical protein M959_09755                       52.0    4e-05   Chaetura pelagica
ref|XP_005504193.1|  PREDICTED: LOW QUALITY PROTEIN: 39S ribosoma...  52.4    4e-05   
ref|XP_002723421.1|  PREDICTED: 39S ribosomal protein L46, mitoch...  52.8    4e-05   Oryctolagus cuniculus [domestic rabbit]
gb|EGW12685.1|  39S ribosomal protein L46, mitochondrial              52.8    4e-05   Cricetulus griseus [Chinese hamsters]
ref|XP_004617585.1|  PREDICTED: 39S ribosomal protein L46, mitoch...  52.8    4e-05   Sorex araneus [Eurasian shrew]
gb|ELW62787.1|  39S ribosomal protein L46, mitochondrial              52.8    4e-05   Tupaia chinensis
ref|XP_003921693.2|  PREDICTED: 39S ribosomal protein L46, mitoch...  52.8    4e-05   Saimiri boliviensis boliviensis
ref|XP_003413836.1|  PREDICTED: 39S ribosomal protein L46, mitoch...  52.8    4e-05   Loxodonta africana [African bush elephant]
ref|XP_005381634.1|  PREDICTED: 39S ribosomal protein L46, mitoch...  52.8    4e-05   Chinchilla lanigera
emb|CDF91758.1|  ZYBA0S14-00364g1_1                                   52.8    4e-05   Zygosaccharomyces bailii CLIB 213
ref|XP_008510001.1|  PREDICTED: 39S ribosomal protein L46, mitoch...  51.2    4e-05   Equus przewalskii [Przewalski horse]
ref|XP_001693106.1|  mitochondrial ribosomal protein L17              52.4    4e-05   Chlamydomonas reinhardtii
ref|NP_001029884.1|  39S ribosomal protein L46, mitochondrial         52.8    4e-05   Bos taurus [bovine]
gb|EZF74373.1|  hypothetical protein H105_04059                       52.8    4e-05   Trichophyton soudanense CBS 452.61
ref|XP_006771845.1|  PREDICTED: 39S ribosomal protein L46, mitoch...  52.0    4e-05   Myotis davidii
ref|XP_002197666.1|  PREDICTED: 39S ribosomal protein L46, mitoch...  52.8    4e-05   Taeniopygia guttata
ref|XP_003234769.1|  mitochondrial 54S ribosomal protein YmL17/YmL30  52.8    5e-05   Trichophyton rubrum CBS 118892
ref|XP_003475304.1|  PREDICTED: 39S ribosomal protein L46, mitoch...  52.8    5e-05   Cavia porcellus [guinea pig]
ref|XP_009922146.1|  PREDICTED: 39S ribosomal protein L46, mitoch...  52.4    5e-05   Haliaeetus albicilla
ref|XP_009070479.1|  PREDICTED: 39S ribosomal protein L46, mitoch...  52.4    5e-05   Acanthisitta chloris
tpg|DAA17711.1|  TPA: 39S ribosomal protein L46, mitochondrial pr...  52.4    5e-05   Bos taurus [bovine]
ref|XP_007479444.1|  PREDICTED: LOW QUALITY PROTEIN: 39S ribosoma...  52.8    5e-05   
dbj|GAM25389.1|  hypothetical protein SAMD00019534_085640             52.8    5e-05   Acytostelium subglobosum LB1
ref|XP_005178430.1|  PREDICTED: 39S ribosomal protein L46, mitoch...  52.4    5e-05   Musca domestica
ref|XP_004593230.1|  PREDICTED: 39S ribosomal protein L46, mitoch...  52.4    5e-05   Ochotona princeps [southern American pika]
ref|XP_003514322.2|  PREDICTED: 39S ribosomal protein L46, mitoch...  52.4    5e-05   Cricetulus griseus [Chinese hamsters]
ref|XP_001261166.1|  mitochondrial 54S ribosomal protein YmL17/YmL30  52.4    6e-05   Aspergillus fischeri NRRL 181
ref|XP_011151459.1|  PREDICTED: 39S ribosomal protein L46, mitoch...  52.4    6e-05   Harpegnathos saltator
gb|ELK24203.1|  39S ribosomal protein L46, mitochondrial              52.0    6e-05   Myotis davidii
ref|XP_002791388.1|  mitochondrial 54S ribosomal protein YmL17/YmL30  52.4    6e-05   Paracoccidioides lutzii Pb01
ref|XP_005242474.1|  PREDICTED: 39S ribosomal protein L46, mitoch...  51.6    6e-05   
ref|XP_006178607.1|  PREDICTED: 39S ribosomal protein L46, mitoch...  52.4    6e-05   Camelus ferus
gb|EFN76605.1|  39S ribosomal protein L46, mitochondrial              52.0    6e-05   Harpegnathos saltator
gb|KFP77928.1|  hypothetical protein N310_01806                       52.0    6e-05   Acanthisitta chloris
ref|XP_006198536.1|  PREDICTED: LOW QUALITY PROTEIN: 39S ribosoma...  52.4    6e-05   Vicugna pacos
ref|XP_010570277.1|  PREDICTED: 39S ribosomal protein L46, mitoch...  52.0    6e-05   Haliaeetus leucocephalus
gb|KGK38489.1|  hypothetical protein JL09_g2370                       52.0    6e-05   Pichia kudriavzevii
gb|EFA77335.1|  hypothetical protein PPL_12546                        52.4    6e-05   Heterostelium album PN500
ref|XP_005436712.1|  PREDICTED: 39S ribosomal protein L46, mitoch...  51.6    7e-05   
gb|EEH20326.1|  hypothetical protein PABG_02585                       52.4    7e-05   Paracoccidioides brasiliensis Pb03
ref|XP_010756576.1|  hypothetical protein PADG_01016                  52.4    7e-05   Paracoccidioides brasiliensis Pb18
ref|XP_007580976.1|  putative 50s ribosomal subunit l30 protein       52.4    7e-05   
ref|XP_009274849.1|  PREDICTED: 39S ribosomal protein L46, mitoch...  51.6    7e-05   Aptenodytes forsteri
ref|XP_008055372.1|  PREDICTED: 39S ribosomal protein L46, mitoch...  52.0    7e-05   Carlito syrichta
ref|XP_009922144.1|  PREDICTED: 39S ribosomal protein L46, mitoch...  52.0    7e-05   Haliaeetus albicilla
ref|XP_756034.1|  50S ribosomal subunit L30                           52.0    7e-05   Aspergillus fumigatus Af293
gb|KEY76551.1|  50S ribosomal subunit L30                             52.0    7e-05   Aspergillus fumigatus var. RP-2014
ref|XP_004481132.1|  PREDICTED: 39S ribosomal protein L46, mitoch...  52.0    8e-05   Dasypus novemcinctus
ref|XP_008851067.1|  PREDICTED: 39S ribosomal protein L46, mitoch...  52.0    8e-05   
ref|XP_009876955.1|  PREDICTED: 39S ribosomal protein L46, mitoch...  51.2    8e-05   
ref|XP_006885295.1|  PREDICTED: 39S ribosomal protein L46, mitoch...  52.0    8e-05   
ref|XP_004017786.1|  PREDICTED: LOW QUALITY PROTEIN: 39S ribosoma...  51.6    8e-05   
gb|KFM05708.1|  hypothetical protein AS27_00183                       51.6    9e-05   
ref|XP_006867225.1|  PREDICTED: 39S ribosomal protein L46, mitoch...  51.6    9e-05   
ref|XP_003170496.1|  mitochondrial 54S ribosomal protein YmL17/YmL30  52.0    9e-05   
ref|XP_002111953.1|  hypothetical protein TRIADDRAFT_55493            51.6    9e-05   
emb|CCM03837.1|  predicted protein                                    51.6    1e-04   
ref|XP_007944288.1|  PREDICTED: 39S ribosomal protein L46, mitoch...  51.6    1e-04   
dbj|BAB24577.1|  unnamed protein product                              50.1    1e-04   
ref|XP_006970102.1|  PREDICTED: 39S ribosomal protein L46, mitoch...  51.6    1e-04   
ref|XP_008157160.1|  PREDICTED: 39S ribosomal protein L46, mitoch...  51.2    1e-04   
ref|XP_003023157.1|  hypothetical protein TRV_02737                   51.6    1e-04   
dbj|BAB84879.1|  FLJ00124 protein                                     49.3    1e-04   
ref|XP_010155386.1|  PREDICTED: 39S ribosomal protein L46, mitoch...  50.8    1e-04   
ref|XP_001731034.1|  hypothetical protein MGL_2033                    51.2    1e-04   
ref|XP_003010596.1|  hypothetical protein ARB_03297                   51.2    1e-04   
gb|EZF29974.1|  hypothetical protein H101_06376                       51.2    1e-04   
gb|KFO99432.1|  hypothetical protein N300_13759                       51.2    1e-04   
gb|EGD97500.1|  50S ribosomal subunit L30                             51.2    1e-04   
ref|XP_005357798.1|  PREDICTED: 39S ribosomal protein L46, mitoch...  51.2    1e-04   
ref|XP_008490271.1|  PREDICTED: 39S ribosomal protein L46, mitoch...  51.2    1e-04   
ref|XP_008055373.1|  PREDICTED: 39S ribosomal protein L46, mitoch...  50.8    1e-04   
ref|XP_003121908.1|  PREDICTED: 39S ribosomal protein L46, mitoch...  51.2    1e-04   
emb|CDH09743.1|  related to 54S ribosomal protein L17,mitochondrial   51.2    1e-04   
ref|XP_002626646.1|  mitochondrial 54S ribosomal protein YmL17/YmL30  51.2    2e-04   
tpe|CBF78699.1|  TPA: 50S ribosomal subunit L30 (AFU_orthologue; ...  51.2    2e-04   
ref|XP_007528091.1|  PREDICTED: 39S ribosomal protein L46, mitoch...  50.8    2e-04   
ref|XP_005826326.1|  hypothetical protein GUITHDRAFT_114545           50.8    2e-04   
ref|XP_002181562.1|  predicted protein                                50.8    2e-04   
ref|NP_075820.1|  39S ribosomal protein L46, mitochondrial            50.8    2e-04   
ref|XP_004709926.1|  PREDICTED: 39S ribosomal protein L46, mitoch...  50.8    2e-04   
ref|XP_001275978.1|  mitochondrial 54S ribosomal protein YmL17/YmL30  50.8    2e-04   
ref|XP_004347926.1|  hypothetical protein CAOG_04101                  50.8    2e-04   
ref|XP_680553.1|  hypothetical protein AN7284.2                       51.2    2e-04   
ref|XP_005139381.1|  PREDICTED: LOW QUALITY PROTEIN: mitochondria...  50.8    2e-04   
ref|XP_004351947.1|  hypothetical protein DFA_10057                   50.8    2e-04   
ref|XP_008932712.1|  PREDICTED: 39S ribosomal protein L46, mitoch...  50.1    2e-04   
gb|EWM26303.1|  mitochondrial ribosomal protein l46                   50.8    2e-04   
emb|CDS05359.1|  hypothetical protein LRAMOSA07888                    50.4    2e-04   
ref|XP_010210516.1|  PREDICTED: 39S ribosomal protein L46, mitoch...  49.3    3e-04   
ref|XP_005853752.1|  hypothetical protein NGA_0453300                 50.4    3e-04   
ref|XP_008473315.1|  PREDICTED: 39S ribosomal protein L46, mitoch...  50.4    3e-04   
ref|XP_009965264.1|  PREDICTED: 39S ribosomal protein L46, mitoch...  49.7    3e-04   
ref|XP_007925676.1|  hypothetical protein MYCFIDRAFT_203293           50.4    3e-04   
ref|XP_011113699.1|  hypothetical protein H072_7974                   50.4    3e-04   
gb|KFW76781.1|  hypothetical protein N305_05605                       50.1    3e-04   
gb|KFV84601.1|  hypothetical protein N308_02656                       49.7    3e-04   
ref|XP_007832367.1|  hypothetical protein PFICI_05595                 50.4    3e-04   
gb|EEH04202.1|  50S ribosomal protein L30                             50.4    3e-04   
gb|EER42101.1|  50S ribosomal subunit L30                             50.1    3e-04   
ref|XP_002340218.1|  mitochondrial 54S ribosomal protein YmL17/YmL30  50.1    3e-04   
ref|XP_001538938.1|  mitochondrial 54S ribosomal protein YmL17/YmL30  50.1    3e-04   
gb|EEQ84392.1|  50S ribosomal subunit L30                             50.1    3e-04   
gb|EST08307.1|  hypothetical protein PSEUBRA_SCAF17g04302             50.1    4e-04   
ref|XP_010170438.1|  PREDICTED: 39S ribosomal protein L46, mitoch...  49.3    4e-04   
ref|XP_002738570.1|  PREDICTED: 39S ribosomal protein L46, mitoch...  49.7    4e-04   
ref|XP_011377982.1|  PREDICTED: 39S ribosomal protein L46, mitoch...  49.7    4e-04   
ref|XP_006905315.1|  PREDICTED: 39S ribosomal protein L46, mitoch...  49.7    4e-04   
ref|XP_002848405.1|  mitochondrial 54S ribosomal protein YmL17/YmL30  49.7    5e-04   
ref|XP_011377983.1|  PREDICTED: 39S ribosomal protein L46, mitoch...  49.3    5e-04   
ref|NP_001013086.1|  39S ribosomal protein L46, mitochondrial         49.7    5e-04   
gb|AAG33698.1|  P2ECSL                                                49.3    5e-04   
ref|XP_009679875.1|  PREDICTED: 39S ribosomal protein L46, mitoch...  49.3    5e-04   
gb|EAX01997.1|  mitochondrial ribosomal protein L46, isoform CRA_c    48.9    5e-04   
ref|XP_009698445.1|  PREDICTED: 39S ribosomal protein L46, mitoch...  48.9    5e-04   
ref|XP_004056766.1|  PREDICTED: 39S ribosomal protein L46, mitoch...  49.7    5e-04   
ref|XP_010303900.1|  PREDICTED: 39S ribosomal protein L46, mitoch...  48.9    6e-04   
gb|EKG10921.1|  hypothetical protein MPH_11924                        49.7    6e-04   
ref|XP_002475240.1|  hypothetical 60S ribosomal protein L17           49.3    6e-04   
emb|CDI55971.1|  related to MRPL17-mitochondrial ribosomal protei...  49.3    6e-04   
ref|XP_504369.1|  YALI0E24805p                                        49.3    6e-04   
ref|XP_001088970.1|  PREDICTED: 39S ribosomal protein L46, mitoch...  49.3    6e-04   
gb|EPS32880.1|  hypothetical protein PDE_07841                        49.3    6e-04   
gb|EHH63311.1|  39S ribosomal protein L46, mitochondrial              49.3    6e-04   
ref|XP_003901395.1|  PREDICTED: 39S ribosomal protein L46, mitoch...  49.3    7e-04   
gb|KGL75606.1|  hypothetical protein N309_08864                       48.9    7e-04   
gb|KEQ89745.1|  hypothetical protein M438DRAFT_379825                 49.3    7e-04   
ref|XP_005560485.1|  PREDICTED: 39S ribosomal protein L46, mitoch...  49.3    7e-04   
ref|XP_002825829.1|  PREDICTED: 39S ribosomal protein L46, mitoch...  48.9    8e-04   
ref|XP_510572.2|  PREDICTED: 39S ribosomal protein L46, mitochond...  48.9    8e-04   
ref|XP_007988508.1|  PREDICTED: 39S ribosomal protein L46, mitoch...  48.9    8e-04   
ref|XP_007792956.1|  putative 54s ribosomal protein l17 protein       49.3    8e-04   
ref|XP_011391827.1|  hypothetical protein UMAG_05502                  48.9    9e-04   
ref|NP_071446.2|  39S ribosomal protein L46, mitochondrial            48.9    9e-04   
ref|XP_009885539.1|  PREDICTED: LOW QUALITY PROTEIN: 39S ribosoma...  48.5    9e-04   
gb|KEZ42678.1|  hypothetical protein SAPIO_CDS5934                    48.9    9e-04   
gb|KGL86723.1|  hypothetical protein N301_04433                       48.5    9e-04   
sp|Q5RBU2.1|RM46_PONAB  RecName: Full=39S ribosomal protein L46, ...  48.9    0.001   
ref|XP_002749195.1|  PREDICTED: 39S ribosomal protein L46, mitoch...  48.9    0.001   
ref|XP_010619340.1|  PREDICTED: 39S ribosomal protein L46, mitoch...  48.9    0.001   
gb|KEQ97092.1|  hypothetical protein AUEXF2481DRAFT_630067            48.9    0.001   
gb|AEE62479.1|  unknown                                               48.5    0.001   
ref|XP_007364517.1|  hypothetical protein DICSQDRAFT_103778           48.9    0.001   
ref|XP_003268528.1|  PREDICTED: 39S ribosomal protein L46, mitoch...  48.9    0.001   
ref|XP_006693072.1|  hypothetical protein CTHT_0026130                48.9    0.001   



>ref|XP_006359862.1| PREDICTED: 39S ribosomal protein L46, mitochondrial-like [Solanum 
tuberosum]
Length=229

 Score =   249 bits (636),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 120/150 (80%), Positives = 136/150 (91%), Gaps = 4/150 (3%)
 Frame = +1

Query  154  MRRCL---GLALLAKRGFSTSSSGDKIVASVLFERLPVVVPKIDPVVYAFQEFSFRWRQQ  324
            M+RC    G ++++KR FS SSS DKIVASVLFERLPVVVPKIDP VYAFQEFSFRWRQQ
Sbjct  1    MQRCCSSAGRSVISKRWFS-SSSNDKIVASVLFERLPVVVPKIDPTVYAFQEFSFRWRQQ  59

Query  325  YRREYPENFLKKADTRGKGEYQIDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSL  504
            YRREYPE+FLKK+DTRGKG+YQIDY PAPRI+EADKTND++SLQRALD+RLYLL+HGT+ 
Sbjct  60   YRREYPESFLKKSDTRGKGDYQIDYKPAPRISEADKTNDQRSLQRALDRRLYLLVHGTTH  119

Query  505  SSGKPVWHFPEKAYESEETLRRCAESALKS  594
             SGKPVWHFPEK YESEE LR+CAESAL+S
Sbjct  120  GSGKPVWHFPEKIYESEENLRKCAESALES  149



>ref|XP_004236846.1| PREDICTED: 39S ribosomal protein L46, mitochondrial-like [Solanum 
lycopersicum]
Length=227

 Score =   248 bits (633),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 120/148 (81%), Positives = 133/148 (90%), Gaps = 2/148 (1%)
 Frame = +1

Query  151  KMRRCLGLALLAKRGFSTSSSGDKIVASVLFERLPVVVPKIDPVVYAFQEFSFRWRQQYR  330
            KM+RC   A+  KR FS S + DKIVASVLFERLPVVVPKIDP VYAFQEFSFRWRQQYR
Sbjct  2    KMQRCCSSAI-GKRWFS-SFNNDKIVASVLFERLPVVVPKIDPTVYAFQEFSFRWRQQYR  59

Query  331  REYPENFLKKADTRGKGEYQIDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLSS  510
            REYPE+FLKK+DTRGKG+YQIDY PAPRI+EADKTND++SLQRALDKRLYLL+HGT+  S
Sbjct  60   REYPESFLKKSDTRGKGDYQIDYKPAPRISEADKTNDQRSLQRALDKRLYLLVHGTTQGS  119

Query  511  GKPVWHFPEKAYESEETLRRCAESALKS  594
            GKPVWHFPEK YESEE LR+CAESAL+S
Sbjct  120  GKPVWHFPEKVYESEENLRKCAESALES  147



>ref|XP_004247399.1| PREDICTED: 39S ribosomal protein L46, mitochondrial [Solanum 
lycopersicum]
Length=229

 Score =   248 bits (632),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 119/150 (79%), Positives = 135/150 (90%), Gaps = 4/150 (3%)
 Frame = +1

Query  154  MRRCL---GLALLAKRGFSTSSSGDKIVASVLFERLPVVVPKIDPVVYAFQEFSFRWRQQ  324
            M+RC    G ++ +KR FS SSS DKIVASVLFERLPV+VPKIDP VYAFQEFSFRWRQQ
Sbjct  1    MQRCCSSAGRSVTSKRWFS-SSSTDKIVASVLFERLPVIVPKIDPTVYAFQEFSFRWRQQ  59

Query  325  YRREYPENFLKKADTRGKGEYQIDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSL  504
            YRREYPE+FLKK+DTRGKG+YQIDY PAPRI+EADKTND++SLQRALD+RLYLL+HGT+ 
Sbjct  60   YRREYPESFLKKSDTRGKGDYQIDYKPAPRISEADKTNDQRSLQRALDRRLYLLVHGTTH  119

Query  505  SSGKPVWHFPEKAYESEETLRRCAESALKS  594
             SGKPVWHFPEK YESEE LR+CAESAL+S
Sbjct  120  GSGKPVWHFPEKVYESEENLRKCAESALES  149



>ref|XP_006359291.1| PREDICTED: 39S ribosomal protein L46, mitochondrial-like isoform 
X1 [Solanum tuberosum]
Length=231

 Score =   244 bits (624),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 117/151 (77%), Positives = 133/151 (88%), Gaps = 4/151 (3%)
 Frame = +1

Query  151  KMRRCL---GLALLAKRGFSTSSSGDKIVASVLFERLPVVVPKIDPVVYAFQEFSFRWRQ  321
            KM+RC    G + + KR FS SS+ DKIVASVLFERLPVVVPKI+P VYAFQEFSFRWRQ
Sbjct  2    KMQRCCSSAGRSAIGKRWFS-SSNNDKIVASVLFERLPVVVPKINPTVYAFQEFSFRWRQ  60

Query  322  QYRREYPENFLKKADTRGKGEYQIDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTS  501
            QYRREYPE+FLKK+DTRGKG+YQIDY PAPRI+EADKTND++SL RALD+RLYLL+HG +
Sbjct  61   QYRREYPESFLKKSDTRGKGDYQIDYKPAPRISEADKTNDQRSLHRALDRRLYLLVHGAT  120

Query  502  LSSGKPVWHFPEKAYESEETLRRCAESALKS  594
              SGKPVWHFPEK YESEE LR+CAESAL+S
Sbjct  121  QGSGKPVWHFPEKVYESEENLRKCAESALES  151



>ref|XP_011093029.1| PREDICTED: 39S ribosomal protein L46, mitochondrial [Sesamum 
indicum]
Length=238

 Score =   239 bits (610),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 118/159 (74%), Positives = 135/159 (85%), Gaps = 7/159 (4%)
 Frame = +1

Query  133  GIS*VAKMRRCLGLALLAKRGFSTSS----SGDKIVASVLFERLPVVVPKIDPVVYAFQE  300
            GI+  +K  R L   +   RGFSTS+    S +K+VASVLFERLPVV+PKIDPVVYAFQE
Sbjct  3    GITSCSKFGRSLQSII---RGFSTSTTKSGSDEKLVASVLFERLPVVIPKIDPVVYAFQE  59

Query  301  FSFRWRQQYRREYPENFLKKADTRGKGEYQIDYTPAPRITEADKTNDRKSLQRALDKRLY  480
            FSFRWRQQYRREYPE FLKKAD RGKG+YQID+TPAPRITEADK+ND++SLQRALD+RLY
Sbjct  60   FSFRWRQQYRREYPEAFLKKADARGKGDYQIDFTPAPRITEADKSNDKRSLQRALDRRLY  119

Query  481  LLLHGTSLSSGKPVWHFPEKAYESEETLRRCAESALKSV  597
            LLL G +  S +PVWHFPEK YESE+TLR+CAESALKSV
Sbjct  120  LLLFGAAYGSKEPVWHFPEKVYESEQTLRKCAESALKSV  158



>ref|XP_009784201.1| PREDICTED: 39S ribosomal protein L46, mitochondrial [Nicotiana 
sylvestris]
Length=231

 Score =   238 bits (607),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 116/152 (76%), Positives = 133/152 (88%), Gaps = 5/152 (3%)
 Frame = +1

Query  154  MRRCL--GLALLAKRGFSTSSSGDKIVASVLFERLPVVVPKIDPVVYAFQEFSFRWRQQY  327
            +R C   G ++  KR FS S + DKIVASVLFERLPVVVPKIDP VYAFQEFSFRWRQQY
Sbjct  2    LRWCTSAGRSMTCKRWFS-SLNNDKIVASVLFERLPVVVPKIDPTVYAFQEFSFRWRQQY  60

Query  328  RREYPENFLKKADTRGKGEYQIDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLS  507
            RREYPE+FLKK+DTRGKG+YQIDY PAPRI+EADK ND++SLQRALD+RLYLL+HGT+  
Sbjct  61   RREYPESFLKKSDTRGKGDYQIDYKPAPRISEADKANDQRSLQRALDRRLYLLVHGTTHC  120

Query  508  S--GKPVWHFPEKAYESEETLRRCAESALKSV  597
            S  GKP+WHFPEK YESEETLR+CAESAL++V
Sbjct  121  SHGGKPIWHFPEKVYESEETLRKCAESALEAV  152



>ref|XP_009610439.1| PREDICTED: 39S ribosomal protein L46, mitochondrial [Nicotiana 
tomentosiformis]
Length=231

 Score =   236 bits (601),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 114/143 (80%), Positives = 129/143 (90%), Gaps = 3/143 (2%)
 Frame = +1

Query  175  ALLAKRGFSTSSSGDKIVASVLFERLPVVVPKIDPVVYAFQEFSFRWRQQYRREYPENFL  354
            +++ KR FS S + DKIVASVLFERLPVVVPKIDP VYAFQEFSFRWRQQYRREYPE+FL
Sbjct  11   SMICKRWFS-SLNNDKIVASVLFERLPVVVPKIDPTVYAFQEFSFRWRQQYRREYPESFL  69

Query  355  KKADTRGKGEYQIDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLS--SGKPVWH  528
            KK+DTRGKG+YQIDY PAPRI+EADKTND++SLQRALD+RLYLL+HGT+    SG PVWH
Sbjct  70   KKSDTRGKGDYQIDYKPAPRISEADKTNDQRSLQRALDRRLYLLVHGTTHGSHSGMPVWH  129

Query  529  FPEKAYESEETLRRCAESALKSV  597
            FPEK YESEETLR+CAESAL+ V
Sbjct  130  FPEKVYESEETLRKCAESALEFV  152



>gb|EYU32177.1| hypothetical protein MIMGU_mgv1a012774mg [Erythranthe guttata]
Length=240

 Score =   234 bits (598),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 117/144 (81%), Positives = 129/144 (90%), Gaps = 6/144 (4%)
 Frame = +1

Query  184  AKRGFSTSSS---GD-KIVASVLFERLPVVVPKIDPVVYAFQEFSFRWRQQYRREYPENF  351
             KRGFSTS+S   GD KI+ASVLFERLPVVVPKIDPVVYAFQEFSFRW QQYRREYPE+ 
Sbjct  17   GKRGFSTSTSKNAGDEKILASVLFERLPVVVPKIDPVVYAFQEFSFRWGQQYRREYPESL  76

Query  352  LKKADTRGKGEYQIDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLSSG--KPVW  525
            LKKAD RGKG+YQIDYTPAPR+TEADKTND++SLQRALDKRLYLL++GT+  S   KPVW
Sbjct  77   LKKADARGKGDYQIDYTPAPRVTEADKTNDKRSLQRALDKRLYLLIYGTAHGSKDEKPVW  136

Query  526  HFPEKAYESEETLRRCAESALKSV  597
            HFPEK YESE TLR+CAESAL+SV
Sbjct  137  HFPEKVYESEPTLRKCAESALQSV  160



>gb|KEH18785.1| 39S ribosomal protein L46 [Medicago truncatula]
Length=229

 Score =   234 bits (596),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 112/142 (79%), Positives = 126/142 (89%), Gaps = 4/142 (3%)
 Frame = +1

Query  178  LLAKRGFSTSSSGDKIVASVLFERLPVVVPKIDPVVYAFQEFSFRWRQQYRREYPENFLK  357
            LL +RGFSTSS  DK+VASVLFERLPVV+PKIDP+VYAFQEFSFRWRQQY+R YP+ FL 
Sbjct  10   LLTRRGFSTSS--DKMVASVLFERLPVVIPKIDPIVYAFQEFSFRWRQQYQRRYPDEFLD  67

Query  358  KADTRGKGEYQIDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLS--SGKPVWHF  531
            ++D RGKG+YQIDY PAPRITEADK NDR+SLQRALD+RLYLLL G +    SGKPVWHF
Sbjct  68   RSDARGKGDYQIDYVPAPRITEADKQNDRRSLQRALDRRLYLLLFGDAYGAPSGKPVWHF  127

Query  532  PEKAYESEETLRRCAESALKSV  597
            PEK YESEET+R+CAESALKSV
Sbjct  128  PEKVYESEETMRKCAESALKSV  149



>ref|XP_004510692.1| PREDICTED: 39S ribosomal protein L46, mitochondrial-like [Cicer 
arietinum]
Length=233

 Score =   234 bits (597),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 112/151 (74%), Positives = 129/151 (85%), Gaps = 4/151 (3%)
 Frame = +1

Query  151  KMRRCLGLALLAKRGFSTSSSGDKIVASVLFERLPVVVPKIDPVVYAFQEFSFRWRQQYR  330
            +M+  L   LL +RGFSTSS  DK+VA+VLFERLPVV+PK+DPVVYAFQEFSFRWR QY+
Sbjct  5    RMKMSLIRPLLTRRGFSTSS--DKMVAAVLFERLPVVIPKVDPVVYAFQEFSFRWRMQYQ  62

Query  331  REYPENFLKKADTRGKGEYQIDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLS-  507
            R YP+ FL ++D RGKG+YQIDY PAPRITEADK NDR+SLQRALDKRLYLLL+G +   
Sbjct  63   RRYPDEFLDRSDARGKGDYQIDYVPAPRITEADKKNDRRSLQRALDKRLYLLLYGNAHGA  122

Query  508  -SGKPVWHFPEKAYESEETLRRCAESALKSV  597
             SG PVWHFPEK YESEET+R+CAESALKSV
Sbjct  123  PSGNPVWHFPEKVYESEETMRKCAESALKSV  153



>ref|XP_007051699.1| Decoy isoform 2, partial [Theobroma cacao]
 gb|EOX95856.1| Decoy isoform 2, partial [Theobroma cacao]
Length=155

 Score =   231 bits (588),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 117/153 (76%), Positives = 128/153 (84%), Gaps = 7/153 (5%)
 Frame = +1

Query  154  MRRCLGL---ALLAKRGFSTSSSGDKIVASVLFERLPVVVPKIDPVVYAFQEFSFRWRQQ  324
            MRR L      L   RGFSTSS   K+VASVLFERLPVV+PKIDPVVYAFQEFSFRW+QQ
Sbjct  1    MRRSLTALVQPLAGARGFSTSSG--KVVASVLFERLPVVIPKIDPVVYAFQEFSFRWKQQ  58

Query  325  YRREYPENFLKKADTRGKGEYQIDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSL  504
            YRR+YP+ FL  + +RGKG+YQIDY PAPRITEADKTNDRKSLQRALD+RLYLLL G S 
Sbjct  59   YRRKYPDEFLDMSKSRGKGDYQIDYVPAPRITEADKTNDRKSLQRALDRRLYLLLCGNSH  118

Query  505  S--SGKPVWHFPEKAYESEETLRRCAESALKSV  597
               SGKPVWHFPEK Y+SEETLR+CAESALKSV
Sbjct  119  GAPSGKPVWHFPEKVYDSEETLRKCAESALKSV  151



>ref|XP_007051698.1| Decoy isoform 1 [Theobroma cacao]
 gb|EOX95855.1| Decoy isoform 1 [Theobroma cacao]
Length=229

 Score =   231 bits (590),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 117/153 (76%), Positives = 128/153 (84%), Gaps = 7/153 (5%)
 Frame = +1

Query  154  MRRCLGL---ALLAKRGFSTSSSGDKIVASVLFERLPVVVPKIDPVVYAFQEFSFRWRQQ  324
            MRR L      L   RGFSTSS   K+VASVLFERLPVV+PKIDPVVYAFQEFSFRW+QQ
Sbjct  1    MRRSLTALVQPLAGARGFSTSSG--KVVASVLFERLPVVIPKIDPVVYAFQEFSFRWKQQ  58

Query  325  YRREYPENFLKKADTRGKGEYQIDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSL  504
            YRR+YP+ FL  + +RGKG+YQIDY PAPRITEADKTNDRKSLQRALD+RLYLLL G S 
Sbjct  59   YRRKYPDEFLDMSKSRGKGDYQIDYVPAPRITEADKTNDRKSLQRALDRRLYLLLCGNSH  118

Query  505  S--SGKPVWHFPEKAYESEETLRRCAESALKSV  597
               SGKPVWHFPEK Y+SEETLR+CAESALKSV
Sbjct  119  GAPSGKPVWHFPEKVYDSEETLRKCAESALKSV  151



>ref|XP_004494826.1| PREDICTED: 39S ribosomal protein L46, mitochondrial-like isoform 
X1 [Cicer arietinum]
Length=235

 Score =   231 bits (589),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 110/152 (72%), Positives = 129/152 (85%), Gaps = 4/152 (3%)
 Frame = +1

Query  148  AKMRRCLGLALLAKRGFSTSSSGDKIVASVLFERLPVVVPKIDPVVYAFQEFSFRWRQQY  327
             +M+  L   LL KRGFSTSS  +K+VA+VLFERLPVV+PKIDP+VYAFQEFSFRWRQQY
Sbjct  6    VRMKMSLIRPLLTKRGFSTSS--EKMVAAVLFERLPVVIPKIDPIVYAFQEFSFRWRQQY  63

Query  328  RREYPENFLKKADTRGKGEYQIDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLS  507
            +R YP+ FL ++D RGKG+YQIDY PAPR+TEADK NDR+SLQRALD+RLYLL++G    
Sbjct  64   QRRYPDEFLDRSDARGKGDYQIDYVPAPRVTEADKNNDRRSLQRALDRRLYLLIYGNVYG  123

Query  508  --SGKPVWHFPEKAYESEETLRRCAESALKSV  597
              S KPVWHFPEK YESEET+R+CAESALKSV
Sbjct  124  APSEKPVWHFPEKLYESEETMRKCAESALKSV  155



>ref|XP_004494827.1| PREDICTED: 39S ribosomal protein L46, mitochondrial-like isoform 
X2 [Cicer arietinum]
Length=228

 Score =   230 bits (587),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 110/150 (73%), Positives = 128/150 (85%), Gaps = 4/150 (3%)
 Frame = +1

Query  154  MRRCLGLALLAKRGFSTSSSGDKIVASVLFERLPVVVPKIDPVVYAFQEFSFRWRQQYRR  333
            M+  L   LL KRGFSTSS  +K+VA+VLFERLPVV+PKIDP+VYAFQEFSFRWRQQY+R
Sbjct  1    MKMSLIRPLLTKRGFSTSS--EKMVAAVLFERLPVVIPKIDPIVYAFQEFSFRWRQQYQR  58

Query  334  EYPENFLKKADTRGKGEYQIDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLS--  507
             YP+ FL ++D RGKG+YQIDY PAPR+TEADK NDR+SLQRALD+RLYLL++G      
Sbjct  59   RYPDEFLDRSDARGKGDYQIDYVPAPRVTEADKNNDRRSLQRALDRRLYLLIYGNVYGAP  118

Query  508  SGKPVWHFPEKAYESEETLRRCAESALKSV  597
            S KPVWHFPEK YESEET+R+CAESALKSV
Sbjct  119  SEKPVWHFPEKLYESEETMRKCAESALKSV  148



>gb|AET04314.2| 39S ribosomal protein L46 [Medicago truncatula]
Length=229

 Score =   229 bits (584),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 110/142 (77%), Positives = 125/142 (88%), Gaps = 4/142 (3%)
 Frame = +1

Query  178  LLAKRGFSTSSSGDKIVASVLFERLPVVVPKIDPVVYAFQEFSFRWRQQYRREYPENFLK  357
            LL +RGFSTSS  +K+VASVLFERLPVV+PKIDP VYAFQEFSFRWRQQY+R YP+ FL 
Sbjct  10   LLMRRGFSTSS--EKMVASVLFERLPVVIPKIDPNVYAFQEFSFRWRQQYQRRYPDEFLD  67

Query  358  KADTRGKGEYQIDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLS--SGKPVWHF  531
            ++D RGKG+YQIDY PAPRITEADK NDR+SLQRALD+RLYLLL G +    SGKPVWHF
Sbjct  68   RSDARGKGDYQIDYVPAPRITEADKQNDRRSLQRALDRRLYLLLFGDAYGAPSGKPVWHF  127

Query  532  PEKAYESEETLRRCAESALKSV  597
            PEK YESE+T+R+CAESALKSV
Sbjct  128  PEKVYESEDTMRKCAESALKSV  149



>ref|XP_003629838.1| 39S ribosomal protein L46 [Medicago truncatula]
Length=279

 Score =   230 bits (586),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 110/142 (77%), Positives = 125/142 (88%), Gaps = 4/142 (3%)
 Frame = +1

Query  178  LLAKRGFSTSSSGDKIVASVLFERLPVVVPKIDPVVYAFQEFSFRWRQQYRREYPENFLK  357
            LL +RGFSTSS  +K+VASVLFERLPVV+PKIDP VYAFQEFSFRWRQQY+R YP+ FL 
Sbjct  60   LLMRRGFSTSS--EKMVASVLFERLPVVIPKIDPNVYAFQEFSFRWRQQYQRRYPDEFLD  117

Query  358  KADTRGKGEYQIDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLS--SGKPVWHF  531
            ++D RGKG+YQIDY PAPRITEADK NDR+SLQRALD+RLYLLL G +    SGKPVWHF
Sbjct  118  RSDARGKGDYQIDYVPAPRITEADKQNDRRSLQRALDRRLYLLLFGDAYGAPSGKPVWHF  177

Query  532  PEKAYESEETLRRCAESALKSV  597
            PEK YESE+T+R+CAESALKSV
Sbjct  178  PEKVYESEDTMRKCAESALKSV  199



>emb|CAN73362.1| hypothetical protein VITISV_006167 [Vitis vinifera]
Length=253

 Score =   229 bits (583),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 113/156 (72%), Positives = 132/156 (85%), Gaps = 6/156 (4%)
 Frame = +1

Query  145  VAKMRRC---LGLALLAKRGFSTSSSGDKIVASVLFERLPVVVPKIDPVVYAFQEFSFRW  315
            +AKMRR    L  +L   RGF TS+S +KIVASVLFERLPVV+PKIDPVVYAFQEFSFRW
Sbjct  19   IAKMRRTFTSLARSLPPARGFCTSTS-EKIVASVLFERLPVVIPKIDPVVYAFQEFSFRW  77

Query  316  RQQYRREYPENFLKKADTRGKGEYQIDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHG  495
            RQQYRR+YP+   K+++ RGKG+YQIDY PAPR+TEAD+ NDR+SLQRALD+RLYLLL G
Sbjct  78   RQQYRRKYPDEIFKRSEERGKGDYQIDYVPAPRVTEADENNDRRSLQRALDRRLYLLLFG  137

Query  496  TSLSS--GKPVWHFPEKAYESEETLRRCAESALKSV  597
            T+  +  GKPVWHFPEK Y SEETLR+CAESAL+SV
Sbjct  138  TTYGAPDGKPVWHFPEKVYGSEETLRKCAESALESV  173



>ref|XP_010661810.1| PREDICTED: 39S ribosomal protein L46, mitochondrial [Vitis vinifera]
 emb|CBI40412.3| unnamed protein product [Vitis vinifera]
Length=232

 Score =   224 bits (571),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 111/153 (73%), Positives = 129/153 (84%), Gaps = 6/153 (4%)
 Frame = +1

Query  154  MRRC---LGLALLAKRGFSTSSSGDKIVASVLFERLPVVVPKIDPVVYAFQEFSFRWRQQ  324
            MRR    L  +L   RGF TS+S +KIVASVLFERLPVV+PKIDPVVYAFQEFSFRWRQQ
Sbjct  1    MRRTFTSLARSLPPARGFCTSTS-EKIVASVLFERLPVVIPKIDPVVYAFQEFSFRWRQQ  59

Query  325  YRREYPENFLKKADTRGKGEYQIDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSL  504
            YRR+YP+   K+++ RGKG+YQIDY PAPR+TEAD+ NDR+SLQRALD+RLYLLL GT+ 
Sbjct  60   YRRKYPDEIFKRSEERGKGDYQIDYVPAPRVTEADENNDRRSLQRALDRRLYLLLFGTTY  119

Query  505  SS--GKPVWHFPEKAYESEETLRRCAESALKSV  597
             +  GKPVWHFPEK Y SEETLR+CAESAL+SV
Sbjct  120  GAPDGKPVWHFPEKVYGSEETLRKCAESALESV  152



>ref|XP_010559102.1| PREDICTED: 54S ribosomal protein L17, mitochondrial [Tarenaya 
hassleriana]
Length=232

 Score =   224 bits (570),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 110/148 (74%), Positives = 125/148 (84%), Gaps = 4/148 (3%)
 Frame = +1

Query  160  RCLGLALLAKRGFSTSSSGDKIVASVLFERLPVVVPKIDPVVYAFQEFSFRWRQQYRREY  339
            R L   LLA RGFSTSS  DKIVASV+FERLP+V+PKIDPVVYAFQEFSFRW QQYRR Y
Sbjct  7    RSLVRPLLASRGFSTSS--DKIVASVVFERLPIVLPKIDPVVYAFQEFSFRWGQQYRRRY  64

Query  340  PENFLKKADTRGKGEYQIDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLSS--G  513
            P+ FL  A +R KGEY IDY PAPRITEADK+ND+KSLQRALD+RLYLL++G +  +   
Sbjct  65   PDEFLDLAKSRAKGEYHIDYVPAPRITEADKSNDKKSLQRALDRRLYLLVYGKAFGAPDD  124

Query  514  KPVWHFPEKAYESEETLRRCAESALKSV  597
            KP+WHFPEK YESE+TLR+CAESALKSV
Sbjct  125  KPIWHFPEKVYESEDTLRKCAESALKSV  152



>ref|NP_001145941.1| uncharacterized protein LOC100279464 [Zea mays]
 gb|ACL52893.1| unknown [Zea mays]
Length=219

 Score =   222 bits (566),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 107/145 (74%), Positives = 121/145 (83%), Gaps = 9/145 (6%)
 Frame = +1

Query  190  RGFSTS-------SSGDKIVASVLFERLPVVVPKIDPVVYAFQEFSFRWRQQYRREYPEN  348
            RGFS+S       ++  K+VASVLFERLPVV+PKI PVVYAFQEFSFRWRQQYRR+YPE 
Sbjct  20   RGFSSSVLASSKETADGKLVASVLFERLPVVIPKIHPVVYAFQEFSFRWRQQYRRQYPEE  79

Query  349  FLKKADTRGKGEYQIDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLSS--GKPV  522
             L KAD RGKG+Y IDY PAPRITEADKTNDRKSLQRALD +LYLLL+G +  +  GKPV
Sbjct  80   VLGKADARGKGDYHIDYVPAPRITEADKTNDRKSLQRALDNKLYLLLYGNAYGAPDGKPV  139

Query  523  WHFPEKAYESEETLRRCAESALKSV  597
            WHFPEK YE+EET+R CAE+ALKSV
Sbjct  140  WHFPEKVYENEETMRLCAEAALKSV  164



>ref|XP_010112966.1| hypothetical protein L484_021487 [Morus notabilis]
 gb|EXC35125.1| hypothetical protein L484_021487 [Morus notabilis]
Length=230

 Score =   221 bits (564),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 111/154 (72%), Positives = 125/154 (81%), Gaps = 8/154 (5%)
 Frame = +1

Query  154  MRRCLGLA----LLAKRGFSTSSSGDKIVASVLFERLPVVVPKIDPVVYAFQEFSFRWRQ  321
            MRR L       L  +RGF T S  DKIVASVLFERLPV++PKIDPVVYAFQEFSFRWRQ
Sbjct  1    MRRALSSVVRRPLAGQRGFCTGS--DKIVASVLFERLPVIIPKIDPVVYAFQEFSFRWRQ  58

Query  322  QYRREYPENFLKKADTRGKGEYQIDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHG--  495
            QYRR YPE  L+K+ ++ KGEYQIDY PAPRITEADK ND+KSLQRALD+RLYLLL G  
Sbjct  59   QYRRIYPEELLEKSGSKEKGEYQIDYEPAPRITEADKKNDKKSLQRALDRRLYLLLFGNP  118

Query  496  TSLSSGKPVWHFPEKAYESEETLRRCAESALKSV  597
                +G+PVWHFPEK YESEETLR+CAESAL++V
Sbjct  119  NGAPTGEPVWHFPEKVYESEETLRKCAESALENV  152



>gb|AFW86415.1| hypothetical protein ZEAMMB73_080636 [Zea mays]
Length=244

 Score =   221 bits (564),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 111/160 (69%), Positives = 128/160 (80%), Gaps = 13/160 (8%)
 Frame = +1

Query  145  VAKMRRCLGLALLAKRGFSTS-------SSGDKIVASVLFERLPVVVPKIDPVVYAFQEF  303
            V+ +RR    +L   RGFS+S       ++  K+VASVLFERLPVV+PKI PVVYAFQEF
Sbjct  9    VSLLRR----SLREPRGFSSSVLASSKETADGKLVASVLFERLPVVIPKIHPVVYAFQEF  64

Query  304  SFRWRQQYRREYPENFLKKADTRGKGEYQIDYTPAPRITEADKTNDRKSLQRALDKRLYL  483
            SFRWRQQYRR+YPE  L KAD RGKG+Y IDY PAPRITEADKTNDRKSLQRALD +LYL
Sbjct  65   SFRWRQQYRRQYPEEVLGKADARGKGDYHIDYVPAPRITEADKTNDRKSLQRALDNKLYL  124

Query  484  LLHGTSLSS--GKPVWHFPEKAYESEETLRRCAESALKSV  597
            LL+G +  +  GKPVWHFPEK YE+EET+R CAE+ALKSV
Sbjct  125  LLYGNAYGAPDGKPVWHFPEKVYENEETMRLCAEAALKSV  164



>ref|XP_006656026.1| PREDICTED: 39S ribosomal protein L46, mitochondrial-like [Oryza 
brachyantha]
Length=249

 Score =   221 bits (564),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 113/153 (74%), Positives = 126/153 (82%), Gaps = 12/153 (8%)
 Frame = +1

Query  175  ALLAKRGFSTSS--------SGD--KIVASVLFERLPVVVPKIDPVVYAFQEFSFRWRQQ  324
            +LL  RGFS+SS         GD  KIVASVLFERLP+V+PKI PVVYAFQEFSFRWRQQ
Sbjct  16   SLLGARGFSSSSPPSAPAAAEGDDGKIVASVLFERLPIVIPKIHPVVYAFQEFSFRWRQQ  75

Query  325  YRREYPENFLKKADTRGKGEYQIDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSL  504
            YRR+YP++ L KAD RGKG+YQIDY PAPRITEADK NDRKSLQRALD +LYLLL+G S 
Sbjct  76   YRRQYPDDVLGKADARGKGDYQIDYVPAPRITEADKANDRKSLQRALDNKLYLLLYGKSF  135

Query  505  SS--GKPVWHFPEKAYESEETLRRCAESALKSV  597
             +  GKPVWHFPEK YE+E+TLR CAESALKSV
Sbjct  136  GAPDGKPVWHFPEKVYENEDTLRLCAESALKSV  168



>ref|XP_007147685.1| hypothetical protein PHAVU_006G145900g [Phaseolus vulgaris]
 gb|ESW19679.1| hypothetical protein PHAVU_006G145900g [Phaseolus vulgaris]
Length=228

 Score =   220 bits (561),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 103/150 (69%), Positives = 127/150 (85%), Gaps = 4/150 (3%)
 Frame = +1

Query  154  MRRCLGLALLAKRGFSTSSSGDKIVASVLFERLPVVVPKIDPVVYAFQEFSFRWRQQYRR  333
            M+  L   LL +RGFSTSS  + +VASVLFERLPVV+PKIDPVVYAFQEFSFRW+QQY+R
Sbjct  1    MKMSLVRPLLTRRGFSTSS--ENLVASVLFERLPVVIPKIDPVVYAFQEFSFRWQQQYQR  58

Query  334  EYPENFLKKADTRGKGEYQIDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLS--  507
             YP+ F+ K++TRGKG+Y IDY PA R TEADK ND++SLQRALD+RLYLL++G +    
Sbjct  59   RYPDEFIDKSETRGKGDYHIDYVPAARFTEADKNNDKRSLQRALDRRLYLLVYGNAHGAP  118

Query  508  SGKPVWHFPEKAYESEETLRRCAESALKSV  597
            SGKP+WHFPEK YESE+T+R+CAESAL+S+
Sbjct  119  SGKPLWHFPEKVYESEDTMRKCAESALESI  148



>ref|XP_004965300.1| PREDICTED: 39S ribosomal protein L46, mitochondrial-like [Setaria 
italica]
Length=248

 Score =   219 bits (557),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 103/132 (78%), Positives = 116/132 (88%), Gaps = 2/132 (2%)
 Frame = +1

Query  208  SSGDKIVASVLFERLPVVVPKIDPVVYAFQEFSFRWRQQYRREYPENFLKKADTRGKGEY  387
             S  K+VASVLFERLPVV+PKI PVVYAFQEFSFRWRQQYRR+YP++ L KAD RGKG+Y
Sbjct  37   GSDGKLVASVLFERLPVVIPKIHPVVYAFQEFSFRWRQQYRRQYPDDVLGKADARGKGDY  96

Query  388  QIDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLSS--GKPVWHFPEKAYESEET  561
            QIDY PAPRITEADKTNDRKSLQRALD +LYLLL+G +  +  GKPVWHFPEK +E+EET
Sbjct  97   QIDYVPAPRITEADKTNDRKSLQRALDNKLYLLLYGNAYGAPDGKPVWHFPEKVFENEET  156

Query  562  LRRCAESALKSV  597
            +R CAESALKSV
Sbjct  157  MRLCAESALKSV  168



>ref|XP_002511925.1| DECOY, putative [Ricinus communis]
 gb|EEF50594.1| DECOY, putative [Ricinus communis]
Length=284

 Score =   219 bits (559),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 108/152 (71%), Positives = 125/152 (82%), Gaps = 8/152 (5%)
 Frame = +1

Query  160  RC----LGLALLAKRGFSTSSSGDKIVASVLFERLPVVVPKIDPVVYAFQEFSFRWRQQY  327
            RC    L   ++  RGF T    +KIVASVLFERLPVVVPKIDPVVYAFQEFSFRW+QQY
Sbjct  56   RCSLMRLARPVVTTRGFCTKP--EKIVASVLFERLPVVVPKIDPVVYAFQEFSFRWQQQY  113

Query  328  RREYPENFLKKADTRGKGEYQIDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLS  507
            RR YP+ FL KA+ RG+G+YQIDY PAPRITEADKTND KSLQRALD+RLYL+L+G +  
Sbjct  114  RRRYPDEFLDKANARGQGDYQIDYVPAPRITEADKTNDTKSLQRALDRRLYLVLYGNAYG  173

Query  508  --SGKPVWHFPEKAYESEETLRRCAESALKSV  597
              S KPVWHFP+K YE+E+TLR+CAESAL+SV
Sbjct  174  SPSKKPVWHFPQKLYEAEDTLRKCAESALQSV  205



>ref|XP_003563932.1| PREDICTED: 39S ribosomal protein L46, mitochondrial [Brachypodium 
distachyon]
Length=241

 Score =   217 bits (553),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 107/143 (75%), Positives = 122/143 (85%), Gaps = 7/143 (5%)
 Frame = +1

Query  190  RGFSTS---SSG--DKIVASVLFERLPVVVPKIDPVVYAFQEFSFRWRQQYRREYPENFL  354
            RGFS+S   ++G   KIVASVLFERLPVV+PKI PVVYAFQEFSFRW QQY+R+YP++ L
Sbjct  18   RGFSSSPPSAAGVDGKIVASVLFERLPVVIPKIHPVVYAFQEFSFRWGQQYKRKYPDDVL  77

Query  355  KKADTRGKGEYQIDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLSS--GKPVWH  528
             KAD RGKG+YQIDY PAPRITEADK NDRKSLQRALD +LYLLL+G +  +  GKPVWH
Sbjct  78   GKADARGKGDYQIDYVPAPRITEADKANDRKSLQRALDNKLYLLLYGNTFGAPDGKPVWH  137

Query  529  FPEKAYESEETLRRCAESALKSV  597
            FPEK YE+E+TLR CAESALKSV
Sbjct  138  FPEKVYENEDTLRLCAESALKSV  160



>ref|XP_002438278.1| hypothetical protein SORBIDRAFT_10g011040 [Sorghum bicolor]
 gb|EER89645.1| hypothetical protein SORBIDRAFT_10g011040 [Sorghum bicolor]
Length=246

 Score =   217 bits (552),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 102/128 (80%), Positives = 113/128 (88%), Gaps = 2/128 (2%)
 Frame = +1

Query  220  KIVASVLFERLPVVVPKIDPVVYAFQEFSFRWRQQYRREYPENFLKKADTRGKGEYQIDY  399
            K+VASVLFERLPVV+PKI PVVYAFQEFSFRWRQQYRR+YPE  L KAD RGKG+Y IDY
Sbjct  39   KLVASVLFERLPVVIPKIHPVVYAFQEFSFRWRQQYRRQYPEEVLGKADARGKGDYHIDY  98

Query  400  TPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLSS--GKPVWHFPEKAYESEETLRRC  573
             PAPRITEADKTNDRKSLQRALD +LYLLL+G +  +  GKPVWHFPEK YE+EET+R C
Sbjct  99   VPAPRITEADKTNDRKSLQRALDNKLYLLLYGNAYGAPDGKPVWHFPEKVYENEETMRLC  158

Query  574  AESALKSV  597
            AE+ALKSV
Sbjct  159  AEAALKSV  166



>ref|XP_010679139.1| PREDICTED: 39S ribosomal protein L46, mitochondrial [Beta vulgaris 
subsp. vulgaris]
Length=229

 Score =   215 bits (548),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 110/150 (73%), Positives = 127/150 (85%), Gaps = 3/150 (2%)
 Frame = +1

Query  157  RRC-LGLALLAKRGFSTSSSGDKIVASVLFERLPVVVPKIDPVVYAFQEFSFRWRQQYRR  333
            R+C L L    +   S+SSS DKIVASVLFERLPVV+PKIDP+VYAFQEFSFRW+QQY+R
Sbjct  3    RKCTLPLMRSLRSFSSSSSSSDKIVASVLFERLPVVIPKIDPLVYAFQEFSFRWKQQYQR  62

Query  334  EYPENFLKKADTRGKGEYQIDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLSS-  510
             YP+ F KK ++RGKG+YQIDY PA RITEADKTND++SLQRALD+RL+LLLHGTS  S 
Sbjct  63   IYPDEFYKKYESRGKGDYQIDYKPASRITEADKTNDKRSLQRALDRRLFLLLHGTSYGSP  122

Query  511  -GKPVWHFPEKAYESEETLRRCAESALKSV  597
             GK VWHFPEK YE EETLR+CAESAL+SV
Sbjct  123  DGKAVWHFPEKVYEDEETLRKCAESALQSV  152



>ref|NP_001057451.1| Os06g0300600 [Oryza sativa Japonica Group]
 dbj|BAD53489.1| putative decoy [Oryza sativa Japonica Group]
 dbj|BAF19365.1| Os06g0300600 [Oryza sativa Japonica Group]
 dbj|BAG87532.1| unnamed protein product [Oryza sativa Japonica Group]
Length=248

 Score =   216 bits (550),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 110/153 (72%), Positives = 126/153 (82%), Gaps = 12/153 (8%)
 Frame = +1

Query  175  ALLAKRGF--------STSSSGD--KIVASVLFERLPVVVPKIDPVVYAFQEFSFRWRQQ  324
            +LL  RGF        +T++ GD  KIVASVLFERLPVV+PKI PVVYAFQEFSFRWRQQ
Sbjct  15   SLLRARGFISSASPSAATAAEGDDGKIVASVLFERLPVVIPKIHPVVYAFQEFSFRWRQQ  74

Query  325  YRREYPENFLKKADTRGKGEYQIDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSL  504
            YRR+YP++ L KAD RGKG+YQIDY PAPRIT+ADKTNDRKSLQRALD RLYLLL+G + 
Sbjct  75   YRRKYPDDVLGKADARGKGDYQIDYVPAPRITDADKTNDRKSLQRALDNRLYLLLYGKAY  134

Query  505  SS--GKPVWHFPEKAYESEETLRRCAESALKSV  597
             +   KPVWHFPEK Y++E+TLR CAESALKSV
Sbjct  135  GAPDDKPVWHFPEKVYDNEDTLRLCAESALKSV  167



>gb|EEC80450.1| hypothetical protein OsI_22651 [Oryza sativa Indica Group]
Length=248

 Score =   216 bits (549),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 111/153 (73%), Positives = 126/153 (82%), Gaps = 12/153 (8%)
 Frame = +1

Query  175  ALLAKRGFSTSS--------SGD--KIVASVLFERLPVVVPKIDPVVYAFQEFSFRWRQQ  324
            +LL  RGFS+S+         GD  KIVASVLFERLPVV+PKI PVVYAFQEFSFRWRQQ
Sbjct  15   SLLRARGFSSSASPSAATAAEGDDGKIVASVLFERLPVVIPKIHPVVYAFQEFSFRWRQQ  74

Query  325  YRREYPENFLKKADTRGKGEYQIDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSL  504
            YRR+YP++ L KAD RGKG+YQIDY PAPRIT+ADKTNDRKSLQRALD RLYLLL+G + 
Sbjct  75   YRRKYPDDVLGKADARGKGDYQIDYVPAPRITDADKTNDRKSLQRALDNRLYLLLYGKAY  134

Query  505  SS--GKPVWHFPEKAYESEETLRRCAESALKSV  597
             +   KPVWHFPEK Y++E+TLR CAESALKSV
Sbjct  135  GAPDDKPVWHFPEKVYDNEDTLRLCAESALKSV  167



>ref|XP_006598926.1| PREDICTED: 39S ribosomal protein L46, mitochondrial-like isoform 
X2 [Glycine max]
Length=233

 Score =   214 bits (546),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 112/151 (74%), Positives = 131/151 (87%), Gaps = 4/151 (3%)
 Frame = +1

Query  151  KMRRCLGLALLAKRGFSTSSSGDKIVASVLFERLPVVVPKIDPVVYAFQEFSFRWRQQYR  330
            +M+  L   LL +RGFSTSS  + +VASVLFERLPVV+PKIDPVVYAFQEFSFRWRQQY+
Sbjct  5    RMKMSLVWPLLTRRGFSTSS--ENLVASVLFERLPVVIPKIDPVVYAFQEFSFRWRQQYQ  62

Query  331  REYPENFLKKADTRGKGEYQIDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLS-  507
            R YP+ FL K+D RGKG+YQIDY PAPRITEAD++NDR+SLQRALD+RLYLLL+G +   
Sbjct  63   RRYPDEFLDKSDARGKGDYQIDYVPAPRITEADQSNDRRSLQRALDRRLYLLLYGNAYGA  122

Query  508  -SGKPVWHFPEKAYESEETLRRCAESALKSV  597
             SGKPVWHFPEK YESE+T+R+CAESALKSV
Sbjct  123  PSGKPVWHFPEKVYESEDTMRKCAESALKSV  153



>gb|KHN18820.1| 39S ribosomal protein L46, mitochondrial [Glycine soja]
Length=228

 Score =   214 bits (545),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 112/150 (75%), Positives = 130/150 (87%), Gaps = 4/150 (3%)
 Frame = +1

Query  154  MRRCLGLALLAKRGFSTSSSGDKIVASVLFERLPVVVPKIDPVVYAFQEFSFRWRQQYRR  333
            M+  L   LL +RGFSTSS  + +VASVLFERLPVV+PKIDPVVYAFQEFSFRWRQQY+R
Sbjct  1    MKMSLVWPLLTRRGFSTSS--ENLVASVLFERLPVVIPKIDPVVYAFQEFSFRWRQQYQR  58

Query  334  EYPENFLKKADTRGKGEYQIDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLS--  507
             YP+ FL K+D RGKG+YQIDY PAPRITEAD++NDR+SLQRALD+RLYLLL+G +    
Sbjct  59   RYPDEFLDKSDARGKGDYQIDYVPAPRITEADQSNDRRSLQRALDRRLYLLLYGNAYGAP  118

Query  508  SGKPVWHFPEKAYESEETLRRCAESALKSV  597
            SGKPVWHFPEK YESE+T+R+CAESALKSV
Sbjct  119  SGKPVWHFPEKVYESEDTMRKCAESALKSV  148



>ref|XP_003548630.1| PREDICTED: 39S ribosomal protein L46, mitochondrial-like isoform 
X1 [Glycine max]
Length=228

 Score =   214 bits (545),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 112/150 (75%), Positives = 130/150 (87%), Gaps = 4/150 (3%)
 Frame = +1

Query  154  MRRCLGLALLAKRGFSTSSSGDKIVASVLFERLPVVVPKIDPVVYAFQEFSFRWRQQYRR  333
            M+  L   LL +RGFSTSS  + +VASVLFERLPVV+PKIDPVVYAFQEFSFRWRQQY+R
Sbjct  1    MKMSLVWPLLTRRGFSTSS--ENLVASVLFERLPVVIPKIDPVVYAFQEFSFRWRQQYQR  58

Query  334  EYPENFLKKADTRGKGEYQIDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLS--  507
             YP+ FL K+D RGKG+YQIDY PAPRITEAD++NDR+SLQRALD+RLYLLL+G +    
Sbjct  59   RYPDEFLDKSDARGKGDYQIDYVPAPRITEADQSNDRRSLQRALDRRLYLLLYGNAYGAP  118

Query  508  SGKPVWHFPEKAYESEETLRRCAESALKSV  597
            SGKPVWHFPEK YESE+T+R+CAESALKSV
Sbjct  119  SGKPVWHFPEKVYESEDTMRKCAESALKSV  148



>ref|XP_003534686.1| PREDICTED: 39S ribosomal protein L46, mitochondrial-like [Glycine 
max]
 gb|KHN40856.1| 39S ribosomal protein L46, mitochondrial [Glycine soja]
Length=228

 Score =   213 bits (542),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 112/150 (75%), Positives = 128/150 (85%), Gaps = 4/150 (3%)
 Frame = +1

Query  154  MRRCLGLALLAKRGFSTSSSGDKIVASVLFERLPVVVPKIDPVVYAFQEFSFRWRQQYRR  333
            M+  L   LL KRGFSTSS  + +VASVLFERLPVV+PKIDPVVYAFQEFSFRWRQQY+R
Sbjct  1    MKMSLVRPLLTKRGFSTSS--ENLVASVLFERLPVVIPKIDPVVYAFQEFSFRWRQQYQR  58

Query  334  EYPENFLKKADTRGKGEYQIDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLS--  507
             YP+ FL K+D RGKG+YQIDY PAPR+TEADK NDR+SLQRALD+RLYLLL+G +    
Sbjct  59   RYPDEFLDKSDARGKGDYQIDYVPAPRVTEADKNNDRRSLQRALDRRLYLLLYGIAYGAP  118

Query  508  SGKPVWHFPEKAYESEETLRRCAESALKSV  597
            SGKPVWHFPEK YESE+ +R+CAESALKSV
Sbjct  119  SGKPVWHFPEKVYESEDNMRKCAESALKSV  148



>gb|ACU23195.1| unknown [Glycine max]
Length=228

 Score =   213 bits (541),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 112/150 (75%), Positives = 128/150 (85%), Gaps = 4/150 (3%)
 Frame = +1

Query  154  MRRCLGLALLAKRGFSTSSSGDKIVASVLFERLPVVVPKIDPVVYAFQEFSFRWRQQYRR  333
            M+  L   LL KRGFSTSS  + +VASVLFERLPVV+PKIDPVVYAFQEFSFRWRQQY+R
Sbjct  1    MKMSLVRPLLTKRGFSTSS--ENLVASVLFERLPVVIPKIDPVVYAFQEFSFRWRQQYQR  58

Query  334  EYPENFLKKADTRGKGEYQIDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLS--  507
             YP+ FL K+D RGKG+YQIDY PAPR+TEADK NDR+SLQRALD+RLYLLL+G +    
Sbjct  59   RYPDEFLDKSDARGKGDYQIDYVPAPRVTEADKNNDRRSLQRALDRRLYLLLYGIAYGAP  118

Query  508  SGKPVWHFPEKAYESEETLRRCAESALKSV  597
            SGKPVWHFPEK YESE+ +R+CAESALKSV
Sbjct  119  SGKPVWHFPEKVYESEDDMRKCAESALKSV  148



>gb|KDP46856.1| hypothetical protein JCGZ_24065 [Jatropha curcas]
Length=231

 Score =   212 bits (540),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 117/153 (76%), Positives = 130/153 (85%), Gaps = 7/153 (5%)
 Frame = +1

Query  154  MRRCLGLA---LLAKRGFSTSSSGDKIVASVLFERLPVVVPKIDPVVYAFQEFSFRWRQQ  324
            MRR L      L+  RGF T S  +KIVASVLFERLPVVVPKIDPVVYAFQEFSFRWRQQ
Sbjct  1    MRRSLMWVARPLVTTRGFCTKS--EKIVASVLFERLPVVVPKIDPVVYAFQEFSFRWRQQ  58

Query  325  YRREYPENFLKKADTRGKGEYQIDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSL  504
            YRR YP+ FL K+++RGKG+YQIDY PAPRITEADKTNDRKSLQRALD+RLYLLL+G + 
Sbjct  59   YRRLYPDEFLDKSNSRGKGDYQIDYVPAPRITEADKTNDRKSLQRALDRRLYLLLYGNAY  118

Query  505  --SSGKPVWHFPEKAYESEETLRRCAESALKSV  597
               SGKPVWHFPEK YE+EETLR+CAESAL+SV
Sbjct  119  RSPSGKPVWHFPEKVYEAEETLRKCAESALQSV  151



>gb|KGN44851.1| hypothetical protein Csa_7G391280 [Cucumis sativus]
Length=272

 Score =   213 bits (543),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 113/159 (71%), Positives = 137/159 (86%), Gaps = 6/159 (4%)
 Frame = +1

Query  133  GIS*VAKMRRCLGLA--LLAKRGFSTSSSGDKIVASVLFERLPVVVPKIDPVVYAFQEFS  306
            G + + +M+R L  A  L+ +RGFST+S  +KIVA+VLFERLPVV+PKIDPV+YAF +F 
Sbjct  37   GHTVILRMQRSLNFAGQLVKRRGFSTNS--EKIVAAVLFERLPVVIPKIDPVIYAFTDFQ  94

Query  307  FRWRQQYRREYPENFLKKADTRGKGEYQIDYTPAPRITEADKTNDRKSLQRALDKRLYLL  486
            FRW+QQYRR+YP+ FL KAD RGKG+YQIDY PAPRITEADKTNDRKSL+RALD+RLYLL
Sbjct  95   FRWQQQYRRKYPDEFLNKADGRGKGDYQIDYVPAPRITEADKTNDRKSLKRALDRRLYLL  154

Query  487  LHGTSLSSG--KPVWHFPEKAYESEETLRRCAESALKSV  597
            L+G S+ +   KP+WHFPEKAYE+EETLR+CAESALKSV
Sbjct  155  LYGPSIGAPDEKPIWHFPEKAYETEETLRKCAESALKSV  193



>dbj|BAJ99373.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ91918.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK01038.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=245

 Score =   212 bits (539),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 99/128 (77%), Positives = 113/128 (88%), Gaps = 2/128 (2%)
 Frame = +1

Query  220  KIVASVLFERLPVVVPKIDPVVYAFQEFSFRWRQQYRREYPENFLKKADTRGKGEYQIDY  399
            K+VA+V+FERLPVV+PKI PVVYAFQEFSFRWRQQYRR+YP++ L KAD RGKG+YQIDY
Sbjct  37   KVVAAVVFERLPVVIPKIHPVVYAFQEFSFRWRQQYRRQYPDDVLGKADARGKGDYQIDY  96

Query  400  TPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLSS--GKPVWHFPEKAYESEETLRRC  573
             PAPRITEADK  DRKSLQRALD +LYLLL+G +  +  GKPVWHFPEK YE+E+TLR C
Sbjct  97   VPAPRITEADKAKDRKSLQRALDNKLYLLLYGKTFGAPDGKPVWHFPEKVYENEDTLRSC  156

Query  574  AESALKSV  597
            AESALKSV
Sbjct  157  AESALKSV  164



>ref|XP_004148875.1| PREDICTED: 39S ribosomal protein L46, mitochondrial-like [Cucumis 
sativus]
Length=229

 Score =   211 bits (537),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 112/152 (74%), Positives = 133/152 (88%), Gaps = 6/152 (4%)
 Frame = +1

Query  154  MRRCLGLA--LLAKRGFSTSSSGDKIVASVLFERLPVVVPKIDPVVYAFQEFSFRWRQQY  327
            M+R L  A  L+ +RGFST+S  +KIVA+VLFERLPVV+PKIDPV+YAF +F FRW+QQY
Sbjct  1    MQRSLNFAGQLVKRRGFSTNS--EKIVAAVLFERLPVVIPKIDPVIYAFTDFQFRWQQQY  58

Query  328  RREYPENFLKKADTRGKGEYQIDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLS  507
            RR+YP+ FL KAD RGKG+YQIDY PAPRITEADKTNDRKSL+RALD+RLYLLL+G S+ 
Sbjct  59   RRKYPDEFLNKADGRGKGDYQIDYVPAPRITEADKTNDRKSLKRALDRRLYLLLYGPSIG  118

Query  508  SG--KPVWHFPEKAYESEETLRRCAESALKSV  597
            +   KP+WHFPEKAYE+EETLR+CAESALKSV
Sbjct  119  APDEKPIWHFPEKAYETEETLRKCAESALKSV  150



>ref|XP_008451408.1| PREDICTED: 54S ribosomal protein L17, mitochondrial isoform X1 
[Cucumis melo]
Length=235

 Score =   211 bits (536),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 112/153 (73%), Positives = 133/153 (87%), Gaps = 6/153 (4%)
 Frame = +1

Query  151  KMRRCLGLA--LLAKRGFSTSSSGDKIVASVLFERLPVVVPKIDPVVYAFQEFSFRWRQQ  324
            +M+R L  A  L+ +RGFST+S  +KIVA+VLFERLP+V+PKIDPVVYAF EF FRW+QQ
Sbjct  6    RMQRSLSFASQLVKRRGFSTNS--EKIVANVLFERLPIVIPKIDPVVYAFTEFRFRWQQQ  63

Query  325  YRREYPENFLKKADTRGKGEYQIDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSL  504
            YRR+YP+ FL KAD RGKG+YQIDY PAPRITEADKTNDRKSL+RALD+RLYLLL+G S+
Sbjct  64   YRRKYPDEFLDKADARGKGDYQIDYVPAPRITEADKTNDRKSLKRALDRRLYLLLYGPSI  123

Query  505  SSG--KPVWHFPEKAYESEETLRRCAESALKSV  597
             +   KP+WHFPEK YE+EETLR+CAESALKSV
Sbjct  124  GAPDEKPIWHFPEKVYETEETLRKCAESALKSV  156



>emb|CDP08755.1| unnamed protein product [Coffea canephora]
Length=241

 Score =   211 bits (537),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 114/159 (72%), Positives = 131/159 (82%), Gaps = 12/159 (8%)
 Frame = +1

Query  157  RRC---LGLALLAKRGFSTSSS-------GDKIVASVLFERLPVVVPKIDPVVYAFQEFS  306
            R C   +G   L  RGF +SSS        DKI+ASV+FERLPVV+PKIDPVVYAFQEFS
Sbjct  3    RSCTSLVGRRQLRTRGFCSSSSRAANTGGDDKIIASVVFERLPVVIPKIDPVVYAFQEFS  62

Query  307  FRWRQQYRREYPENFLKKADTRGKGEYQIDYTPAPRITEADKTNDRKSLQRALDKRLYLL  486
            FRW+QQYRREYPE FLKK+D RGKG+YQIDY P+PR+TEADKTND+KSL+RALD+RLYLL
Sbjct  63   FRWQQQYRREYPEKFLKKSDARGKGDYQIDYVPSPRVTEADKTNDKKSLERALDRRLYLL  122

Query  487  LHGTSLS--SGKPVWHFPEKAYESEETLRRCAESALKSV  597
            L+GT+    SGKP WHFPEK YESE TLR+CAESAL+SV
Sbjct  123  LYGTAYGSPSGKPTWHFPEKVYESEGTLRKCAESALQSV  161



>ref|XP_003546166.1| PREDICTED: 39S ribosomal protein L46, mitochondrial-like [Glycine 
max]
 gb|KHN32993.1| 39S ribosomal protein L46, mitochondrial [Glycine soja]
Length=230

 Score =   210 bits (535),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 109/142 (77%), Positives = 125/142 (88%), Gaps = 4/142 (3%)
 Frame = +1

Query  178  LLAKRGFSTSSSGDKIVASVLFERLPVVVPKIDPVVYAFQEFSFRWRQQYRREYPENFLK  357
            LL +RGFS SS  + +VASVLFERLPVV+PKIDPVVYAFQEFSFRWRQQY+R YP+ FL 
Sbjct  11   LLTRRGFSASS--ENLVASVLFERLPVVIPKIDPVVYAFQEFSFRWRQQYQRRYPDEFLD  68

Query  358  KADTRGKGEYQIDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLS--SGKPVWHF  531
            K+D RGKG+YQIDY PAPR+TEADK NDR+SLQRALD+RLYLLL+G +    SGKPVWHF
Sbjct  69   KSDARGKGDYQIDYVPAPRVTEADKNNDRRSLQRALDRRLYLLLYGNAYGAPSGKPVWHF  128

Query  532  PEKAYESEETLRRCAESALKSV  597
            PEK YESE+T+R+CAESALKSV
Sbjct  129  PEKVYESEDTMRKCAESALKSV  150



>gb|ACU19535.1| unknown [Glycine max]
Length=230

 Score =   210 bits (535),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 109/142 (77%), Positives = 125/142 (88%), Gaps = 4/142 (3%)
 Frame = +1

Query  178  LLAKRGFSTSSSGDKIVASVLFERLPVVVPKIDPVVYAFQEFSFRWRQQYRREYPENFLK  357
            LL +RGFS SS  + +VASVLFERLPVV+PKIDPVVYAFQEFSFRWRQQY+R YP+ FL 
Sbjct  11   LLTRRGFSASS--ENLVASVLFERLPVVIPKIDPVVYAFQEFSFRWRQQYQRRYPDEFLD  68

Query  358  KADTRGKGEYQIDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLS--SGKPVWHF  531
            K+D RGKG+YQIDY PAPR+TEADK NDR+SLQRALD+RLYLLL+G +    SGKPVWHF
Sbjct  69   KSDARGKGDYQIDYVPAPRVTEADKNNDRRSLQRALDRRLYLLLYGNAYGAPSGKPVWHF  128

Query  532  PEKAYESEETLRRCAESALKSV  597
            PEK YESE+T+R+CAESALKSV
Sbjct  129  PEKVYESEDTMRKCAESALKSV  150



>ref|XP_008451409.1| PREDICTED: 54S ribosomal protein L17, mitochondrial isoform X2 
[Cucumis melo]
 ref|XP_008451410.1| PREDICTED: 54S ribosomal protein L17, mitochondrial isoform X2 
[Cucumis melo]
Length=229

 Score =   210 bits (534),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 112/152 (74%), Positives = 132/152 (87%), Gaps = 6/152 (4%)
 Frame = +1

Query  154  MRRCLGLA--LLAKRGFSTSSSGDKIVASVLFERLPVVVPKIDPVVYAFQEFSFRWRQQY  327
            M+R L  A  L+ +RGFST+S  +KIVA+VLFERLP+V+PKIDPVVYAF EF FRW+QQY
Sbjct  1    MQRSLSFASQLVKRRGFSTNS--EKIVANVLFERLPIVIPKIDPVVYAFTEFRFRWQQQY  58

Query  328  RREYPENFLKKADTRGKGEYQIDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLS  507
            RR+YP+ FL KAD RGKG+YQIDY PAPRITEADKTNDRKSL+RALD+RLYLLL+G S+ 
Sbjct  59   RRKYPDEFLDKADARGKGDYQIDYVPAPRITEADKTNDRKSLKRALDRRLYLLLYGPSIG  118

Query  508  SG--KPVWHFPEKAYESEETLRRCAESALKSV  597
            +   KP+WHFPEK YE+EETLR+CAESALKSV
Sbjct  119  APDEKPIWHFPEKVYETEETLRKCAESALKSV  150



>ref|XP_002461132.1| hypothetical protein SORBIDRAFT_02g041260 [Sorghum bicolor]
 gb|EER97653.1| hypothetical protein SORBIDRAFT_02g041260 [Sorghum bicolor]
Length=237

 Score =   210 bits (535),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 101/144 (70%), Positives = 120/144 (83%), Gaps = 9/144 (6%)
 Frame = +1

Query  193  GFSTSSS------GD-KIVASVLFERLPVVVPKIDPVVYAFQEFSFRWRQQYRREYPENF  351
            GFS+S++      GD K+VA+V+FERLPVV+PKI P VYAFQEFSFRWRQQ+RR+YP+  
Sbjct  14   GFSSSATSAAKEGGDGKLVATVMFERLPVVIPKIHPAVYAFQEFSFRWRQQHRRQYPDEV  73

Query  352  LKKADTRGKGEYQIDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLSS--GKPVW  525
            L KAD RGKG+Y IDY PAPRITEAD+TND+KSLQRALD +LYLLL+G +  +  GK VW
Sbjct  74   LGKADARGKGDYHIDYVPAPRITEADRTNDQKSLQRALDNKLYLLLYGNTYGAPDGKSVW  133

Query  526  HFPEKAYESEETLRRCAESALKSV  597
            HFPEK YE+EET+R CAESALKSV
Sbjct  134  HFPEKIYENEETMRLCAESALKSV  157



>ref|XP_004307545.1| PREDICTED: 39S ribosomal protein L46, mitochondrial [Fragaria 
vesca subsp. vesca]
Length=231

 Score =   210 bits (534),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 113/151 (75%), Positives = 128/151 (85%), Gaps = 3/151 (2%)
 Frame = +1

Query  154  MRRCLG-LALLAKRGFSTSSSGDKIVASVLFERLPVVVPKIDPVVYAFQEFSFRWRQQYR  330
            MRR +  L     RGF+T+SS +KIVASVLFERLPVV+P+IDPVVYAFQEFSFRWRQQYR
Sbjct  1    MRRSIASLGESLGRGFNTTSSSEKIVASVLFERLPVVIPRIDPVVYAFQEFSFRWRQQYR  60

Query  331  REYPENFLKKADTRGKGEYQIDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLSS  510
            R YP+  L K++ RGKG+YQIDY PAPRITEADK NDRKSLQRALD RLYLL++G +  S
Sbjct  61   RRYPDELLDKSNARGKGDYQIDYVPAPRITEADKQNDRKSLQRALDSRLYLLIYGNTYGS  120

Query  511  --GKPVWHFPEKAYESEETLRRCAESALKSV  597
              GKPVWHFPEK YESEETLR+CAESAL+SV
Sbjct  121  PAGKPVWHFPEKVYESEETLRKCAESALQSV  151



>gb|KJB24643.1| hypothetical protein B456_004G155200 [Gossypium raimondii]
Length=226

 Score =   208 bits (529),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 112/150 (75%), Positives = 128/150 (85%), Gaps = 4/150 (3%)
 Frame = +1

Query  154  MRRCLGLALLAKRGFSTSSSGDKIVASVLFERLPVVVPKIDPVVYAFQEFSFRWRQQYRR  333
            M R L    +  RGFS++S  +KIVASVLFERLPVV+PK+DPVVYAFQEFSFRWRQQYRR
Sbjct  1    MHRSLVRPFMGARGFSSTS--EKIVASVLFERLPVVIPKLDPVVYAFQEFSFRWRQQYRR  58

Query  334  EYPENFLKKADTRGKGEYQIDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLS--  507
            +YP+ FL  + +RGKG+YQIDY PAPRITEADKTNDRKSLQRALD+RLYLLL+G S +  
Sbjct  59   KYPDEFLDMSKSRGKGDYQIDYVPAPRITEADKTNDRKSLQRALDRRLYLLLYGDSNAAP  118

Query  508  SGKPVWHFPEKAYESEETLRRCAESALKSV  597
            S KPVWHFPEK Y+SEETLR+CAESAL SV
Sbjct  119  SRKPVWHFPEKVYDSEETLRKCAESALASV  148



>ref|XP_002892819.1| hypothetical protein ARALYDRAFT_888845 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69078.1| hypothetical protein ARALYDRAFT_888845 [Arabidopsis lyrata subsp. 
lyrata]
Length=233

 Score =   206 bits (525),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 106/149 (71%), Positives = 117/149 (79%), Gaps = 5/149 (3%)
 Frame = +1

Query  160  RCLGLALL-AKRGFSTSSSGDKIVASVLFERLPVVVPKIDPVVYAFQEFSFRWRQQYRRE  336
            R L   LL +KRGF TSS  DKIVASVLFERL VV+PK DP VYAFQEF F W+QQ+RR 
Sbjct  7    RLLAKPLLESKRGFCTSS--DKIVASVLFERLRVVIPKPDPAVYAFQEFKFNWQQQFRRR  64

Query  337  YPENFLKKADTRGKGEYQIDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSL--SS  510
            YP+ FL  A  R KGEYQ+DY PAPRITEADK NDRKSL RALDK+LYLL+ G     +S
Sbjct  65   YPDEFLDIAKNRAKGEYQMDYVPAPRITEADKNNDRKSLYRALDKKLYLLIFGKPFGATS  124

Query  511  GKPVWHFPEKAYESEETLRRCAESALKSV  597
             KPVWHFPEK Y+SE TLR+CAESALKSV
Sbjct  125  DKPVWHFPEKVYDSEPTLRKCAESALKSV  153



>ref|XP_006444943.1| hypothetical protein CICLE_v10021940mg [Citrus clementina]
 ref|XP_006491192.1| PREDICTED: 39S ribosomal protein L46, mitochondrial-like isoform 
X1 [Citrus sinensis]
 gb|ESR58183.1| hypothetical protein CICLE_v10021940mg [Citrus clementina]
 gb|KDO86322.1| hypothetical protein CISIN_1g026251mg [Citrus sinensis]
Length=241

 Score =   206 bits (524),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 113/161 (70%), Positives = 134/161 (83%), Gaps = 7/161 (4%)
 Frame = +1

Query  130  LGIS*VAKMRRCLGL---ALLAKRGFSTSSSGDKIVASVLFERLPVVVPKIDPVVYAFQE  300
            L +   +KMRR L      L A RGFST+S  +KIVASVLFERLPVV+PKIDPVVYAFQE
Sbjct  3    LSVGRNSKMRRSLTSLVRPLTATRGFSTNS--EKIVASVLFERLPVVIPKIDPVVYAFQE  60

Query  301  FSFRWRQQYRREYPENFLKKADTRGKGEYQIDYTPAPRITEADKTNDRKSLQRALDKRLY  480
            FSFRWRQQYRR YP+ FL K+++RGKG+YQ++Y PAPRITE DKTNDRKSLQRALD+RLY
Sbjct  61   FSFRWRQQYRRRYPDEFLDKSNSRGKGDYQMEYVPAPRITETDKTNDRKSLQRALDRRLY  120

Query  481  LLLHGTSLSS--GKPVWHFPEKAYESEETLRRCAESALKSV  597
            L+L+G +  +  GKP+WHFPEK YESEE+LR+CAE AL+SV
Sbjct  121  LILYGETFGAPGGKPIWHFPEKVYESEESLRKCAECALQSV  161



>gb|EPS64107.1| hypothetical protein M569_10674, partial [Genlisea aurea]
Length=220

 Score =   205 bits (522),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 113/143 (79%), Positives = 126/143 (88%), Gaps = 7/143 (5%)
 Frame = +1

Query  190  RGFSTSS----SGD-KIVASVLFERLPVVVPKIDPVVYAFQEFSFRWRQQYRREYPENFL  354
            RGF +S+     GD KIVASVLFERLPVVVPKIDP+VYAFQEFSFRWRQQYRREYPE FL
Sbjct  1    RGFCSSTVKSGGGDEKIVASVLFERLPVVVPKIDPIVYAFQEFSFRWRQQYRREYPEAFL  60

Query  355  KKADTRGKGEYQIDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLSS--GKPVWH  528
            KKAD+RG G+YQIDY PA RITEADKTND++SLQRALD+RLYLLL+G++ SS  GKPVWH
Sbjct  61   KKADSRGTGDYQIDYVPASRITEADKTNDKRSLQRALDRRLYLLLYGSTCSSPDGKPVWH  120

Query  529  FPEKAYESEETLRRCAESALKSV  597
             PEK +ESE TLR+CAESALKSV
Sbjct  121  LPEKLHESEPTLRKCAESALKSV  143



>ref|XP_010458967.1| PREDICTED: 54S ribosomal protein L17, mitochondrial-like [Camelina 
sativa]
Length=233

 Score =   205 bits (522),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 105/149 (70%), Positives = 118/149 (79%), Gaps = 5/149 (3%)
 Frame = +1

Query  160  RCLGLALL-AKRGFSTSSSGDKIVASVLFERLPVVVPKIDPVVYAFQEFSFRWRQQYRRE  336
            R L   LL ++RGF TSS  DKIVASVLFERL VV+PK DP VYAFQEF F W+QQ+RR 
Sbjct  7    RLLAKPLLESRRGFCTSS--DKIVASVLFERLRVVIPKPDPAVYAFQEFKFNWQQQFRRR  64

Query  337  YPENFLKKADTRGKGEYQIDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSL--SS  510
            YP+ FL  A  R KGEYQ+DY PAPRITEADK+NDRKSL RALDK+LYLL+ G     +S
Sbjct  65   YPDEFLDIAKNRSKGEYQMDYVPAPRITEADKSNDRKSLYRALDKKLYLLIFGKPFGATS  124

Query  511  GKPVWHFPEKAYESEETLRRCAESALKSV  597
             KPVWHFPEK Y+SE TLR+CAESALKSV
Sbjct  125  DKPVWHFPEKVYDSEPTLRKCAESALKSV  153



>ref|NP_001154338.1| protein decoy [Arabidopsis thaliana]
 gb|AEE29192.1| protein decoy [Arabidopsis thaliana]
Length=220

 Score =   205 bits (521),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 105/149 (70%), Positives = 117/149 (79%), Gaps = 5/149 (3%)
 Frame = +1

Query  160  RCLGLALL-AKRGFSTSSSGDKIVASVLFERLPVVVPKIDPVVYAFQEFSFRWRQQYRRE  336
            R L   LL ++RGF TSS  DKIVASVLFERL VV+PK DP VYAFQEF F W+QQ+RR 
Sbjct  7    RLLAKPLLESRRGFCTSS--DKIVASVLFERLRVVIPKPDPAVYAFQEFKFNWQQQFRRR  64

Query  337  YPENFLKKADTRGKGEYQIDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSL--SS  510
            YP+ FL  A  R KGEYQ+DY PAPRITEADK NDRKSL RALDK+LYLL+ G     +S
Sbjct  65   YPDEFLDIAKNRAKGEYQMDYVPAPRITEADKNNDRKSLYRALDKKLYLLIFGKPFGATS  124

Query  511  GKPVWHFPEKAYESEETLRRCAESALKSV  597
             KPVWHFPEK Y+SE TLR+CAESALKSV
Sbjct  125  DKPVWHFPEKVYDSEPTLRKCAESALKSV  153



>ref|NP_172914.1| protein decoy [Arabidopsis thaliana]
 gb|AAM83228.1| At1g14620/T5E21_15 [Arabidopsis thaliana]
 gb|AAN46785.1| At1g14620/T5E21_15 [Arabidopsis thaliana]
 gb|AEE29191.1| protein decoy [Arabidopsis thaliana]
Length=233

 Score =   205 bits (522),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 105/149 (70%), Positives = 117/149 (79%), Gaps = 5/149 (3%)
 Frame = +1

Query  160  RCLGLALL-AKRGFSTSSSGDKIVASVLFERLPVVVPKIDPVVYAFQEFSFRWRQQYRRE  336
            R L   LL ++RGF TSS  DKIVASVLFERL VV+PK DP VYAFQEF F W+QQ+RR 
Sbjct  7    RLLAKPLLESRRGFCTSS--DKIVASVLFERLRVVIPKPDPAVYAFQEFKFNWQQQFRRR  64

Query  337  YPENFLKKADTRGKGEYQIDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSL--SS  510
            YP+ FL  A  R KGEYQ+DY PAPRITEADK NDRKSL RALDK+LYLL+ G     +S
Sbjct  65   YPDEFLDIAKNRAKGEYQMDYVPAPRITEADKNNDRKSLYRALDKKLYLLIFGKPFGATS  124

Query  511  GKPVWHFPEKAYESEETLRRCAESALKSV  597
             KPVWHFPEK Y+SE TLR+CAESALKSV
Sbjct  125  DKPVWHFPEKVYDSEPTLRKCAESALKSV  153



>ref|XP_010252867.1| PREDICTED: 39S ribosomal protein L46, mitochondrial [Nelumbo 
nucifera]
Length=234

 Score =   205 bits (521),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 110/148 (74%), Positives = 125/148 (84%), Gaps = 4/148 (3%)
 Frame = +1

Query  166  LGLALLAKRGFSTSSSG--DKIVASVLFERLPVVVPKIDPVVYAFQEFSFRWRQQYRREY  339
            L  +L+  RGF TSS+   DKIVA+VLFERLPVV+PKIDPVVYAFQEFSF WRQQYRR+Y
Sbjct  7    LSRSLVRTRGFCTSSNSNTDKIVAAVLFERLPVVIPKIDPVVYAFQEFSFLWRQQYRRKY  66

Query  340  PENFLKKADTRGKGEYQIDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLS--SG  513
            P+  L K+DTRGKG+YQIDY PAPR TEADK NDR+SLQRALD+RLYLLL+G+     +G
Sbjct  67   PDEVLSKSDTRGKGDYQIDYVPAPRATEADKKNDRRSLQRALDRRLYLLLYGSGYGAPAG  126

Query  514  KPVWHFPEKAYESEETLRRCAESALKSV  597
            KPVWHFPEK YE EETLR+CAESALK V
Sbjct  127  KPVWHFPEKVYEDEETLRKCAESALKYV  154



>ref|XP_006306556.1| hypothetical protein CARUB_v10012651mg [Capsella rubella]
 ref|XP_010476524.1| PREDICTED: 39S ribosomal protein L46, mitochondrial-like [Camelina 
sativa]
 gb|EOA39454.1| hypothetical protein CARUB_v10012651mg [Capsella rubella]
Length=233

 Score =   204 bits (520),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 105/149 (70%), Positives = 117/149 (79%), Gaps = 5/149 (3%)
 Frame = +1

Query  160  RCLGLALL-AKRGFSTSSSGDKIVASVLFERLPVVVPKIDPVVYAFQEFSFRWRQQYRRE  336
            R L   LL ++RGF TSS  DKIVASVLFERL VV+PK DP VYAFQEF F W+QQ+RR 
Sbjct  7    RLLAKPLLESRRGFCTSS--DKIVASVLFERLRVVIPKPDPAVYAFQEFKFNWQQQFRRR  64

Query  337  YPENFLKKADTRGKGEYQIDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSL--SS  510
            YP+ FL  A  R KGEYQ+DY PAPRITEADK NDRKSL RALDK+LYLL+ G     +S
Sbjct  65   YPDEFLDIAKNRAKGEYQMDYVPAPRITEADKKNDRKSLYRALDKKLYLLIFGKPFGATS  124

Query  511  GKPVWHFPEKAYESEETLRRCAESALKSV  597
             KPVWHFPEK Y+SE TLR+CAESALKSV
Sbjct  125  DKPVWHFPEKVYDSEPTLRKCAESALKSV  153



>gb|KCW80911.1| hypothetical protein EUGRSUZ_C02275 [Eucalyptus grandis]
Length=276

 Score =   206 bits (523),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 112/152 (74%), Positives = 125/152 (82%), Gaps = 4/152 (3%)
 Frame = +1

Query  148  AKMRRCLGLALLAKRGFSTSSSGDKIVASVLFERLPVVVPKIDPVVYAFQEFSFRWRQQY  327
            A+MRR L   +   RGF T    +K+VASVLFERLPVVVPKIDPVVYAFQEFSFRW QQY
Sbjct  47   AEMRRSLSSLVRPARGFCTKP--EKVVASVLFERLPVVVPKIDPVVYAFQEFSFRWCQQY  104

Query  328  RREYPENFLKKADTRGKGEYQIDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLS  507
            RR YP+ FL K++ RGKG+YQIDY PA RITEADKTNDRKSLQRALD+RLYLLL+G +  
Sbjct  105  RRRYPDEFLDKSNARGKGDYQIDYVPASRITEADKTNDRKSLQRALDRRLYLLLYGNAYG  164

Query  508  S--GKPVWHFPEKAYESEETLRRCAESALKSV  597
            S    PVWHFPEK YESEETLR+CAESAL+SV
Sbjct  165  SPAADPVWHFPEKVYESEETLRKCAESALESV  196



>ref|XP_009133763.1| PREDICTED: 39S ribosomal protein L46, mitochondrial-like [Brassica 
rapa]
 emb|CDX83379.1| BnaA03g21270D [Brassica napus]
Length=239

 Score =   204 bits (519),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 99/137 (72%), Positives = 111/137 (81%), Gaps = 2/137 (1%)
 Frame = +1

Query  193  GFSTSSSGDKIVASVLFERLPVVVPKIDPVVYAFQEFSFRWRQQYRREYPENFLKKADTR  372
            G+ TSSS +KIVASVLFERL VV+PK DP VYAFQEF F W+QQ+RR YP+ FL  A  R
Sbjct  23   GYCTSSSSEKIVASVLFERLRVVIPKPDPAVYAFQEFKFNWQQQFRRRYPDEFLDIAKNR  82

Query  373  GKGEYQIDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSL--SSGKPVWHFPEKAY  546
             KGEYQ+DY PAPRITEADK NDRKSL RALDK+LYLL+ G     +S KPVWHFPEK Y
Sbjct  83   AKGEYQMDYVPAPRITEADKNNDRKSLYRALDKKLYLLIFGKPFGATSDKPVWHFPEKVY  142

Query  547  ESEETLRRCAESALKSV  597
            +SE TLR+CAESALKSV
Sbjct  143  DSEPTLRKCAESALKSV  159



>ref|XP_009142409.1| PREDICTED: 39S ribosomal protein L46, mitochondrial-like [Brassica 
rapa]
Length=236

 Score =   204 bits (518),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 97/138 (70%), Positives = 112/138 (81%), Gaps = 2/138 (1%)
 Frame = +1

Query  190  RGFSTSSSGDKIVASVLFERLPVVVPKIDPVVYAFQEFSFRWRQQYRREYPENFLKKADT  369
            RG+ TSSS +KI+ASVLFERL VV+PK DP VYAFQEF F W+QQ+RR YP+ FL  A  
Sbjct  19   RGYCTSSSSEKIIASVLFERLRVVIPKPDPTVYAFQEFKFNWQQQFRRRYPDEFLDIAKN  78

Query  370  RGKGEYQIDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSL--SSGKPVWHFPEKA  543
            R KGEYQ+DY PAPR+TEADK ND+KSL RALDK+LYLL+ G     +S KPVWHFPEK 
Sbjct  79   RAKGEYQMDYVPAPRVTEADKNNDKKSLYRALDKKLYLLVFGKPFGATSDKPVWHFPEKV  138

Query  544  YESEETLRRCAESALKSV  597
            Y+SE TLR+CAESALKSV
Sbjct  139  YDSEPTLRKCAESALKSV  156



>gb|EMT05997.1| hypothetical protein F775_31074 [Aegilops tauschii]
Length=909

 Score =   216 bits (551),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 101/128 (79%), Positives = 114/128 (89%), Gaps = 2/128 (2%)
 Frame = +1

Query  220  KIVASVLFERLPVVVPKIDPVVYAFQEFSFRWRQQYRREYPENFLKKADTRGKGEYQIDY  399
            KIVASV+FERLPVV+PKI PVVYAFQEFSFRWRQQYRR+YP++ L KAD RGKG+YQIDY
Sbjct  37   KIVASVVFERLPVVIPKIHPVVYAFQEFSFRWRQQYRRQYPDDVLGKADARGKGDYQIDY  96

Query  400  TPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLSS--GKPVWHFPEKAYESEETLRRC  573
             PAPRITEADK NDRKSLQRALD +LYLLL+G +  +  GKPVWHFPEK YE+E++LR C
Sbjct  97   VPAPRITEADKANDRKSLQRALDNKLYLLLYGKTFGAPDGKPVWHFPEKVYENEDSLRLC  156

Query  574  AESALKSV  597
            AESALKSV
Sbjct  157  AESALKSV  164



>ref|XP_010496294.1| PREDICTED: 39S ribosomal protein L46, mitochondrial-like [Camelina 
sativa]
Length=233

 Score =   203 bits (517),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 104/149 (70%), Positives = 117/149 (79%), Gaps = 5/149 (3%)
 Frame = +1

Query  160  RCLGLALL-AKRGFSTSSSGDKIVASVLFERLPVVVPKIDPVVYAFQEFSFRWRQQYRRE  336
            R L   LL ++RGF TSS  DKIVASVLFERL VV+P+ DP VYAFQEF F W+QQ+RR 
Sbjct  7    RLLAKPLLESRRGFCTSS--DKIVASVLFERLRVVIPRPDPAVYAFQEFKFNWQQQFRRR  64

Query  337  YPENFLKKADTRGKGEYQIDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSL--SS  510
            YP+ FL  A  R KGEYQ+DY PAPRITEADK NDRKSL RALDK+LYLL+ G     +S
Sbjct  65   YPDEFLDIAKNRAKGEYQMDYVPAPRITEADKKNDRKSLYRALDKKLYLLIFGKPFGATS  124

Query  511  GKPVWHFPEKAYESEETLRRCAESALKSV  597
             KPVWHFPEK Y+SE TLR+CAESALKSV
Sbjct  125  DKPVWHFPEKVYDSEPTLRKCAESALKSV  153



>ref|XP_006444940.1| hypothetical protein CICLE_v10021940mg [Citrus clementina]
 ref|XP_006444941.1| hypothetical protein CICLE_v10021940mg [Citrus clementina]
 ref|XP_006444945.1| hypothetical protein CICLE_v10021940mg [Citrus clementina]
 ref|XP_006491193.1| PREDICTED: 39S ribosomal protein L46, mitochondrial-like isoform 
X2 [Citrus sinensis]
 ref|XP_006491194.1| PREDICTED: 39S ribosomal protein L46, mitochondrial-like isoform 
X3 [Citrus sinensis]
 ref|XP_006491195.1| PREDICTED: 39S ribosomal protein L46, mitochondrial-like isoform 
X4 [Citrus sinensis]
 gb|ESR58180.1| hypothetical protein CICLE_v10021940mg [Citrus clementina]
 gb|ESR58181.1| hypothetical protein CICLE_v10021940mg [Citrus clementina]
 gb|ESR58185.1| hypothetical protein CICLE_v10021940mg [Citrus clementina]
 gb|KDO86323.1| hypothetical protein CISIN_1g026251mg [Citrus sinensis]
 gb|KDO86324.1| hypothetical protein CISIN_1g026251mg [Citrus sinensis]
 gb|KDO86325.1| hypothetical protein CISIN_1g026251mg [Citrus sinensis]
Length=231

 Score =   203 bits (517),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 111/153 (73%), Positives = 130/153 (85%), Gaps = 7/153 (5%)
 Frame = +1

Query  154  MRRCLGL---ALLAKRGFSTSSSGDKIVASVLFERLPVVVPKIDPVVYAFQEFSFRWRQQ  324
            MRR L      L A RGFST+S  +KIVASVLFERLPVV+PKIDPVVYAFQEFSFRWRQQ
Sbjct  1    MRRSLTSLVRPLTATRGFSTNS--EKIVASVLFERLPVVIPKIDPVVYAFQEFSFRWRQQ  58

Query  325  YRREYPENFLKKADTRGKGEYQIDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSL  504
            YRR YP+ FL K+++RGKG+YQ++Y PAPRITE DKTNDRKSLQRALD+RLYL+L+G + 
Sbjct  59   YRRRYPDEFLDKSNSRGKGDYQMEYVPAPRITETDKTNDRKSLQRALDRRLYLILYGETF  118

Query  505  SS--GKPVWHFPEKAYESEETLRRCAESALKSV  597
             +  GKP+WHFPEK YESEE+LR+CAE AL+SV
Sbjct  119  GAPGGKPIWHFPEKVYESEESLRKCAECALQSV  151



>emb|CDY37090.1| BnaA04g26680D [Brassica napus]
Length=266

 Score =   204 bits (520),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 98/138 (71%), Positives = 112/138 (81%), Gaps = 2/138 (1%)
 Frame = +1

Query  190  RGFSTSSSGDKIVASVLFERLPVVVPKIDPVVYAFQEFSFRWRQQYRREYPENFLKKADT  369
            RG+ TSSS +KIVASVLFERL VV+PK DP VYAFQEF F W+QQ+RR YP+ FL  A  
Sbjct  49   RGYCTSSSSEKIVASVLFERLRVVIPKPDPTVYAFQEFKFNWQQQFRRRYPDEFLDIAKN  108

Query  370  RGKGEYQIDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSL--SSGKPVWHFPEKA  543
            R KGEYQ+DY PAPR+TEADK ND+KSL RALDK+LYLL+ G     +S KPVWHFPEK 
Sbjct  109  RAKGEYQMDYVPAPRVTEADKNNDKKSLYRALDKKLYLLVFGKPFGATSDKPVWHFPEKV  168

Query  544  YESEETLRRCAESALKSV  597
            Y+SE TLR+CAESALKSV
Sbjct  169  YDSEPTLRKCAESALKSV  186



>ref|XP_010048602.1| PREDICTED: 39S ribosomal protein L46, mitochondrial [Eucalyptus 
grandis]
 ref|XP_010048604.1| PREDICTED: 39S ribosomal protein L46, mitochondrial [Eucalyptus 
grandis]
 ref|XP_010048605.1| PREDICTED: 39S ribosomal protein L46, mitochondrial [Eucalyptus 
grandis]
Length=228

 Score =   202 bits (515),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 111/150 (74%), Positives = 123/150 (82%), Gaps = 4/150 (3%)
 Frame = +1

Query  154  MRRCLGLALLAKRGFSTSSSGDKIVASVLFERLPVVVPKIDPVVYAFQEFSFRWRQQYRR  333
            MRR L   +   RGF T    +K+VASVLFERLPVVVPKIDPVVYAFQEFSFRW QQYRR
Sbjct  1    MRRSLSSLVRPARGFCTKP--EKVVASVLFERLPVVVPKIDPVVYAFQEFSFRWCQQYRR  58

Query  334  EYPENFLKKADTRGKGEYQIDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLSS-  510
             YP+ FL K++ RGKG+YQIDY PA RITEADKTNDRKSLQRALD+RLYLLL+G +  S 
Sbjct  59   RYPDEFLDKSNARGKGDYQIDYVPASRITEADKTNDRKSLQRALDRRLYLLLYGNAYGSP  118

Query  511  -GKPVWHFPEKAYESEETLRRCAESALKSV  597
               PVWHFPEK YESEETLR+CAESAL+SV
Sbjct  119  AADPVWHFPEKVYESEETLRKCAESALESV  148



>ref|XP_006416994.1| hypothetical protein EUTSA_v10008660mg [Eutrema salsugineum]
 gb|ESQ35347.1| hypothetical protein EUTSA_v10008660mg [Eutrema salsugineum]
Length=232

 Score =   202 bits (515),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 101/152 (66%), Positives = 117/152 (77%), Gaps = 4/152 (3%)
 Frame = +1

Query  148  AKMRRCLGLALLAKRGFSTSSSGDKIVASVLFERLPVVVPKIDPVVYAFQEFSFRWRQQY  327
            + +R   G  L ++RGF TSS  DK+VASVLFERL VV+PK DP VY FQEF F W+QQ+
Sbjct  3    SSLRLLAGSLLESRRGFCTSS--DKLVASVLFERLRVVIPKPDPAVYTFQEFKFNWQQQF  60

Query  328  RREYPENFLKKADTRGKGEYQIDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSL-  504
            RR YP+ FL  A  R KGEYQ+DY PAPRITEADK NDRKSL RALDK+LYLL+ G    
Sbjct  61   RRRYPDEFLDIAKNRAKGEYQMDYVPAPRITEADKKNDRKSLYRALDKKLYLLIFGKPFG  120

Query  505  -SSGKPVWHFPEKAYESEETLRRCAESALKSV  597
             +S KPVWHFPEK Y+SE TLR+CAESAL+SV
Sbjct  121  ATSDKPVWHFPEKVYDSEPTLRKCAESALESV  152



>emb|CDX95682.1| BnaC03g25630D [Brassica napus]
Length=239

 Score =   202 bits (514),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 98/137 (72%), Positives = 111/137 (81%), Gaps = 2/137 (1%)
 Frame = +1

Query  193  GFSTSSSGDKIVASVLFERLPVVVPKIDPVVYAFQEFSFRWRQQYRREYPENFLKKADTR  372
            G+ TSSS +KIVASVLFERL VV+PK DP VYAFQEF F W+QQ+RR YP+ FL  A  R
Sbjct  23   GYCTSSSSEKIVASVLFERLRVVIPKPDPAVYAFQEFKFNWQQQFRRRYPDEFLDIAKNR  82

Query  373  GKGEYQIDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSL--SSGKPVWHFPEKAY  546
             KGEYQ+DY PAPRITEADK NDRKSL RALDK+LYLL+ G     +S +PVWHFPEK Y
Sbjct  83   AKGEYQMDYVPAPRITEADKNNDRKSLYRALDKKLYLLIFGKPFGATSDEPVWHFPEKVY  142

Query  547  ESEETLRRCAESALKSV  597
            +SE TLR+CAESALKSV
Sbjct  143  DSEPTLRKCAESALKSV  159



>gb|AAB48039.1| decoy [Arabidopsis thaliana]
 gb|AAB51588.1| decoy [Arabidopsis thaliana]
Length=210

 Score =   201 bits (511),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 104/149 (70%), Positives = 116/149 (78%), Gaps = 5/149 (3%)
 Frame = +1

Query  160  RCLGLALL-AKRGFSTSSSGDKIVASVLFERLPVVVPKIDPVVYAFQEFSFRWRQQYRRE  336
            R L   LL ++RGF TSS  DKIVASVLFERL VV+PK DP VYAFQEF F W+QQ+RR 
Sbjct  7    RLLAKPLLESRRGFCTSS--DKIVASVLFERLRVVIPKPDPAVYAFQEFKFNWQQQFRRR  64

Query  337  YPENFLKKADTRGKGEYQIDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSL--SS  510
            YP+ FL  A  R KGEYQ+DY PAPRITEADK NDRKSL RALDK+LYLL+ G     +S
Sbjct  65   YPDEFLDIAKNRAKGEYQMDYVPAPRITEADKNNDRKSLYRALDKKLYLLIFGKPFGATS  124

Query  511  GKPVWHFPEKAYESEETLRRCAESALKSV  597
             KPVW FPEK Y+SE TLR+CAESALKSV
Sbjct  125  DKPVWPFPEKVYDSEPTLRKCAESALKSV  153



>gb|KFK43707.1| hypothetical protein AALP_AA1G162600 [Arabis alpina]
Length=230

 Score =   201 bits (511),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 100/140 (71%), Positives = 111/140 (79%), Gaps = 4/140 (3%)
 Frame = +1

Query  184  AKRGFSTSSSGDKIVASVLFERLPVVVPKIDPVVYAFQEFSFRWRQQYRREYPENFLKKA  363
            +KR F TSS  DKIVASVLFERL VV+PK DP VY FQEF F W+QQ+RR YP+ FL  A
Sbjct  13   SKRAFCTSS--DKIVASVLFERLRVVIPKPDPAVYTFQEFKFNWQQQFRRRYPDEFLDIA  70

Query  364  DTRGKGEYQIDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSL--SSGKPVWHFPE  537
              R KGEYQ+DY PAPRITEADK NDRKSL RALDK+LYLL+ G     +S KPVWHFPE
Sbjct  71   KNRAKGEYQMDYVPAPRITEADKKNDRKSLYRALDKKLYLLIFGKPFGATSDKPVWHFPE  130

Query  538  KAYESEETLRRCAESALKSV  597
            K Y+SE TLR+CAESALKSV
Sbjct  131  KVYDSEPTLRKCAESALKSV  150



>ref|XP_002301376.2| hypothetical protein POPTR_0002s16630g [Populus trichocarpa]
 gb|EEE80649.2| hypothetical protein POPTR_0002s16630g [Populus trichocarpa]
Length=256

 Score =   201 bits (512),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 111/156 (71%), Positives = 131/156 (84%), Gaps = 8/156 (5%)
 Frame = +1

Query  148  AKMRRCL----GLALLAKRGFSTSSSGDKIVASVLFERLPVVVPKIDPVVYAFQEFSFRW  315
            +KMRR L     L+L+ KRGF   +  +KIVASVLFERLPVV+PKIDPVVYAF EFSFRW
Sbjct  24   SKMRRSLFTSLALSLVTKRGFC--AKPEKIVASVLFERLPVVIPKIDPVVYAFTEFSFRW  81

Query  316  RQQYRREYPENFLKKADTRGKGEYQIDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHG  495
            RQQ+RR YP+ FL K+++ GKG+YQI+Y PAPRITEADKTND+KSLQRALD++LYLLL+G
Sbjct  82   RQQFRRRYPDEFLDKSNSSGKGDYQIEYEPAPRITEADKTNDKKSLQRALDRKLYLLLYG  141

Query  496  TSLS--SGKPVWHFPEKAYESEETLRRCAESALKSV  597
             +    S KPVWHFPEK YESEETLR+CAESAL+SV
Sbjct  142  KAYGSPSDKPVWHFPEKVYESEETLRKCAESALQSV  177



>ref|XP_006857649.1| hypothetical protein AMTR_s00061p00143360 [Amborella trichopoda]
 gb|ERN19116.1| hypothetical protein AMTR_s00061p00143360 [Amborella trichopoda]
Length=233

 Score =   200 bits (508),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 110/148 (74%), Positives = 126/148 (85%), Gaps = 9/148 (6%)
 Frame = +1

Query  160  RCLGLALLAKRGFSTSSSGDKIVASVLFERLPVVVPKIDPVVYAFQEFSFRWRQQYRREY  339
            R LGL      GF TSSS +KI+ASVLFERLPVV+PKIDP+VYAFQEF+FRWRQQY R+Y
Sbjct  13   RKLGL------GFCTSSS-EKILASVLFERLPVVIPKIDPLVYAFQEFAFRWRQQYGRQY  65

Query  340  PENFLKKADTRGKGEYQIDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSL--SSG  513
            P+  L KAD RGKG+YQIDY PAPRITEADKTNDR+SLQRALD+RLYLLL+GT+   S+ 
Sbjct  66   PDEVLGKADARGKGDYQIDYQPAPRITEADKTNDRRSLQRALDRRLYLLLYGTAFGTSNK  125

Query  514  KPVWHFPEKAYESEETLRRCAESALKSV  597
             PVWHFPEK Y +EETLR+CAESAL+SV
Sbjct  126  NPVWHFPEKVYGTEETLRKCAESALQSV  153



>ref|XP_011023270.1| PREDICTED: 39S ribosomal protein L46, mitochondrial [Populus 
euphratica]
 ref|XP_011023271.1| PREDICTED: 39S ribosomal protein L46, mitochondrial [Populus 
euphratica]
Length=231

 Score =   199 bits (505),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 110/154 (71%), Positives = 128/154 (83%), Gaps = 8/154 (5%)
 Frame = +1

Query  154  MRRCL----GLALLAKRGFSTSSSGDKIVASVLFERLPVVVPKIDPVVYAFQEFSFRWRQ  321
            MRR L     L+L+ KRGF T    +KIVASVLFERLPVV+PKIDPVVYAF EFSFRWRQ
Sbjct  1    MRRSLFTSLALSLVTKRGFCTKP--EKIVASVLFERLPVVIPKIDPVVYAFTEFSFRWRQ  58

Query  322  QYRREYPENFLKKADTRGKGEYQIDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTS  501
            Q+RR YP+ FL K+++ GKG+YQI+Y PAPRITEADK ND+KSLQRALD++LYLLL+G +
Sbjct  59   QFRRRYPDEFLDKSNSSGKGDYQIEYEPAPRITEADKKNDKKSLQRALDRKLYLLLYGKA  118

Query  502  LS--SGKPVWHFPEKAYESEETLRRCAESALKSV  597
                S KPVWHFPEK YESEETLR+CAESAL+SV
Sbjct  119  YGSPSDKPVWHFPEKVYESEETLRKCAESALQSV  152



>ref|XP_009391791.1| PREDICTED: 54S ribosomal protein L17, mitochondrial-like [Musa 
acuminata subsp. malaccensis]
Length=235

 Score =   198 bits (504),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 110/158 (70%), Positives = 129/158 (82%), Gaps = 10/158 (6%)
 Frame = +1

Query  154  MRRCLGLALLAKRGF--STSSSG------DKIVASVLFERLPVVVPKIDPVVYAFQEFSF  309
            MRR +   LL  R F  ST+ SG      DKIVA+VLFERLPVV+PKI+P+VYAF+EFSF
Sbjct  1    MRRSVAPLLLRSRRFASSTAVSGISSSSSDKIVAAVLFERLPVVIPKIEPIVYAFREFSF  60

Query  310  RWRQQYRREYPENFLKKADTRGKGEYQIDYTPAPRITEADKTNDRKSLQRALDKRLYLLL  489
            RWRQQYRR+YP+  L KAD RGKG+YQ DY PAPRITEADKTND++SLQRALD+RLYLLL
Sbjct  61   RWRQQYRRKYPDEVLGKADARGKGDYQTDYVPAPRITEADKTNDKRSLQRALDRRLYLLL  120

Query  490  HGTSLSS--GKPVWHFPEKAYESEETLRRCAESALKSV  597
            +G++  +   +PVWHFPEK YE+EETLR CAESALKSV
Sbjct  121  YGSTYGTPDKEPVWHFPEKVYENEETLRLCAESALKSV  158



>ref|XP_008371440.1| PREDICTED: 54S ribosomal protein L17, mitochondrial [Malus domestica]
Length=227

 Score =   198 bits (503),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 114/154 (74%), Positives = 130/154 (84%), Gaps = 6/154 (4%)
 Frame = +1

Query  154  MRRCLGL---ALLAKRGFSTSSSG--DKIVASVLFERLPVVVPKIDPVVYAFQEFSFRWR  318
            M+R + L    L   RGFSTS S   +KIVASVLFERLPVV+PKIDPVVYA+QEF+FRWR
Sbjct  1    MQRTIPLLRGTLARGRGFSTSPSSSSEKIVASVLFERLPVVIPKIDPVVYAYQEFAFRWR  60

Query  319  QQYRREYPENFLKKADTRGKGEYQIDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHG-  495
            QQYRR YP+  L K++ RGKG+YQIDY PAPRITEADKTND+KSLQRALD+RLYLLL+G 
Sbjct  61   QQYRRIYPDELLDKSNARGKGDYQIDYVPAPRITEADKTNDKKSLQRALDRRLYLLLYGN  120

Query  496  TSLSSGKPVWHFPEKAYESEETLRRCAESALKSV  597
            T  S+GK VWHFPEK Y+SEETLR+CAESALKSV
Sbjct  121  TDGSAGKSVWHFPEKVYQSEETLRKCAESALKSV  154



>ref|XP_009378423.1| PREDICTED: 39S ribosomal protein L46, mitochondrial-like [Pyrus 
x bretschneideri]
Length=227

 Score =   197 bits (501),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 103/128 (80%), Positives = 117/128 (91%), Gaps = 1/128 (1%)
 Frame = +1

Query  217  DKIVASVLFERLPVVVPKIDPVVYAFQEFSFRWRQQYRREYPENFLKKADTRGKGEYQID  396
            DKIVASVLFERLPVV+PKIDPVVYA+QEF+FRWRQQYRR YP+  L K++ RGKG+YQID
Sbjct  27   DKIVASVLFERLPVVIPKIDPVVYAYQEFAFRWRQQYRRIYPDELLDKSNARGKGDYQID  86

Query  397  YTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTS-LSSGKPVWHFPEKAYESEETLRRC  573
            Y PAPRITEADK ND+KSLQRALD+RLYLLL+GT+  S+GK VWHFPEK Y+SEETLR+C
Sbjct  87   YEPAPRITEADKKNDKKSLQRALDRRLYLLLYGTTDGSAGKSVWHFPEKVYQSEETLRKC  146

Query  574  AESALKSV  597
            AESALKSV
Sbjct  147  AESALKSV  154



>ref|XP_007218304.1| hypothetical protein PRUPE_ppa010842mg [Prunus persica]
 gb|EMJ19503.1| hypothetical protein PRUPE_ppa010842mg [Prunus persica]
Length=233

 Score =   196 bits (498),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 112/153 (73%), Positives = 129/153 (84%), Gaps = 5/153 (3%)
 Frame = +1

Query  154  MRRCLGL---ALLAKRGFSTSSSG-DKIVASVLFERLPVVVPKIDPVVYAFQEFSFRWRQ  321
            M+R + +    L+  RGFSTSSS   KIVASVLFERLPVV+PKIDPVVYA+QEF+FRWRQ
Sbjct  1    MQRTITILRGPLVRDRGFSTSSSSSQKIVASVLFERLPVVIPKIDPVVYAYQEFAFRWRQ  60

Query  322  QYRREYPENFLKKADTRGKGEYQIDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHG-T  498
            QYRR YP+  L K++ RGKG+Y IDY PAPRITEADK NDRKSLQRALD+RLYLLL+G T
Sbjct  61   QYRRIYPDELLDKSNARGKGDYHIDYVPAPRITEADKMNDRKSLQRALDRRLYLLLYGNT  120

Query  499  SLSSGKPVWHFPEKAYESEETLRRCAESALKSV  597
              S+GK VWHFPEK Y+SEETLR+CAESALKS+
Sbjct  121  DGSAGKSVWHFPEKVYQSEETLRKCAESALKSI  153



>ref|XP_008233590.1| PREDICTED: 39S ribosomal protein L46, mitochondrial [Prunus mume]
Length=233

 Score =   195 bits (496),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 111/153 (73%), Positives = 130/153 (85%), Gaps = 5/153 (3%)
 Frame = +1

Query  154  MRRCLGL---ALLAKRGFSTSSSG-DKIVASVLFERLPVVVPKIDPVVYAFQEFSFRWRQ  321
            M+R + +    L+  RGFSTSSS  +KIVASVLFERLPV++PKIDPVVYA+QEF+FRWRQ
Sbjct  1    MQRTITILRGPLVRDRGFSTSSSSSEKIVASVLFERLPVIIPKIDPVVYAYQEFAFRWRQ  60

Query  322  QYRREYPENFLKKADTRGKGEYQIDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHG-T  498
            QYRR YP+  L K++ RGKG+Y IDY PAPRITEADK NDRKSLQRALD+RLYLLL+G T
Sbjct  61   QYRRIYPDELLDKSNARGKGDYHIDYVPAPRITEADKMNDRKSLQRALDRRLYLLLYGNT  120

Query  499  SLSSGKPVWHFPEKAYESEETLRRCAESALKSV  597
              S+GK VWHFPEK Y+SEETLR+CAESALKS+
Sbjct  121  DRSAGKSVWHFPEKFYQSEETLRKCAESALKSI  153



>ref|XP_009357695.1| PREDICTED: 39S ribosomal protein L46, mitochondrial-like [Pyrus 
x bretschneideri]
Length=227

 Score =   195 bits (495),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 113/154 (73%), Positives = 129/154 (84%), Gaps = 6/154 (4%)
 Frame = +1

Query  154  MRRCLGL---ALLAKRGFSTSSSG--DKIVASVLFERLPVVVPKIDPVVYAFQEFSFRWR  318
            M+R + L    L   RGFSTS S   +KIVASVLFERLPVV+PKIDPVVYA+QEF+FRWR
Sbjct  1    MQRTIPLLRGTLARGRGFSTSPSSSSEKIVASVLFERLPVVIPKIDPVVYAYQEFAFRWR  60

Query  319  QQYRREYPENFLKKADTRGKGEYQIDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHG-  495
            QQYRR YP+  L K++ RGKG+YQIDY PAPRITEADKTND+KSLQRALD+RLYLLL+G 
Sbjct  61   QQYRRIYPDELLDKSNARGKGDYQIDYVPAPRITEADKTNDKKSLQRALDRRLYLLLYGK  120

Query  496  TSLSSGKPVWHFPEKAYESEETLRRCAESALKSV  597
            T  S+GK VW FPEK Y+SEETLR+CAESALKSV
Sbjct  121  TDGSAGKSVWQFPEKVYQSEETLRKCAESALKSV  154



>ref|XP_009347441.1| PREDICTED: 54S ribosomal protein L17, mitochondrial-like [Pyrus 
x bretschneideri]
Length=227

 Score =   195 bits (495),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 113/154 (73%), Positives = 129/154 (84%), Gaps = 6/154 (4%)
 Frame = +1

Query  154  MRRCLGL---ALLAKRGFSTSSSG--DKIVASVLFERLPVVVPKIDPVVYAFQEFSFRWR  318
            M+R + L    L   RGFSTS S   +KIVASVLFERLPVV+PKIDPVVYA+QEF+FRWR
Sbjct  1    MQRTIPLLRGTLARGRGFSTSPSSSSEKIVASVLFERLPVVIPKIDPVVYAYQEFAFRWR  60

Query  319  QQYRREYPENFLKKADTRGKGEYQIDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHG-  495
            QQYRR YP+  L K++ RGKG+YQIDY PAPRITEADKTND+KSLQRALD+RLYLLL+G 
Sbjct  61   QQYRRIYPDELLDKSNARGKGDYQIDYVPAPRITEADKTNDKKSLQRALDRRLYLLLYGK  120

Query  496  TSLSSGKPVWHFPEKAYESEETLRRCAESALKSV  597
            T  S+GK VW FPEK Y+SEETLR+CAESALKSV
Sbjct  121  TDGSAGKSVWQFPEKVYQSEETLRKCAESALKSV  154



>ref|XP_010928038.1| PREDICTED: 39S ribosomal protein L46, mitochondrial isoform X2 
[Elaeis guineensis]
Length=232

 Score =   194 bits (493),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 104/129 (81%), Positives = 115/129 (89%), Gaps = 2/129 (2%)
 Frame = +1

Query  217  DKIVASVLFERLPVVVPKIDPVVYAFQEFSFRWRQQYRREYPENFLKKADTRGKGEYQID  396
            DKIVA+VLFERLPVV+PKIDPVVYAFQEFSFRWRQQYRR YP+  L K D RGKGEYQID
Sbjct  24   DKIVAAVLFERLPVVIPKIDPVVYAFQEFSFRWRQQYRRRYPDEVLGKGDARGKGEYQID  83

Query  397  YTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLSS--GKPVWHFPEKAYESEETLRR  570
            Y PAPRITEADKTNDR+SLQRALD+RLYLLL+G++  +   KPVWHFPEK YE+EETLR 
Sbjct  84   YVPAPRITEADKTNDRRSLQRALDRRLYLLLNGSTYGAPDKKPVWHFPEKIYENEETLRL  143

Query  571  CAESALKSV  597
            CAESAL+SV
Sbjct  144  CAESALRSV  152



>ref|XP_006444944.1| hypothetical protein CICLE_v10021940mg [Citrus clementina]
 gb|ESR58184.1| hypothetical protein CICLE_v10021940mg [Citrus clementina]
Length=177

 Score =   191 bits (486),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 107/155 (69%), Positives = 126/155 (81%), Gaps = 7/155 (5%)
 Frame = +1

Query  148  AKMRRCLGL---ALLAKRGFSTSSSGDKIVASVLFERLPVVVPKIDPVVYAFQEFSFRWR  318
            +KMRR L      L A RGFST+S  +KIVASVLFERLPVV+PKIDPVVYAFQEFSFRWR
Sbjct  9    SKMRRSLTSLVRPLTATRGFSTNS--EKIVASVLFERLPVVIPKIDPVVYAFQEFSFRWR  66

Query  319  QQYRREYPENFLKKADTRGKGEYQIDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHGT  498
            QQYRR YP+ FL K+++RGKG+YQ++Y PAPRITE DKTNDRKSLQRALD+RLYL+L+G 
Sbjct  67   QQYRRRYPDEFLDKSNSRGKGDYQMEYVPAPRITETDKTNDRKSLQRALDRRLYLILYGE  126

Query  499  SLSS--GKPVWHFPEKAYESEETLRRCAESALKSV  597
            +  +  GKP+WHFPEK YESEE+LR+     L  V
Sbjct  127  TFGAPGGKPIWHFPEKVYESEESLRKSVHYNLYWV  161



>emb|CDY27332.1| BnaC04g50730D [Brassica napus]
Length=648

 Score =   202 bits (515),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 97/138 (70%), Positives = 112/138 (81%), Gaps = 2/138 (1%)
 Frame = +1

Query  190  RGFSTSSSGDKIVASVLFERLPVVVPKIDPVVYAFQEFSFRWRQQYRREYPENFLKKADT  369
            RG+ TSSS +K+VASVLFERL VV+PK DP VYAFQEF F W+QQ+RR YP+ FL  A  
Sbjct  431  RGYCTSSSSEKMVASVLFERLRVVIPKPDPTVYAFQEFKFNWQQQFRRRYPDEFLDIAKN  490

Query  370  RGKGEYQIDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSL--SSGKPVWHFPEKA  543
            R KGEYQ+DY PAPR+TEADK ND+KSL RALDK+LYLL+ G     +S KPVWHFPEK 
Sbjct  491  RAKGEYQMDYVPAPRVTEADKNNDKKSLYRALDKKLYLLIFGKPFGATSDKPVWHFPEKV  550

Query  544  YESEETLRRCAESALKSV  597
            Y+SE TLR+CAESALKSV
Sbjct  551  YDSEPTLRKCAESALKSV  568



>ref|XP_006444942.1| hypothetical protein CICLE_v10021940mg [Citrus clementina]
 gb|ESR58182.1| hypothetical protein CICLE_v10021940mg [Citrus clementina]
Length=167

 Score =   188 bits (477),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 106/153 (69%), Positives = 124/153 (81%), Gaps = 7/153 (5%)
 Frame = +1

Query  154  MRRCLGL---ALLAKRGFSTSSSGDKIVASVLFERLPVVVPKIDPVVYAFQEFSFRWRQQ  324
            MRR L      L A RGFST+S  +KIVASVLFERLPVV+PKIDPVVYAFQEFSFRWRQQ
Sbjct  1    MRRSLTSLVRPLTATRGFSTNS--EKIVASVLFERLPVVIPKIDPVVYAFQEFSFRWRQQ  58

Query  325  YRREYPENFLKKADTRGKGEYQIDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSL  504
            YRR YP+ FL K+++RGKG+YQ++Y PAPRITE DKTNDRKSLQRALD+RLYL+L+G + 
Sbjct  59   YRRRYPDEFLDKSNSRGKGDYQMEYVPAPRITETDKTNDRKSLQRALDRRLYLILYGETF  118

Query  505  SS--GKPVWHFPEKAYESEETLRRCAESALKSV  597
             +  GKP+WHFPEK YESEE+LR+     L  V
Sbjct  119  GAPGGKPIWHFPEKVYESEESLRKSVHYNLYWV  151



>ref|XP_010928037.1| PREDICTED: 39S ribosomal protein L46, mitochondrial isoform X1 
[Elaeis guineensis]
Length=246

 Score =   186 bits (472),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 104/143 (73%), Positives = 116/143 (81%), Gaps = 16/143 (11%)
 Frame = +1

Query  217  DKIVASVLFERLPVVVPKIDPVVYAFQEFSFRWRQQYRREYPENFLKKADTRGKGEYQID  396
            DKIVA+VLFERLPVV+PKIDPVVYAFQEFSFRWRQQYRR YP+  L K D RGKGEYQID
Sbjct  24   DKIVAAVLFERLPVVIPKIDPVVYAFQEFSFRWRQQYRRRYPDEVLGKGDARGKGEYQID  83

Query  397  YTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLSS--GKPVWHFPEKAYESEETLR-  567
            Y PAPRITEADKTNDR+SLQRALD+RLYLLL+G++  +   KPVWHFPEK YE+EETLR 
Sbjct  84   YVPAPRITEADKTNDRRSLQRALDRRLYLLLNGSTYGAPDKKPVWHFPEKIYENEETLRL  143

Query  568  -------------RCAESALKSV  597
                         +CAESAL+SV
Sbjct  144  KSVLVMSMRNPSFQCAESALRSV  166



>gb|AAF63174.1|AC010657_10 T5E21.12 [Arabidopsis thaliana]
Length=254

 Score =   184 bits (468),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 102/167 (61%), Positives = 115/167 (69%), Gaps = 27/167 (16%)
 Frame = +1

Query  160  RCLGLALL-AKRGFSTSSSGDKIVASVLFERLPVVVPKIDPVVYAFQEFSFRWRQQYRRE  336
            R L   LL ++RGF TSS  DKIVASVLFERL VV+PK DP VYAFQEF F W+QQ+RR 
Sbjct  7    RLLAKPLLESRRGFCTSS--DKIVASVLFERLRVVIPKPDPAVYAFQEFKFNWQQQFRRR  64

Query  337  YPENFLKKA------------------DTRGKGEYQIDYTPAPRITEADKTNDRKSLQRA  462
            YP+ FL  A                  + R KGEYQ+DY PAPRITEADK NDRK    A
Sbjct  65   YPDEFLDIAKNSFYENFISSLVNLMIREYRAKGEYQMDYVPAPRITEADKNNDRK----A  120

Query  463  LDKRLYLLLHGTSL--SSGKPVWHFPEKAYESEETLRRCAESALKSV  597
            LDK+LYLL+ G     +S KPVWHFPEK Y+SE TLR+CAESALKSV
Sbjct  121  LDKKLYLLIFGKPFGATSDKPVWHFPEKVYDSEPTLRKCAESALKSV  167



>ref|XP_006359292.1| PREDICTED: 39S ribosomal protein L46, mitochondrial-like isoform 
X2 [Solanum tuberosum]
Length=190

 Score =   176 bits (446),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 78/100 (78%), Positives = 92/100 (92%), Gaps = 0/100 (0%)
 Frame = +1

Query  295  QEFSFRWRQQYRREYPENFLKKADTRGKGEYQIDYTPAPRITEADKTNDRKSLQRALDKR  474
            +++ FRWRQQYRREYPE+FLKK+DTRGKG+YQIDY PAPRI+EADKTND++SL RALD+R
Sbjct  11   KDYRFRWRQQYRREYPESFLKKSDTRGKGDYQIDYKPAPRISEADKTNDQRSLHRALDRR  70

Query  475  LYLLLHGTSLSSGKPVWHFPEKAYESEETLRRCAESALKS  594
            LYLL+HG +  SGKPVWHFPEK YESEE LR+CAESAL+S
Sbjct  71   LYLLVHGATQGSGKPVWHFPEKVYESEENLRKCAESALES  110



>gb|KJB61927.1| hypothetical protein B456_009G392100 [Gossypium raimondii]
Length=205

 Score =   169 bits (428),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 92/150 (61%), Positives = 105/150 (70%), Gaps = 25/150 (17%)
 Frame = +1

Query  154  MRRCLGLALLAKRGFSTSSSGDKIVASVLFERLPVVVPKIDPVVYAFQEFSFRWRQQYRR  333
            M R L    +  RGFS++S   KIVASVLFERLPVV+PK+DPVVYAF+ F          
Sbjct  1    MHRSLVRPFMGVRGFSSTSK--KIVASVLFERLPVVIPKLDPVVYAFKSFR---------  49

Query  334  EYPENFLKKADTRGKGEYQIDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLS--  507
                        +GKG+YQID  PAPRITEADKT DRKSLQRALD+RLYLL +G S +  
Sbjct  50   ------------KGKGDYQIDNVPAPRITEADKTIDRKSLQRALDRRLYLLPYGNSNAAP  97

Query  508  SGKPVWHFPEKAYESEETLRRCAESALKSV  597
            SGKPVWHFPEK Y+SEETLR+CAESAL  V
Sbjct  98   SGKPVWHFPEKVYDSEETLRKCAESALAFV  127



>gb|EAZ36734.1| hypothetical protein OsJ_21070 [Oryza sativa Japonica Group]
Length=245

 Score =   155 bits (391),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 92/154 (60%), Positives = 111/154 (72%), Gaps = 17/154 (11%)
 Frame = +1

Query  175  ALLAKRGF--------STSSSGD--KIVASVLFERLPVVVPKIDPVVYAFQEFSFRWRQQ  324
            +LL  RGF        +T++ GD  KIVASVLFERLPVV+PKI PVVYAFQEFS+   Q 
Sbjct  15   SLLRARGFISSASPSAATAAEGDDGKIVASVLFERLPVVIPKIHPVVYAFQEFSYS--QI  72

Query  325  YRREYPENFLK-KADTRGKGEYQIDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTS  501
            Y    P + L+ +   R +   ++DY PAP IT+ADKTNDRKSLQRALD RLYLLL+G +
Sbjct  73   Y--PCPLSVLRVEWLPRARENIRLDYVPAPGITDADKTNDRKSLQRALDNRLYLLLYGKA  130

Query  502  LSS--GKPVWHFPEKAYESEETLRRCAESALKSV  597
              +   KPVWHFPEK Y++E+TLR CAESALKSV
Sbjct  131  YGAPDDKPVWHFPEKVYDNEDTLRLCAESALKSV  164



>ref|XP_001752736.1| predicted protein [Physcomitrella patens]
 gb|EDQ82607.1| predicted protein [Physcomitrella patens]
Length=260

 Score =   154 bits (389),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 77/142 (54%), Positives = 100/142 (70%), Gaps = 6/142 (4%)
 Frame = +1

Query  184  AKRGFSTSSSG----DKIVASVLFERLPVVVPKIDPVVYAFQEFSFRWRQQYRREYPENF  351
            A R FSTSS+     +KI+A+++ ERLPVV+PK  P V  F+ FSF WRQQ+RREYP+ F
Sbjct  40   AGRPFSTSSTAGATNEKIIAAMVVERLPVVLPKSAPPVDTFESFSFDWRQQFRREYPQEF  99

Query  352  LKKADTRGKGEYQIDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLSSGKP--VW  525
            L  + +R   E + D+ PAP +TEAD+TNDR+SL RAL +RLYLL+ G      K   VW
Sbjct  100  LDASSSREADEGEADFEPAPTVTEADRTNDRRSLNRALSRRLYLLIRGIPYGGVKDSFVW  159

Query  526  HFPEKAYESEETLRRCAESALK  591
            HFPEK Y +E++LR CAE A+K
Sbjct  160  HFPEKVYANEDSLRMCAEEAVK  181



>emb|CDY23448.1| BnaC04g49760D [Brassica napus]
Length=593

 Score =   160 bits (404),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 78/120 (65%), Positives = 91/120 (76%), Gaps = 5/120 (4%)
 Frame = +1

Query  250  LPVVVPKIDPVVYAFQEF---SFRWRQQYRREYPENFLKKADTRGKGEYQIDYTPAPRIT  420
            L VV+PK DP VYAFQE     F W+QQ+RR YP+ FL  A  + KGEYQ+DY P PR+T
Sbjct  413  LRVVIPKQDPTVYAFQELLCCRFNWQQQFRRRYPDEFLDIAKNKAKGEYQMDYVPTPRVT  472

Query  421  EADKTNDRKSLQRALDKRLYLLLHGTSL--SSGKPVWHFPEKAYESEETLRRCAESALKS  594
            EA K+NDRKSL RALDK+LYLL+ G     +S KPVWHFPEK Y+SE TLR+CAESALKS
Sbjct  473  EAAKSNDRKSLYRALDKKLYLLVFGKPFEATSDKPVWHFPEKVYDSEPTLRKCAESALKS  532



>ref|XP_004158950.1| PREDICTED: 39S ribosomal protein L46, mitochondrial-like [Cucumis 
sativus]
Length=234

 Score =   149 bits (376),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 68/90 (76%), Positives = 80/90 (89%), Gaps = 2/90 (2%)
 Frame = +1

Query  178  LLAKRGFSTSSSGDKIVASVLFERLPVVVPKIDPVVYAFQEFSFRWRQQYRREYPENFLK  357
            L+ +RGFST+S  +KIVA+VLFERLPVV+PKIDPV+YAF +F FRW+QQYRR+YP+ FL 
Sbjct  60   LVKRRGFSTNS--EKIVAAVLFERLPVVIPKIDPVIYAFTDFQFRWQQQYRRKYPDEFLN  117

Query  358  KADTRGKGEYQIDYTPAPRITEADKTNDRK  447
            KAD RGKG+YQIDY PAPRITEADKTNDR 
Sbjct  118  KADGRGKGDYQIDYVPAPRITEADKTNDRN  147



>gb|KEH24642.1| decoy [Medicago truncatula]
Length=138

 Score =   141 bits (355),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 73/99 (74%), Positives = 88/99 (89%), Gaps = 2/99 (2%)
 Frame = +1

Query  307  FRWRQQYRREYPENFLKKADTRGKGEYQIDYTPAPRITEADKTNDRKSLQRALDKRLYLL  486
            F+WRQQY+R YP+ FL ++D RGKG+YQIDY PAPR+TEADK+ND++SLQRALD+RLYLL
Sbjct  4    FQWRQQYQRRYPDEFLDRSDARGKGDYQIDYVPAPRVTEADKSNDQRSLQRALDRRLYLL  63

Query  487  LHGTSLS--SGKPVWHFPEKAYESEETLRRCAESALKSV  597
            L+G +    SGKPVWHFPEK YESEET+R+CAESALKSV
Sbjct  64   LYGDTYGAPSGKPVWHFPEKPYESEETMRKCAESALKSV  102



>ref|XP_009793597.1| PREDICTED: 39S ribosomal protein L46, mitochondrial-like [Nicotiana 
sylvestris]
Length=171

 Score =   134 bits (337),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 64/79 (81%), Positives = 71/79 (90%), Gaps = 2/79 (3%)
 Frame = +1

Query  367  TRGKGEYQIDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLS--SGKPVWHFPEK  540
             RGKG+YQIDY PAPRITEA+KTNDR+SLQRALDKRLYLL+HGT+    S KPVWHFPEK
Sbjct  14   CRGKGDYQIDYKPAPRITEANKTNDRRSLQRALDKRLYLLVHGTTHGSPSEKPVWHFPEK  73

Query  541  AYESEETLRRCAESALKSV  597
             Y+SEETLR+CAESALKSV
Sbjct  74   VYDSEETLRKCAESALKSV  92



>gb|EMS58710.1| hypothetical protein TRIUR3_26422 [Triticum urartu]
Length=991

 Score =   142 bits (358),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 63/79 (80%), Positives = 71/79 (90%), Gaps = 0/79 (0%)
 Frame = +1

Query  220  KIVASVLFERLPVVVPKIDPVVYAFQEFSFRWRQQYRREYPENFLKKADTRGKGEYQIDY  399
            KIVA+V+FERLPVV+PKI PVVYAFQEFSFRWRQQYRR+YP++ L KAD RGKG+YQIDY
Sbjct  37   KIVAAVVFERLPVVIPKIHPVVYAFQEFSFRWRQQYRRQYPDDVLGKADARGKGDYQIDY  96

Query  400  TPAPRITEADKTNDRKSLQ  456
             PAPRITEADK NDRK + 
Sbjct  97   VPAPRITEADKANDRKHIN  115


 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 45/54 (83%), Gaps = 2/54 (4%)
 Frame = +1

Query  442  RKSLQRALDKRLYLLLHGTSLSS--GKPVWHFPEKAYESEETLRRCAESALKSV  597
            R SLQRALD +LYLLL+G +  +  GKPVWHFPEK YE+E++LR CAESALKSV
Sbjct  213  RWSLQRALDNKLYLLLYGKTFGAPDGKPVWHFPEKVYENEDSLRLCAESALKSV  266



>ref|XP_008809307.1| PREDICTED: 39S ribosomal protein L46, mitochondrial, partial 
[Phoenix dactylifera]
Length=159

 Score =   129 bits (325),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 61/79 (77%), Positives = 71/79 (90%), Gaps = 2/79 (3%)
 Frame = +1

Query  367  TRGKGEYQIDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLSS--GKPVWHFPEK  540
            +RGKG+YQIDY PAPRITEADKTNDR+SLQRALD+RLYLLL+G++  +   KPVWHFPEK
Sbjct  1    SRGKGDYQIDYVPAPRITEADKTNDRRSLQRALDRRLYLLLNGSTYGAPDKKPVWHFPEK  60

Query  541  AYESEETLRRCAESALKSV  597
             YE+EETLR CAESAL+SV
Sbjct  61   VYENEETLRLCAESALRSV  79



>gb|KJB24644.1| hypothetical protein B456_004G155200 [Gossypium raimondii]
Length=185

 Score =   110 bits (274),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 63/78 (81%), Positives = 70/78 (90%), Gaps = 2/78 (3%)
 Frame = +1

Query  370  RGKGEYQIDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLS--SGKPVWHFPEKA  543
            +GKG+YQIDY PAPRITEADKTNDRKSLQRALD+RLYLLL+G S +  S KPVWHFPEK 
Sbjct  30   KGKGDYQIDYVPAPRITEADKTNDRKSLQRALDRRLYLLLYGDSNAAPSRKPVWHFPEKV  89

Query  544  YESEETLRRCAESALKSV  597
            Y+SEETLR+CAESAL SV
Sbjct  90   YDSEETLRKCAESALASV  107



>gb|KHG07503.1| 39S ribosomal L46, mitochondrial [Gossypium arboreum]
Length=135

 Score = 89.0 bits (219),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 43/57 (75%), Positives = 48/57 (84%), Gaps = 2/57 (4%)
 Frame = +1

Query  433  TNDRKSLQRALDKRLYLLLHGTSLSS--GKPVWHFPEKAYESEETLRRCAESALKSV  597
             NDRKSLQRALD RLYLLL+G S ++  GKPVWHFPEK Y+SEETLR+CAESAL  V
Sbjct  1    MNDRKSLQRALDTRLYLLLYGISNAAPCGKPVWHFPEKVYDSEETLRKCAESALAFV  57



>ref|XP_002985848.1| hypothetical protein SELMODRAFT_424892 [Selaginella moellendorffii]
 gb|EFJ13025.1| hypothetical protein SELMODRAFT_424892 [Selaginella moellendorffii]
Length=214

 Score = 88.6 bits (218),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 52/140 (37%), Positives = 78/140 (56%), Gaps = 14/140 (10%)
 Frame = +1

Query  190  RGFSTSSSGDKIVASVLFERLPVVVPKIDPVVYAFQEFSFRWRQQYRREYPENFLKKADT  369
            R +S+ ++   IVA+ + ERLP+      P V +F+E S +W+Q          + + D 
Sbjct  12   RLYSSVAASKPIVAAAVLERLPLYPRPPHPTVASFRELSKKWKQ---------IIGEVDI  62

Query  370  RGKGEYQIDYTPAPRITEADK-----TNDRKSLQRALDKRLYLLLHGTSLSSGKPVWHFP  534
              +    +    AP  ++ +K     + DRKSLQR LD+RLYL++ G S   G+  WHFP
Sbjct  63   LEQTLDDMKGRAAPAASDQEKVAPVQSTDRKSLQRLLDQRLYLIVRGNSPYKGQKEWHFP  122

Query  535  EKAYESEETLRRCAESALKS  594
            EK Y  E  LR+CAESAL++
Sbjct  123  EKKYVDEMNLRKCAESALET  142



>ref|XP_002984785.1| hypothetical protein SELMODRAFT_446047 [Selaginella moellendorffii]
 gb|EFJ14035.1| hypothetical protein SELMODRAFT_446047 [Selaginella moellendorffii]
Length=214

 Score = 87.4 bits (215),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 52/140 (37%), Positives = 77/140 (55%), Gaps = 14/140 (10%)
 Frame = +1

Query  190  RGFSTSSSGDKIVASVLFERLPVVVPKIDPVVYAFQEFSFRWRQQYRREYPENFLKKADT  369
            R +S+ ++   IVA+ + ERLP+      P V +F+E S +W+Q          + + D 
Sbjct  12   RLYSSVAASKPIVAAAVLERLPLYPRPPHPTVASFRELSKKWKQ---------IIGEVDI  62

Query  370  RGKGEYQIDYTPAPRITEADK-----TNDRKSLQRALDKRLYLLLHGTSLSSGKPVWHFP  534
              +    +    AP  ++  K     + DRKSLQR LD+RLYL++ G S   G+  WHFP
Sbjct  63   LEQTLDDMKGRAAPAASDQAKVAPVQSTDRKSLQRLLDQRLYLIVRGNSPYKGQKEWHFP  122

Query  535  EKAYESEETLRRCAESALKS  594
            EK Y  E  LR+CAESAL++
Sbjct  123  EKKYVDEMNLRKCAESALET  142



>ref|XP_005846128.1| hypothetical protein CHLNCDRAFT_53397 [Chlorella variabilis]
 gb|EFN54026.1| hypothetical protein CHLNCDRAFT_53397 [Chlorella variabilis]
Length=255

 Score = 83.6 bits (205),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 78/135 (58%), Gaps = 10/135 (7%)
 Frame = +1

Query  199  STSSSGDKIVASVLFERLPVVVPKIDPVVYAFQEFSFRWRQQYRREY----PENFLKKAD  366
            + ++SG K+    + ERLPV++P  DP  +  ++    W+Q    +Y    P++F++  D
Sbjct  48   AAAASGGKLFGVCVLERLPVIIP--DPPEW--EQEHREWQQAITEKYFKVLPKDFVELKD  103

Query  367  T-RGKGEYQIDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLSSGKPVWHFPEKA  543
            + R   +    Y PAPRIT ADK NDR+SLQR LD+RL++L+      SG   W   ++ 
Sbjct  104  SERQADDAGARYEPAPRITAADKANDRRSLQRRLDQRLFMLVRPKG-GSGGGAWSLMQRE  162

Query  544  YESEETLRRCAESAL  588
             +  ET+R+ AE AL
Sbjct  163  NQEGETMRQTAERAL  177



>ref|XP_011016234.1| PREDICTED: 39S ribosomal protein L46, mitochondrial-like [Populus 
euphratica]
Length=142

 Score = 81.6 bits (200),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 46/54 (85%), Gaps = 2/54 (4%)
 Frame = +1

Query  442  RKSLQRALDKRLYLLLHGTSLSS--GKPVWHFPEKAYESEETLRRCAESALKSV  597
             +SLQRALD++LYLLL+G +  S   KPVWHFPEK YESEETLR+CAESAL+SV
Sbjct  10   HRSLQRALDRKLYLLLYGKAYGSPSDKPVWHFPEKVYESEETLRKCAESALQSV  63



>ref|XP_005650541.1| hypothetical protein COCSUDRAFT_60992 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE25997.1| hypothetical protein COCSUDRAFT_60992 [Coccomyxa subellipsoidea 
C-169]
Length=205

 Score = 82.4 bits (202),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 50/120 (42%), Positives = 70/120 (58%), Gaps = 8/120 (7%)
 Frame = +1

Query  256  VVVPKIDPVV-YAFQEFSFRWRQQYRREYPENFLK-----KADTRGKGEYQIDYTPAPRI  417
            VVVP+ DP+    + E   R   +YRRE P  F K       DT         ++ A RI
Sbjct  10   VVVPE-DPLYEIEYHELKERLFSKYRRELPSEFTKVTGGESGDTPEGDAGDTSFSFASRI  68

Query  418  TEADKTNDRKSLQRALDKRLYLLLHGTSLSSGKPVWHFPEKAYESEETLRRCAESALKSV  597
            TEAD+ ND KSL+RAL KRL+ L+  +    GK VWHFP++ +E+ +T+++ AE AL+ V
Sbjct  69   TEADEQNDIKSLRRALHKRLFFLVR-SKGEGGKEVWHFPQRGHEAGQTIKQAAEGALEGV  127



>ref|XP_011398740.1| 39S ribosomal protein L46, mitochondrial [Auxenochlorella protothecoides]
 gb|KFM25844.1| 39S ribosomal protein L46, mitochondrial [Auxenochlorella protothecoides]
Length=209

 Score = 73.2 bits (178),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 42/133 (32%), Positives = 70/133 (53%), Gaps = 6/133 (5%)
 Frame = +1

Query  199  STSSSGDKIVASVLFERLPVVVPKIDPVVYAFQEFSFRWRQQYRREYPENFL---KKADT  369
            S +++  ++  + +FERLP+VVP           + F W   Y ++YP +F+   +  +T
Sbjct  3    SQAAAPGRVFGACVFERLPLVVPPHPDWEVEHSRWRFEWNLPYFKKYPADFIDEPRTEET  62

Query  370  RGKGEYQIDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLSSGKPVWHFPEKAYE  549
                     + PAP  +EAD++ D +SL+R LD+R+++L+       G   W FP   +E
Sbjct  63   DSAVAASNRWEPAPLESEADRSGDVRSLKRRLDQRVFMLVR---RKGGSGAWEFPAVEHE  119

Query  550  SEETLRRCAESAL  588
              ET+R  AE AL
Sbjct  120  EGETIRGSAERAL  132



>ref|XP_006359294.1| PREDICTED: uncharacterized protein LOC102591608 [Solanum tuberosum]
Length=55

 Score = 69.3 bits (168),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 38/55 (69%), Positives = 43/55 (78%), Gaps = 4/55 (7%)
 Frame = +1

Query  151  KMRRCL---GLALLAKRGFSTSSSGDKIVASVLFERLPVVVPKIDPVVYAFQEFS  306
            KM+RC    G + + KR FS SS+ DKIVASVLFERLPVVVP I+P VYAFQEFS
Sbjct  2    KMQRCCSSAGRSAIGKRWFS-SSNNDKIVASVLFERLPVVVPTINPTVYAFQEFS  55



>ref|XP_002508846.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO70104.1| predicted protein [Micromonas sp. RCC299]
Length=197

 Score = 71.2 bits (173),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 40/124 (32%), Positives = 70/124 (56%), Gaps = 10/124 (8%)
 Frame = +1

Query  235  VLFERLPVVVPKIDPVVYAFQEFSFRWRQQYRREYPENFLK---KADTRGKGEYQIDYTP  405
            ++ ERLP+V P  +P    +Q++S   R+++ ++ PE  +    + + R +GE   D+ P
Sbjct  1    MIVERLPMVAPPPEPWEAEYQQWSDERRRKFLKKLPEGLVNPKAEFEERDQGE---DFEP  57

Query  406  APRITEADKTNDRKSLQRALDKRLYLLLHGTSLSSGKPVWHFPEKAYESEETLRRCAESA  585
            APR TEADKT D++++ R LD+ L+L++           W FP + +   ET+R  A  A
Sbjct  58   APRETEADKTGDQRTMHRRLDEFLFLVVQNAKTGQ----WGFPRREHVEGETMRDVARQA  113

Query  586  LKSV  597
            ++  
Sbjct  114  MEEA  117



>ref|XP_010246565.1| PREDICTED: 39S ribosomal protein L46, mitochondrial-like, partial 
[Nelumbo nucifera]
Length=122

 Score = 70.1 bits (170),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 37/42 (88%), Gaps = 2/42 (5%)
 Frame = +1

Query  478  YLLLHGTSLSS--GKPVWHFPEKAYESEETLRRCAESALKSV  597
            YLLL+G+S  S  GKPVWHFPEK YE+EETLR+CAESALKSV
Sbjct  1    YLLLYGSSYGSPAGKPVWHFPEKVYENEETLRKCAESALKSV  42



>ref|XP_005536202.1| mitochondrial ribosomal protein L46 [Cyanidioschyzon merolae 
strain 10D]
 dbj|BAM79916.1| mitochondrial ribosomal protein L46 [Cyanidioschyzon merolae 
strain 10D]
Length=338

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 56/174 (32%), Positives = 81/174 (47%), Gaps = 33/174 (19%)
 Frame = +1

Query  145  VAKMRRCLGLA--LLAKRGFSTSSSGDKIVAS----------------VLFERLPVVVPK  270
            +A  RRCL LA   L   GF    S  K  AS                 + ER P+++P+
Sbjct  22   LAASRRCLRLARYQLPPNGFPRRGSASKAGASKPSTEPQRLPYRYAVATILERTPIIMPE  81

Query  271  IDPVVYAFQEFSFRWRQQYRREY-PEN----FLKKADT-------RGKGEYQID---YTP  405
              P   AF +F         RE  PE     F +  DT            +++D   Y P
Sbjct  82   PTPEERAFLKFQLLMANAQARELSPEVMQRLFGESGDTIPDKHPFLNSKVFELDDSEYVP  141

Query  406  APRITEADKTNDRKSLQRALDKRLYLLLHGTSLSSGKPVWHFPEKAYESEETLR  567
            APR TEAD+TNDR+SL+R LD+ L+L++      +G+ +W FP++  E E  ++
Sbjct  142  APRETEADRTNDRRSLRRKLDQWLFLIVQRKLGPTGRSLWQFPQRFIEEERLMQ  195



>ref|XP_003083852.1| Mitochondrial ribosomal protein L17 (ISS) [Ostreococcus tauri]
 emb|CAL57819.1| Ribosomal protein L46 [Ostreococcus tauri]
Length=245

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 44/136 (32%), Positives = 75/136 (55%), Gaps = 10/136 (7%)
 Frame = +1

Query  190  RGFSTS--SSGDKIVASVLFERLPVVVPKIDPVVYAFQEFSFRWRQQYRREYPENFLKKA  363
            R F+TS  +S   +  S+L ER+PVV+P+       + E++   R +++ + P+  +   
Sbjct  46   RSFTTSFAASASALYGSMLVERIPVVIPEPPAWEREYLEWAQARRDKFKVKLPDEMV---  102

Query  364  DTRGKGEYQIDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLSSGKPVWHFPEKA  543
            + +G  +   D+  APR TEAD+T DR ++ R L + L+L+L   S       W FP+  
Sbjct  103  EAKGLIDNLPDFDAAPRETEADRTGDRSTMYRKLPEFLFLVLKDKS-----GTWGFPKAP  157

Query  544  YESEETLRRCAESALK  591
            +   ET+R+ AE +LK
Sbjct  158  HTDGETMRQTAERSLK  173



>ref|XP_635795.1| hypothetical protein DDB_G0290311 [Dictyostelium discoideum AX4]
 gb|EAL62282.1| hypothetical protein DDB_G0290311 [Dictyostelium discoideum AX4]
Length=361

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 46/141 (33%), Positives = 71/141 (50%), Gaps = 19/141 (13%)
 Frame = +1

Query  220  KIVASVLFERLPVVVPKIDPVVYAFQEFSFRWRQQYRR-------------EYPENFLKK  360
            K  + V+ ER P + P  + +   + E   R ++  RR             E+ E   +K
Sbjct  130  KYTSGVIIERFPSLNPLPNEIEKTYMETYERLQEIVRRDPIRFVSIVEDLPEFKEQQREK  189

Query  361  ADTRGKGEYQID---YTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLSSGKPVWHF  531
             +   + E++ D   YTP PR TEAD  NDRKSL R LDK LYL+++    S  +  W F
Sbjct  190  NEDNLQDEFEEDFSNYTPEPRETEADLKNDRKSLDRKLDKSLYLIINK---SGSRYDWQF  246

Query  532  PEKAYESEETLRRCAESALKS  594
            P   + + E+++ CAE +L+ 
Sbjct  247  PSTNWINGESMKNCAERSLRD  267



>ref|XP_004988034.1| hypothetical protein PTSG_13142 [Salpingoeca rosetta]
 gb|EGD80470.1| hypothetical protein PTSG_13142 [Salpingoeca rosetta]
Length=300

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 54/206 (26%), Positives = 88/206 (43%), Gaps = 52/206 (25%)
 Frame = +1

Query  91   RHYHRYGLLYSVNLGIS*VAKMRRCLGLALLAKRGFSTSSSGDKIVASVLFERLPVVVPK  270
            R  +R G++ ++N G       R    LA     G    ++   +   V+ ER P+  P 
Sbjct  31   RTTNRAGMVMTMNSG-------RHVRSLAT----GGGGPATKPAVKVGVILERYPLSEPA  79

Query  271  IDPVVYAFQEFSFRWRQQYRREYPENFLKK-ADTRG----------------KGEYQ---  390
            + P    FQEFS +  ++      E +L+   +  G                +GE Q   
Sbjct  80   LTPFEKKFQEFSRQMDEEKSAVSFEEYLQMLVEQEGGSKKKKKSKKSNQKQEQGEEQDSS  139

Query  391  -----------------IDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLSSGKP  519
                             +++ PAP  TE D+ ++ KSL R L  +LYLL+     +    
Sbjct  140  AATATEQAAVDASDTAPVEFEPAPLETEDDRAHNTKSLNRCLSSKLYLLIK----TKQSD  195

Query  520  VWHFPEKAYESEETLRRCAESALKSV  597
            VWHFP+    +EE++R CAE+A+ +V
Sbjct  196  VWHFPQLPLTNEESIRACAENAMATV  221



>ref|XP_004172215.1| PREDICTED: 39S ribosomal protein L46, mitochondrial-like, partial 
[Cucumis sativus]
Length=131

 Score = 62.0 bits (149),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 47/52 (90%), Gaps = 2/52 (4%)
 Frame = +1

Query  448  SLQRALDKRLYLLLHGTSLSSG--KPVWHFPEKAYESEETLRRCAESALKSV  597
            SL+RALD+RLYLLL+G S+ +   KP+WHFPEKAYE+EETLR+CAESALKSV
Sbjct  1    SLKRALDRRLYLLLYGPSIGAPDEKPIWHFPEKAYETEETLRKCAESALKSV  52



>ref|XP_005715454.1| unnamed protein product [Chondrus crispus]
 emb|CDF35635.1| unnamed protein product [Chondrus crispus]
Length=296

 Score = 63.2 bits (152),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 57/163 (35%), Positives = 84/163 (52%), Gaps = 22/163 (13%)
 Frame = +1

Query  151  KMRRCLGLALLAKRGFSTSSS---GDKIVASVLFERLPVVVPKIDPVVYAFQEFSFRWRQ  321
            KM++  G+  L  +G   ++S   G ++  + + ER PVV P+ DP  +  +  + R+ +
Sbjct  41   KMKK--GVERLPSQGPDPAASFGKGWRLACAAVVERYPVVTPECDP--FESEYLTGRFLE  96

Query  322  QYRREYPEN---FLKKAD-TRGKGE------YQIDYTPAPRITEADKTNDRKSLQRALDK  471
              RR  P +   FL + D   GK E      Y   Y PAPR TEAD+T D +SL+RALD+
Sbjct  97   MQRRARPISPALFLTEKDLMEGKREPDLSDPYAEMYQPAPRTTEADRTGDMRSLERALDE  156

Query  472  RLYLLLHGTSLSSGKPVWHFPEKAYESEET-LRRCAESALKSV  597
            RLY L+        K  + FP+     E+  L R AE A + V
Sbjct  157  RLYFLVK----RGEKGRFQFPQILAADEKVPLWRYAELAWRGV  195



>ref|XP_002291686.1| predicted protein [Thalassiosira pseudonana CCMP1335]
 gb|EED90537.1| predicted protein [Thalassiosira pseudonana CCMP1335]
Length=365

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 45/136 (33%), Positives = 71/136 (52%), Gaps = 15/136 (11%)
 Frame = +1

Query  220  KIVASVLFERLPVVVPKIDPVVYAFQEFSFR-WRQQYRREYPE--NFLKKA--------D  366
            ++  +V+ ERLPVV P  D  V+       + +   + +EYPE   F+ ++        +
Sbjct  136  RVRVAVMVERLPVVTP--DHPVWEMDYMELKDYLMTFGKEYPEETGFMMRSGREEDHVVE  193

Query  367  TRGKGEYQIDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTS--LSSGKPVWHFPEK  540
            TR +    + +TPAPR TEAD T + ++L R L +R++L L   S   +SG P W  P  
Sbjct  194  TREEMLAGLPFTPAPRETEADHTGNIRTLDRQLKERVFLTLKTASERTASGIPRWTLPST  253

Query  541  AYESEETLRRCAESAL  588
               +EETL   A+ A+
Sbjct  254  LVSNEETLLDAAKRAV  269



>ref|XP_001660444.1| AAEL009833-PA [Aedes aegypti]
 gb|EAT38260.1| AAEL009833-PA [Aedes aegypti]
Length=267

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 49/153 (32%), Positives = 71/153 (46%), Gaps = 36/153 (24%)
 Frame = +1

Query  223  IVASVLFERLPVVVPKIDPVVYAFQ--------EFSFRWRQQYRREYPENFLKKADTRGK  378
            I A VL ERLPV+   + P+   F+        E S +   + R+E  +   ++A+    
Sbjct  38   IYAGVLVERLPVITKTLSPIEANFKSMLDQIEFENSLKSNHEIRKEMEK---RQAELLKA  94

Query  379  GEYQID---------------------YTPAPRITEADKTNDRKSLQRALDKRLYLLLHG  495
            G+  +D                     + PAPRITEADK ND KSL R L++ L LL   
Sbjct  95   GKIDLDSEALKQTAQDLEDAYNDEFSKFKPAPRITEADKVNDLKSLNRKLEETLVLL---  151

Query  496  TSLSSG-KPVWHFPEKAYESEETLRRCAESALK  591
            T    G K  +  P+  + + E+LR+ AE  LK
Sbjct  152  TEQKLGDKKYFLLPQGKHSASESLRQTAERVLK  184



>ref|XP_009418190.1| PREDICTED: uncharacterized protein LOC103998440 [Musa acuminata 
subsp. malaccensis]
Length=103

 Score = 57.0 bits (136),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 38/56 (68%), Gaps = 0/56 (0%)
 Frame = +1

Query  157  RRCLGLALLAKRGFSTSSSGDKIVASVLFERLPVVVPKIDPVVYAFQEFSFRWRQQ  324
            RR   LA  +  G ++SS  +KI  +VLFERLPVV+PK DPVVYA QE S   R++
Sbjct  13   RRFSSLADGSFGGDASSSVSEKIAVAVLFERLPVVIPKTDPVVYAVQELSLDCRRE  68



>ref|XP_004341522.1| hydrolase, NUDIX domain containing protein [Acanthamoeba castellanii 
str. Neff]
 gb|ELR19436.1| hydrolase, NUDIX domain containing protein [Acanthamoeba castellanii 
str. Neff]
Length=323

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 37/62 (60%), Gaps = 3/62 (5%)
 Frame = +1

Query  406  APRITEADKTNDRKSLQRALDKRLYLLLHGTSLSSGKPVWHFPEKAYESEETLRRCAESA  585
            +PRIT AD  NDRKSL RAL  RLYL++           W FP+   ES ET+R+C E  
Sbjct  178  SPRITAADLANDRKSLNRALASRLYLIVQKPRTEH---AWQFPQGGRESGETMRQCCERE  234

Query  586  LK  591
            L+
Sbjct  235  LR  236



>ref|XP_002985937.1| hypothetical protein SELMODRAFT_424881 [Selaginella moellendorffii]
 gb|EFJ13114.1| hypothetical protein SELMODRAFT_424881 [Selaginella moellendorffii]
Length=181

 Score = 57.4 bits (137),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 40/64 (63%), Gaps = 1/64 (2%)
 Frame = +1

Query  406  APRITEADKTNDRKSLQRAL-DKRLYLLLHGTSLSSGKPVWHFPEKAYESEETLRRCAES  582
            AP  ++  K    +S  R L D+RLYL++ G S   G+  WHFPEK Y  E  LR+CAES
Sbjct  46   APAASDQAKVAPVQSTDRKLLDQRLYLIVRGNSPYKGQKGWHFPEKKYVDEMNLRKCAES  105

Query  583  ALKS  594
            AL++
Sbjct  106  ALET  109



>gb|EMP35226.1| 39S ribosomal protein L46, partial [Chelonia mydas]
Length=142

 Score = 56.2 bits (134),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 40/67 (60%), Gaps = 2/67 (3%)
 Frame = +1

Query  397  YTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLSSGKPVWHFPEKAYESEETLRRCA  576
            +   PRIT+ADK NDR SL R LD+ L LL+        + +W  P+  +++ ETLR  A
Sbjct  58   FKAGPRITDADKRNDRTSLNRKLDRNLMLLVKEK--VGNQELWLLPQAEWQAGETLRSTA  115

Query  577  ESALKSV  597
            E AL ++
Sbjct  116  ERALATL  122



>ref|XP_003063987.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH51609.1| predicted protein [Micromonas pusilla CCMP1545]
Length=320

 Score = 58.2 bits (139),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 37/135 (27%), Positives = 71/135 (53%), Gaps = 19/135 (14%)
 Frame = +1

Query  223  IVASVLFERLPVVVPKIDPVVYAFQEFSFRWRQQYRREYPENFLKKADTRGKGEYQID--  396
            ++A+++ ER+P ++P        + E+S    Q++R+E P        T  K EY+ +  
Sbjct  84   LIANMIVERIPFLLPLPPAWETEYNEWSHERAQRWRKELPREI-----TNPKKEYESEDE  138

Query  397  ------YTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLSSGKPVWHFPEKAYESE-  555
                  +  APR T+AD+ ND +S++R  D+ L+L++          VW FP + +  + 
Sbjct  139  LRQMEAFVAAPRETDADRANDVRSMRRKSDQFLFLVVQDADTG----VWGFPRRKHSGKE  194

Query  556  -ETLRRCAESALKSV  597
             ET+R+ A +A+++ 
Sbjct  195  GETMRQVATAAMEAC  209



>gb|EKV16030.1| 50S ribosomal subunit L30 [Penicillium digitatum Pd1]
 gb|EKV18025.1| 50S ribosomal subunit L30 [Penicillium digitatum PHI26]
Length=336

 Score = 58.2 bits (139),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 37/62 (60%), Gaps = 5/62 (8%)
 Frame = +1

Query  403  PAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLSSGKPVWHFPEKAYESEETLRRCAES  582
            P PRITEADK ND+KSL R L + LYLL+      S +  W FP    ES ETLR  AE 
Sbjct  185  PYPRITEADKKNDQKSLDRLLSRTLYLLVQ-----SKEGHWKFPSSPVESGETLRSAAER  239

Query  583  AL  588
             L
Sbjct  240  TL  241



>gb|EPT05402.1| hypothetical protein FOMPIDRAFT_1039417 [Fomitopsis pinicola 
FP-58527 SS1]
Length=282

 Score = 57.8 bits (138),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 40/162 (25%), Positives = 68/162 (42%), Gaps = 33/162 (20%)
 Frame = +1

Query  199  STSSSGDKIVASVLFERLPVVVPKIDPVVYAFQEFSFRWRQQYRREYPENFLKKADTRGK  378
            S+S+    I  +V+  R P +     P   ++  +  R ++     +P+ F  +  +  +
Sbjct  38   SSSAPKPAIQTAVILNRSPFLTRTPSPFETSYHAYQARVQRALSNPFPDEFYFRPGSILE  97

Query  379  GEYQID--------------------------------YTPAPRITEADKTNDRKSLQRA  462
            GE+  +                                  P PR+ EAD  ND KSL R 
Sbjct  98   GEFNAEEKHREKLAFGGPYVKDKPKQAAVDSEDAAGKPQGPMPRVHEADVKNDVKSLDRQ  157

Query  463  LDKRLYLLLHGTSLSSGKPVWHFPEKAYESEETLRRCAESAL  588
             ++ LYLL+HG + ++GK VW FP+   E  + L + A+  L
Sbjct  158  GERNLYLLVHGQN-AAGKDVWRFPQGGIEEGQALHQAADRDL  198



>ref|XP_001402265.2| mitochondrial 54S ribosomal protein YmL17/YmL30 [Aspergillus 
niger CBS 513.88]
 gb|EHA20285.1| hypothetical protein ASPNIDRAFT_45871 [Aspergillus niger ATCC 
1015]
Length=335

 Score = 57.8 bits (138),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 40/63 (63%), Gaps = 5/63 (8%)
 Frame = +1

Query  403  PAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLSSGKPVWHFPEKAYESEETLRRCAES  582
            P PR+TEAD+ ND++SL RAL + LYLL+      S +  W FP     +EETLR+ AE 
Sbjct  188  PFPRVTEADQKNDQRSLNRALQRTLYLLVQ-----SKEGFWTFPSSPIVAEETLRQAAER  242

Query  583  ALK  591
             L+
Sbjct  243  TLE  245



>gb|KGO63190.1| Ribosomal protein L46 [Penicillium expansum]
Length=337

 Score = 57.8 bits (138),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 37/62 (60%), Gaps = 5/62 (8%)
 Frame = +1

Query  403  PAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLSSGKPVWHFPEKAYESEETLRRCAES  582
            P PRITEADK ND+KSL R L + LYLL+      S +  W FP    ES ETLR  AE 
Sbjct  186  PYPRITEADKKNDQKSLDRLLSRTLYLLVQ-----SKEGHWKFPSSPVESGETLRLAAER  240

Query  583  AL  588
             L
Sbjct  241  TL  242



>gb|KGO45328.1| Ribosomal protein L46 [Penicillium expansum]
 gb|KGO66921.1| Ribosomal protein L46 [Penicillium expansum]
Length=337

 Score = 57.8 bits (138),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 37/62 (60%), Gaps = 5/62 (8%)
 Frame = +1

Query  403  PAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLSSGKPVWHFPEKAYESEETLRRCAES  582
            P PRITEADK ND+KSL R L + LYLL+      S +  W FP    ES ETLR  AE 
Sbjct  186  PYPRITEADKKNDQKSLDRLLSRTLYLLVQ-----SKEGHWKFPSSPVESGETLRLAAER  240

Query  583  AL  588
             L
Sbjct  241  TL  242



>gb|EOB03109.1| 39S ribosomal protein L46, mitochondrial, partial [Anas platyrhynchos]
Length=228

 Score = 56.6 bits (135),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 27/66 (41%), Positives = 41/66 (62%), Gaps = 2/66 (3%)
 Frame = +1

Query  391  IDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLSSGKPVWHFPEKAYESEETLRR  570
            + ++PAPR+T+ADK +DRKSL R LD  L LL+        + +W  P+  ++  ET+R 
Sbjct  78   LQFSPAPRVTDADKKDDRKSLNRKLDSNLMLLVKQK--IGNQELWLLPQVEWQPGETMRN  135

Query  571  CAESAL  588
             AE A+
Sbjct  136  TAERAM  141



>emb|CDM31272.1| NUDIX hydrolase domain-like [Penicillium roqueforti FM164]
Length=335

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 37/62 (60%), Gaps = 5/62 (8%)
 Frame = +1

Query  403  PAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLSSGKPVWHFPEKAYESEETLRRCAES  582
            P PRITEADK ND+KSL R L + LYLL+      S +  W FP    ES ETLR  AE 
Sbjct  186  PYPRITEADKKNDQKSLDRLLSRTLYLLVQ-----SKEGHWKFPSSPVESGETLRLAAER  240

Query  583  AL  588
             L
Sbjct  241  TL  242



>gb|KGO65591.1| Ribosomal protein L46 [Penicillium italicum]
Length=337

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 37/62 (60%), Gaps = 5/62 (8%)
 Frame = +1

Query  403  PAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLSSGKPVWHFPEKAYESEETLRRCAES  582
            P PRITEADK ND+KSL R L + LYLL+      S +  W FP    ES ETLR  AE 
Sbjct  186  PFPRITEADKKNDQKSLDRLLSRTLYLLVQ-----SKEGHWKFPSSPVESGETLRLAAER  240

Query  583  AL  588
             L
Sbjct  241  TL  242



>ref|XP_005017173.1| PREDICTED: 39S ribosomal protein L46, mitochondrial, partial 
[Anas platyrhynchos]
Length=227

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/66 (41%), Positives = 41/66 (62%), Gaps = 2/66 (3%)
 Frame = +1

Query  391  IDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLSSGKPVWHFPEKAYESEETLRR  570
            + ++PAPR+T+ADK +DRKSL R LD  L LL+        + +W  P+  ++  ET+R 
Sbjct  77   LQFSPAPRVTDADKKDDRKSLNRKLDSNLMLLVKQK--IGNQELWLLPQVEWQPGETMRN  134

Query  571  CAESAL  588
             AE A+
Sbjct  135  TAERAM  140



>ref|XP_002568934.1| Pc21g19430 [Penicillium rubens Wisconsin 54-1255]
 emb|CAP96840.1| Pc21g19430 [Penicillium rubens Wisconsin 54-1255]
Length=336

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 37/62 (60%), Gaps = 5/62 (8%)
 Frame = +1

Query  403  PAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLSSGKPVWHFPEKAYESEETLRRCAES  582
            P PRITEADK ND+KSL R L + LYLL+      S +  W FP    ES ETLR  AE 
Sbjct  186  PYPRITEADKKNDQKSLDRLLSRTLYLLVQ-----SKEGHWKFPSSPVESGETLRLAAER  240

Query  583  AL  588
             L
Sbjct  241  TL  242



>emb|CBJ28077.1| mitochondrial ribosomal protein L46 isoform 2 [Ectocarpus siliculosus]
Length=308

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 42/124 (34%), Positives = 65/124 (52%), Gaps = 10/124 (8%)
 Frame = +1

Query  223  IVASVLFERLPVVVPKIDPVVYAFQEFSFRWRQQYRREYPENFLKKADTRGK--GEYQID  396
            I ++++ ERLPV+V +       F +   + +  Y  ++P     K D       E  ++
Sbjct  91   IRSALILERLPVIVEEYTDWQRDFWDLQTK-QAHYGAKFPAEMGFKYDDEKSLTMEQVLE  149

Query  397  YTP---APRITEADKTNDRKSLQRALDKRLYLLLHGTSLSSGKPVWHFPEKAYESEETLR  567
             +P   APR T AD++NDR +L RALD+RL L++   S       W  PE A+E  ET+R
Sbjct  150  QSPVPLAPRRTPADESNDRTTLDRALDERLVLIVKPRSGDE----WRLPESAWEPGETIR  205

Query  568  RCAE  579
            + AE
Sbjct  206  QTAE  209



>dbj|GAM34646.1| hypothetical protein TCE0_015r02356 [Talaromyces cellulolyticus]
Length=347

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/81 (41%), Positives = 44/81 (54%), Gaps = 6/81 (7%)
 Frame = +1

Query  349  FLKKADTRGKGEYQIDYT-PAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLSSGKPVW  525
             +  A + G    ++D   PAPR+TEADK ND+KSL R L + LYLL+      + +  W
Sbjct  178  LVTTASSEGATTKKVDIERPAPRVTEADKQNDQKSLDRLLQRTLYLLVK-----TKQGYW  232

Query  526  HFPEKAYESEETLRRCAESAL  588
             FP  +   EE LR  AE  L
Sbjct  233  KFPSSSVGLEENLRSAAERTL  253



>ref|XP_536185.2| PREDICTED: 39S ribosomal protein L46, mitochondrial isoform X1 
[Canis lupus familiaris]
Length=280

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 40/69 (58%), Gaps = 2/69 (3%)
 Frame = +1

Query  391  IDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLSSGKPVWHFPEKAYESEETLRR  570
            + + P  RITEADK NDR SLQR LD+ L LL+        + VW  P+  ++  ETLR 
Sbjct  130  LQFKPGARITEADKKNDRTSLQRKLDRNLVLLVKEK--LGDQDVWMLPQAEWQPGETLRG  187

Query  571  CAESALKSV  597
             AE  L ++
Sbjct  188  TAERTLATL  196



>ref|XP_004284406.1| PREDICTED: 39S ribosomal protein L46, mitochondrial [Orcinus 
orca]
Length=279

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 47/92 (51%), Gaps = 3/92 (3%)
 Frame = +1

Query  325  YRREYPENFLKKADTRGKGEYQ-IDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTS  501
            Y  E  +N L   D     E + + + P  RITEAD  NDR SL R LD+ L LL+    
Sbjct  106  YGEEDEQNILLLQDLEDMWEQKFLQFKPGARITEADVKNDRTSLHRKLDRNLILLVREK-  164

Query  502  LSSGKPVWHFPEKAYESEETLRRCAESALKSV  597
                + VW  P+  ++  ETLRR AE  L ++
Sbjct  165  -LGDQDVWMLPQAEWQPGETLRRTAERTLATL  195



>ref|XP_005294941.1| PREDICTED: 39S ribosomal protein L46, mitochondrial [Chrysemys 
picta bellii]
Length=281

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 40/67 (60%), Gaps = 2/67 (3%)
 Frame = +1

Query  397  YTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLSSGKPVWHFPEKAYESEETLRRCA  576
            +   PRIT+ADK NDR SL R LD+ L LL+        + VW  P+  +++ ETLR  A
Sbjct  133  FKAGPRITDADKHNDRTSLNRKLDQNLMLLVKEK--VGNQEVWLLPQAEWQAGETLRSTA  190

Query  577  ESALKSV  597
            E AL ++
Sbjct  191  ERALATL  197



>dbj|GAA91002.1| CAF1 family ribonuclease [Aspergillus kawachii IFO 4308]
Length=869

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 39/63 (62%), Gaps = 5/63 (8%)
 Frame = +1

Query  403  PAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLSSGKPVWHFPEKAYESEETLRRCAES  582
            P PR+TEAD+ ND++SL RAL + LYLL+      S    W FP     +EETLR+ AE 
Sbjct  722  PFPRVTEADQKNDQRSLNRALQRTLYLLVQ-----SKDGFWTFPSSPIVAEETLRQAAER  776

Query  583  ALK  591
             L+
Sbjct  777  TLE  779



>gb|ETE69357.1| 39S ribosomal protein L46, mitochondrial, partial [Ophiophagus 
hannah]
Length=201

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/105 (34%), Positives = 52/105 (50%), Gaps = 4/105 (4%)
 Frame = +1

Query  289  AFQEFSF-RWRQQYRREYPENFLKKADTRGKGEYQID-YTPAPRITEADKTNDRKSLQRA  462
             F E  F R R + + + PE  +   D     E +   + PAPRITEAD+ N R SL R 
Sbjct  15   CFAEVEFLRQRSKEKYDIPEKIVLVQDIEDAWEQKFQKFKPAPRITEADQKNIRTSLNRK  74

Query  463  LDKRLYLLLHGTSLSSGKPVWHFPEKAYESEETLRRCAESALKSV  597
            LD+ L LL+        + +W  P+  ++  ETLR   E  L ++
Sbjct  75   LDQNLLLLVKQK--FGDEDIWLLPQTEWQQGETLRNTVERVLVTL  117



>ref|XP_007427210.1| PREDICTED: 39S ribosomal protein L46, mitochondrial [Python bivittatus]
Length=157

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 39/67 (58%), Gaps = 2/67 (3%)
 Frame = +1

Query  397  YTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLSSGKPVWHFPEKAYESEETLRRCA  576
            + PAPRIT+AD+ NDR SL R LD+ L LL+        + +W  P+  ++  ETLR   
Sbjct  9    FKPAPRITDADRNNDRTSLNRKLDQNLLLLVKQK--FGDEDIWVLPQTEWQHGETLRDTV  66

Query  577  ESALKSV  597
            E  L ++
Sbjct  67   ERVLVTL  73



>ref|XP_316723.3| AGAP006684-PA [Anopheles gambiae str. PEST]
 gb|EAA11413.3| AGAP006684-PA [Anopheles gambiae str. PEST]
Length=271

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 46/149 (31%), Positives = 68/149 (46%), Gaps = 28/149 (19%)
 Frame = +1

Query  223  IVASVLFERLPVVVPKIDPVVYAFQEF--------SFRWRQQYRREYPEN----------  348
            + A VL ERLP+V   ++P+   F+E         S +   + R+E  +           
Sbjct  38   LYAGVLVERLPIVTKTLEPIEAKFKEMLNQIELEKSLKSNHELRKETEKQQLELLKAGKI  97

Query  349  -----FLKKADTRGKGEYQIDYT---PAPRITEADKTNDRKSLQRALDKRLYLLLHGTSL  504
                  LK+     +  Y  +Y    PAPR+TEAD  ND +SL R L++ L LL+    L
Sbjct  98   DLDSEALKQTAQDLEDAYNEEYARFKPAPRVTEADSKNDTRSLDRKLEQTLVLLVE-QKL  156

Query  505  SSGKPVWHFPEKAYESEETLRRCAESALK  591
             S K  +  P+  +   E+LR  AE  LK
Sbjct  157  GS-KSHYLLPQGLHRKGESLRETAERTLK  184



>ref|XP_007194426.1| PREDICTED: 39S ribosomal protein L46, mitochondrial isoform X2 
[Balaenoptera acutorostrata scammoni]
Length=240

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 39/69 (57%), Gaps = 2/69 (3%)
 Frame = +1

Query  391  IDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLSSGKPVWHFPEKAYESEETLRR  570
            + + P  RITEAD  NDR SL R LD+ L LL+        + VW  P+  ++  ETLRR
Sbjct  90   LQFKPGARITEADVKNDRTSLHRKLDRNLILLI--KEKLGDQDVWMLPQAEWQPGETLRR  147

Query  571  CAESALKSV  597
             AE  L ++
Sbjct  148  TAERTLATL  156



>ref|XP_004431984.1| PREDICTED: 39S ribosomal protein L46, mitochondrial [Ceratotherium 
simum simum]
Length=280

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 40/69 (58%), Gaps = 2/69 (3%)
 Frame = +1

Query  391  IDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLSSGKPVWHFPEKAYESEETLRR  570
            + + P  RITEADK NDR SLQR LD+ L LL+        + VW  P+  ++  ETLR 
Sbjct  130  LQFKPGARITEADKKNDRTSLQRKLDRNLVLLVKEK--LGDQDVWVLPQAEWQPGETLRG  187

Query  571  CAESALKSV  597
             AE  L ++
Sbjct  188  TAERTLATL  196



>ref|XP_007122534.1| PREDICTED: 39S ribosomal protein L46, mitochondrial [Physeter 
catodon]
Length=280

 Score = 55.8 bits (133),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 39/69 (57%), Gaps = 2/69 (3%)
 Frame = +1

Query  391  IDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLSSGKPVWHFPEKAYESEETLRR  570
            + + P  RITEAD  NDR SL R LD+ L LL+        + VW  P+  ++  ETLRR
Sbjct  130  LQFKPGARITEADVKNDRTSLHRKLDRNLILLIKEK--LGDQDVWMLPQAEWQPGETLRR  187

Query  571  CAESALKSV  597
             AE  L ++
Sbjct  188  TAERTLTTL  196



>ref|XP_007194425.1| PREDICTED: 39S ribosomal protein L46, mitochondrial isoform X1 
[Balaenoptera acutorostrata scammoni]
Length=280

 Score = 55.8 bits (133),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 39/69 (57%), Gaps = 2/69 (3%)
 Frame = +1

Query  391  IDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLSSGKPVWHFPEKAYESEETLRR  570
            + + P  RITEAD  NDR SL R LD+ L LL+        + VW  P+  ++  ETLRR
Sbjct  130  LQFKPGARITEADVKNDRTSLHRKLDRNLILLIKEK--LGDQDVWMLPQAEWQPGETLRR  187

Query  571  CAESALKSV  597
             AE  L ++
Sbjct  188  TAERTLATL  196



>ref|XP_004763841.1| PREDICTED: 39S ribosomal protein L46, mitochondrial isoform X3 
[Mustela putorius furo]
 ref|XP_004798684.1| PREDICTED: 39S ribosomal protein L46, mitochondrial isoform X3 
[Mustela putorius furo]
Length=227

 Score = 55.1 bits (131),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 60/206 (29%), Positives = 87/206 (42%), Gaps = 40/206 (19%)
 Frame = +1

Query  61   PIWQFLPAAFRHYHRYGLLYSVNLGIS*VAKMRRCLGLALLAKRGFSTSSSGDKIVASVL  240
            PI Q L    +   R+  L++ +LG        R L LA       S S S  +++ +V 
Sbjct  4    PIRQSLFGVAKGRWRFEGLWAGSLG-------SRSLALA----AAPSISGSPWRLLGAVC  52

Query  241  FERLPVVVPKIDPV----------------VYAFQEF-SFRWRQQ--------YRREYPE  345
             +R P+V   + P+                +Y+  E  +    QQ        Y  E  E
Sbjct  53   LQRPPLVSKPLTPLQEEMAALLQQIEVERSLYSDHELRALDEAQQLAKKKADLYDEEGDE  112

Query  346  -NFLKKADTRGKGEYQ-IDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLSSGKP  519
             N L   D     E + + + P  RITEADK NDR SL R LD+ L LL+        + 
Sbjct  113  QNVLLTQDMEDAWEQKFLQFKPGARITEADKKNDRTSLHRKLDRNLVLLVKEK--LGDQD  170

Query  520  VWHFPEKAYESEETLRRCAESALKSV  597
            VW  P+  ++  ETLR  AE  L ++
Sbjct  171  VWMLPQAEWQPGETLRGTAERTLATL  196



>ref|XP_007446131.1| PREDICTED: 39S ribosomal protein L46, mitochondrial [Lipotes 
vexillifer]
Length=280

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 39/69 (57%), Gaps = 2/69 (3%)
 Frame = +1

Query  391  IDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLSSGKPVWHFPEKAYESEETLRR  570
            + + P  RITEAD  NDR SL R LD+ L LL+        + VW  P+  ++  ETLRR
Sbjct  130  LQFKPGARITEADVKNDRTSLHRKLDRNLILLVREK--LGDQDVWMLPQAEWQPGETLRR  187

Query  571  CAESALKSV  597
             AE  L ++
Sbjct  188  TAERTLATL  196



>ref|XP_005051831.1| PREDICTED: 39S ribosomal protein L46, mitochondrial [Ficedula 
albicollis]
Length=270

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 41/68 (60%), Gaps = 2/68 (3%)
 Frame = +1

Query  391  IDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLSSGKPVWHFPEKAYESEETLRR  570
            + +  APRIT+ADK+NDRKSL R LD  L LL+        + +W  P+  ++  ETLR 
Sbjct  120  LRFKAAPRITDADKSNDRKSLNRKLDSNLMLLVKQK--IGNQELWLLPQVEWQPGETLRS  177

Query  571  CAESALKS  594
             AE A+ +
Sbjct  178  TAERAMAT  185



>ref|XP_004623339.1| PREDICTED: 39S ribosomal protein L46, mitochondrial [Octodon 
degus]
Length=280

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 41/69 (59%), Gaps = 2/69 (3%)
 Frame = +1

Query  391  IDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLSSGKPVWHFPEKAYESEETLRR  570
            + + P  RITEADK NDR SL R LD++L LL+        + VW  P+  ++  ETLR 
Sbjct  130  LKFKPGDRITEADKKNDRTSLHRKLDRKLVLLVR--ERFGDEDVWLLPQIEWQPGETLRG  187

Query  571  CAESALKSV  597
             AE AL ++
Sbjct  188  TAERALSTL  196



>emb|CEG81112.1| hypothetical protein RMATCC62417_15350 [Rhizopus microsporus]
Length=263

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 36/60 (60%), Gaps = 4/60 (7%)
 Frame = +1

Query  412  RITEADKTNDRKSLQRALDKRLYLLLHGTSLSSGKPVWHFPEKAYESEETLRRCAESALK  591
            RITEADK ND KSL RAL + LYL++      SG+  W FP+   +S E L   AE  LK
Sbjct  127  RITEADKKNDNKSLDRALKQTLYLVVK----QSGEGAWQFPQGPIDSTEYLHEAAERTLK  182



>ref|XP_010114263.1| PREDICTED: 39S ribosomal protein L46, mitochondrial, partial 
[Chlamydotis macqueenii]
 gb|KFP39845.1| hypothetical protein N324_11823, partial [Chlamydotis macqueenii]
Length=205

 Score = 54.7 bits (130),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 38/66 (58%), Gaps = 2/66 (3%)
 Frame = +1

Query  397  YTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLSSGKPVWHFPEKAYESEETLRRCA  576
            +  APRIT+ADK NDR SL R LD  L LL+        + +W  P+  ++  ETLR  A
Sbjct  57   FEAAPRITDADKNNDRTSLNRKLDSNLMLLVKQK--IGNQELWLLPQVEWQPGETLRSTA  114

Query  577  ESALKS  594
            E A+ +
Sbjct  115  EGAMAT  120



>ref|XP_004325670.1| PREDICTED: 39S ribosomal protein L46, mitochondrial [Tursiops 
truncatus]
Length=280

 Score = 55.5 bits (132),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 39/69 (57%), Gaps = 2/69 (3%)
 Frame = +1

Query  391  IDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLSSGKPVWHFPEKAYESEETLRR  570
            + + P  RITEAD  NDR SL R LD+ L LL+        + VW  P+  ++  ETLRR
Sbjct  130  LQFKPGARITEADVKNDRTSLHRKLDRNLILLVREK--LGDQDVWMLPQAEWQPGETLRR  187

Query  571  CAESALKSV  597
             AE  L ++
Sbjct  188  TAERTLATL  196



>gb|ETN60459.1| mitochondrial ribosomal protein, L46 [Anopheles darlingi]
Length=267

 Score = 55.5 bits (132),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 48/178 (27%), Positives = 83/178 (47%), Gaps = 31/178 (17%)
 Frame = +1

Query  145  VAKMRRCLGLALLAKRGFSTSSSGDK---IVASVLFERLPVVVPKIDPVVYAFQEF----  303
            VA + R L     + +  +T++  D+   + A VL ERLP+V   ++P+  +F++     
Sbjct  9    VANVARLLVTRATSTQTGTTAAKPDQRWDLYAGVLVERLPIVSKTLEPLEVSFKDMLSQI  68

Query  304  ----SFRWRQQYRREYPENFLK-----KADTRGKGEYQI-------------DYTPAPRI  417
                S +   + R+E  +  L+     K D   +   Q               + PAPR+
Sbjct  69   ELEKSLKSNHELRKEVEKRQLELLKAGKIDLDSEALKQTAQDLEDAYNDEFSKFKPAPRV  128

Query  418  TEADKTNDRKSLQRALDKRLYLLLHGTSLSSGKPVWHFPEKAYESEETLRRCAESALK  591
            T+AD  ND +SL+R L++ L LL+        K  +  P+  +++ E+LR  AE  LK
Sbjct  129  TQADHKNDTQSLERKLEETLVLLVEQK--LGNKNHFLLPQGLHKAGESLRETAERTLK  184



>ref|XP_005108662.1| PREDICTED: 39S ribosomal protein L46, mitochondrial-like [Aplysia 
californica]
Length=275

 Score = 55.5 bits (132),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 40/67 (60%), Gaps = 2/67 (3%)
 Frame = +1

Query  397  YTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLSSGKPVWHFPEKAYESEETLRRCA  576
            +T A R T AD++ DR+SL R LD  LYLL+       GK  W  P+  +E  ET+++ A
Sbjct  132  FTAASRRTAADESGDRRSLDRCLDSSLYLLVKQN--IGGKDHWVLPQAEWEQGETMKQTA  189

Query  577  ESALKSV  597
            E AL SV
Sbjct  190  ERALTSV  196



>ref|XP_007060419.1| PREDICTED: 39S ribosomal protein L46, mitochondrial [Chelonia 
mydas]
Length=283

 Score = 55.1 bits (131),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 40/67 (60%), Gaps = 2/67 (3%)
 Frame = +1

Query  397  YTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLSSGKPVWHFPEKAYESEETLRRCA  576
            +   PRIT+ADK NDR SL R LD+ L LL+        + +W  P+  +++ ETLR  A
Sbjct  135  FKAGPRITDADKRNDRTSLNRKLDRNLMLLVK--EKVGNQELWLLPQAEWQAGETLRSTA  192

Query  577  ESALKSV  597
            E AL ++
Sbjct  193  ERALATL  199



>ref|XP_010619339.1| PREDICTED: 39S ribosomal protein L46, mitochondrial isoform X1 
[Fukomys damarensis]
 gb|KFO34591.1| 39S ribosomal protein L46, mitochondrial [Fukomys damarensis]
Length=281

 Score = 55.1 bits (131),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 40/69 (58%), Gaps = 2/69 (3%)
 Frame = +1

Query  391  IDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLSSGKPVWHFPEKAYESEETLRR  570
            + + P  R+TEADKTNDR SL R LD+ L LL+        + VW  P+  ++  ETLR 
Sbjct  131  LKFKPGSRVTEADKTNDRTSLHRKLDRNLVLLVREK--LGDEDVWLLPQTEWQPGETLRD  188

Query  571  CAESALKSV  597
             AE  L ++
Sbjct  189  TAERTLGAL  197



>ref|XP_004798683.1| PREDICTED: 39S ribosomal protein L46, mitochondrial isoform X2 
[Mustela putorius furo]
Length=280

 Score = 55.1 bits (131),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 39/69 (57%), Gaps = 2/69 (3%)
 Frame = +1

Query  391  IDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLSSGKPVWHFPEKAYESEETLRR  570
            + + P  RITEADK NDR SL R LD+ L LL+        + VW  P+  ++  ETLR 
Sbjct  130  LQFKPGARITEADKKNDRTSLHRKLDRNLVLLVKEK--LGDQDVWMLPQAEWQPGETLRG  187

Query  571  CAESALKSV  597
             AE  L ++
Sbjct  188  TAERTLATL  196



>ref|XP_005320175.1| PREDICTED: 39S ribosomal protein L46, mitochondrial [Ictidomys 
tridecemlineatus]
Length=280

 Score = 55.1 bits (131),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 39/69 (57%), Gaps = 2/69 (3%)
 Frame = +1

Query  391  IDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLSSGKPVWHFPEKAYESEETLRR  570
            + + P  RITEADK NDR SL R LD+ L LL+        + VW  P+  ++  ETLR 
Sbjct  130  LQFKPGARITEADKKNDRTSLHRKLDRNLILLVREK--LGDEDVWMLPQTEWQPGETLRG  187

Query  571  CAESALKSV  597
             AE  L ++
Sbjct  188  TAERTLSAL  196



>ref|XP_004763840.1| PREDICTED: 39S ribosomal protein L46, mitochondrial isoform X2 
[Mustela putorius furo]
Length=280

 Score = 55.1 bits (131),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 39/69 (57%), Gaps = 2/69 (3%)
 Frame = +1

Query  391  IDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLSSGKPVWHFPEKAYESEETLRR  570
            + + P  RITEADK NDR SL R LD+ L LL+        + VW  P+  ++  ETLR 
Sbjct  130  LQFKPGARITEADKKNDRTSLHRKLDRNLVLLVKEK--LGDQDVWMLPQAEWQPGETLRG  187

Query  571  CAESALKSV  597
             AE  L ++
Sbjct  188  TAERTLATL  196



>ref|XP_002919597.1| PREDICTED: 39S ribosomal protein L46, mitochondrial [Ailuropoda 
melanoleuca]
 gb|EFB17362.1| hypothetical protein PANDA_008237 [Ailuropoda melanoleuca]
Length=280

 Score = 55.1 bits (131),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 39/69 (57%), Gaps = 2/69 (3%)
 Frame = +1

Query  391  IDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLSSGKPVWHFPEKAYESEETLRR  570
            + + P  RITEADK NDR SL R LD+ L LL+        + VW  P+  ++  ETLR 
Sbjct  130  LQFKPGARITEADKKNDRTSLHRKLDRNLVLLVKEK--LGDQDVWMLPQTEWQPGETLRG  187

Query  571  CAESALKSV  597
             AE  L ++
Sbjct  188  TAERTLATL  196



>ref|XP_004763839.1| PREDICTED: 39S ribosomal protein L46, mitochondrial isoform X1 
[Mustela putorius furo]
 ref|XP_004798682.1| PREDICTED: 39S ribosomal protein L46, mitochondrial isoform X1 
[Mustela putorius furo]
Length=299

 Score = 55.1 bits (131),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 45/86 (52%), Gaps = 3/86 (3%)
 Frame = +1

Query  343  ENFLKKADTRGKGEYQ-IDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLSSGKP  519
            +N L   D     E + + + P  RITEADK NDR SL R LD+ L LL+        + 
Sbjct  113  QNVLLTQDMEDAWEQKFLQFKPGARITEADKKNDRTSLHRKLDRNLVLLV--KEKLGDQD  170

Query  520  VWHFPEKAYESEETLRRCAESALKSV  597
            VW  P+  ++  ETLR  AE  L ++
Sbjct  171  VWMLPQAEWQPGETLRGTAERTLATL  196



>ref|NP_001264041.1| 39S ribosomal protein L46, mitochondrial [Gallus gallus]
Length=286

 Score = 55.1 bits (131),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 27/68 (40%), Positives = 40/68 (59%), Gaps = 2/68 (3%)
 Frame = +1

Query  391  IDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLSSGKPVWHFPEKAYESEETLRR  570
            + ++PAPR+T+ADK NDR SL R LD  L LL+        + +W  P+  ++  ETLR 
Sbjct  136  LQFSPAPRVTDADKKNDRTSLNRKLDSNLMLLVKQK--IGNQELWLLPQVEWQPGETLRS  193

Query  571  CAESALKS  594
              E A+ +
Sbjct  194  TVERAMAT  201



>ref|XP_007673999.1| hypothetical protein BAUCODRAFT_120182 [Baudoinia compniacensis 
UAMH 10762]
 gb|EMC98889.1| hypothetical protein BAUCODRAFT_120182 [Baudoinia compniacensis 
UAMH 10762]
Length=354

 Score = 55.1 bits (131),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 37/62 (60%), Gaps = 5/62 (8%)
 Frame = +1

Query  403  PAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLSSGKPVWHFPEKAYESEETLRRCAES  582
            P PRITEAD+TND++SL R LD+ LYLL     + + +  W FPE      E L + AE 
Sbjct  192  PMPRITEADRTNDQRSLSRKLDRSLYLL-----IKNKEGQWRFPEDRIYGRENLHQAAER  246

Query  583  AL  588
             L
Sbjct  247  IL  248



>ref|XP_008564987.1| PREDICTED: 39S ribosomal protein L46, mitochondrial [Galeopterus 
variegatus]
Length=278

 Score = 55.1 bits (131),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 49/162 (30%), Positives = 72/162 (44%), Gaps = 35/162 (22%)
 Frame = +1

Query  199  STSSSGDKIVASVLFERLPVVVPKIDPVVYAFQEFSFRWRQQYRRE---YPENFL-----  354
            S+S S  +++ ++  +R P+V   + P+    QE      QQ  RE   Y ++ L     
Sbjct  39   SSSGSPWRLLGALCLQRPPLVSKNLTPL----QEEMAAVLQQIEREKSLYSDHELRVLDE  94

Query  355  ------KKADTRGKGEYQI---------------DYTPAPRITEADKTNDRKSLQRALDK  471
                  KKAD   + E  I                + P  RITEAD+ NDR SL R LD+
Sbjct  95   AQQQARKKADLYDEDEQDILLVQDLEDMWEQTFLQFKPGARITEADEKNDRTSLHRKLDR  154

Query  472  RLYLLLHGTSLSSGKPVWHFPEKAYESEETLRRCAESALKSV  597
             L LL+        + VW  P+  ++  ETLR  AE  L ++
Sbjct  155  NLILLVREK--LGDQDVWMLPQAEWQPGETLRGTAERTLATL  194



>ref|XP_006733180.1| PREDICTED: 39S ribosomal protein L46, mitochondrial [Leptonychotes 
weddellii]
Length=280

 Score = 55.1 bits (131),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 39/69 (57%), Gaps = 2/69 (3%)
 Frame = +1

Query  391  IDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLSSGKPVWHFPEKAYESEETLRR  570
            + + P  RITEADK NDR SL R LD+ L LL+        + VW  P+  ++  ETLR 
Sbjct  130  LQFKPGARITEADKKNDRTSLHRKLDRNLVLLVKEK--LGDQDVWMLPQAEWQPGETLRG  187

Query  571  CAESALKSV  597
             AE  L ++
Sbjct  188  TAERTLAAL  196



>gb|KFM67643.1| 39S ribosomal protein L46, mitochondrial, partial [Stegodyphus 
mimosarum]
Length=244

 Score = 54.7 bits (130),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 42/67 (63%), Gaps = 2/67 (3%)
 Frame = +1

Query  397  YTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLSSGKPVWHFPEKAYESEETLRRCA  576
            Y P+PRIT+AD  ND+KS++R LD  L LL+     +  +  W  P+  +++ ETLR+ A
Sbjct  125  YKPSPRITDADLNNDQKSIKRKLDSSLLLLVKQKLGNDYR--WILPQAIHQNGETLRQTA  182

Query  577  ESALKSV  597
            E AL  V
Sbjct  183  ERALLEV  189



>ref|XP_009902220.1| PREDICTED: 39S ribosomal protein L46, mitochondrial [Picoides 
pubescens]
Length=191

 Score = 53.9 bits (128),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 41/69 (59%), Gaps = 2/69 (3%)
 Frame = +1

Query  391  IDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLSSGKPVWHFPEKAYESEETLRR  570
            + +  APR+T+ADK+N+R SL R LD  L LL+        + +W  P+  ++  ETLR 
Sbjct  41   LQFEAAPRLTDADKSNNRTSLDRRLDSNLLLLVKQK--VGNQELWLLPQAEWQPGETLRS  98

Query  571  CAESALKSV  597
             AE A+ +V
Sbjct  99   TAERAMATV  107



>ref|XP_004398373.1| PREDICTED: 39S ribosomal protein L46, mitochondrial [Odobenus 
rosmarus divergens]
Length=279

 Score = 54.7 bits (130),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 39/69 (57%), Gaps = 2/69 (3%)
 Frame = +1

Query  391  IDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLSSGKPVWHFPEKAYESEETLRR  570
            + + P  RITEADK NDR SL R LD+ L LL+        + VW  P+  ++  ETLR 
Sbjct  130  LQFKPGARITEADKKNDRTSLHRKLDRNLVLLVKEK--LGDQDVWMLPQAEWQPGETLRG  187

Query  571  CAESALKSV  597
             AE  L ++
Sbjct  188  TAERTLAAL  196



>gb|KFO76523.1| hypothetical protein N303_10980, partial [Cuculus canorus]
Length=206

 Score = 53.9 bits (128),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 38/66 (58%), Gaps = 2/66 (3%)
 Frame = +1

Query  391  IDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLSSGKPVWHFPEKAYESEETLRR  570
            + +  APRIT+ADK NDR SL R LD  L LL+        + +W  P+  ++  ETLR 
Sbjct  56   LQFKAAPRITDADKNNDRMSLNRKLDSNLMLLVKQK--IGNQQLWLLPQVEWQPGETLRG  113

Query  571  CAESAL  588
             AE A+
Sbjct  114  TAERAM  119



>ref|XP_009559709.1| PREDICTED: 39S ribosomal protein L46, mitochondrial [Cuculus 
canorus]
Length=210

 Score = 53.9 bits (128),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 38/66 (58%), Gaps = 2/66 (3%)
 Frame = +1

Query  391  IDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLSSGKPVWHFPEKAYESEETLRR  570
            + +  APRIT+ADK NDR SL R LD  L LL+        + +W  P+  ++  ETLR 
Sbjct  60   LQFKAAPRITDADKNNDRMSLNRKLDSNLMLLVKQK--IGNQQLWLLPQVEWQPGETLRG  117

Query  571  CAESAL  588
             AE A+
Sbjct  118  TAERAM  123



>gb|EPQ12180.1| 39S ribosomal protein L46, mitochondrial [Myotis brandtii]
Length=210

 Score = 53.9 bits (128),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 39/69 (57%), Gaps = 2/69 (3%)
 Frame = +1

Query  391  IDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLSSGKPVWHFPEKAYESEETLRR  570
            + + P  RITEAD+ NDR SL R LDK L LL+        + VW  P+  ++  ETLR 
Sbjct  60   LQFKPGARITEADEKNDRTSLHRKLDKNLVLLVREK--FGDQDVWVLPQAEWQPGETLRA  117

Query  571  CAESALKSV  597
             AE  L ++
Sbjct  118  TAERTLATL  126



>ref|XP_009956506.1| PREDICTED: 39S ribosomal protein L46, mitochondrial, partial 
[Leptosomus discolor]
 gb|KFQ01045.1| hypothetical protein N330_04963, partial [Leptosomus discolor]
Length=206

 Score = 53.9 bits (128),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 39/66 (59%), Gaps = 2/66 (3%)
 Frame = +1

Query  391  IDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLSSGKPVWHFPEKAYESEETLRR  570
            + +  APRIT+ADK+NDR SL R LD  L LL+        + +W  P+  ++  ETLR 
Sbjct  56   LKFKAAPRITDADKSNDRTSLNRKLDSNLMLLVKQK--IGNQELWLLPQVEWQPGETLRG  113

Query  571  CAESAL  588
             AE A+
Sbjct  114  TAERAM  119



>ref|XP_003209577.2| PREDICTED: LOW QUALITY PROTEIN: 39S ribosomal protein L46, mitochondrial 
[Meleagris gallopavo]
Length=279

 Score = 54.7 bits (130),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 27/68 (40%), Positives = 39/68 (57%), Gaps = 2/68 (3%)
 Frame = +1

Query  391  IDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLSSGKPVWHFPEKAYESEETLRR  570
            + ++PAPR+TEAD  NDR SL R LD  L LL+        + +W  P+  ++  ETLR 
Sbjct  129  LQFSPAPRVTEADXKNDRTSLNRKLDSNLMLLVKQK--IGNQELWLLPQAEWQPGETLRS  186

Query  571  CAESALKS  594
              E A+ +
Sbjct  187  TVERAMTT  194



>ref|XP_010360596.1| PREDICTED: 39S ribosomal protein L46, mitochondrial [Rhinopithecus 
roxellana]
Length=279

 Score = 54.7 bits (130),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 40/69 (58%), Gaps = 2/69 (3%)
 Frame = +1

Query  391  IDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLSSGKPVWHFPEKAYESEETLRR  570
            + + P  RITEAD+ NDR SL R LD+ L LL+        + VW  P+  ++  ETLR 
Sbjct  129  LQFKPGARITEADEKNDRTSLNRKLDRNLVLLVREK--LGDQDVWILPQAEWQPGETLRG  186

Query  571  CAESALKSV  597
             AE AL ++
Sbjct  187  TAERALATL  195



>ref|XP_006263876.1| PREDICTED: 39S ribosomal protein L46, mitochondrial [Alligator 
mississippiensis]
Length=242

 Score = 54.3 bits (129),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 39/63 (62%), Gaps = 2/63 (3%)
 Frame = +1

Query  406  APRITEADKTNDRKSLQRALDKRLYLLLHGTSLSSGKPVWHFPEKAYESEETLRRCAESA  585
            APR+T+ADK+NDR SL R LD  L LL+        + +W  P+  ++S ETLR  AE A
Sbjct  97   APRLTDADKSNDRTSLNRKLDSNLTLLVKQK--VGDQEMWLLPQIEWQSGETLRSTAERA  154

Query  586  LKS  594
            L S
Sbjct  155  LVS  157



>gb|KFO64018.1| hypothetical protein N302_16313, partial [Corvus brachyrhynchos]
Length=227

 Score = 54.3 bits (129),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 39/66 (59%), Gaps = 2/66 (3%)
 Frame = +1

Query  397  YTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLSSGKPVWHFPEKAYESEETLRRCA  576
            +  APRIT+ADK+NDR SL R LD  L LL+        + +W  P+  ++  ETLR  A
Sbjct  79   FKAAPRITDADKSNDRTSLNRKLDSNLMLLVKQK--IGNQELWLLPQVEWQPGETLRSTA  136

Query  577  ESALKS  594
            E A+ +
Sbjct  137  ERAMAT  142



>ref|XP_010619342.1| PREDICTED: 39S ribosomal protein L46, mitochondrial isoform X3 
[Fukomys damarensis]
Length=252

 Score = 54.3 bits (129),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 40/69 (58%), Gaps = 2/69 (3%)
 Frame = +1

Query  391  IDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLSSGKPVWHFPEKAYESEETLRR  570
            + + P  R+TEADKTNDR SL R LD+ L LL+        + VW  P+  ++  ETLR 
Sbjct  131  LKFKPGSRVTEADKTNDRTSLHRKLDRNLVLLVREK--LGDEDVWLLPQTEWQPGETLRD  188

Query  571  CAESALKSV  597
             AE  L ++
Sbjct  189  TAERTLGAL  197



>ref|XP_004370673.1| PREDICTED: 39S ribosomal protein L46, mitochondrial [Trichechus 
manatus latirostris]
Length=280

 Score = 54.7 bits (130),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 39/69 (57%), Gaps = 2/69 (3%)
 Frame = +1

Query  391  IDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLSSGKPVWHFPEKAYESEETLRR  570
            + + P  RITEADK NDR SL R LD+ L LL+        + VW  P+  ++  ETLR 
Sbjct  130  LQFKPGARITEADKKNDRTSLHRKLDRSLILLVKEK--LGDQDVWMLPQAEWQPGETLRA  187

Query  571  CAESALKSV  597
             AE  L ++
Sbjct  188  TAERTLATL  196



>ref|XP_005419639.1| PREDICTED: 39S ribosomal protein L46, mitochondrial [Geospiza 
fortis]
Length=231

 Score = 54.3 bits (129),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 28/64 (44%), Positives = 38/64 (59%), Gaps = 2/64 (3%)
 Frame = +1

Query  397  YTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLSSGKPVWHFPEKAYESEETLRRCA  576
            +  APRIT+ADK+NDR SL R LD  L LL+        + +W  P+  ++  ETLR  A
Sbjct  83   FKAAPRITDADKSNDRTSLNRKLDSNLMLLVKQK--IGNQELWLLPQVEWQPGETLRSTA  140

Query  577  ESAL  588
            E A+
Sbjct  141  ERAM  144



>ref|XP_008036322.1| hypothetical protein TRAVEDRAFT_45880 [Trametes versicolor FP-101664 
SS1]
 gb|EIW60631.1| hypothetical protein TRAVEDRAFT_45880 [Trametes versicolor FP-101664 
SS1]
Length=303

 Score = 54.7 bits (130),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 36/58 (62%), Gaps = 1/58 (2%)
 Frame = +1

Query  403  PAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLSSGKPVWHFPEKAYESEETLRRCA  576
            PAPRI E+DKT D KSL R  ++ LYLL+ G    +GK VW FP+   +  E L + A
Sbjct  155  PAPRIHESDKTGDVKSLDRKGERNLYLLVRGKD-HAGKQVWRFPQGPLQEGEQLHKAA  211



>ref|XP_008638376.1| PREDICTED: 39S ribosomal protein L46, mitochondrial [Corvus brachyrhynchos]
Length=241

 Score = 54.3 bits (129),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 39/66 (59%), Gaps = 2/66 (3%)
 Frame = +1

Query  397  YTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLSSGKPVWHFPEKAYESEETLRRCA  576
            +  APRIT+ADK+NDR SL R LD  L LL+        + +W  P+  ++  ETLR  A
Sbjct  93   FKAAPRITDADKSNDRTSLNRKLDSNLMLLVKQK--IGNQELWLLPQVEWQPGETLRSTA  150

Query  577  ESALKS  594
            E A+ +
Sbjct  151  ERAMAT  156



>ref|XP_005873451.1| PREDICTED: 39S ribosomal protein L46, mitochondrial, partial 
[Myotis brandtii]
Length=224

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 39/69 (57%), Gaps = 2/69 (3%)
 Frame = +1

Query  391  IDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLSSGKPVWHFPEKAYESEETLRR  570
            + + P  RITEAD+ NDR SL R LDK L LL+        + VW  P+  ++  ETLR 
Sbjct  74   LQFKPGARITEADEKNDRTSLHRKLDKNLVLLVREK--FGDQDVWVLPQAEWQPGETLRA  131

Query  571  CAESALKSV  597
             AE  L ++
Sbjct  132  TAERTLATL  140



>gb|KFZ57475.1| hypothetical protein N338_05794, partial [Podiceps cristatus]
Length=205

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/68 (40%), Positives = 39/68 (57%), Gaps = 2/68 (3%)
 Frame = +1

Query  391  IDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLSSGKPVWHFPEKAYESEETLRR  570
            + +  APRIT+ADK N+R SL R LD  L LL+        + +W  P+  ++  ETLR 
Sbjct  55   LQFEAAPRITDADKNNNRTSLNRKLDSNLMLLVKQK--IGNQELWLLPQAEWQPGETLRS  112

Query  571  CAESALKS  594
             AE A+ +
Sbjct  113  TAEGAMAT  120



>ref|XP_010389338.1| PREDICTED: 39S ribosomal protein L46, mitochondrial [Corvus cornix 
cornix]
Length=231

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 39/66 (59%), Gaps = 2/66 (3%)
 Frame = +1

Query  397  YTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLSSGKPVWHFPEKAYESEETLRRCA  576
            +  APRIT+ADK+NDR SL R LD  L LL+        + +W  P+  ++  ETLR  A
Sbjct  83   FKAAPRITDADKSNDRTSLNRKLDSNLMLLVKQK--IGNQELWLLPQVEWQPGETLRSTA  140

Query  577  ESALKS  594
            E A+ +
Sbjct  141  ERAMAT  146



>ref|XP_006028350.1| PREDICTED: 39S ribosomal protein L46, mitochondrial [Alligator 
sinensis]
Length=225

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 39/63 (62%), Gaps = 2/63 (3%)
 Frame = +1

Query  406  APRITEADKTNDRKSLQRALDKRLYLLLHGTSLSSGKPVWHFPEKAYESEETLRRCAESA  585
            APR+T+ADK+NDR SL R LD  L LL+        + +W  P+  ++S ETLR  AE A
Sbjct  80   APRLTDADKSNDRTSLNRKLDSNLTLLVKQK--LGDQELWLLPQIEWQSGETLRSTAERA  137

Query  586  LKS  594
            L S
Sbjct  138  LVS  140



>gb|KFV69979.1| hypothetical protein N307_02740, partial [Picoides pubescens]
Length=206

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 41/69 (59%), Gaps = 2/69 (3%)
 Frame = +1

Query  391  IDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLSSGKPVWHFPEKAYESEETLRR  570
            + +  APR+T+ADK+N+R SL R LD  L LL+        + +W  P+  ++  ETLR 
Sbjct  56   LQFEAAPRLTDADKSNNRTSLDRRLDSNLLLLVKQK--VGNQELWLLPQAEWQPGETLRS  113

Query  571  CAESALKSV  597
             AE A+ +V
Sbjct  114  TAERAMATV  122



>gb|KFP13478.1| hypothetical protein Z169_04113, partial [Egretta garzetta]
Length=206

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 38/66 (58%), Gaps = 2/66 (3%)
 Frame = +1

Query  397  YTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLSSGKPVWHFPEKAYESEETLRRCA  576
            +  APRIT+ADK NDR SL R LD  L LL+        + +W  P+  ++  ETLR  A
Sbjct  58   FEAAPRITDADKNNDRTSLNRKLDSNLLLLVKQK--IGNEELWLLPQVEWQPGETLRSTA  115

Query  577  ESALKS  594
            E A+ +
Sbjct  116  ERAMAT  121



>ref|XP_009418195.1| PREDICTED: uncharacterized protein LOC103998442 [Musa acuminata 
subsp. malaccensis]
Length=639

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/92 (37%), Positives = 42/92 (46%), Gaps = 26/92 (28%)
 Frame = +1

Query  178  LLAKRGFSTSSSGD------------KIVASVLFERLPVVVPKIDPVVYAFQEFS-----  306
            LL  R FS+S+ G                A+VLF+ LP  +P  DPVVY FQEFS     
Sbjct  13   LLRSRRFSSSTDGSIGASVSGSVSLKNAAAAVLFDHLPDAIPDTDPVVYRFQEFSESLNP  72

Query  307  ---------FRWRQQYRREYPENFLKKADTRG  375
                      RWR QY R + +    KAD+R 
Sbjct  73   SLPSADSTLSRWRHQYCRRHRDEISGKADSRN  104



>ref|XP_005911074.1| PREDICTED: 39S ribosomal protein L46, mitochondrial [Bos mutus]
 gb|ELR45018.1| 39S ribosomal protein L46, mitochondrial [Bos mutus]
Length=277

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/92 (36%), Positives = 47/92 (51%), Gaps = 3/92 (3%)
 Frame = +1

Query  325  YRREYPENFLKKADTRGKGEYQ-IDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTS  501
            Y  E  +N L   D     E + + + P  RIT+AD  NDR SL R LD+ L LL+    
Sbjct  104  YEEEDEKNILLVQDLEDMWEQKFLQFKPGARITDADVKNDRSSLHRKLDRNLILLVKDK-  162

Query  502  LSSGKPVWHFPEKAYESEETLRRCAESALKSV  597
                + VW  P+  ++  ETLR+ AE  L ++
Sbjct  163  -LGDQDVWMLPQAEWQPGETLRQTAERTLATL  193



>ref|XP_010855042.1| PREDICTED: 39S ribosomal protein L46, mitochondrial [Bison bison 
bison]
Length=277

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/92 (36%), Positives = 47/92 (51%), Gaps = 3/92 (3%)
 Frame = +1

Query  325  YRREYPENFLKKADTRGKGEYQ-IDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTS  501
            Y  E  +N L   D     E + + + P  RIT+AD  NDR SL R LD+ L LL+    
Sbjct  104  YEEEDEKNILLVQDLEDMWEQKFLQFKPGARITDADVKNDRSSLHRKLDRNLILLVKDK-  162

Query  502  LSSGKPVWHFPEKAYESEETLRRCAESALKSV  597
                + VW  P+  ++  ETLR+ AE  L ++
Sbjct  163  -LGDQDVWMLPQAEWQPGETLRQTAERTLATL  193



>ref|XP_001822358.1| mitochondrial 54S ribosomal protein YmL17/YmL30 [Aspergillus 
oryzae RIB40]
 ref|XP_002382448.1| mitochondrial 54S ribosomal protein YmL17/YmL30 [Aspergillus 
flavus NRRL3357]
 dbj|BAE61225.1| unnamed protein product [Aspergillus oryzae RIB40]
 gb|EED47606.1| 50S ribosomal subunit L30 [Aspergillus flavus NRRL3357]
 gb|EIT80198.1| ribosomal protein [Aspergillus oryzae 3.042]
 gb|KDE78638.1| ribosomal protein [Aspergillus oryzae 100-8]
Length=338

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 37/62 (60%), Gaps = 5/62 (8%)
 Frame = +1

Query  403  PAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLSSGKPVWHFPEKAYESEETLRRCAES  582
            P PR+TEAD+ ND++SL RAL + LYLL+      + +  W  P    E +ETLR  AE 
Sbjct  188  PFPRVTEADQKNDQRSLNRALQRTLYLLVQ-----TKEGYWRLPSSPVEQDETLRLAAER  242

Query  583  AL  588
             L
Sbjct  243  TL  244



>ref|XP_007099345.1| PREDICTED: LOW QUALITY PROTEIN: mitochondrial ribosomal protein 
L46 [Panthera tigris altaica]
Length=278

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 39/69 (57%), Gaps = 2/69 (3%)
 Frame = +1

Query  391  IDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLSSGKPVWHFPEKAYESEETLRR  570
            + + P  RITEAD+ NDR SL R LD+ L LL+        K VW  P+  ++  ETLR 
Sbjct  127  LQFKPGARITEADEKNDRTSLHRKLDRNLVLLVKEK--LGDKDVWLLPQAEWQPGETLRG  184

Query  571  CAESALKSV  597
             AE  L ++
Sbjct  185  TAERTLATL  193



>ref|XP_005483503.1| PREDICTED: 39S ribosomal protein L46, mitochondrial [Zonotrichia 
albicollis]
Length=262

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/64 (44%), Positives = 38/64 (59%), Gaps = 2/64 (3%)
 Frame = +1

Query  397  YTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLSSGKPVWHFPEKAYESEETLRRCA  576
            +  APRIT+ADK+NDR SL R LD  L LL+        + +W  P+  ++  ETLR  A
Sbjct  114  FKAAPRITDADKSNDRTSLNRKLDSNLMLLVKQK--IGNQELWLLPQVEWQPGETLRSTA  171

Query  577  ESAL  588
            E A+
Sbjct  172  ERAM  175



>gb|KFX51337.1| 54S ribosomal protein L17, mitochondrial [Talaromyces marneffei 
PM1]
Length=337

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/81 (40%), Positives = 43/81 (53%), Gaps = 6/81 (7%)
 Frame = +1

Query  349  FLKKADTRGKGEYQIDYT-PAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLSSGKPVW  525
             +  A + G    ++D   PA R+TEADK ND+KSL R L + LYLL+      + +  W
Sbjct  168  LVTTASSEGATTKKVDIERPASRVTEADKQNDQKSLNRLLQRTLYLLVK-----TKQGYW  222

Query  526  HFPEKAYESEETLRRCAESAL  588
             FP  +   EE LR  AE  L
Sbjct  223  KFPSSSVGLEENLRSAAERTL  243



>ref|XP_004693033.1| PREDICTED: 39S ribosomal protein L46, mitochondrial [Condylura 
cristata]
Length=206

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/69 (41%), Positives = 39/69 (57%), Gaps = 2/69 (3%)
 Frame = +1

Query  391  IDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLSSGKPVWHFPEKAYESEETLRR  570
            + + P  R+TEADK NDR SL R LD+ L LL+        + VW  P+  ++  E+LR 
Sbjct  56   LQFKPGARVTEADKKNDRTSLHRKLDRNLVLLV--KEKLGDQEVWLLPQAEWQPGESLRG  113

Query  571  CAESALKSV  597
             AE  L S+
Sbjct  114  TAERTLASL  122



>ref|XP_009468517.1| PREDICTED: 39S ribosomal protein L46, mitochondrial [Nipponia 
nippon]
Length=216

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 39/67 (58%), Gaps = 2/67 (3%)
 Frame = +1

Query  397  YTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLSSGKPVWHFPEKAYESEETLRRCA  576
            +  APRIT+ADK N+R SL R LD  L LL+        + +W  P+  ++  ETLR  A
Sbjct  68   FEAAPRITDADKNNNRTSLNRRLDSNLMLLVKQK--IGNQELWLLPQVEWQPGETLRNTA  125

Query  577  ESALKSV  597
            E A+ ++
Sbjct  126  ERAMANI  132



>ref|XP_002145154.1| mitochondrial 54S ribosomal protein YmL17/YmL30 [Talaromyces 
marneffei ATCC 18224]
 gb|EEA28639.1| 50S ribosomal subunit L30 [Talaromyces marneffei ATCC 18224]
Length=347

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/81 (40%), Positives = 43/81 (53%), Gaps = 6/81 (7%)
 Frame = +1

Query  349  FLKKADTRGKGEYQIDYT-PAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLSSGKPVW  525
             +  A + G    ++D   PA R+TEADK ND+KSL R L + LYLL+      + +  W
Sbjct  178  LVTTASSEGATTKKVDIERPASRVTEADKQNDQKSLNRLLQRTLYLLVK-----TKQGYW  232

Query  526  HFPEKAYESEETLRRCAESAL  588
             FP  +   EE LR  AE  L
Sbjct  233  KFPSSSVGLEENLRSAAERTL  253



>dbj|GAD91787.1| CAF1 family ribonuclease, putative [Byssochlamys spectabilis 
No. 5]
Length=960

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 37/62 (60%), Gaps = 5/62 (8%)
 Frame = +1

Query  403  PAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLSSGKPVWHFPEKAYESEETLRRCAES  582
            P PR+TEAD+ ND+KSL RAL + LYLL+      + +  W FP    E  E+LR  AE 
Sbjct  810  PFPRVTEADQKNDQKSLNRALQRTLYLLVQ-----TKEGYWKFPSSPVEQGESLRLAAER  864

Query  583  AL  588
             L
Sbjct  865  TL  866



>ref|XP_005521832.1| PREDICTED: 39S ribosomal protein L46, mitochondrial [Pseudopodoces 
humilis]
Length=261

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/68 (40%), Positives = 40/68 (59%), Gaps = 2/68 (3%)
 Frame = +1

Query  391  IDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLSSGKPVWHFPEKAYESEETLRR  570
            + +  APR+T+ADK+NDR SL R LD  L LL+        + +W  P+  ++  ETLR 
Sbjct  111  LQFKAAPRVTDADKSNDRTSLNRKLDSNLMLLVKQK--IGNQELWLLPQVEWQPGETLRS  168

Query  571  CAESALKS  594
             AE A+ +
Sbjct  169  TAERAMAT  176



>gb|KFQ36057.1| hypothetical protein N331_06273, partial [Merops nubicus]
Length=205

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 39/67 (58%), Gaps = 2/67 (3%)
 Frame = +1

Query  397  YTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLSSGKPVWHFPEKAYESEETLRRCA  576
            +  A RIT+ADK NDR SL R LD+ L LL+        + +W  P+  ++  ETLR  A
Sbjct  57   FKAASRITDADKNNDRTSLNRKLDRNLMLLVKQK--VGDQELWLLPQVEWQPGETLRSTA  114

Query  577  ESALKSV  597
            E A+ +V
Sbjct  115  ERAMAAV  121



>ref|XP_003986866.1| PREDICTED: 39S ribosomal protein L46, mitochondrial [Felis catus]
Length=281

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 39/69 (57%), Gaps = 2/69 (3%)
 Frame = +1

Query  391  IDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLSSGKPVWHFPEKAYESEETLRR  570
            + + P  RITEAD+ NDR SL R LD+ L LL+        K VW  P+  ++  ETLR 
Sbjct  130  LQFKPGARITEADEKNDRTSLHRKLDRNLVLLVKEK--LGDKDVWILPQAEWQPGETLRG  187

Query  571  CAESALKSV  597
             AE  L ++
Sbjct  188  TAERTLATL  196



>ref|XP_009975701.1| PREDICTED: 39S ribosomal protein L46, mitochondrial, partial 
[Tauraco erythrolophus]
 gb|KFV08340.1| hypothetical protein N340_10245, partial [Tauraco erythrolophus]
Length=206

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 40/69 (58%), Gaps = 2/69 (3%)
 Frame = +1

Query  391  IDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLSSGKPVWHFPEKAYESEETLRR  570
            + +  APRIT+ADK N+R SL R LD  L LL+        + +W  P+  ++  ETLR 
Sbjct  56   LQFKAAPRITDADKNNNRTSLDRRLDSNLMLLVKQK--IGNQELWLLPQAEWQPGETLRS  113

Query  571  CAESALKSV  597
             AE A+ ++
Sbjct  114  TAERAMATL  122



>ref|XP_010078894.1| PREDICTED: 39S ribosomal protein L46, mitochondrial, partial 
[Pterocles gutturalis]
 gb|KFV12884.1| hypothetical protein N339_05245, partial [Pterocles gutturalis]
Length=205

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/64 (44%), Positives = 38/64 (59%), Gaps = 2/64 (3%)
 Frame = +1

Query  397  YTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLSSGKPVWHFPEKAYESEETLRRCA  576
            +  A RIT+ADK+NDRKSL R LD  L LL+        + +W  P+  ++  ETLR  A
Sbjct  57   FEAASRITDADKSNDRKSLNRKLDSNLMLLVKQK--IGNQELWLLPQVEWQPGETLRSTA  114

Query  577  ESAL  588
            E A+
Sbjct  115  ERAM  118



>ref|XP_008945244.1| PREDICTED: LOW QUALITY PROTEIN: 39S ribosomal protein L46, mitochondrial, 
partial [Merops nubicus]
Length=211

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 39/67 (58%), Gaps = 2/67 (3%)
 Frame = +1

Query  397  YTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLSSGKPVWHFPEKAYESEETLRRCA  576
            +  A RIT+ADK NDR SL R LD+ L LL+        + +W  P+  ++  ETLR  A
Sbjct  63   FKAASRITDADKNNDRTSLNRKLDRNLMLLVKQK--VGDQELWLLPQVEWQPGETLRSTA  120

Query  577  ESALKSV  597
            E A+ +V
Sbjct  121  ERAMAAV  127



>ref|XP_011428481.1| PREDICTED: 39S ribosomal protein L46, mitochondrial-like [Crassostrea 
gigas]
Length=290

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 44/169 (26%), Positives = 72/169 (43%), Gaps = 45/169 (27%)
 Frame = +1

Query  199  STSSSGDK--IVASVLFERLPVVVPKIDPVVYAFQEFSFRWRQQYRREYPENFLKKADTR  372
            +T ++ +K  +  ++  ERLPV+ PK+  +   ++E+  +      +E  ++ L + +  
Sbjct  43   TTEATAEKWGLAGALYLERLPVITPKMTRLEQEYKEYKLQ------QEVEQSLLSEYEIT  96

Query  373  GKGEYQ-----------------------------------IDYTPAPRITEADKTNDRK  447
             K E +                                     +TPA R TEADK+ND +
Sbjct  97   KKEEEERLAIQKKNVLDTPLHLRNIPIQTMQDKEELWSKELAQFTPADRETEADKSNDVR  156

Query  448  SLQRALDKRLYLLLHGTSLSSGKPVWHFPEKAYESEETLRRCAESALKS  594
            S  R LD+ L LLL    +  GK  W+ P   Y    ++R  AE AL S
Sbjct  157  STDRKLDQSLVLLLK--QVVDGKEWWYLPTMNYTPGLSMREVAEQALTS  203



>emb|CAK38994.1| unnamed protein product [Aspergillus niger]
Length=255

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 38/61 (62%), Gaps = 5/61 (8%)
 Frame = +1

Query  403  PAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLSSGKPVWHFPEKAYESEETLRRCAES  582
            P PR+TEAD+ ND++SL RAL + LYLL+      S +  W FP     +EETLR+ + +
Sbjct  188  PFPRVTEADQKNDQRSLNRALQRTLYLLVQ-----SKEGFWTFPSSPIVAEETLRQVSSA  242

Query  583  A  585
             
Sbjct  243  G  243



>ref|XP_010974026.1| PREDICTED: 39S ribosomal protein L46, mitochondrial [Camelus 
dromedarius]
Length=279

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/92 (35%), Positives = 48/92 (52%), Gaps = 3/92 (3%)
 Frame = +1

Query  325  YRREYPENFLKKADTRGKGEYQ-IDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTS  501
            Y  E   N L   D     E + + + P  RITEAD+ ND+ SL R LD+ L LL+    
Sbjct  106  YEEEDERNILLAQDLEDMWEQKFLQFKPGARITEADEKNDQTSLHRKLDRNLILLIKEK-  164

Query  502  LSSGKPVWHFPEKAYESEETLRRCAESALKSV  597
                + +W  P+  ++  ETLR+ AE +L ++
Sbjct  165  -LGDQDLWMLPQAEWQPGETLRQTAERSLANL  195



>ref|XP_010185611.1| PREDICTED: 39S ribosomal protein L46, mitochondrial, partial 
[Mesitornis unicolor]
 gb|KFQ37996.1| hypothetical protein N332_13236, partial [Mesitornis unicolor]
Length=204

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/68 (40%), Positives = 39/68 (57%), Gaps = 2/68 (3%)
 Frame = +1

Query  391  IDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLSSGKPVWHFPEKAYESEETLRR  570
            + +  APRIT+ADK N+R SL R LD  L LL+        + +W  P+  ++  ETLR 
Sbjct  54   LQFKAAPRITDADKNNNRTSLDRKLDSNLMLLVKQK--IGNQELWLLPQAEWQPGETLRS  111

Query  571  CAESALKS  594
             AE A+ +
Sbjct  112  TAERAMAT  119



>ref|XP_006070110.1| PREDICTED: 39S ribosomal protein L46, mitochondrial [Bubalus 
bubalis]
Length=277

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/92 (36%), Positives = 47/92 (51%), Gaps = 3/92 (3%)
 Frame = +1

Query  325  YRREYPENFLKKADTRGKGEYQ-IDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTS  501
            Y  E  +N L   D     E + + + P  RIT+AD  NDR SL R LD+ L LL+    
Sbjct  104  YEEEDEKNILLVQDLEDMWEQKFLQFKPGARITDADVKNDRSSLHRKLDRNLILLVKEK-  162

Query  502  LSSGKPVWHFPEKAYESEETLRRCAESALKSV  597
                + VW  P+  ++  ETLR+ AE  L ++
Sbjct  163  -LGDQDVWMLPQAEWQPGETLRQTAERTLATL  193



>ref|XP_002187876.2| PREDICTED: 39S ribosomal protein L46, mitochondrial-like [Taeniopygia 
guttata]
Length=231

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/68 (40%), Positives = 39/68 (57%), Gaps = 2/68 (3%)
 Frame = +1

Query  391  IDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLSSGKPVWHFPEKAYESEETLRR  570
            + +  APRIT+ADK+NDR SL R LD  L  L+        + +W  P+  ++  ETLR 
Sbjct  81   LQFKAAPRITDADKSNDRTSLNRKLDSNLMFLVKQK--IGNQELWLLPQVEWQPGETLRS  138

Query  571  CAESALKS  594
             AE A+ +
Sbjct  139  TAERAMAT  146



>ref|XP_008685987.1| PREDICTED: 39S ribosomal protein L46, mitochondrial [Ursus maritimus]
Length=280

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/69 (41%), Positives = 39/69 (57%), Gaps = 2/69 (3%)
 Frame = +1

Query  391  IDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLSSGKPVWHFPEKAYESEETLRR  570
            + + P  RITEAD+ NDR SL R LD+ L LL+        + VW  P+  ++  ETLR 
Sbjct  130  LQFKPGARITEADEKNDRTSLHRKLDRNLVLLVKEK--LGDQDVWMLPQTEWQPGETLRG  187

Query  571  CAESALKSV  597
             AE  L ++
Sbjct  188  TAERTLATL  196



>emb|CCA68916.1| related to MRPL17-mitochondrial ribosomal protein, large subunit 
[Piriformospora indica DSM 11827]
Length=290

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 46/173 (27%), Positives = 69/173 (40%), Gaps = 46/173 (27%)
 Frame = +1

Query  202  TSSSGDKIVASVLFERLPVVVPKIDPVVYAF----------------------------Q  297
             S+   +IVA+ +  R P + P  DP   A+                            +
Sbjct  34   ASNKTTRIVAATILNRAPFLTPTPDPFEQAYYDYQARLARAISSPLPTDVYFKPGSLLER  93

Query  298  EFSFRWRQQYRREYPENFLK----KADTRGKG-----------EYQIDYTPAPRITEADK  432
             F+   RQ+ +  + E+F        D  GKG           E  ++  P PRI  ADK
Sbjct  94   RFALEERQREKAAFGEDFTPIISLPVDEDGKGGGKSLADQLAEEAGLEEPPQPRIHRADK  153

Query  433  TNDRKSLQRALDKRLYLLLHGTSLSSGKPVWHFPEKAYESEETLRRCAESALK  591
              D KSL RA ++ LYLL+     ++    W FP+   E++E L + A   LK
Sbjct  154  EKDVKSLDRAGERNLYLLVKKDRKANS---WQFPQGGLENDEALHKAALRELK  203



>ref|XP_004909190.1| PREDICTED: 39S ribosomal protein L46, mitochondrial [Heterocephalus 
glaber]
 ref|XP_004852793.1| PREDICTED: 39S ribosomal protein L46, mitochondrial [Heterocephalus 
glaber]
 gb|EHB18440.1| 39S ribosomal protein L46, mitochondrial [Heterocephalus glaber]
Length=281

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/69 (41%), Positives = 39/69 (57%), Gaps = 2/69 (3%)
 Frame = +1

Query  391  IDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLSSGKPVWHFPEKAYESEETLRR  570
            +++ P  RITEADK NDR SL R LD+ L LL+        + VW  P+  ++  ETLR 
Sbjct  131  LNFKPGARITEADKKNDRTSLHRKLDRNLVLLVREK--LGDEDVWLLPQAEWQPGETLRG  188

Query  571  CAESALKSV  597
              E  L ++
Sbjct  189  TVERTLGTL  197



>ref|XP_009634183.1| PREDICTED: 39S ribosomal protein L46, mitochondrial [Egretta 
garzetta]
Length=227

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 38/66 (58%), Gaps = 2/66 (3%)
 Frame = +1

Query  397  YTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLSSGKPVWHFPEKAYESEETLRRCA  576
            +  APRIT+ADK NDR SL R LD  L LL+        + +W  P+  ++  ETLR  A
Sbjct  79   FEAAPRITDADKNNDRTSLNRKLDSNLLLLVKQK--IGNEELWLLPQVEWQPGETLRSTA  136

Query  577  ESALKS  594
            E A+ +
Sbjct  137  ERAMAT  142



>ref|XP_001421985.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
 gb|ABP00279.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
Length=132

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 42/66 (64%), Gaps = 5/66 (8%)
 Frame = +1

Query  397  YTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLSSGKPVWHFPEKAYESEETLRRCA  576
            + PAPR TEAD+T DR +L R L + L+L++       GK  W FP+  ++  ET+R+ A
Sbjct  1    FEPAPRETEADRTGDRSTLHRKLPEFLFLVV---KEKDGK--WGFPKSKHDDGETMRQTA  55

Query  577  ESALKS  594
            E +LK+
Sbjct  56   ERSLKA  61



>gb|ERE79416.1| 39S ribosomal protein L46 [Cricetulus griseus]
Length=211

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 39/69 (57%), Gaps = 2/69 (3%)
 Frame = +1

Query  391  IDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLSSGKPVWHFPEKAYESEETLRR  570
            + + P  R+TEADK NDR SL R LD+ L LL+        + +W  P+  ++  ETLR 
Sbjct  61   LQFKPGARVTEADKKNDRTSLNRKLDRNLVLLVREK--LGDQELWMLPQVQWQPGETLRG  118

Query  571  CAESALKSV  597
             AE  L ++
Sbjct  119  TAERILATL  127



>gb|KFQ89126.1| hypothetical protein N337_08283, partial [Phoenicopterus ruber 
ruber]
Length=205

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/66 (41%), Positives = 38/66 (58%), Gaps = 2/66 (3%)
 Frame = +1

Query  397  YTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLSSGKPVWHFPEKAYESEETLRRCA  576
            +  APRIT+ADK N+R SL R LD  L LL+        + +W  P+  ++  ETLR  A
Sbjct  57   FEAAPRITDADKNNNRTSLNRKLDSNLMLLVKQK--IGNQELWLLPQAEWQPGETLRSTA  114

Query  577  ESALKS  594
            E A+ +
Sbjct  115  ERAMAT  120



>gb|EPY85575.1| 39S ribosomal protein L46, mitochondrial-like protein [Camelus 
ferus]
Length=211

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/69 (38%), Positives = 41/69 (59%), Gaps = 2/69 (3%)
 Frame = +1

Query  391  IDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLSSGKPVWHFPEKAYESEETLRR  570
            + + P  RITEAD+ ND+ SL R LD+ L LL+        + +W  P+  ++  ETLR+
Sbjct  61   LQFKPGARITEADEKNDQTSLHRKLDRNLILLIKEK--LGDQDLWMLPQAEWQPGETLRQ  118

Query  571  CAESALKSV  597
             AE +L ++
Sbjct  119  TAERSLANL  127



>ref|XP_005971518.1| PREDICTED: 39S ribosomal protein L46, mitochondrial [Pantholops 
hodgsonii]
Length=277

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 32/92 (35%), Positives = 47/92 (51%), Gaps = 3/92 (3%)
 Frame = +1

Query  325  YRREYPENFLKKADTRGKGEYQ-IDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTS  501
            Y  E  +N L   D     E + + + P  RIT+AD  NDR SL R LD+ L LL+    
Sbjct  104  YEEEDEKNILLVQDLEDMWEQKFLQFKPGARITDADVKNDRSSLHRKLDRNLILLVKEK-  162

Query  502  LSSGKPVWHFPEKAYESEETLRRCAESALKSV  597
                + +W  P+  ++  ETLR+ AE  L ++
Sbjct  163  -LGDQDIWMLPQTEWQPGETLRQTAERTLATL  193



>gb|KFQ57479.1| hypothetical protein N334_09929, partial [Pelecanus crispus]
Length=206

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/66 (41%), Positives = 38/66 (58%), Gaps = 2/66 (3%)
 Frame = +1

Query  391  IDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLSSGKPVWHFPEKAYESEETLRR  570
            + +  APRIT+ADK N+R SL R LD  L LL+        + +W  P+  ++  ETLR 
Sbjct  56   LQFEAAPRITDADKNNNRTSLNRKLDSNLMLLVKQK--IGNQELWLLPQVEWQPGETLRS  113

Query  571  CAESAL  588
             AE A+
Sbjct  114  TAERAM  119



>emb|CEI98109.1| hypothetical protein RMCBS344292_12225 [Rhizopus microsporus]
Length=263

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 35/60 (58%), Gaps = 4/60 (7%)
 Frame = +1

Query  412  RITEADKTNDRKSLQRALDKRLYLLLHGTSLSSGKPVWHFPEKAYESEETLRRCAESALK  591
            R TEADK ND KSL RAL + LYL++      SG+  W FP+   +S E L   AE  LK
Sbjct  127  RTTEADKKNDSKSLDRALKQTLYLVVK----QSGEGTWQFPQGPIDSTEYLHEAAERTLK  182



>gb|KFQ08009.1| hypothetical protein N329_13194, partial [Haliaeetus albicilla]
Length=206

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/68 (40%), Positives = 39/68 (57%), Gaps = 2/68 (3%)
 Frame = +1

Query  391  IDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLSSGKPVWHFPEKAYESEETLRR  570
            + +  APRIT+ADK N+R SL R LD  L LL+        + +W  P+  ++  ETLR 
Sbjct  56   LQFKAAPRITDADKNNNRTSLNRKLDSNLMLLVKQK--LGNQELWLLPQVEWQPGETLRS  113

Query  571  CAESALKS  594
             AE A+ +
Sbjct  114  TAERAMAT  121



>gb|EMF10326.1| hypothetical protein SEPMUDRAFT_89354 [Sphaerulina musiva SO2202]
Length=380

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 37/62 (60%), Gaps = 5/62 (8%)
 Frame = +1

Query  403  PAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLSSGKPVWHFPEKAYESEETLRRCAES  582
            PAPR TEAD+ ND++SL RA+D+ LYLL+ G         W FP+     +E L + AE 
Sbjct  218  PAPRRTEADEKNDQQSLSRAMDRTLYLLVKGKDGE-----WRFPQDRVYGKENLHQAAER  272

Query  583  AL  588
             L
Sbjct  273  IL  274



>emb|CDO69012.1| hypothetical protein BN946_scf184834.g19 [Trametes cinnabarina]
Length=309

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 40/70 (57%), Gaps = 2/70 (3%)
 Frame = +1

Query  367  TRGKGEYQIDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLSSGKPVWHFPEKAY  546
            T   GE  I+  PAPRI E+D+T D KSL R  ++ LYLL+      +GK VW FPE   
Sbjct  150  TETMGEEPIE-PPAPRIHESDRTGDVKSLDRMGERNLYLLIRARD-HTGKQVWRFPEGGL  207

Query  547  ESEETLRRCA  576
            +  E L + A
Sbjct  208  QEGEFLHQAA  217



>emb|CEG72132.1| hypothetical protein RMATCC62417_07743 [Rhizopus microsporus]
 emb|CEJ02852.1| hypothetical protein RMCBS344292_16845 [Rhizopus microsporus]
Length=263

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 35/60 (58%), Gaps = 4/60 (7%)
 Frame = +1

Query  412  RITEADKTNDRKSLQRALDKRLYLLLHGTSLSSGKPVWHFPEKAYESEETLRRCAESALK  591
            R TEADK ND KSL RAL + LYL++      SG+  W FP+   +S E L   AE  LK
Sbjct  127  RTTEADKKNDSKSLDRALKQTLYLVVK----QSGEGAWQFPQGPIDSTEYLHEAAERTLK  182



>ref|XP_001916683.1| PREDICTED: 39S ribosomal protein L46, mitochondrial [Equus caballus]
Length=280

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 57/205 (28%), Positives = 87/205 (42%), Gaps = 44/205 (21%)
 Frame = +1

Query  61   PIWQFLPAAFRHYHRYGLLYSVNLGIS*VAKMRRCLGLALLAKRGFSTSSSGD--KIVAS  234
            P+ + L  A R + R+  L++ +LG        R L LA       + SSSG   +++ +
Sbjct  4    PVRRALLGAARDWRRFDGLWAGSLG-------SRNLALAA------APSSSGSPWRLLGA  50

Query  235  VLFERLPVVVPKIDPV-------------------------VYAFQEFSFRWRQQYRREY  339
            +  +R P+V   + P+                         +   Q+ + R    Y  E 
Sbjct  51   MCLQRPPLVSKPLTPLQEEMAALLQQIEIERSLYSDHELRALSEAQQLAKRKADLYDEED  110

Query  340  PE-NFLKKADTRGKGEYQ-IDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLSSG  513
             E N L   D     E + + + P  RITEADK NDR SL R LD+ L LL+        
Sbjct  111  GERNILLVQDLEDVWEQKFLQFKPGARITEADKKNDRTSLLRKLDRNLVLLVKEK--LGD  168

Query  514  KPVWHFPEKAYESEETLRRCAESAL  588
            + VW  P+  ++  E+LR  AE  L
Sbjct  169  QDVWLLPQAEWQPGESLRGTAERTL  193



>ref|XP_006152832.1| PREDICTED: 39S ribosomal protein L46, mitochondrial [Tupaia chinensis]
Length=279

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 59/210 (28%), Positives = 90/210 (43%), Gaps = 47/210 (22%)
 Frame = +1

Query  58   LPIWQFLPAAFRHYHRYGLLYSVNLGIS*VAKMRRCLGLALLAKRGFSTSSSGDKIVASV  237
            LP  + L    R + R+G L++ +LG       R  LG A       S+S S  +++ ++
Sbjct  3    LPAGRRLCEVARGWRRFGGLWAGSLG-----SRRLALGAAP------SSSRSPWRLLGAL  51

Query  238  LFERLPVVVPKIDPVVYAFQEFSFRWRQQYRRE---YPENFL-----------KKADTRG  375
              +R P+V   + P+    QE      QQ   E   Y ++ L           KKAD   
Sbjct  52   CLQRPPLVSKPLTPL----QEEMAALLQQIEIEKSLYSDHELRALDEAQRLAKKKADLYD  107

Query  376  KGEYQ----------------IDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLS  507
              + Q                + + P  R+TEADK +DR SL R LD+ L LL+      
Sbjct  108  DEDEQGILLVQDLEDMWEQAFLQFKPGDRVTEADKKDDRTSLHRKLDRNLVLLVR--ERL  165

Query  508  SGKPVWHFPEKAYESEETLRRCAESALKSV  597
              + VW  P+  ++  ETLR  AE  L ++
Sbjct  166  GDQDVWMLPQAEWQPGETLRGTAERTLAAL  195



>ref|XP_003788703.1| PREDICTED: 39S ribosomal protein L46, mitochondrial [Otolemur 
garnettii]
Length=279

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 38/69 (55%), Gaps = 2/69 (3%)
 Frame = +1

Query  391  IDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLSSGKPVWHFPEKAYESEETLRR  570
            + + P  RITEAD  NDR SL R LD+ L LL+        + +W  P+  ++  ETLR 
Sbjct  129  LQFKPGARITEADNKNDRTSLHRKLDRNLILLVREK--LGDQDIWMLPQAEWQPGETLRG  186

Query  571  CAESALKSV  597
             AE  L ++
Sbjct  187  TAERTLATL  195



>ref|XP_009484798.1| PREDICTED: LOW QUALITY PROTEIN: 39S ribosomal protein L46, mitochondrial, 
partial [Pelecanus crispus]
Length=211

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/66 (41%), Positives = 38/66 (58%), Gaps = 2/66 (3%)
 Frame = +1

Query  391  IDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLSSGKPVWHFPEKAYESEETLRR  570
            + +  APRIT+ADK N+R SL R LD  L LL+        + +W  P+  ++  ETLR 
Sbjct  61   LQFEAAPRITDADKNNNRTSLNRKLDSNLMLLVKQK--IGNQELWLLPQVEWQPGETLRS  118

Query  571  CAESAL  588
             AE A+
Sbjct  119  TAERAM  124



>gb|EFX87716.1| hypothetical protein DAPPUDRAFT_127151 [Daphnia pulex]
Length=249

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 40/152 (26%), Positives = 62/152 (41%), Gaps = 32/152 (21%)
 Frame = +1

Query  220  KIVASVLFERLPVVVP-------KIDPVVYAFQEF-SFRWRQQYRREYPENFLKKADTRG  375
            +++ ++  ER P++VP       +I  ++  F    S +   + R E  +   K A    
Sbjct  15   ELLGAICLERTPIIVPPMTEIEQQISEMIEKFDNMRSLKSNHELRHEEDKKLQKMAADGN  74

Query  376  KGEYQID--------------------YTPAPRITEADKTNDRKSLQRALDKRLYLLLHG  495
            + +   D                    + PAPR T  D + D+KS  R LDK L  ++  
Sbjct  75   QDDSNPDAATRQTAQDFEDACNEEFLKFKPAPRTTAEDLSGDQKSTNRKLDKHLLFVVQ-  133

Query  496  TSLSSGKPVWHFPEKAYESEETLRRCAESALK  591
                  K VW  PE  +   ETLR  AE AL+
Sbjct  134  ---EKEKKVWKLPESRWREGETLRETAERALR  162



>gb|EMC88376.1| 39S ribosomal protein L46, mitochondrial, partial [Columba livia]
Length=204

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/66 (41%), Positives = 38/66 (58%), Gaps = 2/66 (3%)
 Frame = +1

Query  397  YTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLSSGKPVWHFPEKAYESEETLRRCA  576
            +  APRIT+ADK N+R SL R LD  L LL+        + +W  P+  ++  ETLR  A
Sbjct  56   FKAAPRITDADKNNNRTSLNRRLDSNLMLLVKQK--IGNQDLWLLPQAEWQPGETLRSTA  113

Query  577  ESALKS  594
            E A+ +
Sbjct  114  ERAMAT  119



>ref|XP_010002361.1| PREDICTED: 39S ribosomal protein L46, mitochondrial [Chaetura 
pelagica]
Length=205

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 39/67 (58%), Gaps = 2/67 (3%)
 Frame = +1

Query  397  YTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLSSGKPVWHFPEKAYESEETLRRCA  576
            +  APR+T+ADK N+R SL R LD  L LL+        + +W  P+  ++  ETLR  A
Sbjct  57   FKAAPRVTDADKKNNRMSLDRRLDSNLMLLVKQK--IGNQELWLLPQVEWQPGETLRGTA  114

Query  577  ESALKSV  597
            E AL +V
Sbjct  115  ERALATV  121



>ref|NP_001096501.1| mitochondrial ribosomal protein L46 [Xenopus (Silurana) tropicalis]
 gb|AAI35282.1| LOC100125128 protein [Xenopus (Silurana) tropicalis]
Length=278

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 39/64 (61%), Gaps = 2/64 (3%)
 Frame = +1

Query  406  APRITEADKTNDRKSLQRALDKRLYLLLHGTSLSSGKPVWHFPEKAYESEETLRRCAESA  585
            APRITEADK ND+ ++ R L   L LL+        + +W FP+  ++  ET+R+ AE A
Sbjct  133  APRITEADKKNDKSTINRKLANNLVLLVKEK--IGKEEIWMFPQMEWQFGETMRKTAERA  190

Query  586  LKSV  597
            L S+
Sbjct  191  LTSL  194



>ref|XP_005148817.1| PREDICTED: 39S ribosomal protein L46, mitochondrial [Melopsittacus 
undulatus]
Length=211

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 40/66 (61%), Gaps = 2/66 (3%)
 Frame = +1

Query  397  YTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLSSGKPVWHFPEKAYESEETLRRCA  576
            +  APRIT+AD++N R SL R LD+ L LL+        + +W  P++ ++  ETLR  A
Sbjct  63   FKAAPRITDADESNSRTSLNRKLDRNLMLLVKQK--IGNQELWLLPQEEWQPGETLRNTA  120

Query  577  ESALKS  594
            E A+ +
Sbjct  121  ERAMAT  126



>ref|XP_006106780.1| PREDICTED: 39S ribosomal protein L46, mitochondrial [Myotis lucifugus]
Length=278

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 38/69 (55%), Gaps = 2/69 (3%)
 Frame = +1

Query  391  IDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLSSGKPVWHFPEKAYESEETLRR  570
            + + P  RITEAD  NDR SL R LDK L LL+        + VW  P+  ++  ETLR 
Sbjct  128  LQFKPGARITEADDKNDRTSLHRKLDKNLVLLVKEK--FGDQDVWVLPQAEWQPGETLRA  185

Query  571  CAESALKSV  597
             AE  L ++
Sbjct  186  TAERTLATL  194



>gb|KFU94467.1| hypothetical protein M959_09755, partial [Chaetura pelagica]
Length=205

 Score = 52.0 bits (123),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 39/67 (58%), Gaps = 2/67 (3%)
 Frame = +1

Query  397  YTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLSSGKPVWHFPEKAYESEETLRRCA  576
            +  APR+T+ADK N+R SL R LD  L LL+        + +W  P+  ++  ETLR  A
Sbjct  57   FKAAPRVTDADKKNNRMSLDRRLDSNLMLLVKQK--IGNQELWLLPQVEWQPGETLRGTA  114

Query  577  ESALKSV  597
            E AL +V
Sbjct  115  ERALATV  121



>ref|XP_005504193.1| PREDICTED: LOW QUALITY PROTEIN: 39S ribosomal protein L46, mitochondrial 
[Columba livia]
Length=215

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 27/66 (41%), Positives = 38/66 (58%), Gaps = 2/66 (3%)
 Frame = +1

Query  397  YTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLSSGKPVWHFPEKAYESEETLRRCA  576
            +  APRIT+ADK N+R SL R LD  L LL+        + +W  P+  ++  ETLR  A
Sbjct  67   FKAAPRITDADKNNNRTSLNRRLDSNLMLLVKQK--IGNQDLWLLPQAEWQPGETLRSTA  124

Query  577  ESALKS  594
            E A+ +
Sbjct  125  ERAMAT  130



>ref|XP_002723421.1| PREDICTED: 39S ribosomal protein L46, mitochondrial [Oryctolagus 
cuniculus]
Length=279

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 28/69 (41%), Positives = 39/69 (57%), Gaps = 2/69 (3%)
 Frame = +1

Query  391  IDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLSSGKPVWHFPEKAYESEETLRR  570
            + + P  R TEAD+ NDR SL R LD+ L LL+       G+ VW  P+  ++  ETLR 
Sbjct  129  LRFRPGARTTEADEKNDRTSLHRKLDRSLVLLVREK--LGGQDVWMLPQAEWQPGETLRG  186

Query  571  CAESALKSV  597
             AE  L ++
Sbjct  187  TAERTLATL  195



>gb|EGW12685.1| 39S ribosomal protein L46, mitochondrial [Cricetulus griseus]
 gb|ERE79415.1| 39S ribosomal protein L46 [Cricetulus griseus]
Length=244

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 39/69 (57%), Gaps = 2/69 (3%)
 Frame = +1

Query  391  IDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLSSGKPVWHFPEKAYESEETLRR  570
            + + P  R+TEADK NDR SL R LD+ L LL+        + +W  P+  ++  ETLR 
Sbjct  94   LQFKPGARVTEADKKNDRTSLNRKLDRNLVLLVR--EKLGDQELWMLPQVQWQPGETLRG  151

Query  571  CAESALKSV  597
             AE  L ++
Sbjct  152  TAERILATL  160



>ref|XP_004617585.1| PREDICTED: 39S ribosomal protein L46, mitochondrial [Sorex araneus]
Length=265

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 38/69 (55%), Gaps = 2/69 (3%)
 Frame = +1

Query  391  IDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLSSGKPVWHFPEKAYESEETLRR  570
            + + P  R T+ADK NDR SLQR LD+ L LL+        + VW  P   ++  ETLR 
Sbjct  115  LQFRPGARTTDADKKNDRTSLQRQLDRNLVLLV--KEKLGDQEVWVLPHAEWQPGETLRG  172

Query  571  CAESALKSV  597
             AE  L S+
Sbjct  173  TAERVLGSL  181



>gb|ELW62787.1| 39S ribosomal protein L46, mitochondrial [Tupaia chinensis]
Length=307

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 59/210 (28%), Positives = 90/210 (43%), Gaps = 47/210 (22%)
 Frame = +1

Query  58   LPIWQFLPAAFRHYHRYGLLYSVNLGIS*VAKMRRCLGLALLAKRGFSTSSSGDKIVASV  237
            LP  + L    R + R+G L++ +LG       R  LG A       S+S S  +++ ++
Sbjct  3    LPAGRRLCEVARGWRRFGGLWAGSLG-----SRRLALGAAP------SSSRSPWRLLGAL  51

Query  238  LFERLPVVVPKIDPVVYAFQEFSFRWRQQYRRE---YPENFL-----------KKADTRG  375
              +R P+V   + P+    QE      QQ   E   Y ++ L           KKAD   
Sbjct  52   CLQRPPLVSKPLTPL----QEEMAALLQQIEIEKSLYSDHELRALDEAQRLAKKKADLYD  107

Query  376  KGEYQ----------------IDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLS  507
              + Q                + + P  R+TEADK +DR SL R LD+ L LL+      
Sbjct  108  DEDEQGILLVQDLEDMWEQAFLQFKPGDRVTEADKKDDRTSLHRKLDRNLVLLVR--ERL  165

Query  508  SGKPVWHFPEKAYESEETLRRCAESALKSV  597
              + VW  P+  ++  ETLR  AE  L ++
Sbjct  166  GDQDVWMLPQAEWQPGETLRGTAERTLAAL  195



>ref|XP_003921693.2| PREDICTED: 39S ribosomal protein L46, mitochondrial [Saimiri 
boliviensis boliviensis]
Length=298

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 39/69 (57%), Gaps = 2/69 (3%)
 Frame = +1

Query  391  IDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLSSGKPVWHFPEKAYESEETLRR  570
            + + P  R+TEAD+ NDR SL R LD+ L LL+        + VW  P+  ++  ETLR 
Sbjct  148  VQFKPGARVTEADEKNDRTSLNRKLDRNLVLLVREK--LGDEDVWMLPQAEWQPGETLRG  205

Query  571  CAESALKSV  597
             AE  L ++
Sbjct  206  TAERTLATL  214



>ref|XP_003413836.1| PREDICTED: 39S ribosomal protein L46, mitochondrial [Loxodonta 
africana]
Length=279

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 28/69 (41%), Positives = 38/69 (55%), Gaps = 2/69 (3%)
 Frame = +1

Query  391  IDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLSSGKPVWHFPEKAYESEETLRR  570
            + + P  RITEADK NDR SL R LD+ L LL+        +  W  P+  ++  ETLR 
Sbjct  129  LQFKPGARITEADKKNDRTSLHRKLDRSLILLVREK--LGDQDFWMLPQTEWQPGETLRA  186

Query  571  CAESALKSV  597
             AE  L ++
Sbjct  187  TAERTLATL  195



>ref|XP_005381634.1| PREDICTED: 39S ribosomal protein L46, mitochondrial [Chinchilla 
lanigera]
Length=318

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 39/69 (57%), Gaps = 2/69 (3%)
 Frame = +1

Query  391  IDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLSSGKPVWHFPEKAYESEETLRR  570
            + + P  RITEADK NDR SL R LD+ L LL+        + VW  P+  ++  ETLR 
Sbjct  168  LKFKPGDRITEADKKNDRTSLHRKLDRNLVLLVREK--FGDEDVWLLPQVEWQPGETLRG  225

Query  571  CAESALKSV  597
             AE  L ++
Sbjct  226  TAERTLGTL  234



>emb|CDF91758.1| ZYBA0S14-00364g1_1 [Zygosaccharomyces bailii CLIB 213]
 emb|CDH13373.1| related to 54S ribosomal protein L17,mitochondrial [Zygosaccharomyces 
bailii ISA1307]
Length=267

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 45/185 (24%), Positives = 72/185 (39%), Gaps = 57/185 (31%)
 Frame = +1

Query  199  STSSSGDKIVASVLFERLPVVVPKIDPVVYAFQEFSFRWRQQYRREYPENFLKK------  360
            + +SSG +I A ++  R+P+V P+I+ +   + E+    R++    +P  F  K      
Sbjct  12   AQNSSGSRIAAGLILSRIPLVTPEINQLESQYYEYQNELRRRLMWTFPYYFYYKNGTVAE  71

Query  361  ----------------------------------------------ADTRGKGEYQIDYT  402
                                                          A T+GK +      
Sbjct  72   RRFISAQRGPVSKQPGVWFPKGVPDVRHNRERSLKQEIVLPRESNEAATQGKNDLSRPIV  131

Query  403  PAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLSSGKPVWHFPEKAYESEETLRRCAES  582
            P  R+T+ADK  D  SL+R L + LYLL+     S+G+  W FP  A E+   L   A  
Sbjct  132  PNSRVTDADKKGDLASLERKLARTLYLLVEN---SNGE--WRFPSFAVENNTPLHISANQ  186

Query  583  ALKSV  597
             LK++
Sbjct  187  GLKAL  191



>ref|XP_008510001.1| PREDICTED: 39S ribosomal protein L46, mitochondrial, partial 
[Equus przewalskii]
Length=159

 Score = 51.2 bits (121),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 37/66 (56%), Gaps = 2/66 (3%)
 Frame = +1

Query  391  IDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLSSGKPVWHFPEKAYESEETLRR  570
            + + P  RITEADK NDR SL R LD+ L LL+        + VW  P+  ++  E+LR 
Sbjct  56   LQFKPGARITEADKKNDRTSLLRKLDRNLVLLVKEK--LGDQDVWLLPQAEWQPGESLRG  113

Query  571  CAESAL  588
             AE  L
Sbjct  114  TAERTL  119



>ref|XP_001693106.1| mitochondrial ribosomal protein L17 [Chlamydomonas reinhardtii]
 gb|EDP03132.1| mitochondrial ribosomal protein L17 [Chlamydomonas reinhardtii]
Length=259

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 42/139 (30%), Positives = 67/139 (48%), Gaps = 8/139 (6%)
 Frame = +1

Query  193  GFSTSSSGDKIVASVLFERLPVVVPKIDPVVYAFQEFSFRWRQQYR--REYPENF-LKKA  363
            G STS  G  I+A+ + +RLP+V P++     A      +   Q    ++YP+N  +   
Sbjct  43   GASTSGEG-PIIAACVLQRLPLVRPRLTTGEQAQLALERQRALQTGELKDYPQNMAVTGK  101

Query  364  DTRGKGEYQID---YTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLSSGKPV-WHF  531
            D  G  + Q D   + P P  T AD   D  +++R L   LYL++ G   + G    W F
Sbjct  102  DDAGSKQQQQDLRAFDPVPATTAADSNGDVSTMRRRLADSLYLVVRGGPAAGGGGGEWAF  161

Query  532  PEKAYESEETLRRCAESAL  588
            P+    +EE++   A+ AL
Sbjct  162  PQAVNTAEESISDTAQRAL  180



>ref|NP_001029884.1| 39S ribosomal protein L46, mitochondrial [Bos taurus]
 sp|Q3SZ22.1|RM46_BOVIN RecName: Full=39S ribosomal protein L46, mitochondrial; Short=L46mt; 
Short=MRP-L46; Flags: Precursor [Bos taurus]
 gb|AAI03229.1| Mitochondrial ribosomal protein L46 [Bos taurus]
Length=277

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 39/69 (57%), Gaps = 2/69 (3%)
 Frame = +1

Query  391  IDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLSSGKPVWHFPEKAYESEETLRR  570
            + + P  RIT+AD  NDR SL R LD+ L LL+        + VW  P+  ++  ETLR+
Sbjct  127  LQFKPGARITDADVKNDRSSLHRKLDRNLILLVKDK--LGDQDVWMLPQAEWQPGETLRQ  184

Query  571  CAESALKSV  597
             AE  L ++
Sbjct  185  TAERTLATL  193



>gb|EZF74373.1| hypothetical protein H105_04059 [Trichophyton soudanense CBS 
452.61]
Length=343

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 37/62 (60%), Gaps = 5/62 (8%)
 Frame = +1

Query  403  PAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLSSGKPVWHFPEKAYESEETLRRCAES  582
            P PRITEADK+ D KSL RAL + LYLL+      + +  W FP     ++E +R  AE 
Sbjct  193  PLPRITEADKSGDEKSLDRALQRTLYLLVK-----AKQGYWKFPSVVLNAKENIRAGAER  247

Query  583  AL  588
            +L
Sbjct  248  SL  249



>ref|XP_006771845.1| PREDICTED: 39S ribosomal protein L46, mitochondrial [Myotis davidii]
Length=218

 Score = 52.0 bits (123),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 37/66 (56%), Gaps = 2/66 (3%)
 Frame = +1

Query  391  IDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLSSGKPVWHFPEKAYESEETLRR  570
            + + P  RITEAD+ NDR SL R LD+ L LL+        + VW  P+  ++  ETLR 
Sbjct  68   LQFKPGARITEADEKNDRTSLHRKLDRNLVLLVKEK--FGDQDVWVLPQAEWQPGETLRA  125

Query  571  CAESAL  588
             AE  L
Sbjct  126  TAERTL  131



>ref|XP_002197666.1| PREDICTED: 39S ribosomal protein L46, mitochondrial [Taeniopygia 
guttata]
Length=331

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 27/68 (40%), Positives = 39/68 (57%), Gaps = 2/68 (3%)
 Frame = +1

Query  391  IDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLSSGKPVWHFPEKAYESEETLRR  570
            + +  APRIT+ADK+NDR SL R LD  L  L+        + +W  P+  ++  ETLR 
Sbjct  181  LQFKAAPRITDADKSNDRTSLNRKLDSNLMFLVK--QKIGNQELWLLPQVEWQPGETLRS  238

Query  571  CAESALKS  594
             AE A+ +
Sbjct  239  TAERAMAT  246



>ref|XP_003234769.1| mitochondrial 54S ribosomal protein YmL17/YmL30 [Trichophyton 
rubrum CBS 118892]
 gb|EGD89116.1| hypothetical protein TERG_05360 [Trichophyton rubrum CBS 118892]
 gb|EZF23324.1| hypothetical protein H100_04043 [Trichophyton rubrum MR850]
 gb|EZF42295.1| hypothetical protein H102_04030 [Trichophyton rubrum CBS 100081]
 gb|EZF52959.1| hypothetical protein H103_04043 [Trichophyton rubrum CBS 288.86]
 gb|EZF63599.1| hypothetical protein H104_04029 [Trichophyton rubrum CBS 289.86]
 gb|EZF84866.1| hypothetical protein H110_04037 [Trichophyton rubrum MR1448]
 gb|EZF95626.1| hypothetical protein H113_04073 [Trichophyton rubrum MR1459]
 gb|EZG06720.1| hypothetical protein H106_03858 [Trichophyton rubrum CBS 735.88]
 gb|EZG17171.1| hypothetical protein H107_04156 [Trichophyton rubrum CBS 202.88]
 gb|KDB34103.1| hypothetical protein H112_04036 [Trichophyton rubrum D6]
Length=343

 Score = 52.8 bits (125),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 37/62 (60%), Gaps = 5/62 (8%)
 Frame = +1

Query  403  PAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLSSGKPVWHFPEKAYESEETLRRCAES  582
            P PRITEADK+ D KSL RAL + LYLL+      + +  W FP     ++E +R  AE 
Sbjct  193  PLPRITEADKSGDEKSLDRALQRTLYLLVK-----AKQGYWKFPSVVLNAKENIRAGAER  247

Query  583  AL  588
            +L
Sbjct  248  SL  249



>ref|XP_003475304.1| PREDICTED: 39S ribosomal protein L46, mitochondrial [Cavia porcellus]
Length=280

 Score = 52.8 bits (125),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 38/67 (57%), Gaps = 2/67 (3%)
 Frame = +1

Query  397  YTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLSSGKPVWHFPEKAYESEETLRRCA  576
            + P  R+TEADK NDR SL R LD+ L LL+        + VW  P+  ++  ETLR  A
Sbjct  132  FKPGDRVTEADKKNDRTSLHRKLDRNLVLLVREK--LGDEDVWLLPQTEWQPGETLRGTA  189

Query  577  ESALKSV  597
            E  L ++
Sbjct  190  ERTLGTL  196



>ref|XP_009922146.1| PREDICTED: 39S ribosomal protein L46, mitochondrial isoform X2 
[Haliaeetus albicilla]
Length=232

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 27/68 (40%), Positives = 39/68 (57%), Gaps = 2/68 (3%)
 Frame = +1

Query  391  IDYTPAPRITEADKTNDRKSLQRALDKRLYLLLHGTSLSSGKPVWHFPEKAYESEETLRR  570
            + +  APRIT+ADK N+R SL R LD  L LL+        + +W  P+  ++  ETLR 
Sbjct  82   LQFKAAPRITDADKNNNRTSLNRKLDSNLMLLVKQK--LGNQELWLLPQVEWQPGETLRS  139

Query  571  CAESALKS  594
             AE A+ +
Sbjct  140  TAERAMAT  147



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 774982056510